2GA9D

Crystal structure of the heterodimeric vaccinia virus polyadenylate polymerase with bound atp-gamma-s
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
total genus 151
structure length 445
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
D PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2ga9D01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ga9D03
3ERCC 3ER9B 2GAFD 3ER8C 3OWGA 2GA9D
chains in the Genus database with same CATH superfamily
4R5JA 4LZDA 4OAHA 5CFSA 5DBAA 3PMLA 2PFQA 4WC0A 1XSNA 1ZQMA 9ICIA 2LXYA 5E84A 5D4BA 5J0PA 3QE6A 4I2EA 2OZNB 3TFSA 9ICUA 4KLQA 3C5FA 1ZQEA 3ISDA 3H39A 2IUBA 1ZQIA 8ICNA 4H8SA 1GNLA 3DX2A 4MFFA 4EZNA 4HX0A 1PX5A 2HHPA 5CHEA 4RQ5A 4M0MA 1MIVA 4KLLA 1KNYA 4FHWA 4UAZA 4AZIA 2ZHAA 4R63A 5DB9A 5IILA 1OA1A 1MIWA 4WC2A 7ICLA 1ZQTA 5J0SA 3LVTA 5B3PA 3OVAA 4D8JA 1TV9A 2BCUA 3JPRA 2BPFA 9ICFA 3HIYA 5HRFA 4NXWA 2ZH5A 4Z6FA 1VFGA 4H6HA 3ER8C 2IHMA 1W9MA 4XUSA 3L9DA 1R34A 3RH4A 4R66A 8ICAA 2YIVX 3JZ0A 5J0YA 2HN2A 1ZQAA 2FMPA 2O1PA 3QWEA 2BPCA 3OVSA 4X0AA 5J2GA 3K7DA 4RQ2A 3C66A 4PHEA 4R65A 1LQ7A 2D1LA 4BNEA 3DDGA 4UB2A 4JWNA 3OWGA 2YI9A 4TURA 4K98A 1ZQWA 4IQTA 2FMSA 4M0AA 1O7DB 4WPEA 3NVOA 1YLQA 3ER9B 1NOMA 3HJ1A 9ICEA 1KEJA 4QZEA 3EJUA 5D49A 3MDAA 8ICYA 5JTGA 5TZVA 4UB1A 4LEYA 3A98A 2Z0VA 1VJ7A 5HRDA 5J0OA 4K4GA 1ZQNA 5C5BA 4FO1A 4QZAA 4FH3A 5IIJA 4XQ8A 4X4SA 3BUPA 3QNJA 5J2EA 4F5QA 4M9JA 4RWQA 4NKUA 2ZHBA 1I4TA 4JNEA 4AZHA 5J2CA 4XA5A 3JYYA 4UBCA 2GAFD 3AU6A 5TKYA 4K96A 5FIGA 2NCZA 4P4MA 1ZQFA 1TQUA 4I2HA 8ICMA 8ICHA 4IQUA 4O69A 5HRLA 3KAVA 4F5OA 9ICQA 2JNSA 4RT2A 4JL9A 2PFOA 4R5IA 1F5AA 4Z6CA 3FD9A 4EZUA 4P4OA 3LQCB 2ZH8A 9ICXA 4RPZA 4KLJA 2BCQA 1I4LA 5DEDA 8ICFA 3D51A 3D2EA 4RWOA 4YN4A 4R64A 3PMNA 4DOAA 1ZQCA 3H3AA 3GDXA 1RPLA 4UD5A 4UDXX 4EZYA 7ICKA 4DOCA 3BVUA 1ZWWA 1UETA 4YD2A 2PMRA 3C2LA 3AU2A 5IIKA 3EJRA 4EP7A 5DDMA 4GXKA 3SOGA 3BUIA 1ZQRA 2ZXQA 2DR8A 7ICNA 4WBZA 5CR0A 1O7DC 1BPDA 2Z8YA 7ICGA 3BLBA 3BUDA 4G6QA 1HTYA 4QZBA 9ICVA 1WOTA 4KLSA 4RT3A 1QWUA 4FHVA 4I28A 3C18A 7ICMA 4EZTA 3HAIA 1ZQDA 3DX0A 3WFQE 3L3PA 4PHDA 3T46A 4QZ9A 3T47A 1PS3A 5DB7A 4AZ6A 1ZQYA 4WC6A 1SU6A 2B4VA 3DYTA 2Q13A 3DX3A 4I2DA 4EZWA 5CA7A 3OV7A 4X4PA 4AT7B 8ICOA 4EZRA 4NPHA 9ICGA 1QX1A 4NXUA 4JLCA 4EZSA 4OAIZ 3F7WA 5B3QA 3PLTA 4NXZA 5BPCA 4TUPA 4I27A 1I4DA 1TQVA 3CK6A 1JQRA 3V7LA 2BCSA 5D62A 