2GA9D

Crystal structure of the heterodimeric vaccinia virus polyadenylate polymerase with bound atp-gamma-s
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 151
structure length 445
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
D PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2ga9D01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ga9D03
2GA9D 3ER9B 3ERCC 2GAFD 3OWGA 3ER8C
chains in the Genus database with same CATH superfamily
1O7DB 2FMSA 4FZPA 8ICLA 5J0PA 2F1AA 7ICGA 5DDMA 4OAFA 3GI7A 4AZCB 4X4SA 3RH4A 5DECA 4EZRA 3RJJA 4X4RA 4WC0A 9ICBA 8ICOA 4M9NA 4EBJA 9ICAA 4E81A 4JWMA 1BPZA 4N7RA 4R5JA 5J0RA 3V7JA 4M2YA 1GNLA 3CAZA 3VEBA 5DB6A 2BBHA 3MDAA 5IINA 3OVSA 3QE6A 3QWEA 2D4CA 3ZEDA 4O5KA 3BUDA 4F5RA 5J0YA 4AT7A 2B4VA 5DB9A 2O0I1 1X04A 3UITA 4UB4A 4FM3A 1UPXA 3H3AA 4K97A 4RWNA 1PS3A 2IHMA 2Q12A 3EJQA 4IWPA 3TFRA 1ZQOA 7ICRA 3JPOA 8ICXA 4JWEA 4NXXA 3HJ4A 2BCQA 8ICEA 3UPQA 3JPPA 4AT8B 4TUSA 5HHIA 2ZH7A 9ICEA 1ZQIA 2PMRA 5HHHA 5B3PA 5J0SA 4EZUA 5J2KA 4WQKA 2IHOA 2YI8A 4PHAA 4I2DA 4AZ5A 1WOTA 3ISBA 4E7XA 4KLSA 5IILA 3PMNA 4JWDA 4FH5A 4O6AA 3RH6A 1V4AA 2QXLA 2BCVA 1GN9A 3K7DA 3I04A 4I1QA 4KLFA 1ZQEA 4WH5A 4PO2A 3L9DA 5JTGA 3I01A 4M47A 3OHXM 5HRGA 4RQ3A 4FHPA 4XJEA 4MKPA 8ICFA 3OGUA 4WPCA 3MDCA 3NWIA 4JLCA 7ICLA 4QZFA 4QZDA 4K9BA 1QWNA 3RJKA 2DR9A 4X5VA 1ZQWA 4NM2A 2Z0VA 4I2HA 4K4IA 4QZ9A 3BVVA 4WPEA 3KAVA 4WC2A 1E9VA 2ALWA 5DB8A 2ISPA 7ICUA 2ZXQA 5HR9A 1HUZA 4B9QA 8ICJA 4FHXA 1ZQVA 3MGHA 3GDXA 4PHDA 5HRHA 2EWRA 2ZHBA 1TV9A 4PGXA 3T49A 4E80A 4LZGA 4MFFA 5FLEX 2JNSA 3DPOA 2YL5A 3VEAA 3RJGA 2DVIA 2F7OA 4IM0A 4QZBA 2YLAA 4XRHA 1TFYA 2Q66A 2RAJA 9ICTA 3ACOA 5J0TA 3ISDA 3DYTA 4RT2A 4YD1A 3T46A 3JPSA 1VFGA 2FICA 4O69A 1UEUA 9ICFA 3NVOA 5HRDA 1NO5A 2GWSA 5D4BA 5HREA 7ICQA 4EZSA 5D46A 3H39A 1MQ2A 4FHWA 3AQMA 1HUOA 1ZQPA 5KBPA 4JLZA 3B51X 3M3WA 4AZCA 4DOCA 4Z6FA 2RFFA 3V7KA 4NLNA 4RQ2A 7ICTA 8ICUA 2OO2A 5TZVA 1X03A 8ICMA 4F5QA 3C66A 2F1BA 7ICOA 4P4OA 4UDYX 4XQ8A 4FZSA 3V7LA 3LK9A 4I2AA 8ICGA 2MI7A 2F7RA 3FD9A 1R8AA 4EZVA 1UEVA 3NYBA 4KLOA 4GXJA 4X0AA 2YIBA 3QNJA 2ZH1A 1R5EA 5CFTA 4H6IA 5CFUA 7ICNA 3A98A 5D63A 3HX0A 2ZH4A 3WFRE 3D4YA 9ICJA 3EF2A 3HWTA 5D62A 5CR0A 4TUQA 4NXWA 3V72A 3DX0A 2OBMA 3DDFA 3HJ1A 5IIKA 1OU5A 4EBKA 2QFFA 4JWNA 4X4QA 4JN4A 3C7NA 4X4UA 3AQKA 4I28A 4O5CA 1OA0A 4HR1B 2O5AA 3RV1A 4KLLA 1YLQA 