2GA9D

Crystal structure of the heterodimeric vaccinia virus polyadenylate polymerase with bound atp-gamma-s
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
total genus 151
structure length 445
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
D PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2ga9D01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ga9D03
3OWGA 3ERCC 2GA9D 2GAFD 3ER8C 3ER9B
chains in the Genus database with same CATH superfamily
4D8JA 4K4GA 1SU6A 7ICLA 3LQCB 1F5AA 4EZSA 2ZHAA 3OGUA 1Q79A 2BCUA 3C2MA 3M3WA 7ICEA 2FCLA 3F7WA 1TQWA 3RJEA 4KLDA 4XA5A 4QZ8A 4LZGA 3LLLA 4IW0A 2V0OA 4EZWA 4KLTA 3BUDA 3HIYA 5D61A 4Z6EA 4RWOA 7ICUA 4AT9A 4JWNA 1V4AA 1ZQTA 2ISOA 5EOZA 1TVAA 2F7PA 5J2FA 4RQ8A 5DB8A 4KLFA 2ELBA 3BVTA 4WBZA 4O6AA 9ICXA 5J2AA 4NXTA 3EF2A 2Z0NA 4E81A 4S3NA 4HYBA 4FO6A 5BOLA 5C5BA 3NVOA 4I2IA 1HWWA 3BUPA 2M2UA 3D2EA 3AU2A 4F5RA 2YL5A 1ZQCA 3C5FA 4KLLA 3AQNA 7ICQA 4IQTA 4AZHA 2O0I1 3RJJA 5IINA 3AU6A 2BPGA 4PHEA 1Q78A 1I4LA 4QZAA 3UPQA 4FHWA 2Z8YA 2B51A 4ATBA 3C5GA 4QZBA 1TQUA 4M9HA 1ZQJA 4O5KA 1ZQRA 3Q84A 1GPJA 3DDGA 1NOMA 4NXVA 2BCVA 3I39X 5HRFA 4NXZA 1JQKA 4HY9A 8ICOA 3HJ4A 4AT8A 4I29A 9ICWA 4QZDA 1ZQPA 3NKUA 2B4VA 4F5NA 3EJQA 2ND1A 3C2KA 4DOAA 4PPXA 3BLBA 4EZRA 3WFQE 1ZQYA 4QZHA 1E9VA 5DBBA 4LT6A 3JPTA 4WBYA 4NXUA 3SOGA 4M0MA 4NM2A 4RQ4A 4LVSA 4IWOA 3H39A 2PFNA 2FYVA 5DB7A 4I0UA 1ZQAA 1R5EA 2BPCA 2ALWA 5BPCA 4YMNA 4FHXA 3ISCA 3KDRA 4LEWA 3MGHA 9ICUA 7ICKA 4UB5A 2YLAA 5D49A 1TFWA 1PS3A 4E80A 5HRLA 3JPQA 4I28A 9ICBA 2VANA 1PX5A 4I2EA 4IWPA 5J2HA 3WFSC 3DX0A 4UB2A 4XUSA 3O3OB 4YD1A 4UD5A 1KDHA 4EEDA 2F1BA 3CZNA 2F18A 2YIVX 4EZOA 4R5KA 3TFRA 9ICGA 4BNEA 4WQKA 4MKPA 9ICFA 3BUIA 5CWRA 5J2KA 4F5OA 2LM0A 4B9QA 3DX4A 9ICIA 4M0AA 4R65A 5J2CA 4X4PA 7ICSA 4I2DA 8ICFA 5TZVA 4AZ6A 1O7DC 4WC0A 5HRHA 2F7OA 4EBKA 4PO2A 4R5LA 9ICKA 4EZUA 8ICEA 4FO1A 4YMOA 3VEBA 1BPXA 4RQ6A 4R66A 1OA0A 4PGQA 8ICQA 4IM2A 1TFYA 9ICJA 4AZIA 4YN4A 5J2BA 2BBHA 3NWIA 1ZQWA 3DPOA 3K7DA 3HAHA 3WFPA 4DOBA 4DO9A 5HRKA 4WC5A 9ICOA 4TUSA 3DYTA 4IQVA 7ICIA 4X0AA 2ND0A 3V72A 4EZVA 2ZHBA 1XSLA 4RT3A 2FICA 5IIMA 1ZQEA 4KIKB 8ICYA 2ZXQA 3UQ2A 2P66A 5J0XA 5J2JA 3QE6A 1FA0A 2EWRA 3H3AA 1XSNA 9ICMA 4F5PA 3QA8A 5D62A 4UB1A 3EJTA 5HHIA 4I2BA 3LMFA 3PMLA 4WC3A 2PFOA 5DBAA 4NKUA 3DPPA 2WYIA 1KNYA 2QFFA 3ER9B 2X5CA 4UBBA 1SU7A 4UD4A 1GNTA 