2GA9D

Crystal structure of the heterodimeric vaccinia virus polyadenylate polymerase with bound atp-gamma-s
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
molecule tags Transferase
source organism Vaccinia virus
total genus 151
structure length 445
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
D PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2ga9D01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ga9D03
2GAFD 3ER8C 2GA9D 3ERCC 3OWGA 3ER9B
chains in the Genus database with same CATH superfamily
3V72A 5FLEX 5F2VO 9ICAA 2IHOA 3ERCC 2ZH5A 4MFCA 1OA1A 2FMSA 5IIMA 2EFKA 8ICOA 5DKWA 3AQLA 4UAZA 5IILA 8ICQA 3PHZA 4QZBA 1ZJNA 3O3MB 3D2FA 2Z0VA 4GXIA 4KLQA 5HRKA 4AT9A 4AKVA 3QE6A 3H38A 4R65A 4FO6A 4M47A 4EP7A 3V7LA 1V4AA 9ICOA 3LQCB 3HWTA 2M2VA 4RQ6A 5DDYA 3DX0A 3PNCA 3L3OM 4P4PA 5TKYA 5DECA 4Z6DA 4IQWA 4IQVA 4RQ1A 4WC0A 1ZQBA 5J0TA 4XQ7A 4WQLA 1TQWA 2MI7A 3T48A 4K96A 3AU6A 2BCUA 1TFWA 4NXZA 1ZJMA 7ICJA 5CB1A 1WDZA 3UPQA 1YWMA 1Q78A 2N3KA 2BPCA 4R63A 8ICLA 4KIKB 4EZQA 4EGWA 1MQ3A 1NO5A 4H6HA 1Q79A 2HN1A 1SUFA 1ZQZA 4WCWA 5D46A 3VEBA 4X4NA 2ZH3A 4PHDA 1TQSA 3BVTA 1XSNA 3D51A 3ISBA 4R5GA 2RAIA 4NM2A 5J2KA 2F7PA 4PO2A 4NXTA 3PMLA 4X4UA 1UPXA 4AZCB 4DOBA 2Z0NA 2WINM 1VFGA 2YL8A 1TQVA 1DKZA 8ICRA 3OGUA 9ICHA 3B52X 5C5BB 8ICUA 5CA7A 3BVWA 1FA0A 4K8VA 3QWEA 1ZQKA 4FZSA 2X5CA 5HRLA 9ICNA 2IUBA 7ICPA 1BPEA 3QA8A 4EZYA 3JPNA 4HR1A 7ICFA 3AQKA 3ER9B 4RQ5A 8ICCA 3NVOA 4UD4A 3OV7A 4KLSA 1UETA 2Z0OA 1KEJA 4KIKA 4X4RA 2ZH4A 4I2BA 4UD5A 2Q13A 3WFRE 4M0AA 1I4DA 4UB1A 3MDCA 4YN4A 2OBLA 4EV6A 4JLCA 4YD2A 1X04A 3CAZA 4GXJA 5HC9A 8ICHA 4PH5A 1JN3A 3JCFA 2EWRA 4JLZA 1PX5A 3CVRA 5D61A 4NXUA 4P4OA 2BCQA 4NLNA 3B0XA 2I9GA 4F5QA 5CHEA 3PMNA 7ICMA 3ZEDA 4WC3A 2FMQA 4O9MA 4NXXA 3BUDA 2OZNB 1HUZA 3ACOA 2FICA 8ICTA 1MIYA 3AQNA 4I0UA 2WYIA 4QZEA 1TFYA 4O5CA 7ICLA 3T46A 5HRHA 3MGIA 4YD1A 5CFSA 7ICGA 5BOLA 4R66A 3BUBA 4FHXA 7ICKA 1SU6A 3ISCA 4F5OA 5CHGA 4X4SA 3C7NA 1ZYLA 4EZWA 9ICRA 1ZQUA 3I04A 3NYBA 4NSWA 5DB9A 5EOZA 2ZH9A 2B56A 7ICHA 4QZFA 1E1DA 2RT6A 2NCZA 2V0OA 2EFLA 4UB2A 4EZNA 4XQ8A 2YI9A 4QZAA 3JPOA 5E84A 4UB3A 2YLAA 3C66A 5HRFA 5J0YA 3ER8C 3AQMA 4RQ7A 4KLJA 4M0MA 4M9LA 4P4MA 3AU2A 4X4OA 1ZQRA 2Q12A 3Q84A 3OHXM 2PY6A 1BPZA 2Q66A 1ZQNA 4H6IA 4D8JA 3DYTA 5HHHA 4JN4A 4JWNA 5HRBA 2F1BA 8ICEA 1KDHA 4FZPA 4IW0A 3RV0A 5DB6A 3SOGA 2ZHBA 1HXKA 