4R5GA 4WC3A 3PNCA 5BOLA 4NM1A 7ICPA 4IWQA 4MF8A 1SUFA 4JWIA 8ICSA 5CJ7A 1OA0A 4JNFA 1UPXA 4NXXA 3UQ0A 4WPCA 2RFFA 2GA9D 3RJJA 3C5GA 4WC4A 1X04A 2EFLA 4K9BA 9ICAA 2X3WA 9ICOA 2OBLA 9ICLA 3ZEDA 3I2WA 4X0BA 2DR5A 2WINM 4K4HA 4AZGA 4LEVA 3EJPA 4QZFA 4E7XA 2DR7A 2YLLA 1NO5A 5IIOA 4I2GA 4X4RA 3OUYB 2BE3A 2GWSA 5J2BA 4LVSA 4WBYA 4ATBB 3Q0KA 2PFPA 1ZQUA 5HREA 8ICUA 1DKXA 4EZXA 4NSWA 4EEBA 1R33A 2EWRA 3D4YA 1JMSA 4EBJA 3RV1A 1GPJA 2ISPA 4UAYA 1RZTA 2LM0A 3HW8A 3H37A 3PHZA 4B9QA 3HJ4A 4K99A 4M47A 4NLNA 4O9MA 2YI8A 5DECA 3B51X 1I49A 1ZQJA 3UXOA 4NXVA 4I2IA 4LT6A 4AZBA 5J2KA 2RT6A 4I0UA 5BOMA 3UPQA 3AQNA 5IIMA 3T49A 4X4UA 1TFWA 2HN1A 4P2HA 3KAWA 3I39X 5J0UA 7ICTA 9ICRA 1ZQHA 2N3KA 3ERCC 4PHPA 4R5LA 3V7JA 3RJIA 8ICWA 1R8AA 5IIIA 4S3NA 4NQIA 2M2TA 2BBHA 1SU8A 3MGIA 4I2FA 2FICA 3EJTA 3M3WA 2NRKA 4UB5A 1JQKA 5J0RA 2BPGA 9ICKA 4E80A 2Z0OA 2OBMA 2ALWA 3RV0A 4RWPA 4YMMA 4AT7A 2PXIA 3MCRA 3WFOA 4EZOA 4YMOA 4N7RA 7ICFA 3CZNA 8ICLA 1OAOA 4EZVA 4KLMA 4GXIA 4NLZA 3TFRA 4EGWA 3BUBA 3ACOA 3DPOA 3RJEA 4QZCA 2X5CA 2ZH1A 1MJGA 3H38A 3D4ZA 4I1QA 1R5EA 3V72A 2F1AA 4JLXA 4EZQA 1BPYA 4UB3A 4Z6EA 2YL6A 3CAZA 4WC1A 4NM2A 4UDYX 3UPSA 4XJEA 1Y2OA 2ND1A 1U00A 4JWCA 3UXPA 4R5KA 4K9AA 4OAGA 2EX3B 4KM5A 4KLEA 5J2HA 4XQ7A 4TUSA 4MFCA 4DCNC 2RAJA 4K97A 5DKWA 5J0XA 4NXTA 1ZQXA 2ZH6A 1R8BA 8ICRA 2DVIA 2YL9A 2QXLA 3OHXM 4UBBA 4F5NA 4WQLA 5DBBA 5J0TA 3WFPA 2ID1A 4QZGA 4DO9A 1BPXA 3WFRE 3OUYA 3AQMA 4M04A 3D2FA 3QNIA 2M2UA 2VANA 7ICOA 4M9HA 3O3MB 4EZPA 4PGYA 1TQTA 2FCLA 3C2KA 3DPQA 4ATBA 4F01A 4YMNA 4QZ8A 4JWMA 4H6IA 2RAIA 4AZ7A 3D50A 4O67A 4IM2A 4AKVA 1E9VA 4FHPA 4WOYA 4YD1A 4ATMA 3MBYA 5HC9A 2DRBA 3WFSC 3JPPA 4X5VA 2BBJA 5DB8A 1QWNA 3B52X 4FZSA 2B51A 1MIYA 4Z6DA 1ZYLA 5HRGA 5EOZA 4IM3A 4RQ0A 3LMFA 3B0XA 5J0QA 4I29A 2JNKA 4KB6A 4OAFA 2C08A 4PO2A 3O3OB 1R8CA 4IWOA 3AQLA 4M9GA 7ICSA 5HR9A 4QZHA 4IQWA 2ZH4A 3CZSA 4X4NA 3KDRA 3NWIA 4P4PA 5J2DA 4F00A 5D46A 2Q66A 8ICVA 4FO6A 2ND0A 4O5CA 3C7NA 2ISOA 5KBPA 3EJSA 3AQKA 1ZQKA 9ICNA 1ZJNA 1GNTA 8ICIA 4EV6A 2FMQA 5HRHA 2DRAA 4E81A 4RPYA 4X4VA 4TUQA 1WDZA 4E8FA 2B56A 2BCVA 5HRIA 3T48A 3UXNA 3HAHA 3CV5A 3DX4A 4PGXA 4AT8B 3AUOA 4WC5A 3BVWA 3BVXA 1DKYA 4WQKA 2D4CA 4X4OA 4KIKB 1TVAA 2IHOA 5CB1A 3RJGA 4RWNA 7ICEA 4HY9A 9ICSA 2X3XA 4MFAA 9ICJA 4IM0A 4KLIA 4FZPA 3ISCA 4RQ6A 4DYLA 2F7PA 3I04A 8ICBA 1DKZA 9ICWA 4X4QA 3SYVA 2KHOA 4F5PA 