3ACOA 2M2TA 1R8BA 7ICPA 3SYVA 7ICOA 2HN1A 4I2GA 4AZGA 4YMMA 5J0RA 4IM0A 5CFUA 4KLSA 5IIOA 8ICHA 3EJPA 2FMSA 4OAFA 2YL8A 3ER8C 5J2IA 3EJSA 3OVSA 1MQ3A 3CVRA 3EJUA 3Q0KA 4JWEA 2PBEA 1TQSA 2PXIA 4RWNA 4PGXA 4EZNA 4KLIA 3ISDA 4JWDA 2WINM 4WC7A 4NPHA 5CFTA 2EFKA 2DRAA 2OO2A 2RAKA 3JPRA 4O69A 4AT9B 4WC4A 4EZZA 3LK9A 3AQMA 2BCSA 4XQ8A 2DVIA 4OAIZ 1UEVA 5CJ7A 4UAZA 3MCRA 5J0PA 4KLMA 4TURA 1QWUA 7ICGA 4X4QA 3JPPA 3GI7A 3T47A 4KLHA 3HAIA 1ZQFA 5DEDA 1E2UA 4JWIA 3K75D 1ZQMA 4E3CA 4JN4A 1ZYLA 5C5BB 4IQUA 1BPEA 1JQRA 4M04A 4UB3A 3BVVA 2IHOA 4WC1A 3L3OM 4K9AA 4R5GA 4QZCA 2PY6A 3OUYA 4JWCA 1I49A 4ATBB 4QZGA 3HW8A 4FH3A 4LEYA 8ICIA 3BUBA 4P4MA 3T48A 4R5IA 3ERCC 3VKHA 1ZQZA 3JYYA 5DDMA 5DKWA 2ZH9A 2DR7A 2FMQA 1QWNA 4WPCA 4ATMA 4NLZA 9ICEA 4K96A 2YIAA 2YKTA 3AQLA 4AT8B 5J0SA 3HAJA 2DRBA 3UPSA 2Q13A 2GA9D 3B52X 4Z6FA 3C18A 4E8FA 4F5QA 3OVBA 4O5CA 3JPSA 4FHVA 4R64A 4I2AA 4DCNC 1NO5A 3I2WA 4EGWA 2ZH2A 2NCZA 1OA1A 2OW6A 3O3MB 3UXOA 2BCRA 3RJIA 3D51A 3H37A 1ZQOA 7ICNA 1MIWA 4O68A 1ZWWA 4IM3A 4RT2A 2Q12A 1ZQQA 3FD9A 4IQWA 3OHXM 8ICGA 4RQ1A 4XRHA 1JN3A 5J0UA 7ICFA 8ICTA 2M2VA 4AZBA 7ICJA 4MFFA 3DX2A 2BBJA 5HRIA 8ICKA 5CFSA 3DX1A 1YLQA 4M47A 3WFOA 3O3NB 8ICRA 5HHHA 2PFPA 4MF2A 4X4OA 4JLCA 4FH5A 9ICPA 4EZYA 3TFSA 4PGYA 7ICTA 2IUBA 4JNFA 3MBYA 1R33A 5HRGA 4NLNA 4PH5A 1TV9A 1LQ7A 2O1PA 3CZSA 4Z6DA 4AVMA 5HC9A 4R63A 3RJKA 4O5EA 4MFCA 4KLQA 3DDFA 1RPLA 2OW7A 5J0TA 1ZQLA 1SU8A 1GN9A 5CA7A 2DR5A 4KLUA 4NLKA 4DYLA 3D52A 5DB9A 8ICSA 2RAIA 5HR9A 1ZQDA 2PFQA 4X4NA 4G6QA 4FZSA 3B53X 3RPMA 1GNLA 3GDXA 8ICNA 2RFFA 4LEVA 1R8AA 2QKWA 4FHPA 2EX3B 4RPYA 3WFRE 5J0QA 4Z6CA 1O7DB 2RAJA 1DKZA 3G9GA 4AZCA 4I27A 4EZQA 2D1LA 8ICVA 1HXKA 3PHZA 4EBJA 9ICHA 1JAJA 4HX0A 2HHPA 4I2HA 4R5JA 1UETA 3T49A 3UITA 5B3PA 4KB6A 3KAVA 2BPFA 2F7QA 3UXNA 4AZ5A 5B3QA 4H8SA 3OK8A 1R8CA 4RQ2A 2ZH6A 4M9GA 2OBMA 2PMRA 4KLEA 2EWFA 3CKDA 4N7RA 4JLXA 3RJHA 1TQTA 1DKXA 4AT7A 3ZEDA 4K8VA 8ICAA 3AQKA 3BVXA 4I1QA 1HUOA 2FMPA 8ICWA 4HR1A 5J0OA 3QNIA 5JTGA 3RJGA 8ICBA 2JNSA 2ZH7A 3MDCA 5BOMA 3HWTA 5CHEA 1Y2OA 7ICMA 1X04A 3I04A 4FHYA 1VFGA 4IG8A 2MI7A 1WOTA 5J0WA 8ICCA 9ICQA 2X3WA 3EJRA 4YD2A 2IHMA 5DECA 4EP7A 1ZQKA 5CB1A 3D4YA 1U00A 2X3XA 3B0YA 5E84A 1XSPA 4AZ7A 4NXXA 5J29A 4M9NA 1JMSA 5J2EA 4NM1A 8ICZA 3PLTA 5IIIA 7ICRA 3KAWA 4OAHA 5HREA 3D4ZA 4K9BA 4K98A 4QZIA 4X4TA 2YI8A 1X03A 4JWMA 2ZH1A 3C2LA 