3HW8A 2PXIA 4YD2A 2ZH6A 3AU6A 1ZQMA 1HXKA 9ICXA 2PY6A 4H8SA 3SYVA 4RWOA 1ZQNA 4AZHA 2FMPA 4LEYA 9ICMA 3C2MA 1BPYA 7ICJA 1ZQXA 4KLQA 1R8BA 4ATMA 2NRKA 2F7QA 4OAIZ 4RWQA 3G9GA 2HHPA 4YMNA 3ER8C 4X4OA 2IUBA 1JMSA 4FO6A 5DBBA 5J2IA 2P66A 4Z6CA 4RQ4A 4PHPA 4R66A 4EP7A 5J2FA 1MQ3A 4I2BA 2YIAA 1ZQQA 1KEJA 2X3XA 4AZBA 4EZNA 7ICFA 9ICHA 4AT9B 2YI9A 2FCLA 4O67A 3WFPA 9ICKA 2W9MA 3EJTA 4O68A 4EZWA 4PPXA 3JCFA 4YMOA 3MGIA 8ICZA 3BUIA 8ICBA 4QZHA 2KHOA 3EJSA 3T48A 4I0UA 4QZGA 9ICPA 4M04A 2YIVX 1XSLA 8ICAA 8ICRA 4IQVA 4UAWA 3D2EA 3HAIA 1JN3A 3OUYB 7ICKA 4NKUA 8ICYA 4KLIA 3QA8A 4MFAA 1DKYA 1SUFA 4QZEA 1BPXA 1SU8A 4UBCA 1JAJA 3DX2A 4LT6A 2EFKA 3UQ2A 1BPDA 4P4MA 5J2JA 4RQ5A 2HN2A 1ZJMA 2OZNB 2RAKA 2LXYA 5C5BA 4IQWA 2I9GA 3Q0KA 4AT8A 3EJUA 1NOMA 3WFQE 5DEDA 4UDXX 4NXVA 3L3PA 4IWQA 5J0OA 3UXOA 1TVAA 2O1PA 5B3QA 4X4VA 1SU6A 5CHGA 1ZQTA 4MFCA 4E8FA 4F00A 4LEVA 5DB7A 4M9GA 3QNIA 4I27A 2OW6A 4AZIA 1KNYA 3OUYA 4UD5A 5HRKA 4XQ7A 4UB3A 1GPJA 4MF8A 1R33A 4D8JA 4IWOA 2OBLA 3OV7A 4Z6EA 5IIMA 3WFSC 5DDYA 3CKDA 4QZCA 4UAYA 3JPRA 1MIVA 1MJGA 5J2CA 5FIGA 4GXIA 4O5EA 4RQ1A 4K4HA 4Z6DA 5DBAA 4WBYA 3ISCA 1OA1A 2B51A 4M0MA 3HAHA 2JNKA 5IIOA 1R89A 1JQKA 2M2TA 3UXPA 5J2EA 2BCUA 3JYYA 2PFPA 2GF4A 4K98A 4RQ0A 2YL9A 4IG8A 4EZYA 4NSWA 5HC9A 3RJFA 3OVBA 8ICPA 4WC3A 1ZJNA 2X3WA 3DX4A 3PHZA 4WQLA 4M9HA 5J0UA 9ICGA 2OW7A 4AZGA 4EV6A 4M9LA 4KLEA 3D50A 1QWUA 3B52X 4JWIA 2ND0A 4F5PA 4RQ7A 9ICCA 4EEDA 4AVMA 1F5AA 4WC4A 4R65A 3RV0A 4NM1A 8ICKA 4MF2A 3BVWA 2ZH8A 4ATBA 4X4TA 5CP2A 9ICWA 1E2UA 4LEZA 1TQVA 2YLLA 2N3KA 4F5NA 4WC6A 3DX3A 3RJEA 1QX1A 2C08A 2WINM 1ZQDA 1ZQAA 7ICMA 1SU7A 3DPPA 4AKVA 3ER9B 4P2HA 9ICLA 2V0OA 3UXNA 3AUOA 4I2FA 4LVSA 4FZOA 4WOYA 3SOGA 3KDRA 5HRFA 4EGWA 4NLZA 1RZTA 4QZAA 1I4TA 4LEWA 3CZNA 4RQ8A 5DKWA 4AT7B 3BLBA 1TQUA 4EZXA 3BUBA 2Z0NA 4G6QA 3RPMA 1Q79A 3ERCC 1YWMA 3C5GA 8ICCA 3O3NB 3B0XA 4KIKA 5J2DA 3ABHA 4X4PA 4F5OA 1ZQCA 1MIWA 1JQRA 4KLTA 2ZH5A 3RJHA 3BVTA 4YN4A 3C18A 5CJ7A 5J2HA 4FH3A 2YKTA 8ICVA 3LVTA 4UAZA 4K9AA 1E1DA 4H6HA 4S3NA 3F7WA 3PMLA 4KLUA 4RPXA 3CVRA 4AZ6A 4RPYA 4NXUA 2BPGA 4K4GA 9ICNA 1I49A 9ICOA 1ZQYA 4HX0A 4GXKA 3CV5A 7ICHA 2ID1A 4EZQA 1TQSA 4KLGA 3OWGA 4I2CA 1PX5A 2BBJA 4I2JA 2ZH9A 4KB6A 3C2LA 4WCWA 1ZQBA 4KLDA 2X5CA 2LM0A 3WFOA 1TQWA 4R5LA 9ICQA 4OAGA 4NXTA 7ICEA 3AQLA 3PLTA 4I2EA 4KLMA 2YL8A 1ZQHA 4UB1A 5BPCA 1ZQFA 3D4ZA 