2PMRA 2OW7A 2ZXQA 4N7RA 2OBMA 2QKWA 2OO2A 3Q0KA 4RQ4A 4TUPA 2DR5A 4K4HA 4JNEA 2DR8A 9ICUA 3VKHA 5DEDA 2RAJA 4YMOA 4WOYA 4RPXA 3OUYA 4I2JA 4O6AA 3JPQA 2GAFD 2ZH6A 2FMPA 5J0WA 4RQ2A 1I49A 3EJQA 4RQ3A 4O5EA 1R8CA 5HREA 3RJFA 2DR9A 4AZ6A 9ICPA 1XSPA 5DDMA 1HUOA 4UDYX 2LM0A 3CZNA 4NY8A 4LT6A 4LEYA 5DBBA 5D62A 4ATBA 9ICWA 4I2CA 8ICAA 1PS3A 4EZXA 1ZQVA 3HAIA 4LEWA 4GXKA 7ICVA 8ICIA 1TVAA 7ICSA 1ZQFA 3LMFA 3UITA 4EBJA 3H3AA 3FD9A 1JMSA 4JL9A 3C2MA 1GN9A 5TZVA 4F5RA 1BPDA 4TUQA 4KLIA 4FHVA 5J0UA 1E2UA 3CKDA 4HR1B 8ICYA 1ZQOA 4EZRA 2ELBA 4XJEA 4E8FA 2D4CA 2X3VA 5J2HA 4UAWA 8ICFA 2F18A 1JQKA 4R5JA 2F7RA 3V7JA 4M9GA 3H39A 1ZQJA 4I2FA 4LZGA 8ICWA 1ZWWA 2QFFA 4H8SA 4IWOA 4RT2A 8ICKA 4RT3A 2QXLA 4DO9A 3D2EA 4EEDA 2ZH1A 2DRAA 4K9AA 4M04A 4OAIZ 3GDXA 2YL6A 4NQIA 4EZTA 1ZQTA 2F1AA 2F7QA 1RPLA 3DX1A 1O7DC 3OVAA 5J2DA 1TV9A 5D63A 1BPBA 4F5PA 9ICEA 4RPZA 2ND0A 1GPJA 4G6QA 2ND1A 4EEBA 1R34A 8ICMA 3C5GA 3EJSA 1ZQLA 4JLXA 4NXWA 4EZPA 4QZ8A 3B0YA 5J2EA 5CFUA 5J29A 4UBCA 3WFSC 2LXYA 4RWOA 4IWQA 3C5FA 4NM1A 5HHIA 4NXVA 2D1LA 1QX1A 5J0SA 4TURA 1MIWA 3HW8A 5HRDA 1TQUA 4Z6CA 5IINA 4UB5A 4MF2A 1OA0A 1U00A 5CJ7A 4AVMA 4X4PA 3K75D 3JPRA 4WH5A 4X0BA 4X4QA 3RH4A 9ICFA 5CWRA 2GF4A 4IQUA 2ISPA 5J2JA 3I01A 2C08A 4K9BA 3LVTA 1QWNA 2GWSA 1R8BA 1YLQA 2BBHA 4RQ8A 4DYLA 2EX3B 2BCSA 9ICIA 3DX4A 4I2GA 3D4YA 3RH6A 4E80A 5HRIA 4KB6A 1ZQCA 2VANA 3KAVA 4MKPA 4PGYA 3C2LA 9ICLA 4RWNA 4RWQA 2EWFA 2O1PA 8ICXA 2ID1A 2JNSA 4DCNC 4MFAA 3RH5A 9ICMA 4EZUA 2NRKA 3ABHA 2W9MA 3TFRA 1ZQAA 3DPPA 4E3CA 4X0AA 4LVSA 9ICGA 2RFFA 3JPPA 4MFFA 3B53X 4K4IA 4I2DA 3KDRA 3L3PA 3OVSA 5DBAA 2PXIA 3T49A 3OUYB 3CZSA 2IHMA 2BCRA 5D49A 1R8AA 2YIBA 4WBYA 3UPSA 4EZZA 4R5LA 1BPYA 3CK6A 4X4VA 3PLTA 9ICKA 2YL9A 3JZ0A 3HX0A 4AT8B 2YIVX 7ICTA 1I4TA 4NLZA 2DR7A 5B3PA 8ICBA 3HAJA 2X3XA 3EJRA 4AZGA 4QZDA 8ICJA 4ATBB 1DKYA 1UEUA 5J0RA 4PHPA 4KLGA 5J2IA 4MF8A 1I4LA 3HJ1A 2ZH7A 5J0PA 2WYHA 2JNKA 5CP2A 4AT7A 9ICTA 4I1QA 7ICIA 4EBKA 3UXOA 1HWWA 1SU7A 4Z6EA 7ICUA 4ATMA 4HY9A 2HN2A 4KLOA 3K7DA 3RJKA 1ZQYA 9ICVA 3BVVA 4O69A 5IIKA 4WBZA 5CFTA 3HJ4A 3G9GA 3UQ2A 3UXPA 1OU5A 1W9MA 4PHEA 4I2AA 4O5KA 4AT8A 2HHPA 4F00A 4YCXA 1MQ2A 4I28A 8ICPA 4RQ0A 4KLLA 4WQKA 4S3NA 3A98A 1F5AA 3RJGA 7ICEA 4IWPA 3D50A 2FYVA 1WOTA 3EF2A 4I2EA 4JWDA 5BPCA 1RZTA 8ICGA 2O0I1 4IG8A 4XUSA 4UB4A 4TUSA 5FIGA 1ZQHA 4EZVA 2BBJA 9ICXA 1HTYA 3DDGA 4K99A 