2M2WA 5DB6A 4TUQA 4M5DA 4I2CA 3BUQA 3JPNA 4EV6A 3PNCA 3OVAA 4XJEA 9ICRA 2OZNB 3A98A 4GXKA 3T4AG 4NKTA 4WC2A 4F01A 4O67A 4PHAA 4RQ7A 2F7RA 4EZTA 4IWQA 2GWSA 3L3PA 5IILA 5CHGA 3D2FA 3ISBA 3AUOA 2YIBA 4RPZA 4DOCA 2DR9A 2ZH4A 1MJGA 5TKYA 3LVTA 2W9MA 4EZPA 4RPXA 3BVUA 4OAGA 4JNEA 4YCXA 9ICCA 4M2YA 2WYHA 2ZH5A 1HTYA 1YWMA 4K97A 4QZEA 1WDZA 3OUYB 3C66A 2N3KA 4I2FA 1I4DA 8ICUA 1E1DA 1MIVA 4RQ3A 4GXIA 9ICSA 3B51X 4P2HA 4LZDA 8ICPA 5D63A 4WPEA 5CR0A 4KM5A 3DX3A 4M9LA 2QXLA 4QZ9A 4F00A 3T46A 4P4OA 5J2DA 4WCWA 4O9MA 5KBPA 4UBCA 1ZJMA 2DR8A 8ICLA 4TUPA 3OWGA 1R34A 2GF4A 2YLLA 1ZQVA 3V7JA 1BPZA 4X4VA 4FZOA 3JCFA 1BPDA 2OBLA 4FM3A 4RWQA 5CP2A 2I9GA 2YI9A 5FIGA 1DKYA 1RZTA 4EZXA 3JPOA 1I4TA 3I01A 2YL6A 1ZQSA 2GAFD 2Z0OA 5D4BA 1ZQXA 4KLOA 2D4CA 3D50A 1ZJNA 4JL9A 4EEBA 3RH6A 3OV7A 3L9DA 3V7LA 2YL9A 5IIKA 4X4SA 1BPBA 9ICVA 2KHOA 2BE3A 5HRDA 4NSWA 1ZQHA 2HN2A 2NRKA 2ID1A 3MDAA 7ICVA 2Q66A 4X4RA 4X4UA 3RV1A 2ZH8A 1ZQGA 3HJ1A 3RJFA 2C08A 1W9MA 4WH5A 4MFAA 2EFLA 4H6IA 4NXWA 3MGIA 2ZH3A 3HX0A 4X5VA 5J2GA 4KLJA 4WQLA 1KEJA 3VEAA 4UAYA 4MF8A 1BPYA 4UDXX 8ICMA 3B0XA 4K99A 1OAOA 1UPXA 7ICHA 1ZQIA 3DPQA 3UXPA 4PHPA 3RH5A 1MQ2A 3PMNA 9ICAA 4WOYA 1ZQBA 1ZQUA 4WC6A 2RT6A 5IIJA 4AZCB 3H38A 3JZ0A 4RQ0A 3CK6A 4K4IA 4NY8A 4E7XA 3QWEA 3QNJA 3V7KA 8ICXA 3ABHA 4NQIA 3RH4A 4X0BA 1SUFA 4FZPA 3BVWA 2X3VA 5FLEX 5HRBA 1URUA 4QZFA 3CV5A 5DBCA 9ICNA 1OU5A 3CAZA 4KIKA 2F1AA 4KLGA 2Z0VA 4XQ7A 4UAWA 2BCQA 4JLZA 5DDYA 2ISPA 1R89A 2LXYA 1VJ7A 1QX1A 4LEZA 9ICLA 8ICJA 4H6HA 2O5AA 1HUZA 4AT7B 3C7NA 4K4HA 1MIYA 4UDYX 4GXJA 4HR1B 4UB4A 4P4PA 5D46A 5J0YA 1TQVA 3RV0A 4RQ5A 2JNKA 5F2VO 4AKVA 3NYBA 2B56A 4RWPA 1ZQNA 4I2JA 9ICTA 4M9JA 4PHDA 3UQ0A 1UEUA
chains in the Genus database with same CATH topology
4D8JA 1SU6A 3O3NB 4EZSA 4JLCA 4EZYA 2ND0A 2N3KA 4EZVA 3F7WA 2FCLA 4JNFA 1E1DA 3B51X 4IW0A 4EZWA 5D63A 4KIKB 4KM5A 5D61A 2QXLA 4F00A 3T46A 2EWRA 4O6AA 3QA8A 5D62A 4NXTA 3LMFA 3OWGA 3EF2A 4E81A 1SU8A 1GN9A 3DPPA 2OBLA 4FM3A 4HYBA 2YI9A 5FIGA 1DKYA 2QFFA 4G6QA 4EZXA 3B53X 2X5CA 1GNLA 3ER9B 1SU7A 3D2EA 4LEVA 1GNTA 3I01A 2EX3B 2GAFD 1DKZA 4EZQA 4IM0A 2Z8YA 4JL9A 2B51A 3PHZA 5CFUA 4HX0A 4OAFA 3ER8C 4R5JA 1GPJA 3T49A 3UITA 5B3PA 4KB6A 4NXVA 3I39X 3KAVA 4JWEA 1JQKA 4HY9A 2KHOA 4EZNA 3NKUA 4JWDA 2B4VA 5B3QA 2WINM 2ND1A 4NPHA 5CFTA 2OBMA 3RV1A 4EZRA 2EWFA 1W9MA 4O69A 4EZZA 4JLXA 4N7RA 