3QA8A 1BPZA 1BPEA 2PY6A 9ICHA 3NYBA 5HHHA 3EJQA 3HAJA 3V7KA 4RPXA 1E2UA 4FM3A 2YLAA 3JPQA 1HUZA 2F1BA 7ICVA 4UAWA 1ZQPA 7ICJA 3G9GA 5J0WA 4KLTA 5HRKA 4IQVA 3RH6A 1ZQQA 8ICCA 3OGUA 4JLZA 4F5RA 2F7RA 5HHIA 9ICTA 2P66A 3UITA 3HX0A 5IINA 3CKDA 4WCWA 4LEZA 2MI7A 7ICHA 2WYHA 2ZH3A 2ZH2A 1HWWA 4NLKA 5CP2A 2ZH9A 3B53X 4EZZA 3VEAA 1ZQLA 4O5KA 1X03A 4NKTA 3UQ2A 4K4IA 3GI7A 5CHGA 3ABHA 4FHYA 1ZQBA 4M9LA 3MGHA 3JPSA 4WH5A 2PBEA 3HWTA 1OU5A 1Q79A 3DDFA 5J2FA 3CVRA 4O68A 8ICTA 3NKUA 4I2CA 2OW6A 5CFTA 4AZCB 5J2IA 8ICGA 4O5EA 1XSPA 4KLFA 8ICQA 1TQWA 3ISBA 4JWDA 4HR1B 4QZIA 3RJFA 1HXKA 2OW7A 8ICPA 2YKTA 2DR9A 2YL8A 1XSLA 4KLHA 4RQ3A 2ELBA 4AT8A 3DPPA 3O3NB 8ICZA 1JAJA 1KDHA 4O6AA 3LLLA 3OK8A 2OO2A 4KIKA 4NY8A 2PFNA 4AT9A 3JPTA 3BVVA 3RPMA 3LK9A 4DOBA 4YCXA 2EWFA 2QFFA 5J29A 4I2AA 4KLDA 9ICMA 2M2WA 1ZQOA 5DB6A 4IG8A 4IW0A 5HRBA 5CFUA 2Z0NA 4I2BA 7ICRA 2O0I1 3C2MA 2I9GA 3JPNA 3VEBA 2RAKA 4FHXA 4QZDA 2F18A 2YL5A 4AVMA 4I2JA 4WC7A 2EFKA 3K75D 3RJKA 4AZ5A 3BUQA 4M2YA 4X4TA 1YWMA 5FLEX 8ICXA 4FZOA 1R89A 1Q78A 2ZH7A 9ICBA 4JWEA 3D52A 1ZQVA 5J2JA 4RQ7A 4MF2A 2BCRA 1TQSA 4MKPA 1SU7A 1BPBA 1ZQZA 2M2VA 5CWRA 4KLOA 8ICKA 1FA0A 3JPOA 4EEDA 4LZGA 4HYBA 7ICQA 1E1DA 3RJHA 3I01A 4RQ1A 1GN9A 4GXJA 3VKHA 2QKWA 9ICCA 2F7QA 1ZQSA 4PGQA 3MDCA 3OVBA 4PH5A 2GF4A 4EBKA 1ZQGA 4PPXA 5DBCA 3B0YA 7ICUA 3DX1A 4XRHA 4M9NA 9ICPA 1UEVA 4M5DA 5D61A 4UB4A 7ICIA 4UD4A 4KLGA 2Q12A 3Q84A 5C5BB 3EF2A 2YIBA 5D63A 4FH5A 1TFYA 4RQ8A 1V4AA 3BVTA 2WYIA 1MQ2A 1UEUA 4JN4A 3L3OM 2F7OA 8ICEA 1HUOA 8ICJA 1ZJMA 4AZCA 4E3CA 2X3VA 1MQ3A 3T4AG 2O5AA 5F2VO 2FYVA 4IWPA 5DDYA 4HR1A 4LEWA 4PHAA 4AT9B 2W9MA 3JCFA 1JN3A 4RQ4A 2YIAA 2V0OA 3RH5A 4K8VA 4KLUA 1URUA 5J2AA
chains in the Genus database with same CATH topology
4G6QA 4R5JA 4OAHA 5CFSA 3GI7A 4UDYX 5E84A 4XJEA 2ND1A 1U00A 4JWCA 4EZTA 4R5KA 4K9AA 4OAGA 2EX3B 4KM5A 4WH5A 3T46A 3T47A 1GNLA 4K97A 4NXTA 1SU6A 4EZNA 2B4VA 4HX0A 4O68A 5CHEA 4M0MA 2QXLA 4EZWA 3NKUA 3OHXM 5CFTA 4WQLA 4EZRA 4NPHA 1OA1A 3D2FA 4JWDA 4NXUA 4HR1B 4JLCA 3O3MB 4EZPA 4EZSA 2FCLA 4OAIZ 3DPQA 3F7WA 4F01A 5B3QA 5B3PA 4H6IA 4D8JA 4O67A 4WOYA 4IM2A 1E9VA 4NXWA 5D62A 4H6HA 4R5GA 3DPPA 3O3NB 1W9MA 3B52X 3ER8C 2B51A 4O6AA 4IWQA 2YIVX 1SUFA 1ZYLA 4JWIA 4KIKA 4IM3A 1OA0A 4JNFA 1UPXA 4NXXA 3LMFA 4KB6A 2GA9D 4OAFA 4PO2A 3O3OB 2EWFA 2QFFA 3K7DA 4IWOA 4K9BA 4IW0A 2OBLA 3OWGA 3ZEDA 