2GAHC

Heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
TPLRHSPAEHLDTVMDAASVAGRVELREIAFTTQISLRCAPGTQAHAALAAATGAGLPAKVGEVAGEAQGTAVLWLAPDEFLATSAENTELGGVLSAALGDAPGQVVDLSANRSVLELTGPDAPLVLRKSCPADLHPRAFAVNQAIVTSVANIPVLLWRTGEQAWRIMPRASFTEHTVHWLVDAMSEFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heterotetrameric sarcosine oxidase alpha-subunit
publication title Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution.
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Oxidoreductase
total genus 43
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 2gahC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 2gahC01
3AD8C 2GAHC 1YX2A 3GEEA 3GEHA 3TTGA 5L46A 3GIRA 3GEIA 3ADAC 3TFJA 1PJ5A 4P9SA 3TFIA 4PABA 3A8JA 3AD9C 3A8IA 3GSIA 1X31C 1V5VA 1PJ6A 1WSRA 1WORA 1XZQA 1WOOA 1WOPA 1VRQC 1XZPA 2GAGC 1PJ7A 1WOSA 4PAAA 3AD7C 1VLOA 1XZQB 1WSVA 3A8KA 1XZPB 3TFHA
chains in the Genus database with same CATH superfamily
6FDRA 3N6NA 4DPUA 2WONB 2YPYA 3CJKA 2JEIA 4TXSA 4X66F 3H8YA 2AIRB 2DR9A 2XWXA 4OIRA 1ULRA 1IWGA 3PX4A 5DG7A 4OX6A 3IPJA 2X1GA 1NH8A 2FZKB 2HK3A 3LTOA 4DUZF 3PO3C 1PC4A 4IH5A 4XCHA 2CJ9A 3OUYA 1MLAA 1NHVA 3J7YI 3GTJC 1LW0A 1LK5A 1Q86T 4X65J 3SV3A 2GAHC 4HDHA 5AE2A 1KSPA 2G2ZA 3HOXK 1DBDA 1UAWA 2RRAA 2B5JA 3KHGA 1RHQB 4EFAC 5J2MA 2RQCA 1N8RT 2XZTB 1WHWA 1X5SA 4ELVA 2VC1A 1X5TA 1FFWB 4G3IA 3ZZ0A 3BDPA 4ED2A 1VBXA 5KOXA 1TWHK 3VGSA 3OREA 2CA9A 3EE3A 4O44A 3FEYB 3R97A 1RA6A 1Q53A 3FQLA 1RWOB 4DV0F 2YWGA 4HI1A 1SKWA 2XCOA 3SBMA 5KFFA 3PACA 3U7JA 1KHWA 4NOHA 1RKIA 3BSNA 2KJWA 3GJQB 5F0UA 2B9EA 2GVZB 3KK1B 4XTTA 1WEXA 3AQPA 3AJ1A 1BD6A 4A3KC 1Y1WA 1WHXA 2P6TA 4OZ0A 5IT0A 3JSMB 2J76E 3LP1A 3PW0A 4U8VA 3PKMA 1U1MA 1P27B 2Y0SL 3CCWA 3O44A 1TWCA 4AL6A 1FJEB 4ZIVA 5KG1A 3K8WA 5AJ3F 3M2VB 3ZFVA 5CYJA 3UN3A 4DX5A 4J3NA 3U1LA 1WQGA 3OFEA 2YKNB 5HQMA 4EEYA 1MWZA 1AXQA 4RW4A 3DRRA 4KTQA 3G6XA 1F7UA 2EFVA 2G9OA 1VIXA 4PG5A 4OLOA 2B4PA 2OKQA 1KVIA 5BR8J 4HL9A 2OHDA 3ZC4A 3H40A 3G4CA 2EFOA 2YNHA 4FBTA 3QLHB 2X3DA 3CF5Q 1G7CB 2FJDB 4XIUA 3KJVA 1BQNB 3IS9A 4K7QA 1L3TA 5ETSA 2ROEA 3D68A 4PWDA 1JLQA 4QZVB 4DR7J 4QR2A 4DX8H 1KLMA 4K5SA 1HL6A 4J7CA 1YBUA 4LR9A 4B3TJ 2WVBA 5TMCA 5LMNJ 2I9SA 2YWHA 1IVZA 1IR2A 2B8PA 2NYIA 2XI2A 4B9LA 3T5JA 3HM9A 2LMIA 1VK8A 4R8UB 2NVXK 1HI8A 3S1MK 1S4FA 1JLGB 3M8RA 5M2PA 3S14C 2KHDA 4AXIA 3FDSA 3OVAA 3PCOB 4QQBA 3FZBA 2CFAA 1SIWB 2W2QP 2DR6A 4OHZA 3P5BP 3A8JA 2WTFA 5A8WB 1NCLA 4PKDB 2DK2A 3GJSB 3A12A 3FQKA 4EYHB 4ELUA 2DR8A 2KI2A 1ZAVA 2Y1RI 4OZLA 4ZP9A 4NZ6A 5HL7Q 1HYSB 1MROB 2W4PA 3P8BB 1O27A 4O3RA 2RKIA 2M0GB 1NBEB 4ZVTB 4FVMA 4NLWA 2MLYA 4C3KA 2E9TA 2KG0A 3S0XA 4ED3A 3PVXA 2A1BA 4JI1J 1IS1A 4KC6A 2LECA 2MY8A 4A3DC 5LT5A 1H72C 2DISA 4PWWA 1XN9A 4ZVEA 4PYAA 2VC0A 1GT8A 4OI3A 2Z2LA 5JFEA 2K7KA 3EXYA 3LO3A 2QFIA 5JVOA 1RACB 4CLLA 3TYTA 2CQDA 2OP5A 1OY6A 3OUYB 1N0VC 2YWFA 5L38A 1SL1A 3ADAC 3EX7B 1PSDA 1T95A 1KONA 5KFNA 2XLIA 3PW4A 3HP6A 2B5JB 2HFUA 1YJTA 4KYZA 3QWUA 5J2MB 3JAMY 4C2MC 2C2DA 3G86A 3H5YA 3TFJA 1JLCA 1LW2A 4PG6A 2GHVC 4F4WA 4BY1C 5IYBC 5IT9U 4M5KA 4J9PA 3RGIA 1M5PC 2JOQA 4TY8B 2Q6BA 2RS2A 4KBIA 4O44B 2KXNB 4NEZA 4KMUA 4F8RA 4NA3A 3ZZRA 2CPXA 1FFSB 2KHCA 2XNRA 2DGXA 4URQU 3TQEA 4KASA 4P74A 1U2RA 3N28A 2R42A 3LW5C 3HX9A 3L7PA 2UUBF 3MTKA 1FWLA 1I5OB 2QSWA 3D6HB 2M7SA 2IRXA 3QIPA 2N4CA 2B6AA 3LP1B 1KP6A 2ZZMA 3KOAA 4RNOA 1YNJA 3C14A 1O29A 3US5A 4ZVSB 2MKHA 2QL7B 4JI5J 1S9GB 3IO1A 1HNZJ 1VC0A 1XNRJ 4DDFA 1GQEA 3R2DJ 1RT2A 2DGVA 3FSXA 1U1PA 2Y3PA 1F9FA 2VFSA 4FXDA 4RW4B 3R1LA 1TFYA 3KMSA 2CDRB 3DRRB 1N56A 3TANA 3QATA 3HOYC 2UUAJ 2DNNA 4CO2A 1XC9A 3D66A 2BJEA 4NEYA 4DR6J 3RZDC 4F25A 1WACA 2XSJA 1SCJB 1TQLA 2RNEA 5E2QA 4O0IA 2D3UA 1F3FA 3OHAA 1YGYA 2CRLA 1F9NA 4E98A 4IFVA 1T3OA 4MKVA 4LBIA 1FKOA 4LF1A 2EK1A 4UQGA 3KJVB 3KJFB 5IZHA 1PCAA 1U1LA 1NZAA 1TL3A 1JLQB 2HKEA 4M1KA 4BBRK 1KLMB 3LWLA 2D7SA 3UW1A 1U47A 4DL3A 4PG7A 1NLKL 4LF9J 3GB0A 4NASA 1QAIA 2LEBA 3NG8A 4ZN3A 1U8SA 3W5YA 4DCOB 3MMJA 1DQ8A 5DM7Q 2B7CB 1UKUA 2AV5A 1LXJA 2MSSA 4DFPA 4ES2A 2CFAB 2B56A 2DNZA 3KJNB 2WHOA 1H2VZ 2XZWA 3QT6A 4OI4A 2OFHX 4YHHJ 2HURA 1VC6A 4CLZA 4J5OA 4CI0B 3GTGA 4U8YA 3HOUC 1YRXA 3W8PA 2RKIB 4QWEA 2ZE2A 2BOPA 2IM0A 5MAOA 2C2MB 1VYAA 2VBZA 3T1AA 1RAFB 5C44K 2W4DA 3TFIA 1FKPA 2ZITA 2PSZA 3RG6A 5A0YA 4DN0A 3MCSA 2ASJA 1HARA 4FS2A 4ZLPA 1SJ4P 2NXCA 3K5LA 1I6VA 4DQQA 3M3YK 3CIMA 5H9EK 4CLYA 4HH1A 1U26A 2IM3A 2MZRA 3MPWA 3PX0A 3RW6A 4DR2F 3Q86A 2VA2A 1EKSA 3NLCA 3BBCA 1F93A 1B7FA 5DETA 1VQ8S 4NWBA 1SJRA 5I4MA 3H5XA 1WNEA 1WG5A 3IBWA 3I56S 1MMNA 2PA3A 3CJ0A 3AD7C 3HVTA 1VQ7S 2XMTA 2C28A 3TARA 3ZZUA 3PRDA 2FTRA 2MY7A 3MPVA 4FPRA 4F26A 4DV3J 1NO8A 3NEKA 1JLCB 1WKLA 4ZP6A 2OGUA 1RT4B 3WDOA 1S79A 2HWTA 1BJTA 4JI6F 1OS5A 4EBDA 4LQ3A 4DF4A 1JJ4A 3R2CJ 5ETMA 3VZIA 4C0HA 5B0CA 4LSLA 1W25A 1WOOA 1LWFA 1JKHB 3PRBA 4C7QA 4JV1A 2BZ2A 2Y3YA 5C4XK 2WB4A 1FXLA 2K06A 1JXLA 3IM8A 4RWWA 4Y34A 1S0OA 2M2BA 3EDRB 4M5NA 2UUTA 3PG9A 4CT8A 3TZZA 4NLUA 3OR1A 4Y2AA 3I0SA 3I4PA 2VODA 4M63A 4NCAA 2CJYB 4P73A 1ZETA 4KAWX 1VR6A 1YRTA 3JTNA 3H2UB 4NA2A 1NDCA 2OIHA 2H1YA 1KEKA 4IG3A 3QIPB 2B6AB 5IP7K 3QSYB 2LXIA 3C14B 2QYCA 3VR1A 3TZXA 4C8ZA 2MZQA 1X31C 4YOEA 2LA4A 2KL8A 3DGPA 4XPEA 2W8KA 2HBQB 2OAUA 4ECZA 3ZNJ1 4CP5A 2BX6A 3ILLA 3V6DA 4OJGA 3KLHB 1IBKF 2XMUA 1WD6A 2PMZL 1RADB 3PHTA 4HACB 3VA7A 3I0RB 2XYGB 2IVFB 3NWRA 4DPOA 1RDRA 3LH2S 2VFVA 1S1TA 1NXIA 4DV4F 2A68A 2I38A 4C0OC 1K44A 1ZTWA 1TP7A 5J2QB 2GSUA 3IC1A 2KZMA 4K4UA 2EC0A 4PABA 5HL8A 1IKXA 5SZTA 2DTJA 3LGNA 4DEZA 2XSJB 2LXUA 3E3XA 3VAGA 3M8YA 2PN6A 3HPOA 1LK7A 5ETVA 4U9RA 4DV5F 2QJ3A 5DS7A 3JQJA 1HI1A 3NXZA 1SI9A 2ATLA 2ZOGA 1R9TK 4CH1A 2NZ4A 2NVTK 4O3QA 3QGGA 4AL7A 4DR7F 2B7BB 4USUA 2R93K 4I6AA 3AOCA 1YBAA 3TA1A 1TL3B 2P9EA 2GIFA 2PFFB 2G1HA 3W63A 4Y6IA 2YNGA 4U7UK 4O3OA 2DGWA 2QIFA 5LMNF 4KR0B 4ZPCA 3Q8YA 1YJNS 2BKPA 5TMFA 4R0EA 4RMFA 2ZOMA 3F73A 4B3OA 3DDKA 2LQ9A 4IR9A 1UTAA 2IBOA 1FI4A 4LF6J 5SUHA 2HS0A 2GGPB 2I0XA 3A3NB 4LVOP 4NX9A 1A0OB 1B0PA 3BP8C 2QL9B 2BKOA 2YVSA 4Q0BB 2MQ8A 3WBZA 1WQFA 4WU3A 4USHA 4GVLA 1IBLJ 3BGFA 3S1QK 3UPFA 2FJEB 1GMUA 1S57A 2K3IA 3L9ZA 4RW7B 4I2PB 3C16A 2LVWA 1FD2A 3IBFB 1EB0A 1KTVA 2J0QD 2ZE2B 5F41A 3HKZL 4P5AA 5AXLA 3ZXWA 1WHYA 3H3VL 4CDIA 3Q8PB 1QVFR 2WVDA 2NVYC 1DTTB 5K8PA 1FKPB 5A0YB 2FHMA 3TW0A 3MAQA 5DDOC 3M4OK 1UWBA 2X1FA 1CJTA 1UJ5A 4KGMA 3W2VA 1HQMA 2LYVA 5B0BA 2KFYA 4X62F 2JVOA 1KTQA 3CDBA 4CTAA 4K50A 3RTVA 5B0EA 1U49A 3IRWP 4KKOA 1R8PA 1WCMK 3LPXA 3ITHA 2IHR1 4JI8J 3LA0A 1H74A 3OQ2A 3CO0P 3PIOQ 1Q5VA 1NHKL 1IUJA 3MR2A 3I4NC 1QD1A 8RUCA 3HVTB 4QPXA 2W9CB 2FY1A 1RGVA 4MJKA 4UOGA 3GMGA 3MM7B 3BGOP 3GTQA 1WDDA 5A6PA 1NDLA 4FXVA 3NGDA 4J9LA 5M5XK 3FC9A 4X64F 4OI2A 2ASLA 4EBCA 1XXCA 4EO8A 4X2BA 4LSLB 1LWFB 4MKBA 4J91A 2YWEA 3PYFA 3DM2A 5KFIA 4Q43A 4DS5A 3D0IE 3CPWR 2E2HK 2RQKA 3MUVP 4QWDA 2JA8C 5DDPC 1REVB 4RNNA 2L08A 1NJZA 4MAKA 3OTOJ 3RRKA 2PFDA 4NLRA 1Q8IA 2JA7K 1I94F 1RSCA 4IG3B 4WZQA 3N0CA 1Q1KA 2AX1A 3KK3A 4RBTA 3RYLA 3T01A 3GP9A 4F67A 2MKYA 1F5AA 4Q5VA 5EGHA 4WJ4A 3QZ7A 2D3OR 4KJIA 4ICLA 3S15C 3V6DB 4RW8A 5A8RA 3D6FB 2VG5A 2G4BA 1ZYRA 4ZITA 1HQUA 4OYXA 1JLAA 2EBGA 2KXFA 3CDEA 3O8WA 3LAJA 3H90A 1L3SA 2AEFA 1S1TB 2IMWP 2O5JA 3W60A 1VQ9S 4YR3A 2IDEA 1U0HA 3QT8A 3QRQA 3VAFA 1IKXB 1BY9A 2PGCA 4WYWA 2GO9A 1FT8A 3MD3A 3OW2R 2EFPA 1T9WA 2W4CA 5E3AA 2GQ2A 4M5DB 2BANA 3HHNB 4P5BA 1BGWA 1UCNA 1OYDA 3R6GB 2N3OA 1M90T 2LU2A 4DV1J 4O23A 4X4RA 2EK6A 3TTGA 2JA5A 4IQXA 2XZDB 2FJVA 2K1RA 4G7ZA 1UEVA 3CCUS 4LF9F 2WSCC 1SJ3P 2FQTA 1IL2A 3HK2A 4FYYB 2CPFA 4F0KA 1K9MT 3ZZPA 4WP9A 4ECVA 5GAEI 2YTCA 1NSAA 2HWIA 7AT1B 3VQTA 1ZVUA 1KQSR 1OPZA 1FDDA 2M9KA 4GTFA 4K4VA 3T9NA 4TKTA 5KG2A 3PXGa 3C66A 4NA1A 1N36F 1WC0A 3SQGA 4Z7CA 5CZVA 3K7RA 4DMZA 2XLJA 5IT9Y 4YHHF 3LPYA 1YBTA 2A3JA 1OO0B 1U45A 1SPBP 2AYMA 2POKA 2IJNA 2BJDA 2E44A 2E5JA 2WOMB 5DLGA 2AKWB 3LGMA 2VICA 4J9UE 4XSXA 2DY9A 1P1TA 1A7GE 2JC0A 4CYUA 1MU2A 5HQ8A 2H48B 2A2CA 2DHHA 3R5JB 2UU9J 4DSEA 4CWBA 1DJ0A 3N0BA 3GTJA 3BUEA 3B78A 3Q8QB 2V2QA 5HMYA 1WIHA 3BKUA 3GEEA 2ERRA 1SBRA 5L46A 2JL9A 