2GA9D

Crystal structure of the heterodimeric vaccinia virus polyadenylate polymerase with bound atp-gamma-s
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 151
structure length 445
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
D PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2ga9D01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ga9D03
3ER8C 2GAFD 2GA9D 3ERCC 3ER9B 3OWGA
chains in the Genus database with same CATH superfamily
3C2MA 4WC1A 2X5CA 8ICSA 2Z0VA 3T4AG 4RWPA 4KLDA 1E9VA 4WCWA 1JAJA 3C5GA 3D4ZA 2D1LA 1GNLA 3BLBA 1ZQOA 5DB6A 4P2HA 1I4DA 1ZQRA 4AZ6A 2DR8A 8ICVA 3MGHA 2HN1A 4YD2A 4UB3A 3AUOA 4KLJA 1TQSA 4Z6DA 4X4TA 4K9AA 2GAFD 4BNEA 4NQIA 2M2WA 1ZWWA 2PFNA 1I4LA 3ACOA 2F7OA 3ER9B 5J0OA 4P4MA 3OUYB 4K98A 4KLSA 2YL5A 4O69A 4QZIA 2OW7A 2BBHA 5D46A 3I39X 4XUSA 9ICUA 3B51X 4UAZA 4EZYA 4X4VA 9ICWA 1SU8A 4R5JA 4NLNA 3SYVA 8ICEA 2ALWA 3RJEA 2DRAA 4AVMA 3HX0A 4FHXA 4KB6A 4EZVA 4OAHA 5J2KA 4KLOA 4NXZA 2ZHAA 3VEAA 4K99A 4IW0A 1O7DC 4I27A 8ICKA 1ZQYA 2BBJA 5J0UA 1R8AA 3JPQA 3C2KA 3CAZA 3BUQA 3BVWA 4XJEA 2IHOA 4FM3A 3SOGA 4KLFA 4K9BA 5B3PA 3A98A 2YKTA 3JPNA 4O5CA 4HX0A 4E80A 8ICIA 5F2VO 5HRFA 5TKYA 2YIBA 3DPQA 3T49A 3K7DA 4RQ7A 4RQ3A 1PX5A 2Z0NA 1ZQVA 1BPZA 3RJGA 3VEBA 1ZQPA 4M47A 4LEYA 3DX4A 4FHPA 1Q79A 4TUPA 4F5PA 3K75D 4WC4A 1ZQKA 9ICPA 3OWGA 4M2YA 7ICSA 1OA1A 4E7XA 1QWUA 2X3XA 1GPJA 4LEZA 8ICXA 8ICHA 4EZQA 4RPXA 2PFQA 3MGIA 5E84A 1HUOA 4X4UA 4O5EA 1TQTA 2FMSA 2O5AA 1KDHA 2LXYA 2WINM 4LT6A 3DPOA 3CZNA 3JYYA 4RPZA 4AT7B 3OUYA 3JZ0A 4RWQA 2ZH2A 3RH5A 4UBCA 1RPLA 5CFTA 4UAYA 4R63A 3DX1A 4QZBA 1MIVA 3ISCA 2F18A 4PHPA 4AKVA 1SU7A 1ZQBA 2B51A 4GXKA 2YL8A 4KIKA 5D49A 4KLLA 4R5KA 8ICJA 5C5BA 3DX0A 5HREA 3UXPA 2YLLA 1R33A 4FZOA 2BPFA 4FH3A 4KM5A 4WC5A 4JLCA 3DDGA 4FHVA 3V7LA 4P4PA 3C5FA 4P4OA 5DDMA 4I2GA 4K4GA 3HAHA 9ICAA 5CP2A 4XQ7A 3RH6A 5CA7A 3B52X 4JWMA 4WBYA 1KNYA 4F5QA 4RQ4A 2P66A 9ICHA 8ICYA 3AU2A 4ATBB 2O1PA 5BPCA 4ATMA 3ISDA 4I2CA 4AT9B 4X4OA 4I2EA 1OU5A 7ICKA 2NCZA 2ND1A 3D2FA 4O6AA 4QZAA 2ND0A 3I2WA 1WOTA 4IM2A 4MF8A 4NLKA 4G6QA 4PHDA 2RAIA 4WPCA 1TVAA 2RAJA 3T47A 5HHHA 1W9MA 1GN9A 2Z8YA 5CHEA 4RPYA 1E2UA 2ZH1A 9ICRA 2QXLA 4QZCA 2N3KA 3JPPA 3DX3A 5IIMA 4M04A 4NSWA 4GXJA 1JQRA 2GA9D 1MQ2A 4KLHA 3HWTA 3BUBA 4RQ8A 4FHWA 4DOBA 4AZCA 4QZEA 3RV0A 4LEWA 4PGYA 3BUPA 5CFUA 4X4QA 1R8BA 5HRGA 4M9LA 4I29A 