1XSLA 1Y2OA 4AZ7A 4Z6FA 4M5DA 3JYYA 4LEZA 1JQRA 3C18A 7ICOA 3C2KA 4I27A 4NPHA 5JTGA 3SYVA 2ISOA 8ICZA 2PFPA 3UQ0A 2YLLA 3QNJA 2YL5A 5J2AA 5J2BA 9ICCA 3BUQA 1ZQMA 4FHYA 5J0QA 3EJPA 5J0XA 3RV1A 4FO1A 1ZQXA 4JWCA 1GNLA 5D4BA 1GNTA 1O7DB 1SU8A 2PFNA 8ICNA 2P66A 1R89A 4EZOA 3MGHA 9ICQA 4R64A 4HYBA 3H37A 4O67A 3MCRA 4IM0A 2PFQA 3F7WA 4KLTA 3JPSA 4DOCA 4RPYA 7ICNA 2O5AA 2YIAA 4QZCA 2X3WA 4M2YA 4WPCA 4K97A 3LLLA 4AZBA 4M9JA 2M2UA 4JWEA 5IIIA 2PBEA 1E9VA 3DPOA 4JWIA 3EJUA 7ICQA 2F7OA 4BNEA 3L9DA 5IIOA 5HRGA 4KLFA 2M2WA 1ZQWA 4WC5A 1MIVA 4I2IA 4YMMA 5J2GA 3BUPA 4UBBA 4I29A 3T4AG 5J2FA 2B4VA 4QZGA 3M3WA 3RJIA 4AZ5A 3BLBA 3MBYA 9ICBA 2GA9D 4F01A 1R5EA 3O3OB 4EZSA 4FHWA 4WC2A 4X5VA 3DDFA 4JWMA 4IM2A 3UXNA 2BPFA 3BVXA 2Z8YA 2B51A 3AUOA 2FCLA 1R33A 2KHOA 5CR0A 4YMNA 5J0OA 4KLEA 4QZHA 4NLKA 4FM3A 4E7XA 2BE3A 4UAYA 1BPXA 3I2WA 4I2HA 4QZ9A 3DX3A 4RWPA 2ZH8A 1URUA 8ICSA 8ICVA 4NKUA 2RAKA 1QWUA 4AZCA 4NKTA 2M2TA 2PFOA 4AT7B 3VEAA 3B51X 3GI7A 1VJ7A 2ALWA 5DB7A 1LQ7A 4OAFA 4FZOA 9ICSA 5IIJA 5C5BA 3HAHA 4FH5A 4XA5A 2ZH2A 3WFQE 4PPXA 3HIYA 1OAOA 4OAHA 5DB8A 3ISDA 3BUIA 4O68A 7ICRA 4AZHA 4HX0A 4XRHA 4KLUA 1ZQGA 1ZQDA 2ZHAA 4WPEA 2BCVA 3TFSA 3T47A 1NOMA 3NWIA 3V7KA 3BVUA 4K4GA 4X4TA 1KNYA 3RJJA 3NKUA 4B9QA 4FH3A 4K98A 1UEVA 4LEVA 4PGXA 3CV5A 4OAGA 4PGQA 1ZQSA 4M9NA 4WC1A 3RJEA 1X03A 3WFOA 4P2HA 4KLHA 3RJHA 4KM5A 5B3QA 2DVIA 3WFPA 2OW6A 4PHAA 4LZDA 4IM3A 3OWGA 3I39X 4R5IA 1JAJA 4WC7A 4UDXX 2YKTA 3RPMA 4WC6A 2DRBA 4JNFA 3LK9A 1ZQQA 4KLMA 1DKXA 4E81A 1ZQEA 5HR9A 5DBCA 4WC4A 3D4ZA 3QNIA 1ZQPA 3OVBA 2BPGA 9ICJA 3MDAA 3DPQA 4AT9B 3O3NB 1ZQIA 4F5NA 2YI8A 3JPTA 4R5KA 3KAWA 4FHPA 4QZIA 4M9HA 3OK8A 4KLDA 5J2CA 4DOAA 5KBPA 3D52A 3DX2A 1MJGA 1TQTA 5BOMA 3EJTA 4IQTA 4AZIA
chains in the Genus database with same CATH topology
3C7NA 1ZYLA 3QNJA 4EZWA 4WH5A 5FLEX 3I04A 2IHOA 3ERCC 1OA1A 3I01A 3RV1A 4JWCA 2B56A 4FO1A 1GNLA 4K9BA 1GNTA 1SU8A 1E1DA 2RT6A 4EZOA 4HYBA 2NCZA 3PHZA 4O67A 4EZNA 3MCRA 2YI9A 3O3MB 3D2FA 4IM0A 3F7WA 5E84A 2EX3B 2YIAA 3ER8C 4KB6A 4M0MA 4K97A 3KAVA 4MKPA 3OHXM 2PY6A 2EWFA 4JWEA 4H6IA 2JNSA 4D8JA 3L3OM 1E9VA 3DPOA 4JN4A 4EZUA 4JWIA 5TKYA 3DPPA 4IW0A 3RV0A 4E3CA 3B53X 4WQLA 4N7RA 2OBMA 3T48A 3KDRA 4K96A 4JNEA 3VKHA 3T4AG 3T49A 2B4VA 4O6AA 2GAFD 2YIBA 4EZZA 4R5LA 2GA9D 4F01A 4EZSA 3O3OB 2N3KA 4IM2A 4KIKB 4EZQA 2Z8YA 2B51A 2YIVX 2FCLA 4H6HA 2KHOA 