1E9VA 1DKXA 4WH5A 4OAIZ 4NXUA 4H6IA 3ZEDA 4K8VA 4M0MA 3MCRA 4NXWA 4IWOA 4HR1A 3GI7A 3T47A 4WQLA 3VEAA 2JNSA 1E2UA 4JWIA 4UDXX 5CHEA 4E3CA 3KDRA 1ZYLA 4JN4A 4LEWA 3I04A 4K99A 1OAOA 1UPXA 3DPQA 2IHOA 4WOYA 3L3OM 2RT6A 4K9AA 4IWPA 4R5GA 2PY6A 4JWCA 1U00A 3QNJA 3O3OB 5E84A 4LEYA 4NXXA 3T48A 1SUFA 4R5IA 3ERCC 3VKHA 5FLEX 2YIVX 3KAWA 4EZOA 4OAHA 4K9BA 4R5KA 4K98A 4K96A 2YIAA 4WQKA 4KIKA 4MKPA 2YI8A 2GA9D 3B52X 4JLZA 2LM0A 4B9QA 4XJEA 4LEZA 3A98A 2NCZA 4H6HA 1OA1A 3O3MB 3T4AG 3C7NA 4UDYX 4F01A 4O67A 4PO2A 4O68A 4R5LA 4EZTA 4IM3A 4IWQA 4EZUA 4HR1B 3FD9A 3OHXM 4FO1A 3D2FA 2YIBA 3VEBA 3RV0A 1OA0A 1MJGA 4IM2A 5TKYA 2B56A 4EZPA 4OAGA 4JNEA 3DPOA 3K7DA 4K97A 5CFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWG A;  3ERC C;  2GA9 D;  2GAF D;  3ER8 C;  3ER9 B; 
#chains in the Genus database with same CATH topology
 4D8J A;  4K4G A;  1SU6 A;  7ICL A;  3LQC B;  1F5A A;  4EZS A;  2ZHA A;  3OGU A;  1Q79 A;  2BCU A;  3C2M A;  3M3W A;  7ICE A;  2FCL A;  3F7W A;  1TQW A;  3RJE A;  4KLD A;  4XA5 A;  4QZ8 A;  4LZG A;  3LLL A;  4IW0 A;  2V0O A;  4EZW A;  4KLT A;  3BUD A;  3HIY A;  5D61 A;  4Z6E A;  4RWO A;  7ICU A;  4AT9 A;  4JWN A;  1V4A A;  1ZQT A;  2ISO A;  5EOZ A;  1TVA A;  2F7P A;  5J2F A;  4RQ8 A;  5DB8 A;  4KLF A;  2ELB A;  3BVT A;  4WBZ A;  4O6A A;  9ICX A;  5J2A A;  4NXT A;  3EF2 A;  2Z0N A;  4E81 A;  4S3N A;  4HYB A;  4FO6 A;  5BOL A;  5C5B A;  3NVO A;  4I2I A;  1HWW A;  3BUP A;  2M2U A;  3D2E A;  3AU2 A;  4F5R A;  2YL5 A;  1ZQC A;  3C5F A;  4KLL A;  3AQN A;  7ICQ A;  4IQT A;  4AZH A;  2O0I 1;  3RJJ A;  5IIN A;  3AU6 A;  2BPG A;  4PHE A;  1Q78 A;  1I4L A;  4QZA A;  3UPQ A;  4FHW A;  2Z8Y A;  2B51 A;  4ATB A;  3C5G A;  4QZB A;  1TQU A;  4M9H A;  1ZQJ A;  4O5K A;  1ZQR A;  3Q84 A;  1GPJ A;  3DDG A;  1NOM A;  4NXV A;  2BCV A;  3I39 X;  5HRF A;  4NXZ A;  1JQK A;  4HY9 A;  8ICO A;  3HJ4 A;  4AT8 A;  4I29 A;  9ICW A;  4QZD A;  1ZQP A;  3NKU A;  2B4V A;  4F5N A;  3EJQ A;  2ND1 A;  3C2K A;  4DOA A;  4PPX A;  3BLB A;  4EZR A;  3WFQ E;  1ZQY A;  4QZH A;  1E9V A;  5DBB A;  4LT6 A;  3JPT A;  4WBY A;  4NXU A;  3SOG A;  4M0M A;  4NM2 A;  4RQ4 A;  4LVS A;  4IWO A;  3H39 A;  2PFN A;  2FYV A;  5DB7 A;  4I0U A;  1ZQA A;  1R5E A;  2BPC A;  2ALW A;  5BPC A;  4YMN A;  4FHX A;  3ISC A;  3KDR A;  4LEW A;  3MGH A;  9ICU A;  7ICK A;  4UB5 A;  2YLA A;  