5TZVA 4I28A 1MJGA 1XSLA 1TV9A 8ICZA 1ZQTA 4AT8B 5HRLA 5J0PA 8ICGA 1ZQFA 3HIYA 2ZH9A 4RT3A 4FO6A 1HWWA 3CZSA 5EOZA 1ZQUA 1BPDA 3RV1A 3NWIA 1ZQGA 9ICOA 9ICTA 4JWNA 7ICFA 2FMQA 4R5GA 4QZFA 4NKUA 4RQ0A 2OBLA 2PY6A 7ICHA 3BVXA 2EWRA 2WYIA 3MDCA 2OZNB 1ZQSA 7ICMA 4EZUA 9ICGA 2WYHA 4R66A 1TQVA 3HAIA 5HR9A 5CWRA 4X4SA 5J2HA 7ICIA 3EJSA 8ICCA 4EZOA 3EJUA 4ATBA 4IWPA 4NXWA 4E3CA 2Q13A 4X0BA 5D62A 4JLZA 4WC3A 4AT8A 4HY9A 4DOCA 1JQKA 1ZQDA 5DECA 4MFAA 2F1AA 4AZ7A 5D61A 3G9GA 4QZHA 1UEUA 4O67A 4K96A 3UPQA 4I2AA 4IM3A 4QZGA 4PHAA 2ZH6A 4RWOA 4IWQA 5HRKA 4H6IA 8ICUA 5FIGA 2VANA 5J2BA 1X04A 4X4PA 4EZZA 1QX1A 4IQVA 1KEJA 1GNTA 4OAIZ 2YL9A 4WPEA 2BE3A 1ZQLA 3JPOA 9ICCA 3JPRA 1MIYA 3AQKA 4OAGA 3JPTA 4HR1A 2Q66A 4NY8A 4KLQA 5D63A 4JN4A 3H37A 1O7DB 5BOMA 2ISOA 5DB8A 4UB1A 3UXOA 4TURA 3PNCA 1ZQJA 2F7PA 2RAKA 3HAJA 4AZGA 3L3PA 3D52A 3MDAA 9ICKA 2BCSA 8ICQA 4YD1A 3ZEDA 4TUQA 3V7KA 3DPPA 3TFRA 1RZTA 4Z6EA 1HUZA 2DVIA 3DX2A 2GF4A 1OA0A 3CK6A 1PS3A 3OK8A 4E81A 2YIAA 3QNJA 3AQMA 5DBCA 1ZQWA 3KAVA 4K8VA 3B0XA 3BUDA 1MIWA 2F7QA 1UPXA 5J2JA 9ICIA 7ICRA 3AU6A 1TQUA 4DCNC 5DDYA 3Q0KA 3OHXM 4O68A 8ICTA 2PFPA 4EP7A 2DR7A 5HRDA 4XRHA 1UETA 4KLMA 9ICJA 1DKXA 3EJPA 5J0SA 8ICLA 4H8SA 3HJ1A 4EBJA 1ZQXA 4RQ2A 1R34A 1ZQQA 3RJKA 1TFYA 5C5BB 5IILA 4AZIA 4LZDA 3D2EA 5CR0A 3RH4A 4OAFA 7ICQA 5IIIA 2ZH8A 4EGWA 2IHMA 3T46A 2BPCA 4UBBA 3O3MB 3JCFA 4EZWA 1DKYA 2OBMA 3CKDA 2IUBA 4WOYA 3C7NA 2BCQA 8ICAA 5J0RA 4PH5A 4M9GA 4D8JA 4EZTA 3RPMA 4M5DA 1I4TA 2KHOA 3B53X 5HRHA 9ICFA 3ER8C 3EJQA 3JPSA 3C2LA 4IQWA 4H6HA 3NYBA 4M0AA 5DBAA 2FYVA 4EBKA 1UEVA 1Q78A 1ZQNA 1I49A 3OVSA 2X3WA 4WC2A 1SU6A 4WQLA 4NXVA 5CHGA 1ZQEA 2FICA 3LK9A 2F7RA 3WFQE 4K4HA 2F1BA 4K4IA 1YLQA 2ZHBA 7ICUA 5HRIA 5J0WA 3ISBA 4DOAA 3Q84A 3V72A 3UPSA 1TQWA 4NKTA 2YLAA 1HTYA 2EFKA 9ICSA 3UXNA 7ICJA 2ZH5A 2W9MA 4JWIA 2EX3B 1HXKA 2YIVX 2JNKA 2BPGA 4HYBA 4UDYX 4F00A 1VFGA 3QE6A 4YN4A 5HC9A 4MFFA 9ICBA 2QKWA 1V4AA 5J2CA 5J29A 2OO2A 3H39A 4X4NA 3WFPA 4XA5A 8ICMA 3I01A 3LLLA 3TFSA 3DYTA 5DBBA 1SUFA 1FA0A 4YMOA 3B0YA 3BVUA 2EWFA 3BUIA 3LVTA 3WFOA 5CJ7A 4XQ8A 4F01A 1NOMA 5CFSA 2DR5A 4AZ5A 1BPYA 4N7RA 4AZCB 1JN3A 4I0UA 4O5KA 1ZQMA 4IWOA 4EZXA 4MKPA 4JWCA 9ICNA 5IIOA 1BPEA 9ICMA 1MQ3A 2LM0A 4UB4A 7ICLA 5J2DA 3EJTA 3ERCC 1LQ7A 4AT7A 3WFSC 4EZSA 1R5EA 4Z6FA 2PBEA 2JNSA 3UQ0A 4F5NA 1R89A 5J0TA 4Z6CA 4KLEA 3LQCB 4AZHA 