4FO1A 4QZ8A 5CWRA 3T47A 3H38A 5HRIA 2B56A 3MCRA 2EFLA 3BVXA 4RT3A 2WYHA 3AQNA 4XA5A 4FHVA 2EWFA 4UBBA 8ICQA 1HWWA 4K99A 3I39X 4DO9A 2M2UA 1ZQGA 2BPFA 3O3OB 4JWCA 1FA0A 5D61A 5J0XA 3DPQA 8ICNA 4PGYA 4O9MA 3UPSA 4M9JA 3OVAA 2BE3A 2DR5A 4KLJA 4WBZA 4RWPA 1O7DC 4HY9A 3LLLA 4EZTA 5J2AA 4NXZA 1BPBA 1WDZA 3CZSA 3BUQA 1XSNA 1Y2OA 4AT9A 3RJIA 3JPNA 2PFNA 2F18A 1U00A 4KIKB 5E84A 5J0QA 7ICPA 4JLXA 3CK6A 4RPZA 2BCRA 4YCXA 3PNCA 4IW0A 4P4PA 9ICIA 4JNEA 2ND1A 1W9MA 5CHEA 4TURA 1HTYA 7ICVA 2DR8A 3JPTA 2ELBA 1ZQRA 4BNEA 3JPQA 4I29A 5HRLA 2PFOA 3DX1A 4I2IA 4EZPA 4R5IA 3AU2A 5IIJA 3D2FA 3LQCB 1VJ7A 3JZ0A 4XUSA 4PHEA 5CB1A 4NQIA 4NLKA 2GA9D 4EZZA 5F2VO 3I2WA 5C5BB 4HYBA 1MIYA 2RAIA 4K8VA 8ICIA 3TFSA 5CA7A 2RT6A 4DYLA 1I4LA 3KAWA 2BPCA 2DR7A 5BOLA 2DRBA 3BUPA 1GNTA 7ICSA 3O3MB 2EX3B 4PGQA 1URUA 3EJPA 2Z0OA 2QKWA 4R5KA 3D51A 4NKTA 1ZQKA 2F7PA 4AZ7A 4UB2A 4R64A 4DOBA 8ICHA 4R63A 3C2KA 2ZHAA 3Q84A 5J29A 4DCNC 1OAOA 9ICRA 4DOAA 4IQUA 3LMFA 4NPHA 1UETA 5BOMA 4KM5A 4IM3A 2D1LA 4FHYA 2DRAA 1ZWWA 2FYVA 2VANA 4WC5A 4JNFA 1ZQZA 2WYIA 3VKHA 4JL9A 2ZH2A 9ICUA 2M2VA 3B0YA 4KLHA 3BVUA 1Q78A 4M0AA 9ICVA 4UD4A 2M2WA 3MBYA 8ICTA 4QZIA 4IM2A 4PH5A 5TKYA 2NCZA 4I2GA 1R8CA 1ZQUA 4RQ6A 3T4AG 1R34A 2PFQA 4K96A 4WC7A 1RPLA 4EEBA 2PBEA 2X3VA 5J0WA 2ZH3A 1ZQSA 1I4DA 4R5GA 4LZDA 3UQ0A 5EOZA 5DBCA 3D52A 3L3OM 1DKXA 4TUPA 2YL6A 5CFSA 4YMMA 4EZOA 1LQ7A 4OAHA 1ZQJA 2BCSA 2Q13A 1TFWA 1ZYLA 4M5DA 5J2BA 3NKUA 4E3CA 4X4NA 3H37A 5HRBA 4WC1A 1XSPA 3RH5A 5J2GA 1BPEA 1TQTA 3DDGA 5D49A 7ICIA 3OK8A 3HIYA 4X0BA 8ICSA 3EJRA 3K75D 4HR1A 3B53X 2FMQA 2Z8YA 2GAFD 4NY8A 5IIIA 3HAJA 1DKZA 4F01A 1ZQLA 3C5FA 4ATBB 1KDHA 4UB5A 9ICSA 4IQTA 8ICWA 2HN1A 2ISOA
chains in the Genus database with same CATH topology
1GPJA 4D8JA 4HY9A 4IWOA 2OBLA 4EZTA 4JLZA 3B51X 4OAFA 3GI7A 4EZRA 1MJGA 1U00A 4KIKB 5FIGA 5E84A 4JLXA 1OA1A 2B51A 4IW0A 4M0MA 4JNEA 1JQKA 4E81A 2ND1A 1W9MA 4UDYX 5CHEA 4N7RA 4R5JA 1GNLA 3VEBA 4K98A 3FD9A 4EZVA 4EZYA 4EZPA 4R5IA 2YIBA 3ZEDA 3D2FA 3QNJA 3PHZA 4WQLA 5CFTA 4H6IA 5CFUA 2B4VA 3B52X 4JWIA 2GA9D 2ND0A 3A98A 3UITA 4EZZA 4FM3A 5D63A 1UPXA 4HYBA 3EF2A 4K8VA 4K97A 3RV0A 2RT6A 5D62A 3KAWA 4NXWA 2OBMA 4IWPA 1E2UA 2QFFA 4LEZA 4JN4A 3C7NA 2N3KA 4JWEA 4NXXA 1GNTA 1OA0A 4HR1B 2WINM 3O3MB 2EX3B 3RV1A 1SU7A 3DPPA 4R5KA 3ER9B 2PY6A 5B3PA 4EZUA 4WQKA 2IHOA 4LEYA 4WOYA 3KDRA 2YI8A 1OAOA 