1SUFA 3VEBA 4UDYX 2LM0A 5B3PA 4FM3A 4LEYA 1DKYA 5D62A 4R5GA 4PO2A 4NXTA 1UPXA 4EZXA 2WINM 4LEWA 3VEAA 3B51X 1DKZA 3GI7A 3B52X 3LMFA 3UITA 4OAFA 3FD9A 4JL9A 1GN9A 4K8VA 1SU7A 2X5CA 4HY9A 1OAOA 4OAHA 1E2UA 3QA8A 4HR1B 4EZYA 3K7DA 4HR1A 4EZRA 4HX0A 4O68A 4XJEA 3ER9B 4O69A 5CFTA 3T47A 1JQKA 4R5JA 1W9MA 4KIKA 4F00A 2QFFA 3NKUA 4IWOA 4B9QA 4K98A 2OBLA 4WQKA 2QXLA 4JLCA 3D2EA 4LEVA 3A98A 4OAGA 4IWPA 2EWRA 4JLZA 4K9AA 3EF2A 4OAIZ 4JWDA 4KM5A 4NXUA 5D61A 5B3QA 4EZTA 4IM3A 3OWGA 3I39X 4R5IA 4UDXX 5CHEA 5FIGA 3ZEDA 4JNFA 4EZVA 5D63A 4NXXA 1DKXA 4E81A 4K99A 2ND0A 1GPJA 4G6QA 2ND1A 3DPQA 3O3NB 2YI8A 4JLXA 4NXWA 4R5KA 4LEZA 4EZPA 3KAWA 3T46A 5CFUA 4IWQA 5CFSA 4NXVA 1MJGA 4NPHA 1SU6A 4WOYA 1OA0A 1U00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAF D;  3ER8 C;  2GA9 D;  3ERC C;  3OWG A;  3ER9 B; 
#chains in the Genus database with same CATH topology
 3V72 A;  5FLE X;  5F2V O;  9ICA A;  2IHO A;  3ERC C;  2ZH5 A;  4MFC A;  1OA1 A;  2FMS A;  5IIM A;  2EFK A;  8ICO A;  5DKW A;  3AQL A;  4UAZ A;  5IIL A;  8ICQ A;  3PHZ A;  4QZB A;  1ZJN A;  3O3M B;  3D2F A;  2Z0V A;  4GXI A;  4KLQ A;  5HRK A;  4AT9 A;  4AKV A;  3QE6 A;  3H38 A;  4R65 A;  4FO6 A;  4M47 A;  4EP7 A;  3V7L A;  1V4A A;  9ICO A;  3LQC B;  3HWT A;  2M2V A;  4RQ6 A;  5DDY A;  3DX0 A;  3PNC A;  3L3O M;  4P4P A;  5TKY A;  5DEC A;  4Z6D A;  4IQW A;  4IQV A;  4RQ1 A;  4WC0 A;  1ZQB A;  5J0T A;  4XQ7 A;  4WQL A;  1TQW A;  2MI7 A;  3T48 A;  4K96 A;  3AU6 A;  2BCU A;  1TFW A;  4NXZ A;  1ZJM A;  7ICJ A;  5CB1 A;  1WDZ A;  3UPQ A;  1YWM A;  1Q78 A;  2N3K A;  2BPC A;  4R63 A;  8ICL A;  4KIK B;  4EZQ A;  4EGW A;  1MQ3 A;  1NO5 A;  4H6H A;  1Q79 A;  2HN1 A;  1SUF A;  1ZQZ A;  4WCW A;  5D46 A;  3VEB A;  4X4N A;  2ZH3 A;  4PHD A;  1TQS A;  3BVT A;  1XSN A;  3D51 A;  3ISB A;  4R5G A;  2RAI A;  4NM2 A;  5J2K A;  2F7P A;  4PO2 A;  4NXT A;  3PML A;  4X4U A;  1UPX A;  4AZC B;  4DOB A;  2Z0N A;  2WIN M;  1VFG A;  2YL8 A;  1TQV A;  1DKZ A;  8ICR A;  3OGU A;  9ICH A;  3B52 X;  5C5B B;  8ICU A;  5CA7 A;  3BVW A;  1FA0 A;  4K8V A;  3QWE A;  1ZQK A;  4FZS A;  2X5C A;  5HRL A;  9ICN A;  2IUB A;  7ICP A;  1BPE A;  3QA8 A;  4EZY A;  3JPN A;  4HR1 A;  7ICF A;  3AQK A;  3ER9 B;  4RQ5 A;  8ICC A;  3NVO A;  4UD4 A;  3OV7 A;  4KLS A;  1UET A;  2Z0O A;  1KEJ A;  4KIK A;  4X4R A;  2ZH4 A;  4I2B A;  4UD5 A;  2Q13 