4FF4A 4IH7A 1PYOB 1CJTB 1REGX 3CCTA 3M2UB 1FKAF 4Q44A 4JI2F 1ZQ1C 4CTAB 2QO3A 2CZVC 2PEHA 2LLZA 4YFXA 4YB5A 2PMHA 3I55S 3MF5A 1TELA 1TMMA 4XK8C 4TYBA 5HROB 3GSIA 3DOMB 3S1NC 3ITHB 4OZ1A 3IBCB 3CCLS 4MTPA 1N34F 3N9UC 3HT0A 4A8MP 2BOAA 4ILRA 2OPRA 4MK9A 1O8BA 3QGHA 4LR2A 3JS9A 3BBBA 4OINA 4QOTA 3GDZA 3KDOA 4AYBD 3BPSP 2P8IA 4QIEA 2O1PA 1UVLA 2WBMA 4QPTA 2H3EB 4RLEA 1UPMB 2A69A 4A3CK 1T3NA 1B7YB 2F65A 4P7TA 2VQEF 4FF1A 4QCLA 1NJIT 2E5HA 5A8KA 3BO4A 2MLZA 5KFAA 2ZH2A 1C0AA 2CNOB 3D2WA 1YJ9S 3CCMS 4BBRC 3UVJA 5KFCA 3MM5B 1NEEA 1N5YB 3R7SB 1XXAA 1LWCA 1CULA 4OIQA 2ACYA 4WF9Q 3TUJC 4USVA 3CT9A 3NNCA 2KU7A 3IR5B 4FYXB 2YH0A 5C2GA 2XS2A 5L9NA 2N3LA 4PPDA 2WAQL 1VGXA 4A3LK 1TL1A 3KK3B 2CPIA 1ZH5A 1RT6A 3IG1A 4OYZA 4ES3A 4DR3J 2FC9A 3MPUB 2MZTA 3MR3A 1BQMA 3UNGC 4RUHA 4ICLB 1VQ4S 3FGVA 4LF7F 3T02A 5EWEA 4RW8B 2J0XA 5HVFA 1GMWD 3V6JA 4Q5SA 2DR7A 4BC9A 1HQUB 5C7PA 1JLAB 4DXLA 1MSWD 1HBUB 4C3LA 5CAAA 4I6YA 4WJ3M 1NK8A 1H2TZ 1WKKA 3PW2A 2CWXA 1K83K 2CPDA 5C44C 3QQCD 5HAOA 5ETKA 2CQ0A 5IWAJ 1B0VA 3D54A 2ZWOA 1TKZB 4DG1B 2ILZA 4G0VA 4A8QA 2RF2A 3A13A 1DLOA 5GAGU 2AU0A 1VS3A 3MEGA 2YU9K 1IR1A 1WI6A 1QAJA 1BXNA 3GIRA 3KG4A 2Y0BB 4ZCIA 4B3SJ 2HBZB 3N3YA 2J7KA 3M8QA 4CCHA 4OHVA 5IT4A 2QA4G 1R27B 1P6TA 5MLCV 3G6VA 4DCPB 1KOHA 2FLNA 2GJFA 1RT3A 3DDIA 3CNQP 1M0SA 2F4VJ 1P1LA 2QSFA 4G1QB 3V6HA 1USOA 2GCFA 4BLBA 3WX8A 3S1RC 4DV6F 1O25A 1RWKB 4OI0A 3MOJB 3W65A 3HVRA 3UD3P 4PCQA 1FDNA 3WC0A 2R8IA 2QMUB 3SQGB 2UXCJ 1LKZA 4IG0A 1RHUB 3UO0A 2D9OA 1NJXA 2E5LJ 3IRXA 3NOGA 2NREA 2ZZTA 1WDTA 1JQWA 2J0SD 4GKJF 4YB1P 1OY9A 1YQHA 5HK4A 5KFGA 4MT1A 4CH7A 4YS2A 4HHUA 2GA7A 3E01A 3H4BA 4F4XA 2E9ZA 1VBYA 3G9CA 5HMWA 1P8GA 3WQPA 5DRKA 2IJFA 2DB1A 2KT5A 4NOIA 4NRUA 2VUMA 4OHYA 4DUYF 2QFJA 2CQCA 3TAMA 2CQIA 4Y2KA 4DR5J 3TWZA 1S4EA 1MWYA 3D7SB 4ZK7M 2VU5A 4NYOA 1VOMA 4C8OA 2R92K 2FY8A 3S2DC 1T8EA 3AH5A 2XCPA 1IKWA 4Y65A 4AQYJ 2G1DA 5KT4A 2F63A 4FBUA 3RZOK 4C2MA 2CG8A 2E1RA 4KARA 1I3QA 1KNZA 4DSKA 5E3CA 4D3HA 4K4SA 4ZH4A 4KMAA 2B4OA 3GTMC 3T00A 2GZOA 3TZWA 2D9PA 2FGCA 2LXFA 2OSQA 4WXOA 3KLVA 1S5ZA 3W2WA 4PYDA 1VGYA 2AGOA 1BDFA 1LEOA 2H5EA 2DRDA 2MJNA 2OMOA 1UFKA 1XWLA 3N79A 4LFAJ 2OELA 1R8CA 5BJRA 1SC6A 2LDYA 4ZVOB 2OH2A 3EVOA 3NMAA 3LF0A 4WYLA 5CYMA 3S16K 1FDAA 2DNGA 2E2JC 4RWXA 4QIGA 2FC8A 4B9UA 3ERED 2UXDF 4Y2IA 1R9TC 8AT1B 2KM8C 4Z37A 5A8KB 2E7XA 4YUDA 2R93C 1R89A 1T7PA 3KLGA 3T1YJ 2NXJA 3UVJB 5IP9C 1PJ7A 1V3SA 3RBDA 1O28A 4ZVGA 4I6WA 1CULB 1NH7A 3HVAA 3J7A1 3I6PA 4C3IK 3OVBA 1YJVA 3PR4A 2F9DA 4DV7J 3MUMP 4QWAA 2E2IK 3M30A 3CCQS 1MW7A 3TRGA 4A3MK 3NWGA 3C46A 3KNAA 4GO7X 1HWUA 3QX3A 5AE1A 4U6PA 1FWPA 3W66A 1ELOA 3GCXP 3K89A 3W1YC 1BQMB 2V63A 3KLIA 2DHGA 1FE4A 4F7VA 3S1QC 1S6OA 2H65B 3G6ES 3CC2S 5IQ6A 3C15B 1IXKA 4KFBB 3HHLA 5B7WA 4P75A 2CQ3A 3PFOA 2ZVSA 3IWXA 4OZJA 5KFMA 4O3NA 3PO3K 1RAHB 5BYQA 5EN1A 1EH1A 2C2NA 2VQFJ 1CG2A 3GTJK 4UF4A 5E3RA 3Q8SB 4K4TA 5LSRA 2M52A 3Q83A 2ZEJA 4NXNJ 4B9TA 6FD1A 4CLPA 4ZPVR 2RF2B 5DDQC 1DLOB 4RBUA 1DCHA 1DCOA 2OSRA 1QAXA 4NE9C 4A8OA 1FRXA 2M88A 3MEGB 4PRFA 3BH7B 3QO9B 4B9SA 3DOKB 2ZBIA 3J7YU 1ZM4A 2PHCB 2NVQC 5LJ3Y 2UXBF 1SFOC 4GFQA 1V6HA 4OJ3A 2RU3A 2Y9HA 2R2RA 2IMOA 1TK8A 4OFZA 3CCZA 1RT3B 3W64A 2W24A 1FDBA 1UW4A 2JZ5A 4WILA 1RBAA 2FYXA 4G7OA 4LF8F 4DPXA 1IR0A 4KV8A 4N7TA 4DDQA 3A1YG 4ETXA 1GMVA 2EEYA 4DQPA 4M5JA 1JJCB 3DLKB 4A46A 1D1UA 2QV6A 2L9WA 5D4PA 3QPIA 3MAAA 1YHQS 4F0HA 2ZHOA 2WCXA 3X3UA 4AD6A 3IFEA 4C8LA 2B63K 2PA8D 2W7PA 3IA0A 2ZH8A 1KFDA 2E2HC 5ETOA 4G7HA 4NXMF 2AX0A 3R5DA 1S6PA 5B0AA 4YFNA 3BN7A 3V4MA 4N8NA 1IQTA 1HNWJ 2DNMA 5L9XA 4QWCA 3TAMB 5AXNA 1SUQA 4DV2F 2V6TA 4ITSA 4PXEA 4C45A 4WTYA 3POTA 4FDFA 2DNYA 2C2EA 1U2CA 1HW8A 3JQMA 1RWVB 3LAPA 3KG1A 5A6WA 1UVIA 4B3MF 2YKOA 4X66J 1X4CA 4F3MA 7FD1A 3QMQA 4G6VB 3PJXA 4ECQA 1URNA 4O4GA 4P7VA 5KFJA 2YWWA 2VG7A 2HHUA 3GLJA 1N5QA 1NMEB 1SQGA 2DNPA 3TVKA 3OXFA 2MJUA 3H0PA 2SXLA 4K0KF 1S9EB 4ZDNA 3NGUA 1EZZB 2BW7A 3EICA 4JV5J 5CYMB 1J27A 5HSPA 3FZ2A 1TAQA 2DRAA 4CH0S 1HR0F 3CB4A 1UWAA 5FJ4A 3TEHB 1LOUA 2W25A 3GYGA 3BO3A 4E0DA 2CJAA 1TWAC 3MMBA 2ZC4A 2WVFA 3KLGB 1VMBA 4OLPA 1RWUA 2E7WA 5KFWA 2AJ0A 3R7NB 3WX4A 1RLDA 3BSAA 2BYCA 3OXLA 4NCBA 3MPYA 4UY85 2A6HA 3UN5A 1A6LA 2NPIA 2ZFHA 3EPIA 3EGNA 4WK1A 1R8AA 3FBEA 3GFXA 1F6TA 1U1QA 3NBPA 2VL1A 3UDLA 4ED1A 4ZVPB 2FPHX 1KHVA 4YP3A 1OIAA 1RJJA 2Y8YA 3I4HX 3CW2C 2CQ2A 1Y9OA 3V4IB 4X4OA 2E5GA 3MUTP 2QMXA 5AJ3J 2QRRA 1Y11A 1QY7A 4DUTA 5AXMA 1NK4A 1RWNB 4ZJQA 4GZYA 3H98A 2XBPA 4USKA 5HQLA 2ALZA 1INNA 3GFZA 3SCIE 1UJ6A 3AJDA 5C24A 4TQRA 3DLGA 1FF2A 1WTFA 2I5JA 1H7XA 2G13A 4B17A 2CNLB 3JSBA 4JYAF 1FNXH 5IOLA 5HP1A 3BQ0A 3JAMU 1M5HA 3NCQA 1FJGF 1C4AA 2RE1A 3KHHA 1YTYA 1WHVA 2CNKB 3I4MK 5HO4A 5I42B 4BY1K 1S72S 2MKSA 1X4BA 3VTIA 1T9UA 5KFYA 4KATA 1IKYA 4AE5A 1TWHA 3DLEA 3K2YA 4YY3F 4XLNA 3MFIA 1JLBA 5LJ5Y 2F4VF 4FYDA 3U02A 1WUUA 4OZ2A 3MOZA 1Y5LB 3IR6B 3TJ9A 1RTDA 1R43A 2YNFB 2K7JA 4M94A 1Q16B 2QMWA 3H4DA 4B02A 3VQSA 3ZTSA 4KV8B 2HZCA 3GWCA 3R5BA 2NVYA 5DZ7A 2ZH7A 4WIQA 3TX0A 2AYEA 2ABYA 2DKOB 3TJ8A 4KGXB 4GVBB 5LXRA 3CDWA 2A6EA 3FEXB 4IR1A 5IM0A 1MMDA 2Z30B 2J6SA 2LQJA 4YQWA 2ZH6A 1Y00A 3JQKA 3SV4A 3B4DA 4HDGA 2YQ0A 1D9FA 1U2FA 2AWZA 1S6UA 3EGWB 4IOBA 2YKMA 4LLGA 1RCXB 3OL9A 5KFQA 1TK5A 1TFWA 3T9ZA 3JSTA 1X5OA 4AT1B 2VD3A 1TKTA 1VQLS 1IKVA 4O3SA 2CJKA 3KLEB 4QIWL 3B4MA 1EI6A 3DC2A 1ZTTA 1X9SA 3QGIA 4A3EC 3RZDK 4MK7A 4Q45A 4MIAA 4M95A 4ILDA 1RAIB 2WB1L 1TVRA 3POTB 1BWEA 4LF4F 4C98A 3BM7A 1Q79A 2OEMA 3A8KA 2IC3A 4PUOA 4LSNA 2KDOA 1I3OB 4OYPA 1S1XA 2N82B 1XMOJ 4BWMA 2MPUA 5GAGI 1KVKA 4LJZA 2IAJB 1YZ6A 1ITPA 4I7FA 2VOPA 2V4QA 1YJWS 4KGVB 3BYRA 4ATNA 1JJ2R 1RTHB 3OJUA 2V8HA 1X60A 5DDRC 3E51A 5DZ6A 3D1HA 2YKAA 1SQEA 3D67A 2LA6A 4K59A 4TN2A 5D4LA 3H0GC 2GNKA 3D0HE 1F5BA 1R0BG 1IBAA 1F9HA 3MM8A 2ZNZA 1F2HA 1GTHA 3MMBB 5F3TA 3GTKC 2KZZA 3L3CA 4WIIA 2XI3A 3I5BA 1H38A 2Y0SD 1N88A 4PZVA 2UUCJ 4QBUA 2Z58B 5IV4A 2HLTA 3SCLE 1GAOA 3HSDA 5J1PA 4YR2A 3CJ8A 1JX4A 3P5TL 4F04B 4WKRA 4PEOA 1F1BB 3CC4S 2GVZA 4UQTA 3KK1A 1UVKA 1XZPA 4FKYA 3ETOA 3CJQA 2R7ZC 3JSMA 4LUBA 3MEKA 3CDAA 2H9ZA 1VQ5S 1NK6A 2Y1IA 1U1RA 2JA6K 4NLQA 1DARA 2DGUA 2ZBRA 4XO0A 4NLXA 1EARA 5DM6Q 3ZNUA 4JI7F 1CJKA 4F36A 3PW5A 4DBQA 4HI2A 3M05A 2L48A 3G82A 3ETMA 4OI1A 4ZJOA 2DHXA 3DLGB 2BQ3A 4DF8A 1ZYQA 2EKYA 2RHQB 2I5JB 3CULA 2DH8A 2DGQA 1E6YA 1U24A 4G1IA 4P9SA 2R92C 2CAJA 5D0GA 4OJ1A 3N6LA 1VRQC 1NHUA 3MAHA 4MKYA 1LWEB 2J8SA 3W5XA 2L41A 1QUVA 3CO9A 2HS3A 2YKQA 3NGSA 1KKHA 4DSJA 2HNDA 3DLEB 1JLBB 3J7Z5 3ICLA 1YNNA 1JWWA 2R8GA 4RUAA 2C3PA 3D28A 1NZ8A 3GSDA 2ZKTA 4CNZA 3V81A 2NZCA 2HRUA 4XLPA 1RTDB 3GG1A 2OTJS 3KUEA 3HFZB 1Y4ZB 1KQFB 4R8UA 4LSZB 1TWCC 1KFSA 1HQEB 2B3TB 1JLGA 4YDDB 2AT1B 2MB0B 3QAEA 4QWBA 4C8YA 2GJ2A 2BM0A 1USMA 2VPYB 2VPWB 3M8ZA 2YKMB 3NAHA 3GILA 2R8JA 3AD9C 5F3ZA 1FCAA 3SFUA 4NYPA 3M6WA 1IKVB 1MWQA 1QDUB 1HYSA 1MROA 2B9XA 4RUBA 4ZA1A 1HNWF 3PO2C 2C1EB 1K1SA 3OXGA 1X5PA 2GSOA 3O6QA 3ZZZA 4QIFA 1EAYC 3N01A 1TVRB 3CJ5A 2R7WA 5IS2A 1J6XA 4OYIA 4EU0A 4J9KA 1I6HK 3J81j 2IC3B 2DPJA 4PUOB 4LSNB 3W5ZA 1V5VA 4KMDA 3NMRA 2BDPA 1S1XB 2VJVA 5DO2A 1SC1B 1QVGR 5DGBA 4OYWA 2X1AA 1F9EB 3JTOA 3RAMA 1FTRA 4ZPAA 4A93C 1S6QA 4I7FB 5DLFA 5IQQA 4LT6A 5HLFB 2VPXB 4CO5A 4DR2J 2JRSA 1RISA 2UZAA 5JUMA 3GTPC 1SKRA 4YMEA 3FMWA 3OFGA 2PO4A 4Y2CA 4JV5F 1DTQB 1J98A 2Z4PA 3HXAA 2J9EA 1OSCA 3N5FA 3SXLA 2JEGA 3BSOA 3KFWX 2CPYA 3EWGA 1VH2A 2BJ3A 2HFVA 1R8HA 1YX2A 3RB4A 2W8LA 5E68A 3MM8B 4RJVA 1NSQA 1IBCB 4ZP8A 5DQIA 4TY8A 5FLXY 3VZHA 5E3PA 2VG6B 2FVCA 4JI6J 3FCWA 1S99A 4A3BC 1X4GA 2BJ9A 2YPZA 5M5WK 3LP2B 1PAEX 4RO0A 4J9RA 1D3WA 3HFKA 1BS2A 1U1OA 2FJAB 1YRUA 3CD7A 2IRUA 3PYEA 2NVYK 3EUNA 1XZPB 3AFGA 3HMJG 1VQMS 1HBOA 2QE5A 2CDQA 1S10A 3MFHA 2QT7A 3G2XA 1S9GA 4ECXA 1HNXF 1J6VA 5B09A 1KS2A 2B63C 3Q8UA 2W01A 2ZFZA 3Q2TC 1CJKB 2OEKA 3VF0B 1JXEA 1PGZA 2F8HA 1O5JA 1VQNS 3G82B 2ZUAA 1EK8A 2ZH4A 1IBKJ 2N4DA 2ADCA 2F8EX 3CSKA 2FQOA 2G0JA 1O51A 4JK1A 5A2QU 5IV3A 1C1BB 1E6VA 4ZLNA 4DV4J 3I4NK 1S97A 1H3DA 2AJ2A 1E6YB 3M8SA 2APOA 4QYZJ 5KFLA 4PXBA 1NJWA 1NB7A 4IKAA 3I96A 3NCPA 3MM9A 3T6JA 1NSPA 