3O3NB 2FCLA 4FH5A 2GWSA 4NXUA 8ICFA 3ABHA 5IINA 1ZQHA 2C08A 4I2JA 4UD4A 4EEDA 4JNFA 3L3OM 3M3WA 4JNEA 4YCXA 8ICNA 9ICLA 2PMRA 4R65A 7ICOA 5DB7A 1ZQCA 5J2IA 3KDRA 1QWNA 3WFRE 3AQNA 5BOLA 7ICGA 3RJJA 4X4RA 2V0OA 2NRKA 4YMMA 3GDXA 3FD9A 4M9HA 4PGQA 4O9MA 3L9DA 2OW6A 4NLZA 4FO1A 3D50A 4I2DA 4IM0A 4PPXA 3V7JA 2O0I1 4NM1A 3F7WA 3CV5A 3VKHA 3AQLA 5CB1A 5J2EA 1NO5A 7ICTA 5B3QA 1ZJNA 3D4YA 2ID1A 3MCRA 2B56A 1ZJMA 4LEVA 4I2BA 4M9JA 3EJRA 4KLTA 7ICPA 4PHEA 1BPXA 5DEDA 3CVRA 4RT2A 4JWDA 4WQKA 4X0AA 4MFCA 2RFFA 1ZQIA 4K97A 1Y2OA 2M2TA 4EV6A 2D4CA 3EF2A 4WH5A 2BCVA 3KAWA 3QWEA 5J0QA 4JL9A 4S3NA 1E1DA 3NKUA 8ICRA 1DKZA 4FZSA 4MF2A 2BCRA 2ZH3A 5IIJA 3PHZA 3OV7A 4FHYA 1WDZA 4X5VA 4PO2A 1XSNA 3BVVA 1TFWA 8ICWA 3HJ4A 4R5LA 2DRBA 9ICVA 4TUSA 4UAWA 4DYLA 9ICQA 2HHPA 4WC6A 2I9GA 9ICEA 5FLEX 4KLGA 4R5IA 3BVTA 1ZQZA 8ICOA 2ZH7A 2Q12A 4M9NA 4EZRA 4YMNA 1URUA 2DR9A 4WC7A 3H3AA 3UQ2A 4UB5A 7ICNA 3T48A 3RJFA 2RT6A 3PMLA 4AZBA 4RWNA 4RQ1A 4NXTA 4NM2A 4F5OA 1XSPA 1R8CA 3O3OB 8ICPA 2MI7A 3LMFA 2Z0OA 2M2VA 4PGXA 3HW8A 4I2FA 2X3VA 3C18A 4NXXA 4QZ8A 4RQ5A 3NVOA 2ZXQA 8ICBA 4EZPA 7ICVA 1BPBA 4UD5A 3PLTA 4WBZA 5DB9A 4F5RA 4EEBA 4I2IA 3RJHA 4IQUA 4RQ6A 4GXIA 4M0MA 4LZGA 2YL6A 2M2UA 4KIKB 3GI7A 2QFFA 4JWEA 4UDXX 4JLXA 3MBYA 1F5AA 7ICEA 3QA8A 4HR1B 4UB2A 3D51A 2B4VA 2HN2A 5J0YA 3PMNA 3UITA 4QZ9A 2ZH4A 3OVBA 4LVSA 4EZNA 2YI8A 1YWMA 5D4BA 1U00A 5DKWA 4IG8A 4IQTA 5J2GA 5HRBA 4KLIA 1ZYLA 5J0XA 2ISPA 5IIKA 4FZPA 3H38A 3OGUA 9ICXA 2BCUA 4E8FA 4NPHA 4WC0A 4I2HA 1JMSA 4KLUA 1OAOA 4AT9A 2PFOA 5JTGA 2EFLA 2FMPA 2YI9A 4R64A 3QNIA 1VJ7A 3OVAA 1ZQAA 4QZDA 3I04A 2ELBA 4B9QA 1X03A 4I1QA 3DDFA 5J2FA 2PXIA 3C66A 5KBPA 3RJIA 5J2AA 4DO9A 5HHIA
chains in the Genus database with same CATH topology
2ND0A 4IM2A 2X5CA 4G6QA 3T4AG 3FD9A 1DKXA 1E9VA 3T47A 1W9MA 1GN9A 2Z8YA 5CHEA 1GNLA 1E2UA 4FO1A 2QXLA 4IM0A 3F7WA 2N3KA 3D2EA 3VKHA 4OAFA 3T46A 4K9AA 2GAFD 3O3MB 2GA9D 5B3QA 4EZWA 1DKYA 2OBMA 3MCRA 4WOYA 2B56A 3ER9B 3C7NA 4LEVA 4K98A 4O69A 3RV0A 4D8JA 4LEWA 4JWDA 4EZTA 3I39X 4WQKA 2KHOA 3B53X 5CFUA 4K97A 3B51X 4EZYA 1SU8A 4R5JA 3ER8C 3EF2A 4WH5A 1MJGA 3KAWA 4H6HA 4JL9A 1E1DA 3NKUA 1DKZA 4KB6A 4EZVA 4OAHA 3VEAA 4K99A 4IW0A 1SU6A 4WQLA 3PHZA 4NXVA 3RV1A 4PO2A 4XJEA 4R5GA 2IHOA 4FM3A 2OBLA 4O68A 4K9BA 5B3PA 3A98A 4R5LA 2PY6A 2EWRA 4HX0A 4EZUA 5FLEX 2YIBA 4R5IA 5TKYA 4JWIA 3DPQA 3T49A 