A;  3WFR E;  4M0A A;  1I4D A;  4UB1 A;  3MDC A;  4YN4 A;  2OBL A;  4EV6 A;  4JLC A;  4YD2 A;  1X04 A;  3CAZ A;  4GXJ A;  5HC9 A;  8ICH A;  4PH5 A;  1JN3 A;  3JCF A;  2EWR A;  4JLZ A;  1PX5 A;  3CVR A;  5D61 A;  4NXU A;  4P4O A;  2BCQ A;  4NLN A;  3B0X A;  2I9G A;  4F5Q A;  5CHE A;  3PMN A;  7ICM A;  3ZED A;  4WC3 A;  2FMQ A;  4O9M A;  4NXX A;  3BUD A;  2OZN B;  1HUZ A;  3ACO A;  2FIC A;  8ICT A;  1MIY A;  3AQN A;  4I0U A;  2WYI A;  4QZE A;  1TFY A;  4O5C A;  7ICL A;  3T46 A;  5HRH A;  3MGI A;  4YD1 A;  5CFS A;  7ICG A;  5BOL A;  4R66 A;  3BUB A;  4FHX A;  7ICK A;  1SU6 A;  3ISC A;  4F5O A;  5CHG A;  4X4S A;  3C7N A;  1ZYL A;  4EZW A;  9ICR A;  1ZQU A;  3I04 A;  3NYB A;  4NSW A;  5DB9 A;  5EOZ A;  2ZH9 A;  2B56 A;  7ICH A;  4QZF A;  1E1D A;  2RT6 A;  2NCZ A;  2V0O A;  2EFL A;  4UB2 A;  4EZN A;  4XQ8 A;  2YI9 A;  4QZA A;  3JPO A;  5E84 A;  4UB3 A;  2YLA A;  3C66 A;  5HRF A;  5J0Y A;  3ER8 C;  3AQM A;  4RQ7 A;  4KLJ A;  4M0M A;  4M9L A;  4P4M A;  3AU2 A;  4X4O A;  1ZQR A;  2Q12 A;  3Q84 A;  3OHX M;  2PY6 A;  1BPZ A;  2Q66 A;  1ZQN A;  4H6I A;  4D8J A;  3DYT A;  5HHH A;  4JN4 A;  4JWN A;  5HRB A;  2F1B A;  8ICE A;  1KDH A;  4FZP A;  4IW0 A;  3RV0 A;  5DB6 A;  3SOG A;  2ZHB A;  1HXK A;  2PMR A;  2OW7 A;  2ZXQ A;  4N7R A;  2OBM A;  2QKW A;  2OO2 A;  3Q0K A;  4RQ4 A;  4TUP A;  2DR5 A;  4K4H A;  4JNE A;  2DR8 A;  9ICU A;  3VKH A;  5DED A;  2RAJ A;  4YMO A;  4WOY A;  4RPX A;  3OUY A;  4I2J A;  4O6A A;  3JPQ A;  2GAF D;  2ZH6 A;  2FMP A;  5J0W A;  4RQ2 A;  1I49 A;  3EJQ A;  4RQ3 A;  4O5E A;  1R8C A;  5HRE A;  3RJF A;  2DR9 A;  4AZ6 A;  9ICP A;  1XSP A;  5DDM A;  1HUO A;  4UDY X;  2LM0 A;  3CZN A;  4NY8 A;  4LT6 A;  4LEY A;  5DBB A;  5D62 A;  4ATB A;  9ICW A;  4I2C A;  8ICA A;  1PS3 A;  4EZX A;  1ZQV A;  3HAI A;  4LEW A;  4GXK A;  7ICV A;  8ICI A;  1TVA A;  7ICS A;  1ZQF A;  3LMF A;  3UIT A;  4EBJ A;  3H3A A;  3FD9 A;  1JMS A;  4JL9 A;  3C2M A;  1GN9 A;  5TZV A;  4F5R A;  1BPD A;  4TUQ A;  4KLI A;  4FHV A;  5J0U A;  1E2U A;  3CKD A;  4HR1 B;  8ICY A;  1ZQO A;  4EZR A;  2ELB A;  4XJE A;  4E8F A;  2D4C A;  2X3V A;  5J2H A;  4UAW A;  8ICF A;  2F18 A;  1JQK A;  4R5J A;  2F7R A;  3V7J A;  4M9G A;  3H39 A;  1ZQJ A;  4I2F A;  4LZG A;  8ICW A;  1ZWW A;  2QFF A;  4H8S A;  4IWO A;  4RT2 A;  8ICK A;  4RT3 A;  2QXL A;  4DO9 A;  3D2E A;  4EED A;  