5CFUA 2YI9A 4K98A 2WINM 3KDRA 4LEVA 4F00A 3ER9B 2ND0A 3C7NA 3VEBA 4LEYA 1GNTA 3A98A 4E81A 5FLEX 4FO1A 4K8VA 1DKXA 4EZXA 3QNJA 2B56A 3T48A 2EWRA 4JWEA 4JNEA 3RV1A 1GPJA 2LM0A 2GAFD 3PHZA 4B9QA 4MKPA 5TKYA 1DKYA 4K96A 1SU7A 5FIGA 4WQKA 4K99A 4KIKB 2IHOA 2YI8A 2NCZA 4HY9A 3B51X 4IM0A 4HYBA 1E1DA 4O69A 3I01A 4NXVA 1GN9A 3I04A 1DKZA 2RT6A 3VKHA 3KAVA 2JNSA 4JL9A 2KHOA 4R5IA 3QA8A 3T49A 2PY6A 3FD9A 4EZUA 3KAWA 3I39X 1E2UA 4FM3A 2N3KA 3ERCC 4R5LA 3D2EA 5D61A 1SU8A 3EF2A 4UDXX 2YIBA 5D63A 4EZYA 1JQKA 2OBMA 4JN4A 3L3OM 3RV0A 4E3CA 3MCRA 4EZOA 4JLZA 4N7RA 1OAOA 3T4AG 4EZVA 3UITA 4LEZA 4IWPA 4HR1A 4LEWA 3DPOA 2X5CA 1MJGA 2YIAA 3B53X 2Z8YA 4EZZA 3VEAA 4JLXA 4EZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERC C;  3ER9 B;  2GAF D;  3ER8 C;  3OWG A;  2GA9 D; 
#chains in the Genus database with same CATH topology
 4R5J A;  4LZD A;  4OAH A;  5CFS A;  5DBA A;  3PML A;  2PFQ A;  4WC0 A;  1XSN A;  1ZQM A;  9ICI A;  2LXY A;  5E84 A;  5D4B A;  5J0P A;  3QE6 A;  4I2E A;  2OZN B;  3TFS A;  9ICU A;  4KLQ A;  3C5F A;  1ZQE A;  3ISD A;  3H39 A;  2IUB A;  1ZQI A;  8ICN A;  4H8S A;  1GNL A;  3DX2 A;  4MFF A;  4EZN A;  4HX0 A;  1PX5 A;  2HHP A;  5CHE A;  4RQ5 A;  4M0M A;  1MIV A;  4KLL A;  1KNY A;  4FHW A;  4UAZ A;  4AZI A;  2ZHA A;  4R63 A;  5DB9 A;  5IIL A;  1OA1 A;  1MIW A;  4WC2 A;  7ICL A;  1ZQT A;  5J0S A;  3LVT A;  5B3P A;  3OVA A;  4D8J A;  1TV9 A;  2BCU A;  3JPR A;  2BPF A;  9ICF A;  3HIY A;  5HRF A;  4NXW A;  2ZH5 A;  4Z6F A;  1VFG A;  4H6H A;  3ER8 C;  2IHM A;  1W9M A;  4XUS A;  3L9D A;  1R34 A;  3RH4 A;  4R66 A;  8ICA A;  2YIV X;  3JZ0 A;  5J0Y A;  2HN2 A;  1ZQA A;  2FMP A;  2O1P A;  3QWE A;  2BPC A;  3OVS A;  4X0A A;  5J2G A;  3K7D A;  4RQ2 A;  3C66 A;  4PHE A;  4R65 A;  1LQ7 A;  2D1L A;  4BNE A;  3DDG A;  4UB2 A;  4JWN A;  3OWG A;  2YI9 A;  4TUR A;  4K98 A;  1ZQW A;  4IQT A;  2FMS A;  4M0A A;  1O7D B;  4WPE A;  3NVO A;  1YLQ A;  3ER9 B;  1NOM A;  3HJ1 A;  9ICE A;  1KEJ A;  4QZE A;  3EJU A;  5D49 A;  3MDA A;  8ICY A;  5JTG A;  5TZV A;  4UB1 A;  4LEY A;  3A98 A;  2Z0V A;  1VJ7 A;  5HRD A;  5J0O A;  4K4G A;  1ZQN A;  5C5B A;  4FO1 A;  4QZA A;  4FH3 A;  5IIJ A;  4XQ8 A;  4X4S A;  3BUP A;  3QNJ A;  5J2E A;  4F5Q A;  4M9J A;  4RWQ A;  4NKU A;  2ZHB A;  1I4T A;  4JNE A;  4AZH A;  5J2C A;  4XA5 A;  3JYY A;  4UBC A;  2GAF D;  3AU6 A;  