3K7DA 2EX3B 4EZRA 2YIVX 4HYBA 3VEBA 4UDYX 4F00A 4LEYA 3T48A 2RT6A 4EZOA 4IWPA 4NXWA 4NXTA 4E3CA 5D62A 4JLZA 3OWGA 4HY9A 1JQKA 3O3OB 3LMFA 1OA1A 5D61A 4O67A 4K96A 1GPJA 3I01A 4IM3A 4LEZA 4EZQA 1SUFA 5E84A 4NXXA 4IWQA 4H6IA 4EZPA 2EWFA 5FIGA 3OHXM 4F01A 4EZZA 5CFSA 4N7RA 2WINM 1GNTA 3DPOA 4OAIZ 4IWOA 4M0MA 4EZXA 4MKPA 5CFTA 4KIKB 3GI7A 2QFFA 4JWEA 4JWCA 4UDXX 4JLXA 4OAGA 4HR1A 3QA8A 4HR1B 1SU7A 2B51A 2B4VA 5D63A 4JN4A 4KIKA 3UITA 2LM0A 4R5KA 4EZNA 2YI8A 3ERCC 1U00A 4EZSA 4KM5A 4JLCA 1ZYLA 2JNSA 4NPHA 3ZEDA 3DPPA 3O3NB 2FCLA 1OAOA 4NXUA 3B52X 1OA0A 2YI9A 4JNFA 3L3OM 2YIAA 3QNJA 4JNEA 4E81A 3I04A 4B9QA 3KAVA 4K8VA 1UPXA 3KDRA 2NCZA 2ND1A 3D2FA 4O6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ER8 C;  2GAF D;  2GA9 D;  3ERC C;  3ER9 B;  3OWG A; 
#chains in the Genus database with same CATH topology
 3C2M A;  4WC1 A;  2X5C A;  8ICS A;  2Z0V A;  3T4A G;  4RWP A;  4KLD A;  1E9V A;  4WCW A;  1JAJ A;  3C5G A;  3D4Z A;  2D1L A;  1GNL A;  3BLB A;  1ZQO A;  5DB6 A;  4P2H A;  1I4D A;  1ZQR A;  4AZ6 A;  2DR8 A;  8ICV A;  3MGH A;  2HN1 A;  4YD2 A;  4UB3 A;  3AUO A;  4KLJ A;  1TQS A;  4Z6D A;  4X4T A;  4K9A A;  2GAF D;  4BNE A;  4NQI A;  2M2W A;  1ZWW A;  2PFN A;  1I4L A;  3ACO A;  2F7O A;  3ER9 B;  5J0O A;  4P4M A;  3OUY B;  4K98 A;  4KLS A;  2YL5 A;  4O69 A;  4QZI A;  2OW7 A;  2BBH A;  5D46 A;  3I39 X;  4XUS A;  9ICU A;  3B51 X;  4UAZ A;  4EZY A;  4X4V A;  9ICW A;  1SU8 A;  4R5J A;  4NLN A;  3SYV A;  8ICE A;  2ALW A;  3RJE A;  2DRA A;  4AVM A;  3HX0 A;  4FHX A;  4KB6 A;  4EZV A;  4OAH A;  5J2K A;  4KLO A;  4NXZ A;  2ZHA A;  3VEA A;  4K99 A;  4IW0 A;  1O7D C;  4I27 A;  8ICK A;  1ZQY A;  2BBJ A;  5J0U A;  1R8A A;  3JPQ A;  3C2K A;  3CAZ A;  3BUQ A;  3BVW A;  4XJE A;  2IHO A;  4FM3 A;  3SOG A;  4KLF A;  4K9B A;  5B3P A;  3A98 A;  2YKT A;  3JPN A;  4O5C A;  4HX0 A;  4E80 A;  8ICI A;  5F2V O;  5HRF A;  5TKY A;  2YIB A;  3DPQ A;  3T49 A;  3K7D A;  4RQ7 A;  4RQ3 A;  1PX5 A;  2Z0N A;  1ZQV A;  1BPZ A;  3RJG A;  3VEB A;  1ZQP A;  4M47 A;  4LEY A;  3DX4 A;  4FHP A;  1Q79 A;  4TUP A;  4F5P A;  3K75 D;  4WC4 A;  1ZQK A;  9ICP A;  3OWG A;  4M2Y A;  7ICS A;  1OA1 A;  4E7X A;  1QWU A;  2X3X A;  1GPJ A;  4LEZ A;  8ICX A;  8ICH A;  4EZQ A;  4RPX A;  2PFQ A;  3MGI A;  5E84 A;  1HUO A;  4X4U A;  4O5E A;  1TQT A;  2FMS A;  2O5A A;  1KDH A;  2LXY A;  2WIN M;  4LT6 A;  3DPO A;  3CZN A;  3JYY A;  4RPZ A;  4AT7 B;  3OUY A;  3JZ0 A;  4RWQ A;  2ZH2 A;  3RH5 A;  4UBC A;  1RPL A;  5CFT A;  4UAY A;  4R63 A;  3DX1 A;  4QZB A;  1MIV A;  3ISC A;  2F18 A;  4PHP A;  4AKV A;  1SU7 A;  1ZQB A;  2B51 A;  4GXK A;  2YL8 A;  4KIK A;  5D49 A;  4KLL A;  4R5K A;  8ICJ A;  5C5B A;  3DX0 A;  5HRE A;  3UXP A;  2YLL A;  1R33 A;  4FZO A;  2BPF A;  4FH3 A;  4KM5 A;  4WC5 A;  4JLC A;  3DDG A;  4FHV A;  3V7L A;  4P4P A;  3C5F A;  4P4O A;  5DDM A;  4I2G A;  4K4G A;  3HAH A;  9ICA A;  5CP2 A;  4XQ7 A;  3RH6 A;  5CA7 A;  3B52 X;  4JWM A;  4WBY A;  1KNY A;  4F5Q A;  4RQ4 A;  2P66 A;  9ICH A;  8ICY A;  3AU2 A;  4ATB B;  2O1P A;  5BPC A;  4ATM A;  3ISD A;  4I2C A;  4AT9 B;  4X4O A;  4I2E A;  1OU5 A;  7ICK A;  2NCZ A;  2ND1 A;  3D2F A;  4O6A A;  4QZA A;  2ND0 A;  3I2W A;  1WOT A;  4IM2 A;  4MF8 A;  4NLK A;  4G6Q A;  4PHD A;  2RAI A;  4WPC A;  1TVA A;  2RAJ A;  3T47 A;  5HHH A;  1W9M A;  1GN9 A;  2Z8Y A;  5CHE A;  4RPY A;  1E2U A;  2ZH1 A;  9ICR A;  2QXL A;  4QZC A;  2N3K A;  3JPP A;  3DX3 A;  5IIM A;  4M04 A;  4NSW A;  4GXJ A;  1JQR A;  2GA9 D;  1MQ2 A;  4KLH A;  3HWT A;  3BUB A;  4RQ8 A;  4FHW A;  4DOB A;  4AZC A;  4QZE A;  3RV0 A;  4LEW A;  4PGY A;  3BUP A;  5CFU A;  4X4Q A;  1R8B A;  5HRG A;  4M9L A;  4I29 A;  5TZV A;  4I28 A;  1MJG A;  1XSL A;  1TV9 A;  8ICZ A;  1ZQT A;  4AT8 B;  5HRL A;  5J0P A;  8ICG A;  1ZQF A;  3HIY A;  2ZH9 A;  4RT3 A;  4FO6 A;  1HWW A;  3CZS A;  5EOZ A;  1ZQU A;  1BPD A;  3RV1 A;  3NWI A;  1ZQG A;  9ICO A;  9ICT A;  4JWN A;  7ICF A;  2FMQ A;  4R5G A;  4QZF A;  4NKU A;  4RQ0 A;  2OBL A;  2PY6 A;  7ICH A;  3BVX A;  2EWR A;  2WYI A;  3MDC A;  2OZN B;  1ZQS A;  7ICM A;  4EZU A;  9ICG A;  2WYH A;  4R66 A;  1TQV A;  3HAI A;  5HR9 A;  5CWR A;  4X4S A;  5J2H A;  7ICI A;  3EJS A;  8ICC A;  4EZO A;  3EJU A;  4ATB A;  4IWP A;  4NXW A;  4E3C A;  2Q13 A;  4X0B A;  5D62 A;  4JLZ A;  4WC3 A;  4AT8 A;  4HY9 A;  4DOC A;  1JQK A;  1ZQD A;  5DEC A;  4MFA A;  2F1A A;  4AZ7 A;  5D61 A;  3G9G A;  4QZH A;  1UEU A;  4O67 A;  4K96 A;  3UPQ A;  4I2A A;  4IM3 A;  4QZG A;  4PHA A;  2ZH6 A;  4RWO A;  4IWQ A;  5HRK A;  4H6I A;  8ICU A;  5FIG A;  2VAN A;  5J2B A;  1X04 A;  4X4P A;  4EZZ A;  1QX1 A;  4IQV A;  1KEJ A;  1GNT A;  4OAI Z;  2YL9 A;  4WPE A;  2BE3 A;  1ZQL A;  3JPO A;  9ICC A;  3JPR A;  