4OAIZ 4LEWA 3LMFA 4NPHA 4KM5A 4EZXA 4IM3A 3ER8C 4JWDA 4G6QA 4O6AA 3ERCC 2QXLA 1GN9A 3O3NB 4JNFA 4KIKA 3I04A 3K7DA 3VKHA 4JL9A 4WH5A 4PO2A 3I01A 3OHXM 4XJEA 2YIAA 4IM2A 4MKPA 4K9AA 1E1DA 4EZNA 4H6HA 2NCZA 5TKYA 3F7WA 2YI9A 2FCLA 4O67A 4JLCA 4O68A 3T4AG 4EZWA 4NXUA 4K9BA 4K96A 4HX0A 2KHOA 3T48A 4R5GA 3KAVA 4EZQA 2YIVX 3L3OM 1E9VA 3OWGA 1DKXA 4KB6A 3D2EA 4B9QA 5CFSA 4EZOA 2X5CA 2LM0A 4OAHA 2EWRA 3QA8A 1DKYA 1SUFA 4R5LA 1ZYLA 4OAGA 1SU8A 3T49A 4NXTA 5FLEX 3NKUA 4E3CA 2JNSA 3DPOA 3VEAA 4IM0A 4FO1A 3T47A 2B56A 3MCRA 4UDXX 4HR1A 4NXVA 4IWQA 3B53X 2Z8YA 2GAFD 2EWFA 5B3QA 1SU6A 3T46A 4F01A 1DKZA 4F00A 4LEVA 4O69A 4K99A 3I39X 3O3OB 4JWCA 5D61A 3DPQA 4EZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA9 D;  3ER9 B;  3ERC C;  2GAF D;  3OWG A;  3ER8 C; 
#chains in the Genus database with same CATH topology
 1O7D B;  2FMS A;  4FZP A;  8ICL A;  5J0P A;  2F1A A;  7ICG A;  5DDM A;  4OAF A;  3GI7 A;  4AZC B;  4X4S A;  3RH4 A;  5DEC A;  4EZR A;  3RJJ A;  4X4R A;  4WC0 A;  9ICB A;  8ICO A;  4M9N A;  4EBJ A;  9ICA A;  4E81 A;  4JWM A;  1BPZ A;  4N7R A;  4R5J A;  5J0R A;  3V7J A;  4M2Y A;  1GNL A;  3CAZ A;  3VEB A;  5DB6 A;  2BBH A;  3MDA A;  5IIN A;  3OVS A;  3QE6 A;  3QWE A;  2D4C A;  3ZED A;  4O5K A;  3BUD A;  4F5R A;  5J0Y A;  4AT7 A;  2B4V A;  5DB9 A;  2O0I 1;  1X04 A;  3UIT A;  4UB4 A;  4FM3 A;  1UPX A;  3H3A A;  4K97 A;  4RWN A;  1PS3 A;  2IHM A;  2Q12 A;  3EJQ A;  4IWP A;  3TFR A;  1ZQO A;  7ICR A;  3JPO A;  8ICX A;  4JWE A;  4NXX A;  3HJ4 A;  2BCQ A;  8ICE A;  3UPQ A;  3JPP A;  4AT8 B;  4TUS A;  5HHI A;  2ZH7 A;  9ICE A;  1ZQI A;  2PMR A;  5HHH A;  5B3P A;  5J0S A;  4EZU A;  5J2K A;  4WQK A;  2IHO A;  2YI8 A;  4PHA A;  4I2D A;  4AZ5 A;  1WOT A;  3ISB A;  4E7X A;  4KLS A;  5IIL A;  3PMN A;  4JWD A;  4FH5 A;  4O6A A;  3RH6 A;  1V4A A;  2QXL A;  2BCV A;  1GN9 A;  3K7D A;  3I04 A;  4I1Q A;  4KLF A;  1ZQE A;  4WH5 A;  4PO2 A;  3L9D A;  5JTG A;  3I01 A;  4M47 A;  3OHX M;  5HRG A;  4RQ3 A;  4FHP A;  4XJE A;  4MKP A;  8ICF A;  3OGU A;  4WPC A;  3MDC A;  3NWI A;  4JLC A;  7ICL A;  4QZF A;  4QZD A;  4K9B A;  1QWN A;  3RJK A;  2DR9 A;  4X5V A;  1ZQW A;  4NM2 A;  2Z0V A;  4I2H A;  4K4I A;  4QZ9 A;  3BVV A;  4WPE A;  3KAV A;  4WC2 A;  1E9V A;  2ALW A;  5DB8 A;  2ISP A;  7ICU A;  2ZXQ A;  5HR9 A;  1HUZ A;  4B9Q A;  8ICJ A;  4FHX A;  1ZQV