5TKY A;  4K96 A;  5FIG A;  2NCZ A;  4P4M A;  1ZQF A;  1TQU A;  4I2H A;  8ICM A;  8ICH A;  4IQU A;  4O69 A;  5HRL A;  3KAV A;  4F5O A;  9ICQ A;  2JNS A;  4RT2 A;  4JL9 A;  2PFO A;  4R5I A;  1F5A A;  4Z6C A;  3FD9 A;  4EZU A;  4P4O A;  3LQC B;  2ZH8 A;  9ICX A;  4RPZ A;  4KLJ A;  2BCQ A;  1I4L A;  5DED A;  8ICF A;  3D51 A;  3D2E A;  4RWO A;  4YN4 A;  4R64 A;  3PMN A;  4DOA A;  1ZQC A;  3H3A A;  3GDX A;  1RPL A;  4UD5 A;  4UDX X;  4EZY A;  7ICK A;  4DOC A;  3BVU A;  1ZWW A;  1UET A;  4YD2 A;  2PMR A;  3C2L A;  3AU2 A;  5IIK A;  3EJR A;  4EP7 A;  5DDM A;  4GXK A;  3SOG A;  3BUI A;  1ZQR A;  2ZXQ A;  2DR8 A;  7ICN A;  4WBZ A;  5CR0 A;  1O7D C;  1BPD A;  2Z8Y A;  7ICG A;  3BLB A;  3BUD A;  4G6Q A;  1HTY A;  4QZB A;  9ICV A;  1WOT A;  4KLS A;  4RT3 A;  1QWU A;  4FHV A;  4I28 A;  3C18 A;  7ICM A;  4EZT A;  3HAI A;  1ZQD A;  3DX0 A;  3WFQ E;  3L3P A;  4PHD A;  3T46 A;  4QZ9 A;  3T47 A;  1PS3 A;  5DB7 A;  4AZ6 A;  1ZQY A;  4WC6 A;  1SU6 A;  2B4V A;  3DYT A;  2Q13 A;  3DX3 A;  4I2D A;  4EZW A;  5CA7 A;  3OV7 A;  4X4P A;  4AT7 B;  8ICO A;  4EZR A;  4NPH A;  9ICG A;  1QX1 A;  4NXU A;  4JLC A;  4EZS A;  4OAI Z;  3F7W A;  5B3Q A;  3PLT A;  4NXZ A;  5BPC A;  4TUP A;  4I27 A;  1I4D A;  1TQV A;  3CK6 A;  1JQR A;  3V7L A;  2BCS A;  5D62 A;  4R5G A;  4WC3 A;  3PNC A;  5BOL A;  4NM1 A;  7ICP A;  4IWQ A;  4MF8 A;  1SUF A;  4JWI A;  8ICS A;  5CJ7 A;  1OA0 A;  4JNF A;  1UPX A;  4NXX A;  3UQ0 A;  4WPC A;  2RFF A;  2GA9 D;  3RJJ A;  3C5G A;  4WC4 A;  1X04 A;  2EFL A;  4K9B A;  9ICA A;  2X3W A;  9ICO A;  2OBL A;  9ICL A;  3ZED A;  3I2W A;  4X0B A;  2DR5 A;  2WIN M;  4K4H A;  4AZG A;  4LEV A;  3EJP A;  4QZF A;  4E7X A;  2DR7 A;  2YLL A;  1NO5 A;  5IIO A;  4I2G A;  4X4R A;  3OUY B;  2BE3 A;  2GWS A;  5J2B A;  4LVS A;  4WBY A;  4ATB B;  3Q0K A;  2PFP A;  1ZQU A;  5HRE A;  8ICU A;  1DKX A;  4EZX A;  4NSW A;  4EEB A;  1R33 A;  2EWR A;  3D4Y A;  1JMS A;  4EBJ A;  3RV1 A;  1GPJ A;  2ISP A;  4UAY A;  1RZT A;  2LM0 A;  3HW8 A;  3H37 A;  3PHZ A;  4B9Q A;  3HJ4 A;  4K99 A;  4M47 A;  4NLN A;  4O9M A;  2YI8 A;  5DEC A;  3B51 X;  1I49 A;  1ZQJ A;  3UXO A;  4NXV A;  4I2I A;  4LT6 A;  4AZB A;  5J2K A;  2RT6 A;  4I0U A;  5BOM A;  3UPQ A;  3AQN A;  5IIM A;  3T49 A;  4X4U A;  1TFW A;  2HN1 A;  4P2H A;  3KAW A;  3I39 X;  5J0U A;  7ICT A;  9ICR A;  1ZQH A;  2N3K