1AFJA 4LRBA 4O2DA 2MKCA 3T3FA 1HBNB 1SB6A 5C25A 1J2VA 1CQNA 1PJ6A 3QSIA 3AY0A 2MHNA 4DV5J 2OPSB 1TWGC 1YJUA 2W2PP 2HNDB 1CC8A 1S48A 2HIQA 1UFLA 3OPKA 2FHJD 3OEPA 3DRYA 5GMEA 3U1MA 1DAXA 2JH3A 3V81B 4Y7NC 1FK9A 2CFXA 5KG5A 1ZM9A 5KOWA 4HLBA 3PEHA 4NCGA 2JA8K 2CADA 1FA0A 1NPRA 3BGRA 4KE5A 2MQMA 2PIIA 1EQRA 5GMDA 3FSYA 1O2BA 1O6XA 3DFEA 1JJHA 3A4TA 2QYGA 2ADBA 3ILIA 2HMIA 3HZGA 2FZGB 4KM8A 2FVQA 1KQGB 1CVJA 1P9YA 1XZQB 2FLLA 4HR2A 1RTZA 2RAQA 3VCDA 3EZUA 5K14B 1N6QA 4HVZA 2JJ4D 3S8SA 3GTMA 3TQ1A 1VLYA 3S15K 2D3O1 2VFTA 5ADZA 3UDEA 3MMCA 3RBEA 3EQLA 3VHQA 3SMZA 3KXDA 1Z1ZA 3GR1A 3FUYA 3M1VA 3WIUA 3SIPB 4N41A 3OVSA 1VFJA 5IXUA 2V94A 3BR9A 1S77D 4RNMA 1S0VA 1KR4A 2XGPA 1ZA2B 4JUZA 5JJBA 4DFMA 2XYHB 1XMOF 3BS9A 2ZJPQ 1UEKA 1FEEA 1TAUA 4CO1A 1SKSA 3MHYA 1R9TA 2W9BB 4X62J 2H5IB 2R93A 4KH1B 1ZZNA 1UPPA 2IVYA 5KAKA 1R0AA 2PEBA 2Q66A 4L6V3 2RQMA 2HVEA 1IM4A 1S6QB 3I5AA 2B4VA 2LDIA 2D41A 3CMQA 3ENQA 3QAUA 3W9IA 5D0RA 4U96A 4ID5A 1RABB 4KN4A 3UDCA 4JI4F 3W3SA 4ZMMA 4X4PA 2FVSA 4OYMA 1V3ZA 3ISNC 2RU9A 1Z4UA 2OEJA 1YK9A 2MGZB 3WODA 3B82A 2EFGA 3I4MC 3M32A 1IQZA 2V9KA 1OQ6A 3MWBA 5C2CA 1RT4A 3CQZK 1J5OB 3T6BA 3IWLA 3R6LB 2MEWA 2QL5B 4C4WA 2IVMA 2UUCF 1HHSA 1X4FA 2MMYA 4X64J 2RSQA 2O5DA 5GAEU 4BBSC 4PG8A 4Y00A 2KWAA 1JKHA 1AYEA 3ILJA 2IM1A 2B9YA 1H7WA 4CLKA 2PMZD 3R9LA 5KFVA 3A3OB 2BUNA 3HO1A 1W2BR 1WELA 2KYZA 2BE9B 3ZO7A 1HNIA 1H98A 4QU7A 2E1CA 3D6TB 4TU9A 1GX5A 1HBOB 2IFXA 1UETA 1I94J 1KDNA 4ED0A 1DD5A 2DY1A 5HI7A 4GMKA 4I2QA 3JSRA 5B0GA 2R7XA 2E7VA 3GJTB 3M7VA 2HSEB 4ZVQB 4DL0C 2FJXA 2MQOA 3KLHA 2IJRA 1WCMA 4KPYA 4L76A 4HACA 3S1NK 3I0RA 2E9RX 1EQ0A 4I4BA 3DDNA 3MM6B 1L3VA 1S1VB 5ETNA 4I68A 3X1LB 4MMOA 5LMUF 4OX9F 3MZIA 2HFOA 2Z2ZA 5J2QA 1L5UA 3NS6A 1E6VB 4M5MA 4TU8A 3P6YC 4ZPDA 2IPOB 3QFWA 1BMQB 4WJBA 1SL0A 3MM9B 1HNVA 2MZJA 2OFGX 2J0WA 5C25B 4FNHA 3AXMA 3RB3A 3QRRA 2CZ4A 2EG1A 3KUHA 4TQSA 3I32A 2RS8A 1VJEA 2D6FC 3HLUA 5K8OA 1RAJA 2BBEA 1EETA 5KFBA 3P96A 3QNWB 3BH6B 4DL5A 3PHEA 2NYHA 3JYTA 3FFIA 2HBRB 4BCAA 1FK9B 2E2HA 1IM6A 3V2UC 2BABA 2UVUA 3JTPA 2VASA 1KC8T 1KD1T 1N54B 4NCGB 1WC3A 4FYWB 1CC7A 2WSFC 1T05B 2EKNA 2HNZB 1FX2A 3BGRB 3RUBL 5D0HA 4KO0A 4L73A 2R7UA 2O3DA 3VV2B 1UEUA 3OSPA 2CG4A 2JA7A 4BLAA 3HKZD 1D0EA 3H3VD 2GGPA 1UP1A 2IDLA 2HMIB 2VH7A 5ETTA 3PTWA 4KB7A 3HHEA 3UN2A 3F41A 4FVCA 4Q0BA 3UCGA 1N36J 3N6MA 5L8RC 3RRHA 4UZBA 2KN4A 1Q8LA 1N6QB 5EGYA 4FZBA 2NUUG 5L1KA 1B99A 3IM9A 1FXRA 3D0GE 3PW7A 4RW7A 1HD0A 4I2PA 2IYIA 3VAJA 3MMCB 2D3ZA 3THVA 3RU0A 1AA1B 3PYDA 1RWWB 5IOQA 3DLBA 5HJYA 2XY5A 1SC4B 3LQVA 4F0MA 4ECSA 3M1VB 3B6BA 1X0FA 3BSCA 2J6TA 2Q1LA 1WF2A 3TJAA 3PKYA 1DTTA 1KWMA 3PJ9A 2EI5A 2HFZA 1X8DA 4DLGA 4DFKA 1RT5B 4XDCA 3KMQA 1G3OA 2VONA 2BM1A 4V1Ak 4KSEB 4X6AK 2DXFA 2JA6C 2EBBA 3IAM9 4LRFA 5E33A 3N5BA 2KM8B 3CC7S 1X4DA 4JI2J 1TWAA 1HHTP 4NRTA 1HA1A 1R0AB 1T0TV 3SFGA 3G8TA 1Y3KA 2FHKA 2DNKA 3TUZC 1JB0C 5IYDK 4PR6A 1KRPA 3RR8A 4ID5B 3OTEA 3M6UA 2CJQA 2FB0A 1WORA 5ETLA 1G6BA 1YJ7A 1N34J 2GIQA 3LP0B 3M8WA 2YQ3A 2BA9A 1GX6A 2XNQA 2DNHA 1CPZA 2V5HG 1N5TA 2W9CA 4QW8A 3HKWA 3S1RK 2R7RA 1AZSA 1XERA 3ELHA 3MM7A 1FD8A 2DHAA 2R7TA 2MLXA 3FBFA 4LRCA 3GYXB 4Y0FA 2X7IA 5D8HB 3M32B 4X4VA 1N48A 1T9TA 5D4OA 2NXNA 4C8NA 5L1JA 3BR8A 1NRKA 2E1PA 2VQEJ 3OLBA 4ED8A 1RXOB 4RW9B 4ANDA 2PI4A 2WW8A 4DL7A 3DXSX 2AQ4A 3RRGA 4K4XA 5K5MA 1UV7A 4OHXA 1C0TA 1JK9B 4W92B 5H1SV 4DL4A 4KT0C 2ZC3A 3EXCX 3C8YA 4I0WA 1EQMA 1REVA 4LK0A 1WSRA 2GC8A 2MQPA 2RH6A 1HNIB 4LF5F 2FGOA 4ALZA 4Y52C 1N32F 4LVNP 3S2DK 2FJBB 1V3RA 2XB2D 5IFMA 2GHPA 4WE1B 2WVCA 1OMSA 1OQ3A 2W7AA 1Y1VC 2LFVA 1KQ4A 4I2QB 3GTMK 3GFHA 2FHOB 4U7UD 4LREA 2P5MA 3VWSA 3FK4A 2W2OP 4LF7J 1RWPB 1N4LA 1LWXA 4P2SA 5LSOA 1FRJA 5T7LA 5TJ3A 3L4KA 3MEEA 2X1BA 3VGUA 1VIOA 4DPYA 1VHFA 3T5HA 4KN7A 5KFTA 4ZVRB 1HW9A 1SH0A 2Q6CA 1IBMF 2MKIA 4IFYB 4XDDA 2XTJP 3J7AN 3FSIA 2CQ4A 3Q8VA 1HNVB 2Y1LB 1I6HC 3O2IA 1Q95G 2E2JK 2IBKA 4M5DA 1IE0A 4J9MA 3MDFA 3VVUA 4J37A 3B8HA 4P2XA 1U6BA 3CCVS 1VI7A 4OZ3A 5J1EA 4KM9A 2J9DE 4H4OA 3SQOP 4A3JC 5G4DA 3S01A 3PV8A 1LFWA 3J81Y 1EETB 5CQGA 5IP9K 4KH0B 2J6UA 3JYTB 3FFIB 4DR4J 4TY9A 3V4GA 2P6SA 2ZJRQ 1ZPWX 1V9OA 1TUGB 1UJ4A 2UUWA 1NM2A 2DH9A 2RDIA 1PKUA 4J9QA 2PE8A 3F44A 2BXJA 2HK2A 2DIUA 4HHJA 3BKFA 4KO0B 1S0MA 5K8MA 2XULA 4B3RF 5L1IA 3WC2A 3H7HB 3GR0A 2DIVA 4DV6J 1GXUA 2ZH1A 5IOTA 4KHPF 2XCQA 4Y3CA 4YN3B 1VISA 2DR5A 3K7AC 2U2FA 4LFCJ 2Y1JA 2FZCB 3OR2B 3UFCX 2QLFB 3GIIA 3NGTA 1F3VA 3IR7B 4L72B 4ECTA 4WZMA 2WOMA 5FIIA 4GKJJ 1Y0HA 1RYRA 2UV8A 1M5VC 2R2SA 3NGRA 3BJYA 3P3DA 4NI2A 1K83A 2CQBA 3MR6A 5G0RB 2GQQA 3DKDA 5J2NA 3OLAA 1CSJA 4PAAA 4DUYJ 3OTDA 5F9NA 4IRDA 2XG8A 2CQPA 1RE1B 1K47A 4ZP7A 1ZAWA 2C2ZB 3M2UA 2JA5C 3VAHA 2YU9A 2K8GA 2CJBA 3GZ7A 5E7OB 2KO1A 2B43A 5DQHA 3PYGA 2NVQK 4LBPA 2HVIA 1DY3A 2HHHF 3PO5A 5HROA 1SFOK 3GTKA 3DOMA 3UE2A 1HMVA 2IIHA 3DYAB 4KRWA 1FTCA 1O26A 1S1WB 4PXCA 4NLYA 3P45B 3GTOK 3FCHA 1M1KT 4NZ0A 4KHRA 5A2QY 3CWJA 3AXKA 3M9NB 1H6KX 2I8EA 2MQLA 1BLUA 2LQ5A 3HHKA 1U6ZA 2GVDA 1AZSB 5B0FA 1H2UX 5CYQB 2VIHA 4FZVA 3K8VA 4GTEA 2R7ZA 2IM2A 3ISND 2HHTA 1RHMB 3FBCA 4URGA 2ILYA 1I50C 3UD5A 2B4UA 4YFKA 2WAQD 3GTLK 1PJ5A 4IDKA 4C3JC 1SV5B 2UXDJ 1P9QC 4ZCLA 3T1HJ 1HHQA 2P9CA 4ZJLA 4JV2A 3MCNA 5LM7E 1O2AA 1XK8A 1GNKA 2CVEA 4IOAQ 3VAIA 3AOBA 3MM5A 1N5YA 4BLGA 1C0TB 4L74A 4EUVA 3EVMA 2VDIA 4PQAA 3V6KA 3VAKA 4DPWA 1NK5A 4DSFA 3KK2B 3QJJA 1I6JA 4EGLA 4DN9A 3UQSA 1N5SA 2R92A 3HD2A 3N4WA 4H4MA 2ZUGA 5C3EC 3SZYA 2VBWA 4M5IA 2HZVA 5CD4A 3ZZYA 1WKJA 2ZBCA 4I64A 2C3YA 5T14A 1J5EF 4BWJA 3RR7A 3EGVA 4A47A 3TA2A 4TYAA 3CUNA 4OYBA 3HOWC 2KYXA 2VDHA 2G0CA 1ZM3A 3SSRA 3U27A 1WC1A 2FQQB 1HBUA 3OSNA 3FHZA 1VRUA 3CJTA 5T7LB 2HEKA 3ZZTA 3MEEB 2BJ8A 4IO1A 1A9NB 1SJQA 3CEDA 4DR1F 2HHVA 4PQUA 5M3MK 3QT5A 4ZVFA 1O0PA 1R0CB 3BYPA 4FM9A 4HT7A 1TKZA 4DG1A 1B4BA 4DQRA 4I56A 1PBAA 2R4FA 2DJWA 3QRPA 1TKXB 3CD6S 1RWMB 1XNQF 4FNIA 5L39A 3P4UB 2HQIA 4A3GC 1ZAXA 3CXCR 2JHEA 5D3GA 1SIZA 4JI3J 4ENOA 4J9NA 3PDNA 1TWAK 2KTQA 1YSJA 5J1EB 2M4MA 1NDPA 3F56A 4H4OB 2GJIA 2RUSA 3BEGB 2E29A 2RHSB 1S7HA 1CJVA 3O3LA 5KFEA 2UXBJ 2GW8A 4WKYA 2R2TA 3OFFA 1PAUB 4G1QA 2J5AA 1RLCL 1SH2A 5DG9A 2HVZA 5H9FJ 1FJCA 4WFXA 4BXXK 3HSJA 2E2IA 4TLRA 4CNYA 4LF8J 5E5NA 2QTWA 3A3PB 4NLSA 3NL0A 4F4YA 3GFYA 2AP6A 3G8SA 3FCVA 1CS4B 3UR0A 5E41A 4QJVB 5F9LA 3CCJS 2ZH9A 3CQZC 4ELTA 1JXVA 3S2HC 3GONA 2QLJB 1ZM2A 4MQ9A 1ICEB 1L3KA 1FRLA 4A8SA 1D09B 2YX7A 4EK2A 3CD0A 1QJHA 1WI8A 1KOOA 4NI2B 1FFGB 1RHRB 1NU4A 5JMNA 4LFBJ 2XMWA 2DGSA 5IC6B 4B08A 3GTPA 4NXMJ 3U1NA 4WK3A 2J9DA 5J2NB 2FLPA 1GE9A 1RQ0A 4KY3A 2NSCA 4DV2J 5EHHA 3J80Y 1F5CA 3NS5A 3ZTRA 2C2KB 4CO4A 4LMZA 2WVEA 4W98A 4G0UA 1RT7A 2GFFA 2HIYA 2F3JA 3FRYA 5CHCB 3Q89A 4B3MJ 3I87A 4KPCA 1HMVB 3BBFA 1GXTA 3L4JA 2JLEA 2VKRA 3MMAB 2V6SA 1HFEL 1S0NA 5D15A 1U09A 4MFBA 1DURA 1ACMB 4J9SA 2EVZA 2RB7A 3OJSA 5C4JC 4KC5A 1RKJA 2KG1A 2KFNA 2CPZA 4CLSA 1OWXA 3HOVC 3CJKB 2GVDB 2BE2A 4K0KJ 2WZ1A 4YG2A 3HCXA 1CLFA 1Z2ZA 1WQHA 5KFPA 3FKIC 5FLMC 3Q22A 5C5JA 4A3FC 2DNQA 1D9AA 3K57A 5HN0A 3K17A 4LIWA 2QLXA 1HR0J 4IDKB 1TR0A 4J90A 2B63A 1DHMA 4F3OA 2R7VA 3SI8A 1LW0B 2VUMC 3PX6A 1Y10A 1VQSA 1UZHA 1XPPA 3MD1A 3DRPA 3JXOA 1R7IA 4LJMA 2XY6A 1I3QC 1TWFK 3CVKA 4A3EK 2EFQA 3RAXA 4H4MB 1M1HA 3TVZA 2YNIA 3R3TA 4RR5A 1ZXOA 2L9NA 2HGLA 3R8YA 2X51A 4BY7C 2CPJA 2YY3A 2UVRA 3GIMA 3ULHA 1TWGA 4EWTA 1QSLA 3C15A 1L3UA 4YEAA 4KFBA 4LOWA 1VCTA 1F60B 1VRUB 3CCES 2ZM6F 5T41A 4DX7A 3TOQA 4C9DA 2O5IA 2LKZA 2V67A 5LSLA 4GO5X 4PQUB 2NXEA 3FOEA 3PM9A 4UTGA 2LCWA 3GQCA 4N76A 3Q23A 3TR5A 4LQYA 2HAFA 4A48A 3HVWA 3KYLA 2X3GA 3MGJA 4X4SA 1N33F 2LU1A 4CLUA 3AOAA 3LPEA 2BACA 4CO3A 3H2VE 4JYAJ 4Y28C 4X6AC 4YB7A 5FD1A 4ED4A 3H0GK 1ZS6A 4WWSA 2HQGA 4S0MA 1AB8A 3ONQA 2Z2YB 5D3GB 3QO9A 1IJEB 1UVMA 2IY5B 3DOKA 4GTDA 1FJGJ 3DLHA 5DQGA 1RU1A 2F5GA 4BBYA 4DR4F 3GTKK 1CJVB 4TVAB 5IC4B 2RRNA 1ZPVA 1Q7LB 4QR1A 1TL7A 4LQ9A 1RZMA 1S7IA 2R2UA 5IYDC 4YY3J 2K2PA 2ZDOA 1M5OC 1OPIA 2Z2MA 1ZZFA 4BS2A 2DGTA 2NCKL 2L3MA 3FOFA 2YNHB 2QC3A 3LOUA 2AJ4A 2A18A 3DLKA 4LFCF 3IS9B 3TAQA 2R7ZK 1Y3JA 1HWJA 5JVHQ 3SYZA 1QM9A 3ET6A 4PWDB 1RAGB 