2ZH1 A;  2DRA A;  4K9A A;  4M04 A;  4OAI Z;  3GDX A;  2YL6 A;  4NQI A;  4EZT A;  1ZQT A;  2F1A A;  2F7Q A;  1RPL A;  3DX1 A;  1O7D C;  3OVA A;  5J2D A;  1TV9 A;  5D63 A;  1BPB A;  4F5P A;  9ICE A;  4RPZ A;  2ND0 A;  1GPJ A;  4G6Q A;  2ND1 A;  4EEB A;  1R34 A;  8ICM A;  3C5G A;  3EJS A;  1ZQL A;  4JLX A;  4NXW A;  4EZP A;  4QZ8 A;  3B0Y A;  5J2E A;  5CFU A;  5J29 A;  4UBC A;  3WFS C;  2LXY A;  4RWO A;  4IWQ A;  3C5F A;  4NM1 A;  5HHI A;  4NXV A;  2D1L A;  1QX1 A;  5J0S A;  4TUR A;  1MIW A;  3HW8 A;  5HRD A;  1TQU A;  4Z6C A;  5IIN A;  4UB5 A;  4MF2 A;  1OA0 A;  1U00 A;  5CJ7 A;  4AVM A;  4X4P A;  3K75 D;  3JPR A;  4WH5 A;  4X0B A;  4X4Q A;  3RH4 A;  9ICF A;  5CWR A;  2GF4 A;  4IQU A;  2ISP A;  5J2J A;  3I01 A;  2C08 A;  4K9B A;  3LVT A;  1QWN A;  2GWS A;  1R8B A;  1YLQ A;  2BBH A;  4RQ8 A;  4DYL A;  2EX3 B;  2BCS A;  9ICI A;  3DX4 A;  4I2G A;  3D4Y A;  3RH6 A;  4E80 A;  5HRI A;  4KB6 A;  1ZQC A;  2VAN A;  3KAV A;  4MKP A;  4PGY A;  3C2L A;  9ICL A;  4RWN A;  4RWQ A;  2EWF A;  2O1P A;  8ICX A;  2ID1 A;  2JNS A;  4DCN C;  4MFA A;  3RH5 A;  9ICM A;  4EZU A;  2NRK A;  3ABH A;  2W9M A;  3TFR A;  1ZQA A;  3DPP A;  4E3C A;  4X0A A;  4LVS A;  9ICG A;  2RFF A;  3JPP A;  4MFF A;  3B53 X;  4K4I A;  4I2D A;  3KDR A;  3L3P A;  3OVS A;  5DBA A;  2PXI A;  3T49 A;  3OUY B;  3CZS A;  2IHM A;  2BCR A;  5D49 A;  1R8A A;  2YIB A;  4WBY A;  3UPS A;  4EZZ A;  4R5L A;  1BPY A;  3CK6 A;  4X4V A;  3PLT A;  9ICK A;  2YL9 A;  3JZ0 A;  3HX0 A;  4AT8 B;  2YIV X;  7ICT A;  1I4T A;  4NLZ A;  2DR7 A;  5B3P A;  8ICB A;  3HAJ A;  2X3X A;  3EJR A;  4AZG A;  4QZD A;  8ICJ A;  4ATB B;  1DKY A;  1UEU A;  5J0R A;  4PHP A;  4KLG A;  5J2I A;  4MF8 A;  1I4L A;  3HJ1 A;  2ZH7 A;  5J0P A;  2WYH A;  2JNK A;  5CP2 A;  4AT7 A;  9ICT A;  4I1Q A;  7ICI A;  4EBK A;  3UXO A;  1HWW A;  1SU7 A;  4Z6E A;  7ICU A;  4ATM A;  4HY9 A;  2HN2 A;  4KLO A;  3K7D A;  3RJK A;  1ZQY A;  9ICV A;  3BVV A;  4O69 A;  5IIK A;  4WBZ A;  5CFT A;  3HJ4 A;  3G9G A;  3UQ2 A;  3UXP A;  1OU5 A;  1W9M A;  4PHE A;  4I2A A;  4O5K A;  4AT8 A;  2HHP A;  4F00 A;  4YCX A;  1MQ2 A;  4I28 A;  8ICP A;  4RQ0 A;  4KLL A;  4WQK A;  4S3N A;  3A98 A;  1F5A A;  3RJG A;  7ICE A;  4IWP A;  3D50 A;  2FYV A;  1WOT A;  3EF2 A;  4I2E A;  4JWD A;  5BPC A;  1RZT A;  8ICG A;  2O0I 1;  4IG8 A;  4XUS A;  4UB4 A;  4TUS A;  5FIG