5D49 A;  1TFW A;  1PS3 A;  4E80 A;  5HRL A;  3JPQ A;  4I28 A;  9ICB A;  2VAN A;  1PX5 A;  4I2E A;  4IWP A;  5J2H A;  3WFS C;  3DX0 A;  4UB2 A;  4XUS A;  3O3O B;  4YD1 A;  4UD5 A;  1KDH A;  4EED A;  2F1B A;  3CZN A;  2F18 A;  2YIV X;  4EZO A;  4R5K A;  3TFR A;  9ICG A;  4BNE A;  4WQK A;  4MKP A;  9ICF A;  3BUI A;  5CWR A;  5J2K A;  4F5O A;  2LM0 A;  4B9Q A;  3DX4 A;  9ICI A;  4M0A A;  4R65 A;  5J2C A;  4X4P A;  7ICS A;  4I2D A;  8ICF A;  5TZV A;  4AZ6 A;  1O7D C;  4WC0 A;  5HRH A;  2F7O A;  4EBK A;  4PO2 A;  4R5L A;  9ICK A;  4EZU A;  8ICE A;  4FO1 A;  4YMO A;  3VEB A;  1BPX A;  4RQ6 A;  4R66 A;  1OA0 A;  4PGQ A;  8ICQ A;  4IM2 A;  1TFY A;  9ICJ A;  4AZI A;  4YN4 A;  5J2B A;  2BBH A;  3NWI A;  1ZQW A;  3DPO A;  3K7D A;  3HAH A;  3WFP A;  4DOB A;  4DO9 A;  5HRK A;  4WC5 A;  9ICO A;  4TUS A;  3DYT A;  4IQV A;  7ICI A;  4X0A A;  2ND0 A;  3V72 A;  4EZV A;  2ZHB A;  1XSL A;  4RT3 A;  2FIC A;  5IIM A;  1ZQE A;  4KIK B;  8ICY A;  2ZXQ A;  3UQ2 A;  2P66 A;  5J0X A;  5J2J A;  3QE6 A;  1FA0 A;  2EWR A;  3H3A A;  1XSN A;  9ICM A;  4F5P A;  3QA8 A;  5D62 A;  4UB1 A;  3EJT A;  5HHI A;  4I2B A;  3LMF A;  3PML A;  4WC3 A;  2PFO A;  5DBA A;  4NKU A;  3DPP A;  2WYI A;  1KNY A;  2QFF A;  3ER9 B;  2X5C A;  4UBB A;  1SU7 A;  4UD4 A;  1GNT A;  3ACO A;  2M2T A;  1R8B A;  7ICP A;  3SYV A;  7ICO A;  2HN1 A;  4I2G A;  4AZG A;  4YMM A;  5J0R A;  4IM0 A;  5CFU A;  4KLS A;  5IIO A;  8ICH A;  3EJP A;  2FMS A;  4OAF A;  2YL8 A;  3ER8 C;  5J2I A;  3EJS A;  3OVS A;  1MQ3 A;  3CVR A;  3EJU A;  3Q0K A;  4JWE A;  2PBE A;  1TQS A;  2PXI A;  4RWN A;  4PGX A;  4EZN A;  4KLI A;  3ISD A;  4JWD A;  2WIN M;  4WC7 A;  4NPH A;  5CFT A;  2EFK A;  2DRA A;  2OO2 A;  2RAK A;  3JPR A;  4O69 A;  4AT9 B;  4WC4 A;  4EZZ A;  3LK9 A;  3AQM A;  2BCS A;  4XQ8 A;  2DVI A;  4OAI Z;  1UEV A;  5CJ7 A;  4UAZ A;  3MCR A;  5J0P A;  4KLM A;  4TUR A;  1QWU A;  7ICG A;  4X4Q A;  3JPP A;  3GI7 A;  3T47 A;  4KLH A;  3HAI A;  1ZQF A;  5DED A;  1E2U A;  4JWI A;  3K75 D;  1ZQM A;  4E3C A;  4JN4 A;  1ZYL A;  5C5B B;  4IQU A;  1BPE A;  1JQR A;  4M04 A;  4UB3 A;  3BVV A;  2IHO A;  4WC1 A;  3L3O M;  4K9A A;  4R5G A;  4QZC A;  2PY6 A;  3OUY A;  4JWC A;  1I49 A;  4ATB B;  4QZG A;  3HW8 A;  4FH3 A;  4LEY A;  8ICI A;  3BUB A;  4P4M A;  3T48 A;  4R5I A;  3ERC C;  3VKH A;  1ZQZ A;  3JYY A;  5DDM