1MIY A;  3AQK A;  4OAG A;  3JPT A;  4HR1 A;  2Q66 A;  4NY8 A;  4KLQ A;  5D63 A;  4JN4 A;  3H37 A;  1O7D B;  5BOM A;  2ISO A;  5DB8 A;  4UB1 A;  3UXO A;  4TUR A;  3PNC A;  1ZQJ A;  2F7P A;  2RAK A;  3HAJ A;  4AZG A;  3L3P A;  3D52 A;  3MDA A;  9ICK A;  2BCS A;  8ICQ A;  4YD1 A;  3ZED A;  4TUQ A;  3V7K A;  3DPP A;  3TFR A;  1RZT A;  4Z6E A;  1HUZ A;  2DVI A;  3DX2 A;  2GF4 A;  1OA0 A;  3CK6 A;  1PS3 A;  3OK8 A;  4E81 A;  2YIA A;  3QNJ A;  3AQM A;  5DBC A;  1ZQW A;  3KAV A;  4K8V A;  3B0X A;  3BUD A;  1MIW A;  2F7Q A;  1UPX A;  5J2J A;  9ICI A;  7ICR A;  3AU6 A;  1TQU A;  4DCN C;  5DDY A;  3Q0K A;  3OHX M;  4O68 A;  8ICT A;  2PFP A;  4EP7 A;  2DR7 A;  5HRD A;  4XRH A;  1UET A;  4KLM A;  9ICJ A;  1DKX A;  3EJP A;  5J0S A;  8ICL A;  4H8S A;  3HJ1 A;  4EBJ A;  1ZQX A;  4RQ2 A;  1R34 A;  1ZQQ A;  3RJK A;  1TFY A;  5C5B B;  5IIL A;  4AZI A;  4LZD A;  3D2E A;  5CR0 A;  3RH4 A;  4OAF A;  7ICQ A;  5III A;  2ZH8 A;  4EGW A;  2IHM A;  3T46 A;  2BPC A;  4UBB A;  3O3M B;  3JCF A;  4EZW A;  1DKY A;  2OBM A;  3CKD A;  2IUB A;  4WOY A;  3C7N A;  2BCQ A;  8ICA A;  5J0R A;  4PH5 A;  4M9G A;  4D8J A;  4EZT A;  3RPM A;  4M5D A;  1I4T A;  2KHO A;  3B53 X;  5HRH A;  9ICF A;  3ER8 C;  3EJQ A;  3JPS A;  3C2L A;  4IQW A;  4H6H A;  3NYB A;  4M0A A;  5DBA A;  2FYV A;  4EBK A;  1UEV A;  1Q78 A;  1ZQN A;  1I49 A;  3OVS A;  2X3W A;  4WC2 A;  1SU6 A;  4WQL A;  4NXV A;  5CHG A;  1ZQE A;  2FIC A;  3LK9 A;  2F7R A;  3WFQ E;  4K4H A;  2F1B A;  4K4I A;  1YLQ A;  2ZHB A;  7ICU A;  5HRI A;  5J0W A;  3ISB A;  4DOA A;  3Q84 A;  3V72 A;  3UPS A;  1TQW A;  4NKT A;  2YLA A;  1HTY A;  2EFK A;  9ICS A;  3UXN A;  7ICJ A;  2ZH5 A;  2W9M A;  4JWI A;  2EX3 B;  1HXK A;  2YIV X;  2JNK A;  2BPG A;  4HYB A;  4UDY X;  4F00 A;  1VFG A;  3QE6 A;  4YN4 A;  5HC9 A;  4MFF A;  9ICB A;  2QKW A;  1V4A A;  5J2C A;  5J29 A;  2OO2 A;  3H39 A;  4X4N A;  3WFP A;  4XA5 A;  8ICM A;  3I01 A;  3LLL A;  3TFS A;  3DYT A;  5DBB A;  1SUF A;  1FA0 A;  4YMO A;  3B0Y A;  3BVU A;  2EWF A;  3BUI A;  3LVT A;  3WFO A;  5CJ7 A;  4XQ8 A;  4F01 A;  1NOM A;  5CFS A;  2DR5 A;  4AZ5 A;  1BPY A;  4N7R A;  4AZC B;  1JN3 A;  4I0U A;  4O5K A;  1ZQM A;  4IWO A;  4EZX A;  4MKP A;  4JWC A;  9ICN A;  5IIO A;  1BPE A;  9ICM A;  1MQ3 A;  2LM0 A;  4UB4 A;  7ICL A;  5J2D A;  3EJT A;  3ERC C;  1LQ7 A;  4AT7 A;  3WFS