3H5UA 3HHLC 5I3UA 2I2YA 3EZ5A 3TI0A 3HT3A 3G96A 5RUBA 3M6XA 4GTAA 1LV5A 1Q0NA 4WPAA 3DI6A 1JMTA 4OYAA 1UW9A 2YXLA 1KBRA 3HFVA 4W4MA 1Q5YA 5FDLA 4ECRA 5KG6A 3HSZA 2RILA 4N47A 3AQOA 3ZTOA 3AH6A 1H73A 2HAIA 2ZBPA 2XHCA 2F7VA 3R5CA 4ERDA 4GKKF 2IA0A 1N5VA 5DJBA 2AZ3A 1WC4A 1XMQF 3CGIA 2FVPA 2B51A 4V19X 2BJ1A 1RT7B 3IAS9 4LF4J 2CYYA 4EYIB 3OV7A 2W2MP 2KB2A 3W8GA 3TA0A 4UW2A 5E0OA 4DQSA 1J6WA 1S12A 1TV6A 2P2CB 1OSDA 2WSEC 5HANA 1YKWA 4HYKA 1WC5A 3FJ2A 4OIPA 4MFBB 1UFWA 4JP8A 1Y1WK 3AT1B 4MYTA 1B70B 1S1UA 1S9EA 1RA7A 2DXDA 4AH6A 2BE2B 4B9MA 4JBCA 4WTOB 3A8EA 1TWCK 4NMXA 1VK3A 2D74B 3HOZC 3NAIA 1K0VA 2FUG9 3LANA 1K0TA 4EMDA 1GEHA 2DNOA 1UL3A 4OX7A 3T1HF 1FJ7A 1DQ9A 2I1RA 2KVIA 3L95X 4X65F 3EVWA 4K4YA 2DXEA 5GADI 1G1XA 3K5PA 2V8DA 3BQ2A 1X9MA 1O2FB 2QGFB 5F8HA 3BV8A 4ZS6A 3DRPB 1RU0A 1JLFA 2IA6A 4ZKAA 3PO2K 4DS4A 3KNGA 2VBXA 1YWXA 1LW2B 3SZ2A 1URRA 2UV8G 5CXTA 1FHTA 3DNCA 3EJMA 2DRBA 1UA1A 2XMKA 4LF2A 2NUHA 2YNIB 3CJ4A 2OUGA 1N52B 2HPUA 2U1AA 4RZRA 2V69A 2VFRA 1FEHA 4GRSA 4M8LA 2ZH3A 2GHWA 3HSGA 5HMZA 3GE9A 3D3BJ 1Q78A 2E1MC 3V4IA 1S9FA 4OI6A 4A93K 4BHQA 1TK0A 4RU9A 4JB8B 4DOZA 3EGZA 4JI7J 5HVGA 2ZNYA 2KH9A 1DRZA 2WK4A 4DU8A 4ZCKA 5KFKA 3GTPK 3AJ2A 2CXEA 4NLOA 2E66A 2JLFA 3CJ2A 3ENAA 2B0GA 5EX0A 8ATCB 2CVIA 2H4YB 4RBVA 5D0EA 4D3GA 3M2RA 4JI3F 2AYBA 1RT2B 5CCMA 2ASYA 2JSXA 1YDLA 1XTZA 3K5OA 1FWKA 3GEIA 5I42A 4ZN1A 7FDRA 2JVRA 3PJWA 2MDAA 5ETPA 5FLXU 4IO9Q 1VQYA 1WTBA 4LR7A 4P2MA 4DX6A 2YBVA 5IOSA 4L3NA 2KT3A 5BR8F 1TL7B 3IWNC 3GTOC 3OL7A 5IYCC 1HLWA 4A3BK 4ETZA 2AZ1A 3SZZA 2YNFA 3KG0A 3TZYA 2OPPA 2VV5A 2Z56B 4M5GA 1W26A 2C42A 2MZSA 4M5LA 4IFVB 4QIWD 2RD5C 4A3IK 1FKOB 3QJPA 4GVBA 2XMJA 2HHPA 4MH8A 1RBOB 3BPDA 2CQHA 3UI3A 4M5HA 3ET6B 2EXUA 2QA2A 3GTYX 2W2NP 3GTLC 3R5GA 4A8YA 5I3UB 4KB2A 1NPKA 2JA6A 4P2FA 2WB1D 4B3TF 3DI6B 2OMLA 3TP2A 4CRJA 1RAEB 4L3KA 3QJLA 4GC6A 1VJQA 4WFYA 2OJ3A 4IUFA 2JLGA 1WOPA 4F2RA 3UWTA 4HKQA 4LFBF 3HOXC 1FRIA 3DLJA 4BDPA 3KLEA 5FDLB 5KFUA 2ZHAA 3D3CJ 2HVHA 1HKAA 4DSLA 1JVIA 3ENWA 3SSQA 2VFUA 2WRMA 3ZTQA 2RDDA 3DRXA 3EM1A 3FVYA 1IQ0A 2R9LA 5D77A 4OIXA 1TWHC 4DL6A 4DJBA 3GG0A 3OPFA 1QSYA 2HVDA 3VALA 3C3LA 4Q7AA 3BGUA 3G4SS 2ZBQA 5KTQA 1TWGK 3M9OB 4Z7YA 1QLNA 3DRSA 3QIDA 2KXHA 1TV6B 4JI1F 2IAJA 2BMBA 5K8NA 3WZ0A 2YKPA 4RX6A 3GCWP 2XEXA 5KFRA 2R7OA 1TU0B 4Y7NK 4OZ5A 2HFNA 1XR6A 5GAHU 1RTHA 3DCAA 1S1UB 2D1CA 4CLTA 3C2PA 5AE3A 4OZNA 2VOOA 1HBMA 2Q3PA 3QZ8A 4CM2A 2J7WA 1WEYA 2BJ7A 1T94A 1QE1A 5H9EJ 3LALA 1U4BA 3O1LA 2LQBA 2F8MA 2C3OA 5B0DA 5HBMA 2GSNA 2LQ8A 1Y1VA 1GMWA 4JI0J 2QX0A 4X4UA 2AJ1A 2BKNA 2KJVA 1TL5A 2XS5A 2QEXS 1RK8A 1VQPS 5M2UA 2VB6A 4RKUC 1KLNA 1WF0A 5BYRA 1EFWA 4ZIWA 4MIBA 1JLFB 3M6VA 4DHVA 1SXLA 4IQMA 2NPFA 2M70A 2QA4S 2JEJA 4I1TA 4BXXC 1ZA1B 3DU5A 3OHBA 1BGXT 4USIA 4KHMA 3K59A 2R7SA 3K5MA 4C3HK 4IYQA 1NPPA 3E8OA 2HHSA 3FEZA 3GIKA 1MMLA 1ZOTA 3S17K 3OTBA 4DSIA 3H25A 4CQ1A 3K58A 4DQIA 2Z57B 1RT1A 3BDEA 1I1GA 2WW4A 4K8RA 4LRAA 1HNXJ 4A8XA 2KKHA 3OR1B 3ZTPA 3I0SB 4FN5A 2DNRA 1GH8A 2NVXC 3S1MC 5DG8A 5EWFA 4USWA 3OTCA 1PBUA 2XMVA 2P8TA 4JI5F 2A6MA 3CD5A 1HNZF 1XNRF 2RH3A 2VUGA 3UNYA 4ZVUB 1TZ0A 2OI2A 1XXBA 1DCPA 3PRVA 3AD8C 3DGPB 3M2RB 3NP5A 3UR3C 4MEXA 1LNQA 3NCRA 3QFHA 3CCRS 3V5RA 1YCLA 4OX8A 1JNZB 1LWEA 1K73T 5D4DA 2BV3A 1Z2LA 3VGTA 3GTGK 2O66A 1GXLA 1WOSA 4O0NA 4FXWA 4OIOA 2UUAF 5THWA 4BBSK 1KN6A 2HWHA 3AAWB 4DR6F 3MCOA 4K5RA 1EJ7L 3AODA 5JVGQ 2OPPB 3HZEA 3CMAS 1RHJB 1HIYA 4P52A 3A8IA 3H42A 2HHWA 2AW0A 1HQEA 2COLA 1LQ9A 2CW0A 2F4FA 1O24A 4LBHA 3GV5B 2CPHA 4P10A 2V8VA 1YLXA 3Q24A 1WEZA 2BEFA 4ZLJA 3Q3QA 2YNGB 1FRMA 4HHHA 4DCJB 3HHLD 4FKXA 3G71S 2QA1A 4B3OB 2CJXB 4LK1A 2LP4A 4BC7A 2RUGA 3MURP 2VF3A 4ID8A 3EDQB 1FXDA 2HGMA 3LGHA 3KWMA 2GAGC 4W90B 1XQIA 1VQ6S 4EI2A 3TUIC 1TWFC 2GMHA 2MQQA 3C6TA 4H4KC 4ECYA 4GTLA 4X4NA 3C16B 2HBYB 1APSA 1KQKA 3QGPA 1I50A 1IWAA 3WIVA 2H5JB 3BGLA 3DMJA 2AMCB 1T03A 2V68A 1RU2A 3IGVA 4K2XA 2V0NA 3DRSB 4QW9A 2IYGA 1NNDA 1UVJA 4FYVB 1AT1B 4WFZA 1VQOS 3T5LA 2ZHBA 5J2PA 5CHPA 5E3QA 2QLBB 3IN5A 1XJWB 5M2RA 2ZKUA 5HLFA 1WJ9A 3KTQA 5F8GA 1UWBB 5KG7A 3NNHA 2JNJA 2HRYA 3W2VB 1T11A 4X4TA 4G1PA 4GTBA 3BQ1A 2N7CA 4ILMA 2EW9A 1DTQA 3K0JA 4C48A 4F2SA 4GTCA 3HD1A 3CJSA 4Q8FA 4GC7A 3HXMA 4QU6A 2DBBA 2EFNA 2RVJA 1HBMB 1QE1B 4JI4J 2RGRA 2C3MA 1NUEA 1S49A 3TAPA 4KKOB 1PG5B 2V8GA 1SJFA 2GX8A 3D9BA 1EKRA 4USMA 2DCUB 5HBMB 3OL8A 3Q2SC 2V6UA 3MPDA 1CJUA 5HATA 1HI9A 1X9WA 5J1NA 1S76D 3RZAA 3CE8A 2VG6A 1GTEA 1IJFB 3CIZA 1WC6A 1HWLA 4I69A 4E2FB 3TEGA 3HULA 3LP2A 1B4AA 2PDAA 4DV3F 3PY8A 4F3QA 2O67A 4EZ9A 1LXNA 4CLWA 3P49B 3MEDA 3D1QA 1RB0A 1EX8A 4NLVA 1TL4A 4NLTA 3RAQA 4WCEQ 4F4KA 2UVWA 2CQGA 1RYSA 1F7VA 5GVQA 3BP3A 4MKAA 4OJHA 2ZD1A 1PC5A 4J9OA 3DM2B 4KDDA 1X0PA 1TUWA 2JFDA 3MI7X 4YFUA 1RT1B 2V2KA 3W62A 4DU7A 1FO1A 1M1GA 3L7UA 6AT1B 4G0WA 2FLOA 2XYPB 1VC5A 3LAMA 1PIEA 2K3KA 2XQCA 1NB2A 2CPEA 2EC2A 1C1BA 5LMUJ 4QYZK 2B9WA 4OX9J 3R1HA 2V50A 1FRHA 4KMHA 3IXQA 3M9MB 3W9JA 3L4BC 3SEOA 3HF5A 2H54B 3CMES 1RCOB 1HBNA 5A8RB 2VG5B 1CBKA 4ZLLA 2AHOB 3CQZA 2V6AA 2OPSA 3M8PA 5L1LA 4RUCA 3PNIA 5CD4H 3DXBA 1MN9A 3DXJA 2ZJQQ 3D6MB 3CCSS 1U0HB 1NKCA 4P72A 4UUXA 4ZPBA 2A10A 1Y1WC 5LL6d 3GU0A 2MKJA 2R8HA 1JOEA 1HQ2A 1Q4RA 4DFJA 2BANB 4IRCA 4MIWA 3M3YC 2O01C 1WG1A 2AEJA 2A6OA 4ANCA 4Y52K 2ZZNA 1WG4A 1ZBTA 3GV8B 3BN4A 1XZQA 5CA5A 2K1RB 5K14A 1Y1VK 4K4WA 1U0SA 3EZOA 4Q2LA 3RBXA 2DGOA 1D9DA 1AW0A 1G51A 4HTIA 2XC9A 4O4RA 2AD9A 4WFBQ 4LF6F 4IRKA 4V19J 2C3UA 4RNFA 2HG4A 3BZQA 5HVHA 2OO4A 2CUYA 3AB4B 1YITS 2F1FA 2NR0A 1SMYA 1V5IB 1YJRA 2DO0A 1MG7A 1R3NA 3GTQK 3MMLB 2MHEA 1YIJS 2BE7D 1IBLF 3C6TB 2V34A 2A0FB 2CKWA 4JV0A 2B8QA 2XCAA 4YB6A 3O5TB 1TTHB 1Q82T 3FKIA 5KT7A 4KQZA 3C19A 2R8KA 2XWYA 2BQRA 2V4RA 5C4XC 4CYUB 3DMJB 2W9BA 1MU2B 3H2LA 1T03B 2QZ8A 1ISEA 4ILLA 1R31A 4P6QA 1R8BA 1NK0A 2DVIA 3R7BB 4A3JK 1BUXA 1SH3A 1XBWA 4CLFA 3J81U 4ED7A 1U25A 3D1OA 5J2PB 4EZ6A 4IOCQ 2D69A 3I5CA 2Z0GA 2RT3A 1VQKS 1XEZA 5IP7C 5KT6A 3UDVA 2IRYA 1SVDA 2BRLA 4RNHA 4X4QA 3ENVA 2EPIA 4C8KA 1XR5A 1CQMA 3SCKE 2OPQA 3G87A 3VAMA 1UVNA 1F2GA 4P71A 4JI8F 2MGZA 1RAAB 3JB9k 1VLOA 4JI0F 2XY7A 4DZ6A 2XS7A 3K7AK 1QAYA 3BO2A 1J5OA 3S7RA 2AGPA 3Q0AA 4BKWA 2GS8A 1CJUB 2OPRB 4HTJA 2QN6B 4DL2A 3NKYA 3G4AA 4A8KA 1G2EA 2PC6A 5ITHA 2KRBA 2BRKA 4UOHA 1RWXB 1NDKA 4YR0A 3MEDB 5I3PA 2AJFE 5KFXA 4A3IC 5F8NA 1EP4A 1X4EA 2NVTC 1U02A 4MYUA 3PZPA 2LEPA 1RTJA 4LF5J 2VPZB 2RRBA 2ZD1B 2MSTA 3BKTA 2JA5K 1N32J 5K20B 3MR7A 2HQ3A 4AL5A 2VKZG 4AYBL 3Q8RB 1NJYA 3F0NA 2GV1A 1LWCB 3OTOF 1R6YA 4OV1A 4R5PA 2XGQA 2I6WA 4RU2A 1W2IA 2HRTA 4B9NA 2NXUA 3RBZA 3MM6A 1S1VA 4ER8A 1Y5NB 4ED5A 4NYZA 3GEHA 1TL1B 3OD2A 5F8JA 1C1CA 1RT6B 3IG1B 1OJ4A 3MR5A 4TLQA 4ZPTR 2ZWPA 1AB4A 9RUBA 1IBMJ 1ROFA 1VRTA 2L9DA 3H59A 3CDUA 2MTLA 2M8HA 3FBBA 5F8LA 1C4CA 5GAHI 4B9VA 5BYSA 2GIRA 3NGKA 1I50K 2V4JA 3RB6A 5DGAA 3M8PB 3D5MA 4C3JK 1XMBA 4PPZA 2Q79A 2V2VA 3DU6A 1GK8A 1I51B 4DWIA 2UP1A 3FKBA 3G8QA 2G2YA 2EBEA 2XMAA 1YZ7A 4AXJA 2YH1A 3M4OC 5CH7B 2AEMA 4WFAQ 4LIRA 4C11A 1T05A 2HNZA 1CEZA 1QSSA 4Q4ZA 2V8PA 2XSFA 4DV1F 3MECA 4AUKA 4MK8A 4B3RJ 2Y8WA 4XAKA 2W9AA 1UA0A 2HW3A 5C3EK 1WCMC 1VJWA 1AROP 3K5NA 3I82A 3M8QB 4F4ZA 2FJWA 3C6UA 4KHPJ 2OTLS 2XMMA 3GIJA 1SL2A 2XLKA 4TNOA 3ISZA 1YI2S 2ROPA 5KFOA 1YVFA 3N0VA 2W7VA 1RTIA 4I67A 1JNRB 3HOWK 5D4NA 1JLEA 4C97A 1RUSA 2BQUA 4Q8EA 3EYZA 3AB2B 4A3KK 4UOFA 3DN9A 3IP0A 1ZBSA 4IG0B 2YX1A 3NNAA 1WSVA 2KRRA 3IRXB 1RT5A 4C3HC 2GQCA 3S17C 4UY8T 4A3GK 3E01B 2Q43A 3EMTA 2C22A 1FESA 2UU9F 2P9GA 3T41A 1VBZA 5CABA 2DNLA 2HHHJ 2E1AA 2HHXA 2JA7C 4N8OA 2W1BA 4Z2XA 2RQ4A 4OMFG 1IKWB 3LP0A 3OFHA 4IH6A 2JEFA 1NSKL 5U47A 5KFHA 2NS1B 1D8YA 1C0UA 3LAKA 2WBRA 2OPQB 2Z8QA 4E8UA 3MCMA 4ZOSA 3CTRA 2C2RA 1DQAA 3GTGC 3PIPQ 4FP9A 5GMKa 3W2WB 4LRDA 2DH7A 4AFFA 2ATCB 3I31A 3S2HK 4MEYA 4RW9A 1YG0A 1T9XA 3QWPA 2ZOFA 2MQNA 3UD4P 3W9HA 1SC3B 3QYYA 4DUZJ 1AUDA 1FE0A 1HI0P 1Y5IB 2DHSA 1UMJA 2BW2A 5CZXA 1M5SA 9ATCB 2JFKA 1K8AT 1N0UA 3S14K 1EHWA 3RJMB 3ZZOA 2G2OA 4KAIA 2J8AA 3NS7B 1JIHA 1HD1A 4NMLA 3M4XA 2JX2A 1EP4B 3I9ZA 4PWUA 1Q7YT 3THPA 4RW6A 1KVJA 2M8DB 1RTJB 2DYAA 3J80U 2H4WB 