A;  5DKW A;  2ZH9 A;  2DR7 A;  2FMQ A;  1QWN A;  4WPC A;  4ATM A;  4NLZ A;  9ICE A;  4K96 A;  2YIA A;  2YKT A;  3AQL A;  4AT8 B;  5J0S A;  3HAJ A;  2DRB A;  3UPS A;  2Q13 A;  2GA9 D;  3B52 X;  4Z6F A;  3C18 A;  4E8F A;  4F5Q A;  3OVB A;  4O5C A;  3JPS A;  4FHV A;  4R64 A;  4I2A A;  4DCN C;  1NO5 A;  3I2W A;  4EGW A;  2ZH2 A;  2NCZ A;  1OA1 A;  2OW6 A;  3O3M B;  3UXO A;  2BCR A;  3RJI A;  3D51 A;  3H37 A;  1ZQO A;  7ICN A;  1MIW A;  4O68 A;  1ZWW A;  4IM3 A;  4RT2 A;  2Q12 A;  1ZQQ A;  3FD9 A;  4IQW A;  3OHX M;  8ICG A;  4RQ1 A;  4XRH A;  1JN3 A;  5J0U A;  7ICF A;  8ICT A;  2M2V A;  4AZB A;  7ICJ A;  4MFF A;  3DX2 A;  2BBJ A;  5HRI A;  8ICK A;  5CFS A;  3DX1 A;  1YLQ A;  4M47 A;  3WFO A;  3O3N B;  8ICR A;  5HHH A;  2PFP A;  4MF2 A;  4X4O A;  4JLC A;  4FH5 A;  9ICP A;  4EZY A;  3TFS A;  4PGY A;  7ICT A;  2IUB A;  4JNF A;  3MBY A;  1R33 A;  5HRG A;  4NLN A;  4PH5 A;  1TV9 A;  1LQ7 A;  2O1P A;  3CZS A;  4Z6D A;  4AVM A;  5HC9 A;  4R63 A;  3RJK A;  4O5E A;  4MFC A;  4KLQ A;  3DDF A;  1RPL A;  2OW7 A;  5J0T A;  1ZQL A;  1SU8 A;  1GN9 A;  5CA7 A;  2DR5 A;  4KLU A;  4NLK A;  4DYL A;  3D52 A;  5DB9 A;  8ICS A;  2RAI A;  5HR9 A;  1ZQD A;  2PFQ A;  4X4N A;  4G6Q A;  4FZS A;  3B53 X;  3RPM A;  1GNL A;  3GDX A;  8ICN A;  2RFF A;  4LEV A;  1R8A A;  2QKW A;  4FHP A;  2EX3 B;  4RPY A;  3WFR E;  5J0Q A;  4Z6C A;  1O7D B;  2RAJ A;  1DKZ A;  3G9G A;  4AZC A;  4I27 A;  4EZQ A;  2D1L A;  8ICV A;  1HXK A;  3PHZ A;  4EBJ A;  9ICH A;  1JAJ A;  4HX0 A;  2HHP A;  4I2H A;  4R5J A;  1UET A;  3T49 A;  3UIT A;  5B3P A;  4KB6 A;  3KAV A;  2BPF A;  2F7Q A;  3UXN A;  4AZ5 A;  5B3Q A;  4H8S A;  3OK8 A;  1R8C A;  4RQ2 A;  2ZH6 A;  4M9G A;  2OBM A;  2PMR A;  4KLE A;  2EWF A;  3CKD A;  4N7R A;  4JLX A;  3RJH A;  1TQT A;  1DKX A;  4AT7 A;  3ZED A;  4K8V A;  8ICA A;  3AQK A;  3BVX A;  4I1Q A;  1HUO A;  2FMP A;  8ICW A;  4HR1 A;  5J0O A;  3QNI A;  5JTG A;  3RJG A;  8ICB A;  2JNS A;  2ZH7 A;  3MDC A;  5BOM A;  3HWT A;  5CHE A;  1Y2O A;  7ICM A;  1X04 A;  3I04 A;  4FHY A;  1VFG A;  4IG8 A;  2MI7 A;  1WOT A;  5J0W A;  8ICC A;  9ICQ A;  2X3W A;  3EJR A;  4YD2 A;  2IHM A;  5DEC A;  4EP7 A;  1ZQK A;  5CB1 A;  3D4Y A;  1U00 A;  2X3X A;  3B0Y A;  5E84 A;  1XSP A;  4AZ7 A;  4NXX A;  5J29 A;  4M9N A;  1JMS A;  5J2E A;  4NM1 A;  8ICZ A;  3PLT A;  5III A;  7ICR A;  3KAW