A;  3ERC C;  4PHP A;  4R5L A;  3V7J A;  3RJI A;  8ICW A;  1R8A A;  5III A;  4S3N A;  4NQI A;  2M2T A;  2BBH A;  1SU8 A;  3MGI A;  4I2F A;  2FIC A;  3EJT A;  3M3W A;  2NRK A;  4UB5 A;  1JQK A;  5J0R A;  2BPG A;  9ICK A;  4E80 A;  2Z0O A;  2OBM A;  2ALW A;  3RV0 A;  4RWP A;  4YMM A;  4AT7 A;  2PXI A;  3MCR A;  3WFO A;  4EZO A;  4YMO A;  4N7R A;  7ICF A;  3CZN A;  8ICL A;  1OAO A;  4EZV A;  4KLM A;  4GXI A;  4NLZ A;  3TFR A;  4EGW A;  3BUB A;  3ACO A;  3DPO A;  3RJE A;  4QZC A;  2X5C A;  2ZH1 A;  1MJG A;  3H38 A;  3D4Z A;  4I1Q A;  1R5E A;  3V72 A;  2F1A A;  4JLX A;  4EZQ A;  1BPY A;  4UB3 A;  4Z6E A;  2YL6 A;  3CAZ A;  4WC1 A;  4NM2 A;  4UDY X;  3UPS A;  4XJE A;  1Y2O A;  2ND1 A;  1U00 A;  4JWC A;  3UXP A;  4R5K A;  4K9A A;  4OAG A;  2EX3 B;  4KM5 A;  4KLE A;  5J2H A;  4XQ7 A;  4TUS A;  4MFC A;  4DCN C;  2RAJ A;  4K97 A;  5DKW A;  5J0X A;  4NXT A;  1ZQX A;  2ZH6 A;  1R8B A;  8ICR A;  2DVI A;  2YL9 A;  2QXL A;  3OHX M;  4UBB A;  4F5N A;  4WQL A;  5DBB A;  5J0T A;  3WFP A;  2ID1 A;  4QZG A;  4DO9 A;  1BPX A;  3WFR E;  3OUY A;  3AQM A;  4M04 A;  3D2F A;  3QNI A;  2M2U A;  2VAN A;  7ICO A;  4M9H A;  3O3M B;  4EZP A;  4PGY A;  1TQT A;  2FCL A;  3C2K A;  3DPQ A;  4ATB A;  4F01 A;  4YMN A;  4QZ8 A;  4JWM A;  4H6I A;  2RAI A;  4AZ7 A;  3D50 A;  4O67 A;  4IM2 A;  4AKV A;  1E9V A;  4FHP A;  4WOY A;  4YD1 A;  4ATM A;  3MBY A;  5HC9 A;  2DRB A;  3WFS C;  3JPP A;  4X5V A;  2BBJ A;  5DB8 A;  1QWN A;  3B52 X;  4FZS A;  2B51 A;  1MIY A;  4Z6D A;  1ZYL A;  5HRG A;  5EOZ A;  4IM3 A;  4RQ0 A;  3LMF A;  3B0X A;  5J0Q A;  4I29 A;  2JNK A;  4KB6 A;  4OAF A;  2C08 A;  4PO2 A;  3O3O B;  1R8C A;  4IWO A;  3AQL A;  4M9G A;  7ICS A;  5HR9 A;  4QZH A;  4IQW A;  2ZH4 A;  3CZS A;  4X4N A;  3KDR A;  3NWI A;  4P4P A;  5J2D A;  4F00 A;  5D46 A;  2Q66 A;  8ICV A;  4FO6 A;  2ND0 A;  4O5C A;  3C7N A;  2ISO A;  5KBP A;  3EJS A;  3AQK A;  1ZQK A;  9ICN A;  1ZJN A;  1GNT A;  8ICI A;  4EV6 A;  2FMQ A;  5HRH A;  2DRA A;  4E81 A;  4RPY A;  4X4V A;  4TUQ A;  1WDZ A;  4E8F A;  2B56 A;  2BCV A;  5HRI A;  3T48 A;  3UXN A;  3HAH A;  3CV5 A;  3DX4 A;  4PGX A;  4AT8 B;  3AUO A;  4WC5 A;  3BVW A;  3BVX A;  1DKY A;  4WQK A;  2D4C A;  4X4O A;  4KIK B;  1TVA A;  2IHO A;  5CB1 A;  3RJG A;  4RWN A;  7ICE A;  4HY9 A;  9ICS A;  2X3X A;  4MFA A;  9ICJ A;  4IM0 A;  4KLI A;  