A;  3MGH A;  3GDX A;  4PHD A;  5HRH A;  2EWR A;  2ZHB A;  1TV9 A;  4PGX A;  3T49 A;  4E80 A;  4LZG A;  4MFF A;  5FLE X;  2JNS A;  3DPO A;  2YL5 A;  3VEA A;  3RJG A;  2DVI A;  2F7O A;  4IM0 A;  4QZB A;  2YLA A;  4XRH A;  1TFY A;  2Q66 A;  2RAJ A;  9ICT A;  3ACO A;  5J0T A;  3ISD A;  3DYT A;  4RT2 A;  4YD1 A;  3T46 A;  3JPS A;  1VFG A;  2FIC A;  4O69 A;  1UEU A;  9ICF A;  3NVO A;  5HRD A;  1NO5 A;  2GWS A;  5D4B A;  5HRE A;  7ICQ A;  4EZS A;  5D46 A;  3H39 A;  1MQ2 A;  4FHW A;  3AQM A;  1HUO A;  1ZQP A;  5KBP A;  4JLZ A;  3B51 X;  3M3W A;  4AZC A;  4DOC A;  4Z6F A;  2RFF A;  3V7K A;  4NLN A;  4RQ2 A;  7ICT A;  8ICU A;  2OO2 A;  5TZV A;  1X03 A;  8ICM A;  4F5Q A;  3C66 A;  2F1B A;  7ICO A;  4P4O A;  4UDY X;  4XQ8 A;  4FZS A;  3V7L A;  3LK9 A;  4I2A A;  8ICG A;  2MI7 A;  2F7R A;  3FD9 A;  1R8A A;  4EZV A;  1UEV A;  3NYB A;  4KLO A;  4GXJ A;  4X0A A;  2YIB A;  3QNJ A;  2ZH1 A;  1R5E A;  5CFT A;  4H6I A;  5CFU A;  7ICN A;  3A98 A;  5D63 A;  3HX0 A;  2ZH4 A;  3WFR E;  3D4Y A;  9ICJ A;  3EF2 A;  3HWT A;  5D62 A;  5CR0 A;  4TUQ A;  4NXW A;  3V72 A;  3DX0 A;  2OBM A;  3DDF A;  3HJ1 A;  5IIK A;  1OU5 A;  4EBK A;  2QFF A;  4JWN A;  4X4Q A;  4JN4 A;  3C7N A;  4X4U A;  3AQK A;  4I28 A;  4O5C A;  1OA0 A;  4HR1 B;  2O5A A;  3RV1 A;  4KLL A;  1YLQ A;  3HW8 A;  2PXI A;  4YD2 A;  2ZH6 A;  3AU6 A;  1ZQM A;  1HXK A;  9ICX A;  2PY6 A;  4H8S A;  3SYV A;  4RWO A;  1ZQN A;  4AZH A;  2FMP A;  4LEY A;  9ICM A;  3C2M A;  1BPY A;  7ICJ A;  1ZQX A;  4KLQ A;  1R8B A;  4ATM A;  2NRK A;  2F7Q A;  4OAI Z;  4RWQ A;  3G9G A;  2HHP A;  4YMN A;  3ER8 C;  4X4O A;  2IUB A;  1JMS A;  4FO6 A;  5DBB A;  5J2I A;  2P66 A;  4Z6C A;  4RQ4 A;  4PHP A;  4R66 A;  4EP7 A;  5J2F A;  1MQ3 A;  4I2B A;  2YIA A;  1ZQQ A;  1KEJ A;  2X3X A;  4AZB A;  4EZN A;  7ICF A;  9ICH A;  4AT9 B;  2YI9 A;  2FCL A;  4O67 A;  3WFP A;  9ICK A;  2W9M A;  3EJT A;  4O68 A;  4EZW A;  4PPX A;  3JCF A;  4YMO A;  3MGI A;  8ICZ A;  3BUI A;  8ICB A;  4QZH A;  2KHO A;  3EJS A;  3T48 A;  4I0U A;  4QZG A;  9ICP A;  4M04 A;  2YIV X;  1XSL A;  8ICA A;  8ICR A;  4IQV A;  4UAW A;  3D2E A;  3HAI A;  1JN3 A;  3OUY B;  7ICK A;  4NKU A;  8ICY A;  4KLI A;  3QA8 A;  4MFA A;  1DKY A;  1SUF A;  4QZE A;  1BPX A;  1SU8 A;  4UBC A;  1JAJ A;  3DX2 A;  4LT6 A;  2EFK A;  3UQ2 A;  1BPD A;  4P4M A;  5J2J A;  4RQ5 A;  