A;  4OAH A;  5HRE A;  3D4Z A;  4K9B A;  4K98 A;  4QZI A;  4X4T A;  2YI8 A;  1X03 A;  4JWM A;  2ZH1 A;  3C2L A;  2M2W A;  5DB6 A;  4TUQ A;  4M5D A;  4I2C A;  3BUQ A;  3JPN A;  4EV6 A;  3PNC A;  3OVA A;  4XJE A;  9ICR A;  2OZN B;  3A98 A;  4GXK A;  3T4A G;  4NKT A;  4WC2 A;  4F01 A;  4O67 A;  4PHA A;  4RQ7 A;  2F7R A;  4EZT A;  4IWQ A;  2GWS A;  3L3P A;  5IIL A;  5CHG A;  3D2F A;  3ISB A;  3AUO A;  2YIB A;  4RPZ A;  4DOC A;  2DR9 A;  2ZH4 A;  1MJG A;  5TKY A;  3LVT A;  2W9M A;  4EZP A;  4RPX A;  3BVU A;  4OAG A;  4JNE A;  4YCX A;  9ICC A;  4M2Y A;  2WYH A;  2ZH5 A;  1HTY A;  1YWM A;  4K97 A;  4QZE A;  1WDZ A;  3OUY B;  3C66 A;  2N3K A;  4I2F A;  1I4D A;  8ICU A;  1E1D A;  1MIV A;  4RQ3 A;  4GXI A;  9ICS A;  3B51 X;  4P2H A;  4LZD A;  8ICP A;  5D63 A;  4WPE A;  5CR0 A;  4KM5 A;  3DX3 A;  4M9L A;  2QXL A;  4QZ9 A;  4F00 A;  3T46 A;  4P4O A;  5J2D A;  4WCW A;  4O9M A;  5KBP A;  4UBC A;  1ZJM A;  2DR8 A;  8ICL A;  4TUP A;  3OWG A;  1R34 A;  2GF4 A;  2YLL A;  1ZQV A;  3V7J A;  1BPZ A;  4X4V A;  4FZO A;  3JCF A;  1BPD A;  2OBL A;  4FM3 A;  4RWQ A;  5CP2 A;  2I9G A;  2YI9 A;  5FIG A;  1DKY A;  1RZT A;  4EZX A;  3JPO A;  1I4T A;  3I01 A;  2YL6 A;  1ZQS A;  2GAF D;  2Z0O A;  5D4B A;  1ZQX A;  4KLO A;  2D4C A;  3D50 A;  1ZJN A;  4JL9 A;  4EEB A;  3RH6 A;  3OV7 A;  3L9D A;  3V7L A;  2YL9 A;  5IIK A;  4X4S A;  1BPB A;  9ICV A;  2KHO A;  2BE3 A;  5HRD A;  4NSW A;  1ZQH A;  2HN2 A;  2NRK A;  2ID1 A;  3MDA A;  7ICV A;  2Q66 A;  4X4R A;  4X4U A;  3RV1 A;  2ZH8 A;  1ZQG A;  3HJ1 A;  3RJF A;  2C08 A;  1W9M A;  4WH5 A;  4MFA A;  2EFL A;  4H6I A;  4NXW A;  3MGI A;  2ZH3 A;  3HX0 A;  4X5V A;  5J2G A;  4KLJ A;  4WQL A;  1KEJ A;  3VEA A;  4UAY A;  4MF8 A;  1BPY A;  4UDX X;  8ICM A;  3B0X A;  4K99 A;  1OAO A;  1UPX A;  7ICH A;  1ZQI A;  3DPQ A;  3UXP A;  4PHP A;  3RH5 A;  1MQ2 A;  3PMN A;  9ICA A;  4WOY A;  1ZQB A;  1ZQU A;  4WC6 A;  2RT6 A;  5IIJ A;  4AZC B;  3H38 A;  3JZ0 A;  4RQ0 A;  3CK6 A;  4K4I A;  4NY8 A;  4E7X A;  3QWE A;  3QNJ A;  3V7K A;  8ICX A;  3ABH A;  4NQI A;  3RH4 A;  4X0B A;  1SUF A;  4FZP A;  3BVW A;  2X3V A;  5FLE X;  5HRB A;  1URU A;  4QZF A;  3CV5 A;  5DBC A;  9ICN A;  1OU5 A;  3CAZ A;  4KIK A;  2F1A A;  4KLG A;  2Z0V A;  4XQ7 A;  4UAW A;  2BCQ A;  4JLZ A;  5DDY A;  2ISP A;  1R89 A;  2LXY A;  1VJ7 A;  1QX1 A;  4LEZ A;  9ICL A;  8ICJ A;  4H6H A;  2O5A A;  1HUZ A;  4AT7 B;  3C7N A;  4K4H A;  1MIY A;  4UDY X;  4GXJ A;  4HR1 B;  4UB4 A;  4P4P A;  5D46 A;  5J0Y A;  1TQV A;  3RV0 A;  4RQ5 A;  2JNK A;  5F2V O;  4AKV A;  3NYB A;  2B56 A;  4RWP A;  1ZQN A;  4I2J A;  9ICT A;  4M9J A;  4PHD A;  3UQ0 A;  1UEU A; 