A;  1ZQH A;  4EZV A;  2BBJ A;  9ICX A;  1HTY A;  3DDG A;  4K99 A;  1XSL A;  1Y2O A;  4AZ7 A;  4Z6F A;  4M5D A;  3JYY A;  4LEZ A;  1JQR A;  3C18 A;  7ICO A;  3C2K A;  4I27 A;  4NPH A;  5JTG A;  3SYV A;  2ISO A;  8ICZ A;  2PFP A;  3UQ0 A;  2YLL A;  3QNJ A;  2YL5 A;  5J2A A;  5J2B A;  9ICC A;  3BUQ A;  1ZQM A;  4FHY A;  5J0Q A;  3EJP A;  5J0X A;  3RV1 A;  4FO1 A;  1ZQX A;  4JWC A;  1GNL A;  5D4B A;  1GNT A;  1O7D B;  1SU8 A;  2PFN A;  8ICN A;  2P66 A;  1R89 A;  4EZO A;  3MGH A;  9ICQ A;  4R64 A;  4HYB A;  3H37 A;  4O67 A;  3MCR A;  4IM0 A;  2PFQ A;  3F7W A;  4KLT A;  3JPS A;  4DOC A;  4RPY A;  7ICN A;  2O5A A;  2YIA A;  4QZC A;  2X3W A;  4M2Y A;  4WPC A;  4K97 A;  3LLL A;  4AZB A;  4M9J A;  2M2U A;  4JWE A;  5III A;  2PBE A;  1E9V A;  3DPO A;  4JWI A;  3EJU A;  7ICQ A;  2F7O A;  4BNE A;  3L9D A;  5IIO A;  5HRG A;  4KLF A;  2M2W A;  1ZQW A;  4WC5 A;  1MIV A;  4I2I A;  4YMM A;  5J2G A;  3BUP A;  4UBB A;  4I29 A;  3T4A G;  5J2F A;  2B4V A;  4QZG A;  3M3W A;  3RJI A;  4AZ5 A;  3BLB A;  3MBY A;  9ICB A;  2GA9 D;  4F01 A;  1R5E A;  3O3O B;  4EZS A;  4FHW A;  4WC2 A;  4X5V A;  3DDF A;  4JWM A;  4IM2 A;  3UXN A;  2BPF A;  3BVX A;  2Z8Y A;  2B51 A;  3AUO A;  2FCL A;  1R33 A;  2KHO A;  5CR0 A;  4YMN A;  5J0O A;  4KLE A;  4QZH A;  4NLK A;  4FM3 A;  4E7X A;  2BE3 A;  4UAY A;  1BPX A;  3I2W A;  4I2H A;  4QZ9 A;  3DX3 A;  4RWP A;  2ZH8 A;  1URU A;  8ICS A;  8ICV A;  4NKU A;  2RAK A;  1QWU A;  4AZC A;  4NKT A;  2M2T A;  2PFO A;  4AT7 B;  3VEA A;  3B51 X;  3GI7 A;  1VJ7 A;  2ALW A;  5DB7 A;  1LQ7 A;  4OAF A;  4FZO A;  9ICS A;  5IIJ A;  5C5B A;  3HAH A;  4FH5 A;  4XA5 A;  2ZH2 A;  3WFQ E;  4PPX A;  3HIY A;  1OAO A;  4OAH A;  5DB8 A;  3ISD A;  3BUI A;  4O68 A;  7ICR A;  4AZH A;  4HX0 A;  4XRH A;  4KLU A;  1ZQG A;  1ZQD A;  2ZHA A;  4WPE A;  2BCV A;  3TFS A;  3T47 A;  1NOM A;  3NWI A;  3V7K A;  3BVU A;  4K4G A;  4X4T A;  1KNY A;  3RJJ A;  3NKU A;  4B9Q A;  4FH3 A;  4K98 A;  1UEV A;  4LEV A;  4PGX A;  3CV5 A;  4OAG A;  4PGQ A;  1ZQS A;  4M9N A;  4WC1 A;  3RJE A;  1X03 A;  3WFO A;  4P2H A;  4KLH A;  3RJH A;  4KM5 A;  5B3Q A;  2DVI A;  3WFP A;  2OW6 A;  4PHA A;  4LZD A;  4IM3 A;  3OWG A;  3I39 X;  4R5I A;  1JAJ A;  4WC7 A;  4UDX X;  2YKT A;  3RPM A;  4WC6 A;  2DRB A;  4JNF A;  3LK9 A;  1ZQQ A;  4KLM A;  1DKX A;  4E81 A;  1ZQE A;  5HR9 A;  5DBC A;  4WC4 A;  3D4Z A;  3QNI A;  1ZQP A;  3OVB A;  2BPG A;  9ICJ A;  3MDA A;  3DPQ A;  4AT9 B;  3O3N B;  1ZQI A;  4F5N A;  2YI8 A;  3JPT A;  4R5K A;  3KAW A;  4FHP A;  4QZI A;  4M9H A;  3OK8 A;  4KLD A;  5J2C A;  4DOA A;  5KBP A;  3D52 A;  3DX2 A;  1MJG A;  1TQT A;  5BOM A;  3EJT A;  4IQT A;  4AZI A; 