4FZP A;  3ISC A;  4RQ6 A;  4DYL A;  2F7P A;  3I04 A;  8ICB A;  1DKZ A;  9ICW A;  4X4Q A;  3SYV A;  2KHO A;  4F5P A;  3QA8 A;  1BPZ A;  1BPE A;  2PY6 A;  9ICH A;  3NYB A;  5HHH A;  3EJQ A;  3HAJ A;  3V7K A;  4RPX A;  1E2U A;  4FM3 A;  2YLA A;  3JPQ A;  1HUZ A;  2F1B A;  7ICV A;  4UAW A;  1ZQP A;  7ICJ A;  3G9G A;  5J0W A;  4KLT A;  5HRK A;  4IQV A;  3RH6 A;  1ZQQ A;  8ICC A;  3OGU A;  4JLZ A;  4F5R A;  2F7R A;  5HHI A;  9ICT A;  2P66 A;  3UIT A;  3HX0 A;  5IIN A;  3CKD A;  4WCW A;  4LEZ A;  2MI7 A;  7ICH A;  2WYH A;  2ZH3 A;  2ZH2 A;  1HWW A;  4NLK A;  5CP2 A;  2ZH9 A;  3B53 X;  4EZZ A;  3VEA A;  1ZQL A;  4O5K A;  1X03 A;  4NKT A;  3UQ2 A;  4K4I A;  3GI7 A;  5CHG A;  3ABH A;  4FHY A;  1ZQB A;  4M9L A;  3MGH A;  3JPS A;  4WH5 A;  2PBE A;  3HWT A;  1OU5 A;  1Q79 A;  3DDF A;  5J2F A;  3CVR A;  4O68 A;  8ICT A;  3NKU A;  4I2C A;  2OW6 A;  5CFT A;  4AZC B;  5J2I A;  8ICG A;  4O5E A;  1XSP A;  4KLF A;  8ICQ A;  1TQW A;  3ISB A;  4JWD A;  4HR1 B;  4QZI A;  3RJF A;  1HXK A;  2OW7 A;  8ICP A;  2YKT A;  2DR9 A;  2YL8 A;  1XSL A;  4KLH A;  4RQ3 A;  2ELB A;  4AT8 A;  3DPP A;  3O3N B;  8ICZ A;  1JAJ A;  1KDH A;  4O6A A;  3LLL A;  3OK8 A;  2OO2 A;  4KIK A;  4NY8 A;  2PFN A;  4AT9 A;  3JPT A;  3BVV A;  3RPM A;  3LK9 A;  4DOB A;  4YCX A;  2EWF A;  2QFF A;  5J29 A;  4I2A A;  4KLD A;  9ICM A;  2M2W A;  1ZQO A;  5DB6 A;  4IG8 A;  4IW0 A;  5HRB A;  5CFU A;  2Z0N A;  4I2B A;  7ICR A;  2O0I 1;  3C2M A;  2I9G A;  3JPN A;  3VEB A;  2RAK A;  4FHX A;  4QZD A;  2F18 A;  2YL5 A;  4AVM A;  4I2J A;  4WC7 A;  2EFK A;  3K75 D;  3RJK A;  4AZ5 A;  3BUQ A;  4M2Y A;  4X4T A;  1YWM A;  5FLE X;  8ICX A;  4FZO A;  1R89 A;  1Q78 A;  2ZH7 A;  9ICB A;  4JWE A;  3D52 A;  1ZQV A;  5J2J A;  4RQ7 A;  4MF2 A;  2BCR A;  1TQS A;  4MKP A;  1SU7 A;  1BPB A;  1ZQZ A;  2M2V A;  5CWR A;  4KLO A;  8ICK A;  1FA0 A;  3JPO A;  4EED A;  4LZG A;  4HYB A;  7ICQ A;  1E1D A;  3RJH A;  3I01 A;  4RQ1 A;  1GN9 A;  4GXJ A;  3VKH A;  2QKW A;  9ICC A;  2F7Q A;  1ZQS A;  4PGQ A;  3MDC A;  3OVB A;  4PH5 A;  2GF4 A;  4EBK A;  1ZQG A;  4PPX A;  5DBC A;  3B0Y A;  7ICU A;  3DX1 A;  4XRH A;  4M9N A;  9ICP A;  1UEV A;  4M5D A;  5D61 A;  4UB4 A;  7ICI A;  4UD4 A;  4KLG A;  2Q12 A;  3Q84 A;  5C5B B;  3EF2 A;  2YIB A;  5D63 A;  4FH5 A;  1TFY A;  4RQ8 A;  1V4A A;  3BVT A;  2WYI A;  1MQ2 A;  1UEU A;  4JN4 A;  3L3O M;  2F7O A;  8ICE A;  1HUO A;  8ICJ A;  1ZJM A;  4AZC A;  4E3C A;  2X3V A;  1MQ3 A;  3T4A G;  2O5A A;  5F2V O;  2FYV A;  4IWP A;  5DDY A;  4HR1 A;  4LEW A;  4PHA A;  4AT9 B;  2W9M A;  3JCF A;  1JN3 A;  4RQ4 A;  2YIA A;  2V0O A;  3RH5 A;  4K8V A;  4KLU A;  1URU A;  5J2A A; 