2HN2 A;  1ZJM A;  2OZN B;  2RAK A;  2LXY A;  5C5B A;  4IQW A;  2I9G A;  3Q0K A;  4AT8 A;  3EJU A;  1NOM A;  3WFQ E;  5DED A;  4UDX X;  4NXV A;  3L3P A;  4IWQ A;  5J0O A;  3UXO A;  1TVA A;  2O1P A;  5B3Q A;  4X4V A;  1SU6 A;  5CHG A;  1ZQT A;  4MFC A;  4E8F A;  4F00 A;  4LEV A;  5DB7 A;  4M9G A;  3QNI A;  4I27 A;  2OW6 A;  4AZI A;  1KNY A;  3OUY A;  4UD5 A;  5HRK A;  4XQ7 A;  4UB3 A;  1GPJ A;  4MF8 A;  1R33 A;  4D8J A;  4IWO A;  2OBL A;  3OV7 A;  4Z6E A;  5IIM A;  3WFS C;  5DDY A;  3CKD A;  4QZC A;  4UAY A;  3JPR A;  1MIV A;  1MJG A;  5J2C A;  5FIG A;  4GXI A;  4O5E A;  4RQ1 A;  4K4H A;  4Z6D A;  5DBA A;  4WBY A;  3ISC A;  1OA1 A;  2B51 A;  4M0M A;  3HAH A;  2JNK A;  5IIO A;  1R89 A;  1JQK A;  2M2T A;  3UXP A;  5J2E A;  2BCU A;  3JYY A;  2PFP A;  2GF4 A;  4K98 A;  4RQ0 A;  2YL9 A;  4IG8 A;  4EZY A;  4NSW A;  5HC9 A;  3RJF A;  3OVB A;  8ICP A;  4WC3 A;  1ZJN A;  2X3W A;  3DX4 A;  3PHZ A;  4WQL A;  4M9H A;  5J0U A;  9ICG A;  2OW7 A;  4AZG A;  4EV6 A;  4M9L A;  4KLE A;  3D50 A;  1QWU A;  3B52 X;  4JWI A;  2ND0 A;  4F5P A;  4RQ7 A;  9ICC A;  4EED A;  4AVM A;  1F5A A;  4WC4 A;  4R65 A;  3RV0 A;  4NM1 A;  8ICK A;  4MF2 A;  3BVW A;  2ZH8 A;  4ATB A;  4X4T A;  5CP2 A;  9ICW A;  1E2U A;  4LEZ A;  1TQV A;  2YLL A;  2N3K A;  4F5N A;  4WC6 A;  3DX3 A;  3RJE A;  1QX1 A;  2C08 A;  2WIN M;  1ZQD A;  1ZQA A;  7ICM A;  1SU7 A;  3DPP A;  4AKV A;  3ER9 B;  4P2H A;  9ICL A;  2V0O A;  3UXN A;  3AUO A;  4I2F A;  4LVS A;  4FZO A;  4WOY A;  3SOG A;  3KDR A;  5HRF A;  4EGW A;  4NLZ A;  1RZT A;  4QZA A;  1I4T A;  4LEW A;  3CZN A;  4RQ8 A;  5DKW A;  4AT7 B;  3BLB A;  1TQU A;  4EZX A;  3BUB A;  2Z0N A;  4G6Q A;  3RPM A;  1Q79 A;  3ERC C;  1YWM A;  3C5G A;  8ICC A;  3O3N B;  3B0X A;  4KIK A;  5J2D A;  3ABH A;  4X4P A;  4F5O A;  1ZQC A;  1MIW A;  1JQR A;  4KLT A;  2ZH5 A;  3RJH A;  3BVT A;  4YN4 A;  3C18 A;  5CJ7 A;  5J2H A;  4FH3 A;  2YKT A;  8ICV A;  3LVT A;  4UAZ A;  4K9A A;  1E1D A;  4H6H A;  4S3N A;  3F7W A;  3PML A;  4KLU A;  4RPX A;  3CVR A;  4AZ6 A;  4RPY A;  4NXU A;  2BPG A;  4K4G A;  9ICN A;  1I49 A;  9ICO A;  1ZQY A;  4HX0 A;  4GXK A;  3CV5 A;  7ICH A;  2ID1 A;  4EZQ A;  1TQS A;  4KLG A;  3OWG A;  4I2C A;  1PX5 A;  2BBJ A;  4I2J A;  2ZH9 A;  4KB6 A;  3C2L A;  4WCW A;  1ZQB A;  4KLD A;  2X5C A;  2LM0 A;  3WFO A;  1TQW A;  4R5L A;  9ICQ A;  4OAG A;  4NXT A;  7ICE A;  3AQL A;  3PLT A;  4I2E A;  4KLM A;  2YL8 A;  1ZQH A;  4UB1 A;  5BPC A;  1ZQF A;  3D4Z A;  4FO1 A;  4QZ8 A;  5CWR A;  3T47 A;  3H38 A;  5HRI A;  2B56 A;  3MCR A;  2EFL A;  3BVX A;  4RT3 A;  2WYH A;  3AQN A;  4XA5 A;  4FHV A;  2EWF A;  4UBB A;  8ICQ A;  1HWW A;  4K99 A;  3I39 X;  4DO9 A;  2M2U A;  1ZQG A;  2BPF A;  3O3O B;  4JWC A;  1FA0 A;  5D61 A;  5J0X A;  3DPQ A;  8ICN A;  4PGY A;  4O9M A;  3UPS A;  4M9J A;  3OVA A;  2BE3 A;  2DR5 A;  4KLJ A;  4WBZ A;  4RWP A;  1O7D C;  4HY9 A;  3LLL A;  4EZT A;  5J2A A;  4NXZ A;  1BPB A;  1WDZ A;  3CZS A;  3BUQ A;  1XSN A;  1Y2O A;  4AT9 A;  3RJI A;  3JPN A;  2PFN A;  2F18 A;  1U00 A;  4KIK B;  5E84 A;  5J0Q A;  7ICP A;  4JLX A;  3CK6 A;  4RPZ A;  2BCR A;  4YCX A;  3PNC A;  4IW0 A;  4P4P A;  9ICI A;  4JNE A;  2ND1 A;  1W9M A;  5CHE A;  4TUR A;  1HTY A;  7ICV A;  2DR8 A;  3JPT A;  2ELB A;  1ZQR A;  4BNE A;  3JPQ A;  4I29 A;  5HRL A;  2PFO A;  3DX1 A;  4I2I A;  4EZP A;  4R5I A;  3AU2 A;  5IIJ A;  3D2F A;  3LQC B;  1VJ7 A;  3JZ0 A;  4XUS A;  4PHE A;  5CB1 A;  4NQI A;  4NLK A;  2GA9 D;  4EZZ A;  5F2V O;  3I2W A;  5C5B B;  4HYB A;  1MIY A;  2RAI A;  4K8V A;  8ICI A;  3TFS A;  5CA7 A;  2RT6 A;  4DYL A;  1I4L A;  3KAW A;  2BPC A;  2DR7 A;  5BOL A;  2DRB A;  3BUP A;  1GNT A;  7ICS A;  3O3M B;  2EX3 B;  4PGQ A;  1URU A;  3EJP A;  2Z0O A;  2QKW A;  4R5K A;  3D51 A;  4NKT A;  1ZQK A;  2F7P A;  4AZ7 A;  4UB2 A;  4R64 A;  4DOB A;  8ICH A;  4R63 A;  3C2K A;  2ZHA A;  3Q84 A;  5J29 A;  4DCN C;  1OAO A;  9ICR A;  4DOA A;  4IQU A;  3LMF A;  4NPH A;  1UET A;  5BOM A;  4KM5 A;  4IM3 A;  2D1L A;  4FHY A;  2DRA A;  1ZWW A;  2FYV A;  2VAN A;  4WC5 A;  4JNF A;  1ZQZ A;  2WYI A;  3VKH A;  4JL9 A;  2ZH2 A;  9ICU A;  2M2V A;  3B0Y A;  4KLH A;  3BVU A;  1Q78 A;  4M0A A;  9ICV A;  4UD4 A;  2M2W A;  3MBY A;  8ICT A;  4QZI A;  4IM2 A;  4PH5 A;  5TKY A;  2NCZ A;  4I2G A;  1R8C A;  1ZQU A;  4RQ6 A;  3T4A G;  1R34 A;  2PFQ A;  4K96 A;  4WC7 A;  1RPL A;  4EEB A;  2PBE A;  2X3V A;  5J0W A;  2ZH3 A;  1ZQS A;  1I4D A;  4R5G A;  4LZD A;  3UQ0 A;  5EOZ A;  5DBC A;  3D52 A;  3L3O M;  1DKX A;  4TUP A;  2YL6 A;  5CFS A;  4YMM A;  4EZO A;  1LQ7 A;  4OAH A;  1ZQJ A;  2BCS A;  2Q13 A;  1TFW A;  1ZYL A;  4M5D A;  5J2B A;  3NKU A;  4E3C A;  4X4N A;  3H37 A;  5HRB A;  4WC1 A;  1XSP A;  3RH5 A;  5J2G A;  1BPE A;  1TQT A;  3DDG A;  5D49 A;  7ICI A;  3OK8 A;  3HIY A;  4X0B A;  8ICS A;  3EJR A;  3K75 D;  4HR1 A;  3B53 X;  2FMQ A;  2Z8Y A;  2GAF D;  4NY8 A;  5III A;  3HAJ A;  1DKZ A;  4F01 A;  1ZQL A;  3C5F A;  4ATB B;  1KDH A;  4UB5 A;  9ICS A;  4IQT A;  8ICW A;  2HN1 A;  2ISO A; 