#chains in the Genus database with same CATH homology
 3C7N A;  1ZYL A;  3QNJ A;  4EZW A;  4WH5 A;  5FLE X;  3I04 A;  2IHO A;  3ERC C;  1OA1 A;  3I01 A;  3RV1 A;  4JWC A;  2B56 A;  4FO1 A;  1GNL A;  4K9B A;  1GNT A;  1SU8 A;  1E1D A;  2RT6 A;  4EZO A;  4HYB A;  2NCZ A;  3PHZ A;  4O67 A;  4EZN A;  3MCR A;  2YI9 A;  3O3M B;  3D2F A;  4IM0 A;  3F7W A;  5E84 A;  2EX3 B;  2YIA A;  3ER8 C;  4KB6 A;  4M0M A;  4K97 A;  3KAV A;  4MKP A;  3OHX M;  2PY6 A;  2EWF A;  4JWE A;  4H6I A;  2JNS A;  4D8J A;  3L3O M;  1E9V A;  3DPO A;  4JN4 A;  4EZU A;  4JWI A;  5TKY A;  3DPP A;  4IW0 A;  3RV0 A;  4E3C A;  3B53 X;  4WQL A;  4N7R A;  2OBM A;  3T48 A;  3KDR A;  4K96 A;  4JNE A;  3VKH A;  3T4A G;  3T49 A;  2B4V A;  4O6A A;  2GAF D;  2YIB A;  4EZZ A;  4R5L A;  2GA9 D;  4F01 A;  4EZS A;  3O3O B;  2N3K A;  4IM2 A;  4KIK B;  4EZQ A;  2Z8Y A;  2B51 A;  2YIV X;  2FCL A;  4H6H A;  2KHO A;  1SUF A;  3VEB A;  4UDY X;  2LM0 A;  5B3P A;  4FM3 A;  4LEY A;  1DKY A;  5D62 A;  4R5G A;  4PO2 A;  4NXT A;  1UPX A;  4EZX A;  2WIN M;  4LEW A;  3VEA A;  3B51 X;  1DKZ A;  3GI7 A;  3B52 X;  3LMF A;  3UIT A;  4OAF A;  3FD9 A;  4JL9 A;  1GN9 A;  4K8V A;  1SU7 A;  2X5C A;  4HY9 A;  1OAO A;  4OAH A;  1E2U A;  3QA8 A;  4HR1 B;  4EZY A;  3K7D A;  4HR1 A;  4EZR A;  4HX0 A;  4O68 A;  4XJE A;  3ER9 B;  4O69 A;  5CFT A;  3T47 A;  1JQK A;  4R5J A;  1W9M A;  4KIK A;  4F00 A;  2QFF A;  3NKU A;  4IWO A;  4B9Q A;  4K98 A;  2OBL A;  4WQK A;  2QXL A;  4JLC A;  3D2E A;  4LEV A;  3A98 A;  4OAG A;  4IWP A;  2EWR A;  4JLZ A;  4K9A A;  3EF2 A;  4OAI Z;  4JWD A;  4KM5 A;  4NXU A;  5D61 A;  5B3Q A;  4EZT A;  4IM3 A;  3OWG A;  3I39 X;  4R5I A;  4UDX X;  5CHE A;  5FIG A;  3ZED A;  4JNF A;  4EZV A;  5D63 A;  4NXX A;  1DKX A;  4E81 A;  4K99 A;  2ND0 A;  1GPJ A;  4G6Q A;  2ND1 A;  3DPQ A;  3O3N B;  2YI8 A;  4JLX A;  4NXW A;  4R5K A;  4LEZ A;  4EZP A;  3KAW A;  3T46 A;  5CFU A;  4IWQ A;  5CFS A;  4NXV A;  1MJG A;  4NPH A;  1SU6 A;  4WOY A;  1OA0 A;  1U00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...