1B64A 4WE1A 3MXHP 1F0XA 1T9YA 5LXYA 2RDJA 2XM3A 5HMXA 4A8FA 1SFOA 1B4SA 4DV0J 2V2ZA 4O3PA 1D8ZA 1J5EJ 1L0WA 4R5PB 4ZVHA 4ZHRA 2P5VA 3KKFA 2R3VA 4UOCA 3OT9A 1U1KA 3TUPA 3GTOA 3NRBA 3M30B 3W7BA 4FF2A 2RMLA 4QYRA 3T5KA 3EPGA 4OV6A 5D78A 4DR3F 1C1CB 4F4AA 4A3DK 1WF1A 5C4JK 3OBIA 4TU7A 3MTJA 2OD6A 4GT9A 5EDWA 4DR1J 3HOVK 3IMQJ 4C0BA 2FDNA 4IFYA 2F9JA 3KLIB 5KT5A 2EWHA 3DGVA 1W7WA 2XCRB 1K1QA 5F8MA 1RI7A 1VRTB 4NLDA 3DLLQ 4U67Q 1FNOA 2DEIA 5EUHA 3FKIK 1LFPA 3QBCA 4K2JA 3KLFA 1B0TA 4R0JA 4OL8A 5FLMK 3VVTA 3HHLB 2V4JB 3GTLA 4A3FK 5IORA 2RIJA 1XNQJ 4C3MA 3G6YA 3TO8A 4YDXA 3I9V9 3KHLA 2HNYA 5IWAF 2HS4A 1B3TA 2DCLA 2AJQA 4K4ZA 2JWNA 4EBEA 5KFSA 3FRZA 4N77A 2VUMK 2AGQA 3IGNA 4ZCMA 2BVZA 4QR0A 2PMWA 2NLWA 3FNNA 4DPTA 2BE5A 2CZ9A 1OYEA 1PYTA 4CZCA 4C11B 3BF4A 5ETRA 4C2MK 5EWGA 4DI6A 1I3QK 2HHQA 1VHIA 4B3SF 3VGVA 3MECB 5C42A 3OL6A 1PILA 5IYBK 4N56A 1OY8A 2M5YA 5F0WA 2HZAA 4USJC 2DD8S 4PXDA 2FVRA 3C6UB 3OR2A 4BY7K 4JOUA 2PPBA 1HPZA 2BR0A 3R5AA 5HJXA 5D6GA 4WU2A 1RTIB 5KG3A 4J9VA 1RBLA 1JLEB 3AA8A 1Y7PA 1RHKB 1FVSA 2FIUA 3ILOA 2RJZA 1VDHA 2UXCF 4A3CC 1NKBA 3DOLA 4NLPA 1BWVA 2E5LF 5G0RA 4QIVA 2VHGA 4M1XA 3MAAB 1U6FA 2VBYA 2ZUEA 5A76A 4LR8A 4PG4A 4U95A 3HHDA 5KG0A 2KVQE 2PI5A 5FJ8K 2ZH5A 2MKKA 2E5IA 4KGKA 1NKEA 1GFWB 4NL5A 2QLWA 2MZ1A 1M5KC 1MN7A 3HJFA 3AHPA 3NUHA 3T19A 1U7LA 2VJUA 2N7YA 3GV7B 4HT5A 1S6PB 3W61A 4UT4A 5CJ9A 4DR5F 2R7QA 3DYAA 4A8WA 1S1WA 3HOYK 4OQJA 4C8MA 2XO7A 4AQYF 1SUQB 3GPAA 3SDEA 4A3LC 1X4HA 2MXYA 2HLUA 2G0IA 4CIOA 4ECWA 2FD2A 5CCLA 5K9FA 4CM0A 2WONA 1C0UB 2GO8A 1XR7A 5CYQA 2PA8L 1U1NA 2ZUFA 3AA9A 4XSZA 3NY0A 1EIYB 1WWHA 5KFZA 1NK7A 2A2DA 3PO4A 3FMBA 1S59A 2CWKA 2XHWA 1Q81T 4O4GB 4WFNQ 5KT3A 4LFAF 1IN0A 1SV5A 2F40A 3SSSA 2VG7B 3GYNA 1K83C 3L7OA 1QTNB 3LWMA 1TKDA 5I3QA 3S6EA 1NK9A 3HJVA 4KIAA 4URSA 5ETQA 1T9VA 3KJQB 2KFZA 1G4CA 2NVXA 2JC1A 2HQCA 2DEJA 3L09A 1R6VA 4Q2MA 3LUYA 1H0HB 3UCUP 2YU9C 2UVVA 3KK2A 2CQ1A 3J7ZT 2MYFA 4ECUA 4RW6B 2HQFA 2OD4A 1FX4A 3T1YF 1QUPA 2ASDA 1HWKA 5KFDA 2CNNB 1BQXA 4FF3A 1U8WA 4F50A 4G65A 4DLEA 4NPOA 4EO6A 1C2PA 2HYIB 2AYGA 4DV7F 2FHJA 1PO6A 3HOUK 2HGNA 3E2EA 2J7UA 4ES1A 3H5SA 3R27A 4ZHRB 1DZ5A 4WP8A 2PT0A 1RP5A 4Y2MA 5EX3A 1AUSL 3CAGA 5B08A 4HH0A 4RL1A 3KUGA 2ZM6J 2UUBJ 3GTQC 1T02A 3TVYA 2DT9A 3NBPB 4R25A 2NQPA 5F8IA 1BHNA 4F02A 3CJ3A 1SQFA 2V9WA 4DZDA 4FS1A 2HFSA 1TKXA 1QTMA 2DITA 5BXIA 4C6AA 1N33J 3HOZK 3M2VA 3KLFB 2ROGA 4NLGA 3H20A 2DO4A 4RPFA 2DPIA 2YKNA 2YX4A 3PEJA 3BB5A 4N5SA 2VQFF 2ACMA 5LOQA 1FVQA 1BE4A 4CT9A 2AF6A 2HNYB 1Q8BA 3D4JA 1TUVA 3RW7A 2XO6A 5C24B 2PD1A 4NXNF 2VZ9A 1VBKA 2ZDPA 1X4AA 5EGEA 1JQGA 3HDSA 3QT7A 5H9FK 1BC6A 5HP1B 1NAQA 3RZOC 2W7OA 1IW7A 3QLHA 3SCJE 1TWFA 4ZPWR 5C42B 3DHXA 4XPCA 4H4KA 5AT1B 3TX8A 2CIMA 5GADU 1IKYB 3CJRA 1MNEA 4UZCA 1CS4A 1BQNA 2M3DA 4WXWA 1FERA 2J9CA 1XIQA 4QJVA 3B54A 5KT2A 4UUWA 2EG2A 1HPZB 4ANEA 3UCZP 3KHRA 4U7CA 3BREA 3TNVA 3WHIA 3GJRB 2NSBA 2JDJA 1SKUB 3HI9A 2H51B 3TFHA 1PYSB 1UZDA 3DOLB 3S16C 5IM0B 4ED6A 4X84A 2C2OB 2YQ1A 5M3FK 4L75A 3NOCA 3JSYA 1FNMA 3PFEA 4USTA 5JXSA 3THTA 1Q8KA 2GMLA 5M5YK 4GKKJ 1SJ1A 5A8WA 2VA3A 1FRKA 3H0GA 4CO0A 1XMQJ 3DHWC 2HQDA 1AFIA 1X7VA 3PR5B 4WBFA 4A4JA 4KB4A 1TKTB 3RB0A 1U48A 2GMJA 2LEAA 4FPIA 2YWKA 4HEA9 5KG4A 4C3IC 2KT2A 4OYOA 2ZVIA 4WP3A 2E2IC 4KGZB 4OHWA 3MMAA 1TMJA 1HWIA 2ALYB 5IYCK 2QG9B 4A3MC 1DFDA 4H54A 1RAOA 3SDEB 4NZ7A 3S1TA 5AXKA 3KDNA 2OLWA
chains in the Genus database with same CATH topology
3AD8C 2GAHC 1YX2A 3GEEA 3GEHA 3TTGA 5L46A 3GIRA 3GEIA 3ADAC 3TFJA 1PJ5A 4P9SA 3TFIA 4PABA 3A8JA 3AD9C 3A8IA 3GSIA 1X31C 1V5VA 1PJ6A 1WSRA 1WORA 1XZQA 1WOOA 1WOPA 1VRQC 1XZPA 2GAGC 1PJ7A 1WOSA 4PAAA 3AD7C 1VLOA 1XZQB 1WSVA 3A8KA 1XZPB 3TFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AD8 C;  2GAH C;  1YX2 A;  3GEE A;  3GEH A;  3TTG A;  5L46 A;  3GIR A;  3GEI A;  3ADA C;  3TFJ A;  1PJ5 A;  4P9S A;  3TFI A;  4PAB A;  3A8J A;  3AD9 C;  3A8I A;  3GSI A;  1X31 C;  1V5V A;  1PJ6 A;  1WSR A;  1WOR A;  1XZQ A;  1WOO A;  1WOP A;  1VRQ C;  1XZP A;  2GAG C;  1PJ7 A;  1WOS A;  4PAA A;  3AD7 C;  1VLO A;  1XZQ B;  1WSV A;  3A8K A;  1XZP B;  3TFH A; 
#chains in the Genus database with same CATH topology
 6FDR A;  3N6N A;  4DPU A;  2WON B;  2YPY A;  3CJK A;  2JEI A;  4TXS A;  4X66 F;  3H8Y A;  2AIR B;  2DR9 A;  2XWX A;  4OIR A;  1ULR A;  1IWG A;  3PX4 A;  5DG7 A;  4OX6 A;  3IPJ A;  2X1G A;  1NH8 A;  2FZK B;  2HK3 A;  3LTO A;  4DUZ F;  3PO3 C;  1PC4 A;  4IH5 A;  4XCH A;  2CJ9 A;  3OUY A;  1MLA A;  1NHV A;  3J7Y I;  3GTJ C;  1LW0 A;  1LK5 A;  1Q86 T;  4X65 J;  3SV3 A;  2GAH C;  4HDH A;  5AE2 A;  1KSP A;  2G2Z A;  3HOX K;  1DBD A;  1UAW A;  2RRA A;  2B5J A;  3KHG A;  1RHQ B;  4EFA C;  5J2M A;  2RQC A;  1N8R T;  2XZT B;  1WHW A;  1X5S A;  4ELV A;  2VC1 A;  1X5T A;  1FFW B;  4G3I A;  3ZZ0 A;  3BDP A;  4ED2 A;  1VBX A;  5KOX A;  1TWH K;  3VGS A;  3ORE A;  2CA9 A;  3EE3 A;  4O44 A;  3FEY B;  3R97 A;  1RA6 A;  1Q53 A;  3FQL A;  1RWO B;  4DV0 F;  2YWG A;  4HI1 A;  1SKW A;  2XCO A;  3SBM A;  5KFF A;  3PAC A;  3U7J A;  1KHW A;  4NOH A;  1RKI A;  3BSN A;  2KJW A;  3GJQ B;  5F0U A;  2B9E A;  2GVZ B;  3KK1 B;  4XTT A;  1WEX A;  3AQP A;  3AJ1 A;  1BD6 A;  4A3K C;  1Y1W A;  1WHX A;  2P6T A;  4OZ0 A;  5IT0 A;  3JSM B;  2J76 E;  3LP1 A;  3PW0 A;  4U8V A;  3PKM A;  1U1M A;  1P27 B;  2Y0S L;  3CCW A;  3O44 A;  1TWC A;  4AL6 A;  1FJE B;  4ZIV A;  5KG1 A;  3K8W A;  5AJ3 F;  3M2V B;  3ZFV A;  5CYJ A;  3UN3 A;  4DX5 A;  4J3N A;  3U1L A;  1WQG A;  3OFE A;  2YKN B;  5HQM A;  4EEY A;  1MWZ A;  1AXQ A;  4RW4 A;  3DRR A;  4KTQ A;  3G6X A;  1F7U A;  2EFV A;  2G9O A;  1VIX A;  4PG5 A;  4OLO A;  2B4P A;  2OKQ A;  1KVI A;  5BR8 J;  4HL9 A;  2OHD A;  3ZC4 A;  3H40 A;  3G4C A;  2EFO A;  2YNH A;  4FBT A;  3QLH B;  2X3D A;  3CF5 Q;  1G7C B;  2FJD B;  4XIU A;  3KJV A;  1BQN B;  3IS9 A;  4K7Q A;  1L3T A;  5ETS A;  2ROE A;  3D68 A;  4PWD A;  1JLQ A;  4QZV B;  4DR7 J;  4QR2 A;  4DX8 H;  1KLM A;  4K5S A;  1HL6 A;  4J7C A;  1YBU A;  4LR9 A;  4B3T J;  2WVB A;  5TMC A;  5LMN J;  2I9S A;  2YWH A;  1IVZ A;  1IR2 A;  2B8P A;  2NYI A;  2XI2 A;  4B9L A;  3T5J A;  3HM9 A;  2LMI A;  1VK8 A;  4R8U B;  2NVX K;  1HI8 A;  3S1M K;  1S4F A;  1JLG B;  3M8R A;  5M2P A;  3S14 C;  2KHD A;  4AXI A;  3FDS A;  3OVA A;  3PCO B;  4QQB A;  3FZB A;  2CFA A;  1SIW B;  2W2Q P;  2DR6 A;  4OHZ A;  3P5B P;  3A8J A;  2WTF A;  5A8W B;  1NCL A;  4PKD B;  2DK2 A;  3GJS B;  3A12 A;  3FQK A;  4EYH B;  4ELU A;  2DR8 A;  2KI2 A;  1ZAV A;  2Y1R I;  4OZL A;  4ZP9 A;  4NZ6 A;  5HL7 Q;  1HYS B;  1MRO B;  2W4P A;  3P8B B;  1O27 A;  4O3R A;  2RKI A;  2M0G B;  1NBE B;  4ZVT B;  4FVM A;  4NLW A;  2MLY A;  4C3K A;  2E9T A;  2KG0 A;  3S0X A;  4ED3 A;  3PVX A;  2A1B A;  4JI1 J;  1IS1 A;  4KC6 A;  2LEC A;  2MY8 A;  4A3D C;  5LT5 A;  1H72 C;  2DIS A;  4PWW A;  1XN9 A;  4ZVE A;  4PYA A;  2VC0 A;  1GT8 A;  4OI3 A;  2Z2L A;  5JFE A;  2K7K A;  3EXY A;  3LO3 A;  2QFI A;  5JVO A;  1RAC B;  4CLL A;  3TYT A;  2CQD A;  2OP5 A;  1OY6 A;  3OUY B;  1N0V C;  2YWF A;  5L38 A;  1SL1 A;  3ADA C;  3EX7 B;  1PSD A;  1T95 A;  1KON A;  5KFN A;  2XLI A;  3PW4 A;  3HP6 A;  2B5J B;  2HFU A;  1YJT A;  4KYZ A;  3QWU A;  5J2M B;  3JAM Y;  4C2M C;  2C2D A;  3G86 A;  3H5Y A;  3TFJ A;  1JLC A;  1LW2 A;  4PG6 A;  2GHV C;  4F4W A;  4BY1 C;  5IYB C;  5IT9 U;  4M5K A;  4J9P A;  3RGI A;  1M5P C;  2JOQ A;  4TY8 B;  2Q6B A;  2RS2 A;  4KBI A;  4O44 B;  2KXN B;  4NEZ A;  4KMU A;  4F8R A;  4NA3 A;  3ZZR A;  2CPX A;  1FFS B;  2KHC A;  2XNR A;  2DGX A;  4URQ U;  3TQE A;  4KAS A;  4P74 A;  1U2R A;  3N28 A;  2R42 A;  3LW5 C;  3HX9 A;  3L7P A;  2UUB F;  3MTK A;  1FWL A;  1I5O B;  2QSW A;  3D6H B;  2M7S A;  2IRX A;  3QIP A;  2N4C A;  2B6A A;  3LP1 B;  1KP6 A;  2ZZM A;  3KOA A;  4RNO A;  1YNJ A;  3C14 A;  1O29 A;  3US5 A;  4ZVS B;  2MKH A;  2QL7 B;  4JI5 J;  1S9G B;  3IO1 A;  1HNZ J;  1VC0 A;  1XNR J;  4DDF A;  1GQE A;  3R2D J;  1RT2 A;  2DGV A;  3FSX A;  1U1P A;  2Y3P A;  1F9F A;  2VFS A;  4FXD A;  4RW4 B;  3R1L A;  1TFY A;  