C;  4EZS A;  1R5E A;  4Z6F A;  2PBE A;  2JNS A;  3UQ0 A;  4F5N A;  1R89 A;  5J0T A;  4Z6C A;  4KLE A;  3LQC B;  4AZH A;  3O3N B;  2FCL A;  4FH5 A;  2GWS A;  4NXU A;  8ICF A;  3ABH A;  5IIN A;  1ZQH A;  2C08 A;  4I2J A;  4UD4 A;  4EED A;  4JNF A;  3L3O M;  3M3W A;  4JNE A;  4YCX A;  8ICN A;  9ICL A;  2PMR A;  4R65 A;  7ICO A;  5DB7 A;  1ZQC A;  5J2I A;  3KDR A;  1QWN A;  3WFR E;  3AQN A;  5BOL A;  7ICG A;  3RJJ A;  4X4R A;  2V0O A;  2NRK A;  4YMM A;  3GDX A;  3FD9 A;  4M9H A;  4PGQ A;  4O9M A;  3L9D A;  2OW6 A;  4NLZ A;  4FO1 A;  3D50 A;  4I2D A;  4IM0 A;  4PPX A;  3V7J A;  2O0I 1;  4NM1 A;  3F7W A;  3CV5 A;  3VKH A;  3AQL A;  5CB1 A;  5J2E A;  1NO5 A;  7ICT A;  5B3Q A;  1ZJN A;  3D4Y A;  2ID1 A;  3MCR A;  2B56 A;  1ZJM A;  4LEV A;  4I2B A;  4M9J A;  3EJR A;  4KLT A;  7ICP A;  4PHE A;  1BPX A;  5DED A;  3CVR A;  4RT2 A;  4JWD A;  4WQK A;  4X0A A;  4MFC A;  2RFF A;  1ZQI A;  4K97 A;  1Y2O A;  2M2T A;  4EV6 A;  2D4C A;  3EF2 A;  4WH5 A;  2BCV A;  3KAW A;  3QWE A;  5J0Q A;  4JL9 A;  4S3N A;  1E1D A;  3NKU A;  8ICR A;  1DKZ A;  4FZS A;  4MF2 A;  2BCR A;  2ZH3 A;  5IIJ A;  3PHZ A;  3OV7 A;  4FHY A;  1WDZ A;  4X5V A;  4PO2 A;  1XSN A;  3BVV A;  1TFW A;  8ICW A;  3HJ4 A;  4R5L A;  2DRB A;  9ICV A;  4TUS A;  4UAW A;  4DYL A;  9ICQ A;  2HHP A;  4WC6 A;  2I9G A;  9ICE A;  5FLE X;  4KLG A;  4R5I A;  3BVT A;  1ZQZ A;  8ICO A;  2ZH7 A;  2Q12 A;  4M9N A;  4EZR A;  4YMN A;  1URU A;  2DR9 A;  4WC7 A;  3H3A A;  3UQ2 A;  4UB5 A;  7ICN A;  3T48 A;  3RJF A;  2RT6 A;  3PML A;  4AZB A;  4RWN A;  4RQ1 A;  4NXT A;  4NM2 A;  4F5O A;  1XSP A;  1R8C A;  3O3O B;  8ICP A;  2MI7 A;  3LMF A;  2Z0O A;  2M2V A;  4PGX A;  3HW8 A;  4I2F A;  2X3V A;  3C18 A;  4NXX A;  4QZ8 A;  4RQ5 A;  3NVO A;  2ZXQ A;  8ICB A;  4EZP A;  7ICV A;  1BPB A;  4UD5 A;  3PLT A;  4WBZ A;  5DB9 A;  4F5R A;  4EEB A;  4I2I A;  3RJH A;  4IQU A;  4RQ6 A;  4GXI A;  4M0M A;  4LZG A;  2YL6 A;  2M2U A;  4KIK B;  3GI7 A;  2QFF A;  4JWE A;  4UDX X;  4JLX A;  3MBY A;  1F5A A;  7ICE A;  3QA8 A;  4HR1 B;  4UB2 A;  3D51 A;  2B4V A;  2HN2 A;  5J0Y A;  3PMN A;  3UIT A;  4QZ9 A;  2ZH4 A;  3OVB A;  4LVS A;  4EZN A;  2YI8 A;  1YWM A;  5D4B A;  1U00 A;  5DKW A;  4IG8 A;  4IQT A;  5J2G A;  5HRB A;  4KLI A;  1ZYL A;  5J0X A;  2ISP A;  5IIK A;  4FZP A;  3H38 A;  3OGU A;  9ICX A;  2BCU A;  4E8F A;  4NPH A;  4WC0 A;  4I2H A;  1JMS A;  4KLU A;  1OAO A;  4AT9 A;  2PFO A;  5JTG A;  2EFL A;  2FMP A;  2YI9 A;  4R64 A;  3QNI A;  1VJ7 A;  3OVA A;  1ZQA A;  4QZD A;  3I04 A;  2ELB A;  4B9Q A;  1X03 A;  4I1Q A;  3DDF A;  5J2F A;  2PXI A;  3C66 A;  5KBP A;  3RJI A;  5J2A A;  4DO9 A;  5HHI A; 