#chains in the Genus database with same CATH homology
 1GPJ A;  4D8J A;  4HY9 A;  4IWO A;  2OBL A;  4EZT A;  4JLZ A;  3B51 X;  4OAF A;  3GI7 A;  4EZR A;  1MJG A;  1U00 A;  4KIK B;  5FIG A;  5E84 A;  4JLX A;  1OA1 A;  2B51 A;  4IW0 A;  4M0M A;  4JNE A;  1JQK A;  4E81 A;  2ND1 A;  1W9M A;  4UDY X;  5CHE A;  4N7R A;  4R5J A;  1GNL A;  3VEB A;  4K98 A;  3FD9 A;  4EZV A;  4EZY A;  4EZP A;  4R5I A;  2YIB A;  3ZED A;  3D2F A;  3QNJ A;  3PHZ A;  4WQL A;  5CFT A;  4H6I A;  5CFU A;  2B4V A;  3B52 X;  4JWI A;  2GA9 D;  2ND0 A;  3A98 A;  3UIT A;  4EZZ A;  4FM3 A;  5D63 A;  1UPX A;  4HYB A;  3EF2 A;  4K8V A;  4K97 A;  3RV0 A;  2RT6 A;  5D62 A;  3KAW A;  4NXW A;  2OBM A;  4IWP A;  1E2U A;  2QFF A;  4LEZ A;  4JN4 A;  3C7N A;  2N3K A;  4JWE A;  4NXX A;  1GNT A;  1OA0 A;  4HR1 B;  2WIN M;  3O3M B;  2EX3 B;  3RV1 A;  1SU7 A;  3DPP A;  4R5K A;  3ER9 B;  2PY6 A;  5B3P A;  4EZU A;  4WQK A;  2IHO A;  4LEY A;  4WOY A;  3KDR A;  2YI8 A;  1OAO A;  4OAI Z;  4LEW A;  3LMF A;  4NPH A;  4KM5 A;  4EZX A;  4IM3 A;  3ER8 C;  4JWD A;  4G6Q A;  4O6A A;  3ERC C;  2QXL A;  1GN9 A;  3O3N B;  4JNF A;  4KIK A;  3I04 A;  3K7D A;  3VKH A;  4JL9 A;  4WH5 A;  4PO2 A;  3I01 A;  3OHX M;  4XJE A;  2YIA A;  4IM2 A;  4MKP A;  4K9A A;  1E1D A;  4EZN A;  4H6H A;  2NCZ A;  5TKY A;  3F7W A;  2YI9 A;  2FCL A;  4O67 A;  4JLC A;  4O68 A;  3T4A G;  4EZW A;  4NXU A;  4K9B A;  4K96 A;  4HX0 A;  2KHO A;  3T48 A;  4R5G A;  3KAV A;  4EZQ A;  2YIV X;  3L3O M;  1E9V A;  3OWG A;  1DKX A;  4KB6 A;  3D2E A;  4B9Q A;  5CFS A;  4EZO A;  2X5C A;  2LM0 A;  4OAH A;  2EWR A;  3QA8 A;  1DKY A;  1SUF A;  4R5L A;  1ZYL A;  4OAG A;  1SU8 A;  3T49 A;  4NXT A;  5FLE X;  3NKU A;  4E3C A;  2JNS A;  3DPO A;  3VEA A;  4IM0 A;  4FO1 A;  3T47 A;  2B56 A;  3MCR A;  4UDX X;  4HR1 A;  4NXV A;  4IWQ A;  3B53 X;  2Z8Y A;  2GAF D;  2EWF A;  5B3Q A;  1SU6 A;  3T46 A;  4F01 A;  1DKZ A;  4F00 A;  4LEV A;  4O69 A;  4K99 A;  3I39 X;  3O3O B;  4JWC A;  5D61 A;  3DPQ A;  4EZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...