3KMS A;  2CDR B;  3DRR B;  1N56 A;  3TAN A;  3QAT A;  3HOY C;  2UUA J;  2DNN A;  4CO2 A;  1XC9 A;  3D66 A;  2BJE A;  4NEY A;  4DR6 J;  3RZD C;  4F25 A;  1WAC A;  2XSJ A;  1SCJ B;  1TQL A;  2RNE A;  5E2Q A;  4O0I A;  2D3U A;  1F3F A;  3OHA A;  1YGY A;  2CRL A;  1F9N A;  4E98 A;  4IFV A;  1T3O A;  4MKV A;  4LBI A;  1FKO A;  4LF1 A;  2EK1 A;  4UQG A;  3KJV B;  3KJF B;  5IZH A;  1PCA A;  1U1L A;  1NZA A;  1TL3 A;  1JLQ B;  2HKE A;  4M1K A;  4BBR K;  1KLM B;  3LWL A;  2D7S A;  3UW1 A;  1U47 A;  4DL3 A;  4PG7 A;  1NLK L;  4LF9 J;  3GB0 A;  4NAS A;  1QAI A;  2LEB A;  3NG8 A;  4ZN3 A;  1U8S A;  3W5Y A;  4DCO B;  3MMJ A;  1DQ8 A;  5DM7 Q;  2B7C B;  1UKU A;  2AV5 A;  1LXJ A;  2MSS A;  4DFP A;  4ES2 A;  2CFA B;  2B56 A;  2DNZ A;  3KJN B;  2WHO A;  1H2V Z;  2XZW A;  3QT6 A;  4OI4 A;  2OFH X;  4YHH J;  2HUR A;  1VC6 A;  4CLZ A;  4J5O A;  4CI0 B;  3GTG A;  4U8Y A;  3HOU C;  1YRX A;  3W8P A;  2RKI B;  4QWE A;  2ZE2 A;  2BOP A;  2IM0 A;  5MAO A;  2C2M B;  1VYA A;  2VBZ A;  3T1A A;  1RAF B;  5C44 K;  2W4D A;  3TFI A;  1FKP A;  2ZIT A;  2PSZ A;  3RG6 A;  5A0Y A;  4DN0 A;  3MCS A;  2ASJ A;  1HAR A;  4FS2 A;  4ZLP A;  1SJ4 P;  2NXC A;  3K5L A;  1I6V A;  4DQQ A;  3M3Y K;  3CIM A;  5H9E K;  4CLY A;  4HH1 A;  1U26 A;  2IM3 A;  2MZR A;  3MPW A;  3PX0 A;  3RW6 A;  4DR2 F;  3Q86 A;  2VA2 A;  1EKS A;  3NLC A;  3BBC A;  1F93 A;  1B7F A;  5DET A;  1VQ8 S;  4NWB A;  1SJR A;  5I4M A;  3H5X A;  1WNE A;  1WG5 A;  3IBW A;  3I56 S;  1MMN A;  2PA3 A;  3CJ0 A;  3AD7 C;  3HVT A;  1VQ7 S;  2XMT A;  2C28 A;  3TAR A;  3ZZU A;  3PRD A;  2FTR A;  2MY7 A;  3MPV A;  4FPR A;  4F26 A;  4DV3 J;  1NO8 A;  3NEK A;  1JLC B;  1WKL A;  4ZP6 A;  2OGU A;  1RT4 B;  3WDO A;  1S79 A;  2HWT A;  1BJT A;  4JI6 F;  1OS5 A;  4EBD A;  4LQ3 A;  4DF4 A;  1JJ4 A;  3R2C J;  5ETM A;  3VZI A;  4C0H A;  5B0C A;  4LSL A;  1W25 A;  1WOO A;  1LWF A;  1JKH B;  3PRB A;  4C7Q A;  4JV1 A;  2BZ2 A;  2Y3Y A;  5C4X K;  2WB4 A;  1FXL A;  2K06 A;  1JXL A;  3IM8 A;  4RWW A;  4Y34 A;  1S0O A;  2M2B A;  3EDR B;  4M5N A;  2UUT A;  3PG9 A;  4CT8 A;  3TZZ A;  4NLU A;  3OR1 A;  4Y2A A;  3I0S A;  3I4P A;  2VOD A;  4M63 A;  4NCA A;  2CJY B;  4P73 A;  1ZET A;  4KAW X;  1VR6 A;  1YRT A;  3JTN A;  3H2U B;  4NA2 A;  1NDC A;  2OIH A;  2H1Y A;  1KEK A;  4IG3 A;  3QIP B;  2B6A B;  5IP7 K;  3QSY B;  2LXI A;  3C14 B;  2QYC A;  3VR1 A;  3TZX A;  4C8Z A;  2MZQ A;  1X31 C;  4YOE A;  2LA4 A;  2KL8 A;  3DGP A;  4XPE A;  2W8K A;  2HBQ B;  2OAU A;  4ECZ A;  3ZNJ 1;  4CP5 A;  2BX6 A;  3ILL A;  3V6D A;  4OJG A;  3KLH B;  1IBK F;  2XMU A;  1WD6 A;  2PMZ L;  1RAD B;  3PHT A;  4HAC B;  3VA7 A;  3I0R B;  2XYG B;  2IVF B;  3NWR A;  4DPO A;  1RDR A;  3LH2 S;  2VFV A;  1S1T A;  1NXI A;  4DV4 F;  2A68 A;  2I38 A;  4C0O C;  1K44 A;  1ZTW A;  1TP7 A;  5J2Q B;  2GSU A;  3IC1 A;  2KZM A;  4K4U A;  2EC0 A;  4PAB A;  5HL8 A;  1IKX A;  5SZT A;  2DTJ A;  3LGN A;  4DEZ A;  2XSJ B;  2LXU A;  3E3X A;  3VAG A;  3M8Y A;  2PN6 A;  3HPO A;  1LK7 A;  5ETV A;  4U9R A;  4DV5 F;  2QJ3 A;  5DS7 A;  3JQJ A;  1HI1 A;  3NXZ A;  1SI9 A;  2ATL A;  2ZOG A;  1R9T K;  4CH1 A;  2NZ4 A;  2NVT K;  4O3Q A;  3QGG A;  4AL7 A;  4DR7 F;  2B7B B;  4USU A;  2R93 K;  4I6A A;  3AOC A;  1YBA A;  3TA1 A;  1TL3 B;  2P9E A;  2GIF A;  2PFF B;  2G1H A;  3W63 A;  4Y6I A;  2YNG A;  4U7U K;  4O3O A;  2DGW A;  2QIF A;  5LMN F;  4KR0 B;  4ZPC A;  3Q8Y A;  1YJN S;  2BKP A;  5TMF A;  4R0E A;  4RMF A;  2ZOM A;  3F73 A;  4B3O A;  3DDK A;  2LQ9 A;  4IR9 A;  1UTA A;  2IBO A;  1FI4 A;  4LF6 J;  5SUH A;  2HS0 A;  2GGP B;  2I0X A;  3A3N B;  4LVO P;  4NX9 A;  1A0O B;  1B0P A;  3BP8 C;  2QL9 B;  2BKO A;  2YVS A;  4Q0B B;  2MQ8 A;  3WBZ A;  1WQF A;  4WU3 A;  4USH A;  4GVL A;  1IBL J;  3BGF A;  3S1Q K;  3UPF A;  2FJE B;  1GMU A;  1S57 A;  2K3I A;  3L9Z A;  4RW7 B;  4I2P B;  3C16 A;  2LVW A;  1FD2 A;  3IBF B;  1EB0 A;  1KTV A;  2J0Q D;  2ZE2 B;  5F41 A;  3HKZ L;  4P5A A;  5AXL A;  3ZXW A;  1WHY A;  3H3V L;  4CDI A;  3Q8P B;  1QVF R;  2WVD A;  2NVY C;  1DTT B;  5K8P A;  1FKP B;  5A0Y B;  2FHM A;  3TW0 A;  3MAQ A;  5DDO C;  3M4O K;  1UWB A;  2X1F A;  1CJT A;  1UJ5 A;  4KGM A;  3W2V A;  1HQM A;  2LYV A;  5B0B A;  2KFY A;  4X62 F;  2JVO A;  1KTQ A;  3CDB A;  4CTA A;  4K50 A;  3RTV A;  5B0E A;  1U49 A;  3IRW P;  4KKO A;  1R8P A;  1WCM K;  3LPX A;  3ITH A;  2IHR 1;  4JI8 J;  3LA0 A;  1H74 A;  3OQ2 A;  3CO0 P;  3PIO Q;  1Q5V A;  1NHK L;  1IUJ A;  3MR2 A;  3I4N C;  1QD1 A;  8RUC A;  3HVT B;  4QPX A;  2W9C B;  2FY1 A;  1RGV A;  4MJK A;  4UOG A;  3GMG A;  3MM7 B;  3BGO P;  3GTQ A;  1WDD A;  5A6P A;  1NDL A;  4FXV A;  3NGD A;  4J9L A;  5M5X K;  3FC9 A;  4X64 F;  4OI2 A;  2ASL A;  4EBC A;  1XXC A;  4EO8 A;  4X2B A;  4LSL B;  1LWF B;  4MKB A;  4J91 A;  2YWE A;  3PYF A;  3DM2 A;  5KFI A;  4Q43 A;  4DS5 A;  3D0I E;  3CPW R;  2E2H K;  2RQK A;  3MUV P;  4QWD A;  2JA8 C;  5DDP C;  1REV B;  4RNN A;  2L08 A;  1NJZ A;  4MAK A;  3OTO J;  3RRK A;  2PFD A;  4NLR A;  1Q8I A;  2JA7 K;  1I94 F;  1RSC A;  4IG3 B;  4WZQ A;  3N0C A;  1Q1K A;  2AX1 A;  3KK3 A;  4RBT A;  3RYL A;  3T01 A;  3GP9 A;  4F67 A;  2MKY A;  1F5A A;  4Q5V A;  5EGH A;  4WJ4 A;  3QZ7 A;  2D3O R;  4KJI A;  4ICL A;  3S15 C;  3V6D B;  4RW8 A;  5A8R A;  3D6F B;  2VG5 A;  2G4B A;  1ZYR A;  4ZIT A;  1HQU A;  4OYX A;  1JLA A;  2EBG A;  2KXF A;  3CDE A;  3O8W A;  3LAJ A;  3H90 A;  1L3S A;  2AEF A;  1S1T B;  2IMW P;  2O5J A;  3W60 A;  1VQ9 S;  4YR3 A;  2IDE A;  1U0H A;  3QT8 A;  3QRQ A;  3VAF A;  1IKX B;  1BY9 A;  2PGC A;  4WYW A;  2GO9 A;  1FT8 A;  3MD3 A;  3OW2 R;  2EFP A;  1T9W A;  2W4C A;  5E3A A;  2GQ2 A;  4M5D B;  2BAN A;  3HHN B;  4P5B A;  1BGW A;  1UCN A;  1OYD A;  3R6G B;  2N3O A;  1M90 T;  2LU2 A;  4DV1 J;  4O23 A;  4X4R A;  2EK6 A;  3TTG A;  2JA5 A;  4IQX A;  2XZD B;  2FJV A;  2K1R A;  4G7Z A;  1UEV A;  3CCU S;  4LF9 F;  2WSC C;  1SJ3 P;  2FQT A;  1IL2 A;  3HK2 A;  4FYY B;  2CPF A;  4F0K A;  1K9M T;  3ZZP A;  4WP9 A;  4ECV A;  5GAE I;  2YTC A;  1NSA A;  2HWI A;  7AT1 B;  3VQT A;  1ZVU A;  1KQS R;  1OPZ A;  1FDD A;  2M9K A;  4GTF A;  4K4V A;  3T9N A;  4TKT A;  5KG2 A;  3PXG a;  3C66 A;  4NA1 A;  1N36 F;  1WC0 A;  3SQG A;  4Z7C A;  5CZV A;  3K7R A;  4DMZ A;  2XLJ A;  5IT9 Y;  4YHH F;  3LPY A;  1YBT A;  2A3J A;  1OO0 B;  1U45 A;  1SPB P;  2AYM A;  2POK A;  2IJN A;  2BJD A;  2E44 A;  2E5J A;  2WOM B;  5DLG A;  2AKW B;  3LGM A;  2VIC A;  4J9U E;  4XSX A;  2DY9 A;  1P1T A;  1A7G E;  2JC0 A;  4CYU A;  1MU2 A;  5HQ8 A;  2H48 B;  2A2C A;  2DHH A;  3R5J B;  2UU9 J;  4DSE A;  4CWB A;  1DJ0 A;  3N0B A;  3GTJ A;  3BUE A;  3B78 A;  3Q8Q B;  2V2Q A;  5HMY A;  1WIH A;  3BKU A;  3GEE A;  2ERR A;  1SBR A;  5L46 A;  2JL9 A;  4FF4 A;  4IH7 A;  1PYO B;  1CJT B;  1REG X;  3CCT A;  3M2U B;  1FKA F;  4Q44 A;  4JI2 F;  1ZQ1 C;  4CTA B;  2QO3 A;  2CZV C;  2PEH A;  2LLZ A;  4YFX A;  4YB5 A;  2PMH A;  3I55 S;  3MF5 A;  1TEL A;  1TMM A;  4XK8 C;  4TYB A;  5HRO B;  3GSI A;  3DOM B;  3S1N C;  3ITH B;  4OZ1 A;  3IBC B;  3CCL S;  4MTP A;  1N34 F;  3N9U C;  3HT0 A;  4A8M P;  2BOA A;  4ILR A;  2OPR A;  4MK9 A;  1O8B A;  3QGH A;  4LR2 A;  3JS9 A;  3BBB A;  4OIN A;  4QOT A;  3GDZ A;  3KDO A;  4AYB D;  3BPS P;  2P8I A;  4QIE A;  2O1P A;  1UVL A;  2WBM A;  4QPT A;  2H3E B;  4RLE A;  1UPM B;  2A69 A;  4A3C K;  1T3N A;  1B7Y B;  2F65 A;  4P7T A;  2VQE F;  4FF1 A;  4QCL A;  1NJI T;  2E5H A;  5A8K A;  3BO4 A;  2MLZ A;  5KFA A;  2ZH2 A;  1C0A A;  2CNO B;  3D2W A;  1YJ9 S;  3CCM S;  4BBR C;  3UVJ A;  5KFC A;  3MM5 B;  1NEE A;  1N5Y B;  3R7S B;  1XXA A;  1LWC A;  1CUL A;  4OIQ A;  2ACY A;  4WF9 Q;  3TUJ C;  4USV A;  3CT9 A;  3NNC A;  2KU7 A;  3IR5 B;  4FYX B;  2YH0 A;  5C2G A;  2XS2 A;  5L9N A;  2N3L A;  4PPD A;  2WAQ L;  1VGX A;  4A3L K;  1TL1 A;  3KK3 B;  2CPI A;  1ZH5 A;  1RT6 A;  3IG1 A;  4OYZ A;  4ES3 A;  4DR3 J;  2FC9 A;  3MPU B;  2MZT A;  3MR3 A;  1BQM A;  3UNG C;  4RUH A;  4ICL B;  1VQ4 S;  3FGV A;  4LF7 F;  3T02 A;  5EWE A;  4RW8 B;  2J0X A;  5HVF A;  