#chains in the Genus database with same CATH homology
 4D8J A;  1SU6 A;  3O3N B;  4EZS A;  4JLC A;  4EZY A;  2ND0 A;  2N3K A;  4EZV A;  3F7W A;  2FCL A;  4JNF A;  1E1D A;  3B51 X;  4IW0 A;  4EZW A;  5D63 A;  4KIK B;  4KM5 A;  5D61 A;  2QXL A;  4F00 A;  3T46 A;  2EWR A;  4O6A A;  3QA8 A;  5D62 A;  4NXT A;  3LMF A;  3OWG A;  3EF2 A;  4E81 A;  1SU8 A;  1GN9 A;  3DPP A;  2OBL A;  4FM3 A;  4HYB A;  2YI9 A;  5FIG A;  1DKY A;  2QFF A;  4G6Q A;  4EZX A;  3B53 X;  2X5C A;  1GNL A;  3ER9 B;  1SU7 A;  3D2E A;  4LEV A;  1GNT A;  3I01 A;  2EX3 B;  2GAF D;  1DKZ A;  4EZQ A;  4IM0 A;  2Z8Y A;  4JL9 A;  2B51 A;  3PHZ A;  5CFU A;  4HX0 A;  4OAF A;  3ER8 C;  4R5J A;  1GPJ A;  3T49 A;  3UIT A;  5B3P A;  4KB6 A;  4NXV A;  3I39 X;  3KAV A;  4JWE A;  1JQK A;  4HY9 A;  2KHO A;  4EZN A;  3NKU A;  4JWD A;  2B4V A;  5B3Q A;  2WIN M;  2ND1 A;  4NPH A;  5CFT A;  2OBM A;  3RV1 A;  4EZR A;  2EWF A;  1W9M A;  4O69 A;  4EZZ A;  4JLX A;  4N7R A;  1E9V A;  1DKX A;  4WH5 A;  4OAI Z;  4NXU A;  4H6I A;  3ZED A;  4K8V A;  4M0M A;  3MCR A;  4NXW A;  4IWO A;  4HR1 A;  3GI7 A;  3T47 A;  4WQL A;  3VEA A;  2JNS A;  1E2U A;  4JWI A;  4UDX X;  5CHE A;  4E3C A;  3KDR A;  1ZYL A;  4JN4 A;  4LEW A;  3I04 A;  4K99 A;  1OAO A;  1UPX A;  3DPQ A;  2IHO A;  4WOY A;  3L3O M;  2RT6 A;  4K9A A;  4IWP A;  4R5G A;  2PY6 A;  4JWC A;  1U00 A;  3QNJ A;  3O3O B;  5E84 A;  4LEY A;  4NXX A;  3T48 A;  1SUF A;  4R5I A;  3ERC C;  3VKH A;  5FLE X;  2YIV X;  3KAW A;  4EZO A;  4OAH A;  4K9B A;  4R5K A;  4K98 A;  4K96 A;  2YIA A;  4WQK A;  4KIK A;  4MKP A;  2YI8 A;  2GA9 D;  3B52 X;  4JLZ A;  2LM0 A;  4B9Q A;  4XJE A;  4LEZ A;  3A98 A;  2NCZ A;  4H6H A;  1OA1 A;  3O3M B;  3T4A G;  3C7N A;  4UDY X;  4F01 A;  4O67 A;  4PO2 A;  4O68 A;  4R5L A;  4EZT A;  4IM3 A;  4IWQ A;  4EZU A;  4HR1 B;  3FD9 A;  3OHX M;  4FO1 A;  3D2F A;  2YIB A;  3VEB A;  3RV0 A;  1OA0 A;  1MJG A;  4IM2 A;  5TKY A;  2B56 A;  4EZP A;  4OAG A;  4JNE A;  3DPO A;  3K7D A;  4K97 A;  5CFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...