#chains in the Genus database with same CATH homology
 4G6Q A;  4R5J A;  4OAH A;  5CFS A;  3GI7 A;  4UDY X;  5E84 A;  4XJE A;  2ND1 A;  1U00 A;  4JWC A;  4EZT A;  4R5K A;  4K9A A;  4OAG A;  2EX3 B;  4KM5 A;  4WH5 A;  3T46 A;  3T47 A;  1GNL A;  4K97 A;  4NXT A;  1SU6 A;  4EZN A;  2B4V A;  4HX0 A;  4O68 A;  5CHE A;  4M0M A;  2QXL A;  4EZW A;  3NKU A;  3OHX M;  5CFT A;  4WQL A;  4EZR A;  4NPH A;  1OA1 A;  3D2F A;  4JWD A;  4NXU A;  4HR1 B;  4JLC A;  3O3M B;  4EZP A;  4EZS A;  2FCL A;  4OAI Z;  3DPQ A;  3F7W A;  4F01 A;  5B3Q A;  5B3P A;  4H6I A;  4D8J A;  4O67 A;  4WOY A;  4IM2 A;  1E9V A;  4NXW A;  5D62 A;  4H6H A;  4R5G A;  3DPP A;  3O3N B;  1W9M A;  3B52 X;  3ER8 C;  2B51 A;  4O6A A;  4IWQ A;  2YIV X;  1SUF A;  1ZYL A;  4JWI A;  4KIK A;  4IM3 A;  1OA0 A;  4JNF A;  1UPX A;  4NXX A;  3LMF A;  4KB6 A;  2GA9 D;  4OAF A;  4PO2 A;  3O3O B;  2EWF A;  2QFF A;  3K7D A;  4IWO A;  4K9B A;  4IW0 A;  2OBL A;  3OWG A;  3ZED A;  5CFU A;  2YI9 A;  4K98 A;  2WIN M;  3KDR A;  4LEV A;  4F00 A;  3ER9 B;  2ND0 A;  3C7N A;  3VEB A;  4LEY A;  1GNT A;  3A98 A;  4E81 A;  5FLE X;  4FO1 A;  4K8V A;  1DKX A;  4EZX A;  3QNJ A;  2B56 A;  3T48 A;  2EWR A;  4JWE A;  4JNE A;  3RV1 A;  1GPJ A;  2LM0 A;  2GAF D;  3PHZ A;  4B9Q A;  4MKP A;  5TKY A;  1DKY A;  4K96 A;  1SU7 A;  5FIG A;  4WQK A;  4K99 A;  4KIK B;  2IHO A;  2YI8 A;  2NCZ A;  4HY9 A;  3B51 X;  4IM0 A;  4HYB A;  1E1D A;  4O69 A;  3I01 A;  4NXV A;  1GN9 A;  3I04 A;  1DKZ A;  2RT6 A;  3VKH A;  3KAV A;  2JNS A;  4JL9 A;  2KHO A;  4R5I A;  3QA8 A;  3T49 A;  2PY6 A;  3FD9 A;  4EZU A;  3KAW A;  3I39 X;  1E2U A;  4FM3 A;  2N3K A;  3ERC C;  4R5L A;  3D2E A;  5D61 A;  1SU8 A;  3EF2 A;  4UDX X;  2YIB A;  5D63 A;  4EZY A;  1JQK A;  2OBM A;  4JN4 A;  3L3O M;  3RV0 A;  4E3C A;  3MCR A;  4EZO A;  4JLZ A;  4N7R A;  1OAO A;  3T4A G;  4EZV A;  3UIT A;  4LEZ A;  4IWP A;  4HR1 A;  4LEW A;  3DPO A;  2X5C A;  1MJG A;  2YIA A;  3B53 X;  2Z8Y A;  4EZZ A;  3VEA A;  4JLX A;  4EZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...