1GMW D;  3V6J A;  4Q5S A;  2DR7 A;  4BC9 A;  1HQU B;  5C7P A;  1JLA B;  4DXL A;  1MSW D;  1HBU B;  4C3L A;  5CAA A;  4I6Y A;  4WJ3 M;  1NK8 A;  1H2T Z;  1WKK A;  3PW2 A;  2CWX A;  1K83 K;  2CPD A;  5C44 C;  3QQC D;  5HAO A;  5ETK A;  2CQ0 A;  5IWA J;  1B0V A;  3D54 A;  2ZWO A;  1TKZ B;  4DG1 B;  2ILZ A;  4G0V A;  4A8Q A;  2RF2 A;  3A13 A;  1DLO A;  5GAG U;  2AU0 A;  1VS3 A;  3MEG A;  2YU9 K;  1IR1 A;  1WI6 A;  1QAJ A;  1BXN A;  3GIR A;  3KG4 A;  2Y0B B;  4ZCI A;  4B3S J;  2HBZ B;  3N3Y A;  2J7K A;  3M8Q A;  4CCH A;  4OHV A;  5IT4 A;  2QA4 G;  1R27 B;  1P6T A;  5MLC V;  3G6V A;  4DCP B;  1KOH A;  2FLN A;  2GJF A;  1RT3 A;  3DDI A;  3CNQ P;  1M0S A;  2F4V J;  1P1L A;  2QSF A;  4G1Q B;  3V6H A;  1USO A;  2GCF A;  4BLB A;  3WX8 A;  3S1R C;  4DV6 F;  1O25 A;  1RWK B;  4OI0 A;  3MOJ B;  3W65 A;  3HVR A;  3UD3 P;  4PCQ A;  1FDN A;  3WC0 A;  2R8I A;  2QMU B;  3SQG B;  2UXC J;  1LKZ A;  4IG0 A;  1RHU B;  3UO0 A;  2D9O A;  1NJX A;  2E5L J;  3IRX A;  3NOG A;  2NRE A;  2ZZT A;  1WDT A;  1JQW A;  2J0S D;  4GKJ F;  4YB1 P;  1OY9 A;  1YQH A;  5HK4 A;  5KFG A;  4MT1 A;  4CH7 A;  4YS2 A;  4HHU A;  2GA7 A;  3E01 A;  3H4B A;  4F4X A;  2E9Z A;  1VBY A;  3G9C A;  5HMW A;  1P8G A;  3WQP A;  5DRK A;  2IJF A;  2DB1 A;  2KT5 A;  4NOI A;  4NRU A;  2VUM A;  4OHY A;  4DUY F;  2QFJ A;  2CQC A;  3TAM A;  2CQI A;  4Y2K A;  4DR5 J;  3TWZ A;  1S4E A;  1MWY A;  3D7S B;  4ZK7 M;  2VU5 A;  4NYO A;  1VOM A;  4C8O A;  2R92 K;  2FY8 A;  3S2D C;  1T8E A;  3AH5 A;  2XCP A;  1IKW A;  4Y65 A;  4AQY J;  2G1D A;  5KT4 A;  2F63 A;  4FBU A;  3RZO K;  4C2M A;  2CG8 A;  2E1R A;  4KAR A;  1I3Q A;  1KNZ A;  4DSK A;  5E3C A;  4D3H A;  4K4S A;  4ZH4 A;  4KMA A;  2B4O A;  3GTM C;  3T00 A;  2GZO A;  3TZW A;  2D9P A;  2FGC A;  2LXF A;  2OSQ A;  4WXO A;  3KLV A;  1S5Z A;  3W2W A;  4PYD A;  1VGY A;  2AGO A;  1BDF A;  1LEO A;  2H5E A;  2DRD A;  2MJN A;  2OMO A;  1UFK A;  1XWL A;  3N79 A;  4LFA J;  2OEL A;  1R8C A;  5BJR A;  1SC6 A;  2LDY A;  4ZVO B;  2OH2 A;  3EVO A;  3NMA A;  3LF0 A;  4WYL A;  5CYM A;  3S16 K;  1FDA A;  2DNG A;  2E2J C;  4RWX A;  4QIG A;  2FC8 A;  4B9U A;  3ERE D;  2UXD F;  4Y2I A;  1R9T C;  8AT1 B;  2KM8 C;  4Z37 A;  5A8K B;  2E7X A;  4YUD A;  2R93 C;  1R89 A;  1T7P A;  3KLG A;  3T1Y J;  2NXJ A;  3UVJ B;  5IP9 C;  1PJ7 A;  1V3S A;  3RBD A;  1O28 A;  4ZVG A;  4I6W A;  1CUL B;  1NH7 A;  3HVA A;  3J7A 1;  3I6P A;  4C3I K;  3OVB A;  1YJV A;  3PR4 A;  2F9D A;  4DV7 J;  3MUM P;  4QWA A;  2E2I K;  3M30 A;  3CCQ S;  1MW7 A;  3TRG A;  4A3M K;  3NWG A;  3C46 A;  3KNA A;  4GO7 X;  1HWU A;  3QX3 A;  5AE1 A;  4U6P A;  1FWP A;  3W66 A;  1ELO A;  3GCX P;  3K89 A;  3W1Y C;  1BQM B;  2V63 A;  3KLI A;  2DHG A;  1FE4 A;  4F7V A;  3S1Q C;  1S6O A;  2H65 B;  3G6E S;  3CC2 S;  5IQ6 A;  3C15 B;  1IXK A;  4KFB B;  3HHL A;  5B7W A;  4P75 A;  2CQ3 A;  3PFO A;  2ZVS A;  3IWX A;  4OZJ A;  5KFM A;  4O3N A;  3PO3 K;  1RAH B;  5BYQ A;  5EN1 A;  1EH1 A;  2C2N A;  2VQF J;  1CG2 A;  3GTJ K;  4UF4 A;  5E3R A;  3Q8S B;  4K4T A;  5LSR A;  2M52 A;  3Q83 A;  2ZEJ A;  4NXN J;  4B9T A;  6FD1 A;  4CLP A;  4ZPV R;  2RF2 B;  5DDQ C;  1DLO B;  4RBU A;  1DCH A;  1DCO A;  2OSR A;  1QAX A;  4NE9 C;  4A8O A;  1FRX A;  2M88 A;  3MEG B;  4PRF A;  3BH7 B;  3QO9 B;  4B9S A;  3DOK B;  2ZBI A;  3J7Y U;  1ZM4 A;  2PHC B;  2NVQ C;  5LJ3 Y;  2UXB F;  1SFO C;  4GFQ A;  1V6H A;  4OJ3 A;  2RU3 A;  2Y9H A;  2R2R A;  2IMO A;  1TK8 A;  4OFZ A;  3CCZ A;  1RT3 B;  3W64 A;  2W24 A;  1FDB A;  1UW4 A;  2JZ5 A;  4WIL A;  1RBA A;  2FYX A;  4G7O A;  4LF8 F;  4DPX A;  1IR0 A;  4KV8 A;  4N7T A;  4DDQ A;  3A1Y G;  4ETX A;  1GMV A;  2EEY A;  4DQP A;  4M5J A;  1JJC B;  3DLK B;  4A46 A;  1D1U A;  2QV6 A;  2L9W A;  5D4P A;  3QPI A;  3MAA A;  1YHQ S;  4F0H A;  2ZHO A;  2WCX A;  3X3U A;  4AD6 A;  3IFE A;  4C8L A;  2B63 K;  2PA8 D;  2W7P A;  3IA0 A;  2ZH8 A;  1KFD A;  2E2H C;  5ETO A;  4G7H A;  4NXM F;  2AX0 A;  3R5D A;  1S6P A;  5B0A A;  4YFN A;  3BN7 A;  3V4M A;  4N8N A;  1IQT A;  1HNW J;  2DNM A;  5L9X A;  4QWC A;  3TAM B;  5AXN A;  1SUQ A;  4DV2 F;  2V6T A;  4ITS A;  4PXE A;  4C45 A;  4WTY A;  3POT A;  4FDF A;  2DNY A;  2C2E A;  1U2C A;  1HW8 A;  3JQM A;  1RWV B;  3LAP A;  3KG1 A;  5A6W A;  1UVI A;  4B3M F;  2YKO A;  4X66 J;  1X4C A;  4F3M A;  7FD1 A;  3QMQ A;  4G6V B;  3PJX A;  4ECQ A;  1URN A;  4O4G A;  4P7V A;  5KFJ A;  2YWW A;  2VG7 A;  2HHU A;  3GLJ A;  1N5Q A;  1NME B;  1SQG A;  2DNP A;  3TVK A;  3OXF A;  2MJU A;  3H0P A;  2SXL A;  4K0K F;  1S9E B;  4ZDN A;  3NGU A;  1EZZ B;  2BW7 A;  3EIC A;  4JV5 J;  5CYM B;  1J27 A;  5HSP A;  3FZ2 A;  1TAQ A;  2DRA A;  4CH0 S;  1HR0 F;  3CB4 A;  1UWA A;  5FJ4 A;  3TEH B;  1LOU A;  2W25 A;  3GYG A;  3BO3 A;  4E0D A;  2CJA A;  1TWA C;  3MMB A;  2ZC4 A;  2WVF A;  3KLG B;  1VMB A;  4OLP A;  1RWU A;  2E7W A;  5KFW A;  2AJ0 A;  3R7N B;  3WX4 A;  1RLD A;  3BSA A;  2BYC A;  3OXL A;  4NCB A;  3MPY A;  4UY8 5;  2A6H A;  3UN5 A;  1A6L A;  2NPI A;  2ZFH A;  3EPI A;  3EGN A;  4WK1 A;  1R8A A;  3FBE A;  3GFX A;  1F6T A;  1U1Q A;  3NBP A;  2VL1 A;  3UDL A;  4ED1 A;  4ZVP B;  2FPH X;  1KHV A;  4YP3 A;  1OIA A;  1RJJ A;  2Y8Y A;  3I4H X;  3CW2 C;  2CQ2 A;  1Y9O A;  3V4I B;  4X4O A;  2E5G A;  3MUT P;  2QMX A;  5AJ3 J;  2QRR A;  1Y11 A;  1QY7 A;  4DUT A;  5AXM A;  1NK4 A;  1RWN B;  4ZJQ A;  4GZY A;  3H98 A;  2XBP A;  4USK A;  5HQL A;  2ALZ A;  1INN A;  3GFZ A;  3SCI E;  1UJ6 A;  3AJD A;  5C24 A;  4TQR A;  3DLG A;  1FF2 A;  1WTF A;  2I5J A;  1H7X A;  2G13 A;  4B17 A;  2CNL B;  3JSB A;  4JYA F;  1FNX H;  5IOL A;  5HP1 A;  3BQ0 A;  3JAM U;  1M5H A;  3NCQ A;  1FJG F;  1C4A A;  2RE1 A;  3KHH A;  1YTY A;  1WHV A;  2CNK B;  3I4M K;  5HO4 A;  5I42 B;  4BY1 K;  1S72 S;  2MKS A;  1X4B A;  3VTI A;  1T9U A;  5KFY A;  4KAT A;  1IKY A;  4AE5 A;  1TWH A;  3DLE A;  3K2Y A;  4YY3 F;  4XLN A;  3MFI A;  1JLB A;  5LJ5 Y;  2F4V F;  4FYD A;  3U02 A;  1WUU A;  4OZ2 A;  3MOZ A;  1Y5L B;  3IR6 B;  3TJ9 A;  1RTD A;  1R43 A;  2YNF B;  2K7J A;  4M94 A;  1Q16 B;  2QMW A;  3H4D A;  4B02 A;  3VQS A;  3ZTS A;  4KV8 B;  2HZC A;  3GWC A;  3R5B A;  2NVY A;  5DZ7 A;  2ZH7 A;  4WIQ A;  3TX0 A;  2AYE A;  2ABY A;  2DKO B;  3TJ8 A;  4KGX B;  4GVB B;  5LXR A;  3CDW A;  2A6E A;  3FEX B;  4IR1 A;  5IM0 A;  1MMD A;  2Z30 B;  2J6S A;  2LQJ A;  4YQW A;  2ZH6 A;  1Y00 A;  3JQK A;  3SV4 A;  3B4D A;  4HDG A;  2YQ0 A;  1D9F A;  1U2F A;  2AWZ A;  1S6U A;  3EGW B;  4IOB A;  2YKM A;  4LLG A;  1RCX B;  3OL9 A;  5KFQ A;  1TK5 A;  1TFW A;  3T9Z A;  3JST A;  1X5O A;  4AT1 B;  2VD3 A;  1TKT A;  1VQL S;  1IKV A;  4O3S A;  2CJK A;  3KLE B;  4QIW L;  3B4M A;  1EI6 A;  3DC2 A;  1ZTT A;  1X9S A;  3QGI A;  4A3E C;  3RZD K;  4MK7 A;  4Q45 A;  4MIA A;  4M95 A;  4ILD A;  1RAI B;  2WB1 L;  1TVR A;  3POT B;  1BWE A;  4LF4 F;  4C98 A;  3BM7 A;  1Q79 A;  2OEM A;  3A8K A;  2IC3 A;  4PUO A;  4LSN A;  2KDO A;  1I3O B;  4OYP A;  1S1X A;  2N82 B;  1XMO J;  4BWM A;  2MPU A;  5GAG I;  1KVK A;  4LJZ A;  2IAJ B;  1YZ6 A;  1ITP A;  4I7F A;  2VOP A;  2V4Q A;  1YJW S;  4KGV B;  3BYR A;  4ATN A;  1JJ2 R;  1RTH B;  3OJU A;  2V8H A;  1X60 A;  5DDR C;  3E51 A;  5DZ6 A;  3D1H A;  2YKA A;  1SQE A;  3D67 A;  2LA6 A;  4K59 A;  4TN2 A;  5D4L A;  3H0G C;  2GNK A;  3D0H E;  1F5B A;  1R0B G;  1IBA A;  1F9H A;  3MM8 A;  2ZNZ A;  1F2H A;  1GTH A;  3MMB B;  5F3T A;  3GTK C;  2KZZ A;  3L3C A;  4WII A;  2XI3 A;  3I5B A;  1H38 A;  2Y0S D;  1N88 A;  4PZV A;  2UUC J;  4QBU A;  2Z58 B;  5IV4 A;  2HLT A;  3SCL E;  1GAO A;  3HSD A;  5J1P A;  4YR2 A;  3CJ8 A;  1JX4 A;  3P5T L;  4F04 B;  4WKR A;  4PEO A;  1F1B B;  3CC4 S;  2GVZ A;  4UQT A;  3KK1 A;  1UVK A;  1XZP A;  4FKY A;  3ETO A;  3CJQ A;  2R7Z C;  3JSM A;  4LUB A;  3MEK A;  3CDA A;  2H9Z A;  1VQ5 S;  1NK6 A;  2Y1I A;  1U1R A;  2JA6 K;  4NLQ A;  1DAR A;  2DGU A;  2ZBR A;  4XO0 A;  4NLX A;  1EAR A;  5DM6 Q;  3ZNU A;  4JI7 F;  1CJK A;  4F36 A;  3PW5 A;  4DBQ A;  4HI2 A;  3M05 A;  2L48 A;  3G82 A;  3ETM A;  4OI1 A;  4ZJO A;  