#chains in the Genus database with same CATH homology
 2ND0 A;  4IM2 A;  2X5C A;  4G6Q A;  3T4A G;  3FD9 A;  1DKX A;  1E9V A;  3T47 A;  1W9M A;  1GN9 A;  2Z8Y A;  5CHE A;  1GNL A;  1E2U A;  4FO1 A;  2QXL A;  4IM0 A;  3F7W A;  2N3K A;  3D2E A;  3VKH A;  4OAF A;  3T46 A;  4K9A A;  2GAF D;  3O3M B;  2GA9 D;  5B3Q A;  4EZW A;  1DKY A;  2OBM A;  3MCR A;  4WOY A;  2B56 A;  3ER9 B;  3C7N A;  4LEV A;  4K98 A;  4O69 A;  3RV0 A;  4D8J A;  4LEW A;  4JWD A;  4EZT A;  3I39 X;  4WQK A;  2KHO A;  3B53 X;  5CFU A;  4K97 A;  3B51 X;  4EZY A;  1SU8 A;  4R5J A;  3ER8 C;  3EF2 A;  4WH5 A;  1MJG A;  3KAW A;  4H6H A;  4JL9 A;  1E1D A;  3NKU A;  1DKZ A;  4KB6 A;  4EZV A;  4OAH A;  3VEA A;  4K99 A;  4IW0 A;  1SU6 A;  4WQL A;  3PHZ A;  4NXV A;  3RV1 A;  4PO2 A;  4XJE A;  4R5G A;  2IHO A;  4FM3 A;  2OBL A;  4O68 A;  4K9B A;  5B3P A;  3A98 A;  4R5L A;  2PY6 A;  2EWR A;  4HX0 A;  4EZU A;  5FLE X;  2YIB A;  4R5I A;  5TKY A;  4JWI A;  3DPQ A;  3T49 A;  3K7D A;  2EX3 B;  4EZR A;  2YIV X;  4HYB A;  3VEB A;  4UDY X;  4F00 A;  4LEY A;  3T48 A;  2RT6 A;  4EZO A;  4IWP A;  4NXW A;  4NXT A;  4E3C A;  5D62 A;  4JLZ A;  3OWG A;  4HY9 A;  1JQK A;  3O3O B;  3LMF A;  1OA1 A;  5D61 A;  4O67 A;  4K96 A;  1GPJ A;  3I01 A;  4IM3 A;  4LEZ A;  4EZQ A;  1SUF A;  5E84 A;  4NXX A;  4IWQ A;  4H6I A;  4EZP A;  2EWF A;  5FIG A;  3OHX M;  4F01 A;  4EZZ A;  5CFS A;  4N7R A;  2WIN M;  1GNT A;  3DPO A;  4OAI Z;  4IWO A;  4M0M A;  4EZX A;  4MKP A;  5CFT A;  4KIK B;  3GI7 A;  2QFF A;  4JWE A;  4JWC A;  4UDX X;  4JLX A;  4OAG A;  4HR1 A;  3QA8 A;  4HR1 B;  1SU7 A;  2B51 A;  2B4V A;  5D63 A;  4JN4 A;  4KIK A;  3UIT A;  2LM0 A;  4R5K A;  4EZN A;  2YI8 A;  3ERC C;  1U00 A;  4EZS A;  4KM5 A;  4JLC A;  1ZYL A;  2JNS A;  4NPH A;  3ZED A;  3DPP A;  3O3N B;  2FCL A;  1OAO A;  4NXU A;  3B52 X;  1OA0 A;  2YI9 A;  4JNF A;  3L3O M;  2YIA A;  3QNJ A;  4JNE A;  4E81 A;  3I04 A;  4B9Q A;  3KAV A;  4K8V A;  1UPX A;  3KDR A;  2NCZ A;  2ND1 A;  3D2F A;  4O6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...