2DHX A;  3DLG B;  2BQ3 A;  4DF8 A;  1ZYQ A;  2EKY A;  2RHQ B;  2I5J B;  3CUL A;  2DH8 A;  2DGQ A;  1E6Y A;  1U24 A;  4G1I A;  4P9S A;  2R92 C;  2CAJ A;  5D0G A;  4OJ1 A;  3N6L A;  1VRQ C;  1NHU A;  3MAH A;  4MKY A;  1LWE B;  2J8S A;  3W5X A;  2L41 A;  1QUV A;  3CO9 A;  2HS3 A;  2YKQ A;  3NGS A;  1KKH A;  4DSJ A;  2HND A;  3DLE B;  1JLB B;  3J7Z 5;  3ICL A;  1YNN A;  1JWW A;  2R8G A;  4RUA A;  2C3P A;  3D28 A;  1NZ8 A;  3GSD A;  2ZKT A;  4CNZ A;  3V81 A;  2NZC A;  2HRU A;  4XLP A;  1RTD B;  3GG1 A;  2OTJ S;  3KUE A;  3HFZ B;  1Y4Z B;  1KQF B;  4R8U A;  4LSZ B;  1TWC C;  1KFS A;  1HQE B;  2B3T B;  1JLG A;  4YDD B;  2AT1 B;  2MB0 B;  3QAE A;  4QWB A;  4C8Y A;  2GJ2 A;  2BM0 A;  1USM A;  2VPY B;  2VPW B;  3M8Z A;  2YKM B;  3NAH A;  3GIL A;  2R8J A;  3AD9 C;  5F3Z A;  1FCA A;  3SFU A;  4NYP A;  3M6W A;  1IKV B;  1MWQ A;  1QDU B;  1HYS A;  1MRO A;  2B9X A;  4RUB A;  4ZA1 A;  1HNW F;  3PO2 C;  2C1E B;  1K1S A;  3OXG A;  1X5P A;  2GSO A;  3O6Q A;  3ZZZ A;  4QIF A;  1EAY C;  3N01 A;  1TVR B;  3CJ5 A;  2R7W A;  5IS2 A;  1J6X A;  4OYI A;  4EU0 A;  4J9K A;  1I6H K;  3J81 j;  2IC3 B;  2DPJ A;  4PUO B;  4LSN B;  3W5Z A;  1V5V A;  4KMD A;  3NMR A;  2BDP A;  1S1X B;  2VJV A;  5DO2 A;  1SC1 B;  1QVG R;  5DGB A;  4OYW A;  2X1A A;  1F9E B;  3JTO A;  3RAM A;  1FTR A;  4ZPA A;  4A93 C;  1S6Q A;  4I7F B;  5DLF A;  5IQQ A;  4LT6 A;  5HLF B;  2VPX B;  4CO5 A;  4DR2 J;  2JRS A;  1RIS A;  2UZA A;  5JUM A;  3GTP C;  1SKR A;  4YME A;  3FMW A;  3OFG A;  2PO4 A;  4Y2C A;  4JV5 F;  1DTQ B;  1J98 A;  2Z4P A;  3HXA A;  2J9E A;  1OSC A;  3N5F A;  3SXL A;  2JEG A;  3BSO A;  3KFW X;  2CPY A;  3EWG A;  1VH2 A;  2BJ3 A;  2HFV A;  1R8H A;  1YX2 A;  3RB4 A;  2W8L A;  5E68 A;  3MM8 B;  4RJV A;  1NSQ A;  1IBC B;  4ZP8 A;  5DQI A;  4TY8 A;  5FLX Y;  3VZH A;  5E3P A;  2VG6 B;  2FVC A;  4JI6 J;  3FCW A;  1S99 A;  4A3B C;  1X4G A;  2BJ9 A;  2YPZ A;  5M5W K;  3LP2 B;  1PAE X;  4RO0 A;  4J9R A;  1D3W A;  3HFK A;  1BS2 A;  1U1O A;  2FJA B;  1YRU A;  3CD7 A;  2IRU A;  3PYE A;  2NVY K;  3EUN A;  1XZP B;  3AFG A;  3HMJ G;  1VQM S;  1HBO A;  2QE5 A;  2CDQ A;  1S10 A;  3MFH A;  2QT7 A;  3G2X A;  1S9G A;  4ECX A;  1HNX F;  1J6V A;  5B09 A;  1KS2 A;  2B63 C;  3Q8U A;  2W01 A;  2ZFZ A;  3Q2T C;  1CJK B;  2OEK A;  3VF0 B;  1JXE A;  1PGZ A;  2F8H A;  1O5J A;  1VQN S;  3G82 B;  2ZUA A;  1EK8 A;  2ZH4 A;  1IBK J;  2N4D A;  2ADC A;  2F8E X;  3CSK A;  2FQO A;  2G0J A;  1O51 A;  4JK1 A;  5A2Q U;  5IV3 A;  1C1B B;  1E6V A;  4ZLN A;  4DV4 J;  3I4N K;  1S97 A;  1H3D A;  2AJ2 A;  1E6Y B;  3M8S A;  2APO A;  4QYZ J;  5KFL A;  4PXB A;  1NJW A;  1NB7 A;  4IKA A;  3I96 A;  3NCP A;  3MM9 A;  3T6J A;  1NSP A;  1AFJ A;  4LRB A;  4O2D A;  2MKC A;  3T3F A;  1HBN B;  1SB6 A;  5C25 A;  1J2V A;  1CQN A;  1PJ6 A;  3QSI A;  3AY0 A;  2MHN A;  4DV5 J;  2OPS B;  1TWG C;  1YJU A;  2W2P P;  2HND B;  1CC8 A;  1S48 A;  2HIQ A;  1UFL A;  3OPK A;  2FHJ D;  3OEP A;  3DRY A;  5GME A;  3U1M A;  1DAX A;  2JH3 A;  3V81 B;  4Y7N C;  1FK9 A;  2CFX A;  5KG5 A;  1ZM9 A;  5KOW A;  4HLB A;  3PEH A;  4NCG A;  2JA8 K;  2CAD A;  1FA0 A;  1NPR A;  3BGR A;  4KE5 A;  2MQM A;  2PII A;  1EQR A;  5GMD A;  3FSY A;  1O2B A;  1O6X A;  3DFE A;  1JJH A;  3A4T A;  2QYG A;  2ADB A;  3ILI A;  2HMI A;  3HZG A;  2FZG B;  4KM8 A;  2FVQ A;  1KQG B;  1CVJ A;  1P9Y A;  1XZQ B;  2FLL A;  4HR2 A;  1RTZ A;  2RAQ A;  3VCD A;  3EZU A;  5K14 B;  1N6Q A;  4HVZ A;  2JJ4 D;  3S8S A;  3GTM A;  3TQ1 A;  1VLY A;  3S15 K;  2D3O 1;  2VFT A;  5ADZ A;  3UDE A;  3MMC A;  3RBE A;  3EQL A;  3VHQ A;  3SMZ A;  3KXD A;  1Z1Z A;  3GR1 A;  3FUY A;  3M1V A;  3WIU A;  3SIP B;  4N41 A;  3OVS A;  1VFJ A;  5IXU A;  2V94 A;  3BR9 A;  1S77 D;  4RNM A;  1S0V A;  1KR4 A;  2XGP A;  1ZA2 B;  4JUZ A;  5JJB A;  4DFM A;  2XYH B;  1XMO F;  3BS9 A;  2ZJP Q;  1UEK A;  1FEE A;  1TAU A;  4CO1 A;  1SKS A;  3MHY A;  1R9T A;  2W9B B;  4X62 J;  2H5I B;  2R93 A;  4KH1 B;  1ZZN A;  1UPP A;  2IVY A;  5KAK A;  1R0A A;  2PEB A;  2Q66 A;  4L6V 3;  2RQM A;  2HVE A;  1IM4 A;  1S6Q B;  3I5A A;  2B4V A;  2LDI A;  2D41 A;  3CMQ A;  3ENQ A;  3QAU A;  3W9I A;  5D0R A;  4U96 A;  4ID5 A;  1RAB B;  4KN4 A;  3UDC A;  4JI4 F;  3W3S A;  4ZMM A;  4X4P A;  2FVS A;  4OYM A;  1V3Z A;  3ISN C;  2RU9 A;  1Z4U A;  2OEJ A;  1YK9 A;  2MGZ B;  3WOD A;  3B82 A;  2EFG A;  3I4M C;  3M32 A;  1IQZ A;  2V9K A;  1OQ6 A;  3MWB A;  5C2C A;  1RT4 A;  3CQZ K;  1J5O B;  3T6B A;  3IWL A;  3R6L B;  2MEW A;  2QL5 B;  4C4W A;  2IVM A;  2UUC F;  1HHS A;  1X4F A;  2MMY A;  4X64 J;  2RSQ A;  2O5D A;  5GAE U;  4BBS C;  4PG8 A;  4Y00 A;  2KWA A;  1JKH A;  1AYE A;  3ILJ A;  2IM1 A;  2B9Y A;  1H7W A;  4CLK A;  2PMZ D;  3R9L A;  5KFV A;  3A3O B;  2BUN A;  3HO1 A;  1W2B R;  1WEL A;  2KYZ A;  2BE9 B;  3ZO7 A;  1HNI A;  1H98 A;  4QU7 A;  2E1C A;  3D6T B;  4TU9 A;  1GX5 A;  1HBO B;  2IFX A;  1UET A;  1I94 J;  1KDN A;  4ED0 A;  1DD5 A;  2DY1 A;  5HI7 A;  4GMK A;  4I2Q A;  3JSR A;  5B0G A;  2R7X A;  2E7V A;  3GJT B;  3M7V A;  2HSE B;  4ZVQ B;  4DL0 C;  2FJX A;  2MQO A;  3KLH A;  2IJR A;  1WCM A;  4KPY A;  4L76 A;  4HAC A;  3S1N K;  3I0R A;  2E9R X;  1EQ0 A;  4I4B A;  3DDN A;  3MM6 B;  1L3V A;  1S1V B;  5ETN A;  4I68 A;  3X1L B;  4MMO A;  5LMU F;  4OX9 F;  3MZI A;  2HFO A;  2Z2Z A;  5J2Q A;  1L5U A;  3NS6 A;  1E6V B;  4M5M A;  4TU8 A;  3P6Y C;  4ZPD A;  2IPO B;  3QFW A;  1BMQ B;  4WJB A;  1SL0 A;  3MM9 B;  1HNV A;  2MZJ A;  2OFG X;  2J0W A;  5C25 B;  4FNH A;  3AXM A;  3RB3 A;  3QRR A;  2CZ4 A;  2EG1 A;  3KUH A;  4TQS A;  3I32 A;  2RS8 A;  1VJE A;  2D6F C;  3HLU A;  5K8O A;  1RAJ A;  2BBE A;  1EET A;  5KFB A;  3P96 A;  3QNW B;  3BH6 B;  4DL5 A;  3PHE A;  2NYH A;  3JYT A;  3FFI A;  2HBR B;  4BCA A;  1FK9 B;  2E2H A;  1IM6 A;  3V2U C;  2BAB A;  2UVU A;  3JTP A;  2VAS A;  1KC8 T;  1KD1 T;  1N54 B;  4NCG B;  1WC3 A;  4FYW B;  1CC7 A;  2WSF C;  1T05 B;  2EKN A;  2HNZ B;  1FX2 A;  3BGR B;  3RUB L;  5D0H A;  4KO0 A;  4L73 A;  2R7U A;  2O3D A;  3VV2 B;  1UEU A;  3OSP A;  2CG4 A;  2JA7 A;  4BLA A;  3HKZ D;  1D0E A;  3H3V D;  2GGP A;  1UP1 A;  2IDL A;  2HMI B;  2VH7 A;  5ETT A;  3PTW A;  4KB7 A;  3HHE A;  3UN2 A;  3F41 A;  4FVC A;  4Q0B A;  3UCG A;  1N36 J;  3N6M A;  5L8R C;  3RRH A;  4UZB A;  2KN4 A;  1Q8L A;  1N6Q B;  5EGY A;  4FZB A;  2NUU G;  5L1K A;  1B99 A;  3IM9 A;  1FXR A;  3D0G E;  3PW7 A;  4RW7 A;  1HD0 A;  4I2P A;  2IYI A;  3VAJ A;  3MMC B;  2D3Z A;  3THV A;  3RU0 A;  1AA1 B;  3PYD A;  1RWW B;  5IOQ A;  3DLB A;  5HJY A;  2XY5 A;  1SC4 B;  3LQV A;  4F0M A;  4ECS A;  3M1V B;  3B6B A;  1X0F A;  3BSC A;  2J6T A;  2Q1L A;  1WF2 A;  3TJA A;  3PKY A;  1DTT A;  1KWM A;  3PJ9 A;  2EI5 A;  2HFZ A;  1X8D A;  4DLG A;  4DFK A;  1RT5 B;  4XDC A;  3KMQ A;  1G3O A;  2VON A;  2BM1 A;  4V1A k;  4KSE B;  4X6A K;  2DXF A;  2JA6 C;  2EBB A;  3IAM 9;  4LRF A;  5E33 A;  3N5B A;  2KM8 B;  3CC7 S;  1X4D A;  4JI2 J;  1TWA A;  1HHT P;  4NRT A;  1HA1 A;  1R0A B;  1T0T V;  3SFG A;  3G8T A;  1Y3K A;  2FHK A;  2DNK A;  3TUZ C;  1JB0 C;  5IYD K;  4PR6 A;  1KRP A;  3RR8 A;  4ID5 B;  3OTE A;  3M6U A;  2CJQ A;  2FB0 A;  1WOR A;  5ETL A;  1G6B A;  1YJ7 A;  1N34 J;  2GIQ A;  3LP0 B;  3M8W A;  2YQ3 A;  2BA9 A;  1GX6 A;  2XNQ A;  2DNH A;  1CPZ A;  2V5H G;  1N5T A;  2W9C A;  4QW8 A;  3HKW A;  3S1R K;  2R7R A;  1AZS A;  1XER A;  3ELH A;  3MM7 A;  1FD8 A;  2DHA A;  2R7T A;  2MLX A;  3FBF A;  4LRC A;  3GYX B;  4Y0F A;  2X7I A;  5D8H B;  3M32 B;  4X4V A;  1N48 A;  1T9T A;  5D4O A;  2NXN A;  4C8N A;  5L1J A;  3BR8 A;  1NRK A;  2E1P A;  2VQE J;  3OLB A;  4ED8 A;  1RXO B;  4RW9 B;  4AND A;  2PI4 A;  2WW8 A;  4DL7 A;  3DXS X;  2AQ4 A;  3RRG A;  4K4X A;  5K5M A;  1UV7 A;  4OHX A;  1C0T A;  1JK9 B;  4W92 B;  5H1S V;  4DL4 A;  4KT0 C;  2ZC3 A;  3EXC X;  3C8Y A;  4I0W A;  1EQM A;  1REV A;  4LK0 A;  1WSR A;  2GC8 A;  2MQP A;  2RH6 A;  1HNI B;  4LF5 F;  2FGO A;  4ALZ A;  4Y52 C;  1N32 F;  4LVN P;  3S2D K;  2FJB B;  1V3R A;  2XB2 D;  5IFM A;  2GHP A;  4WE1 B;  2WVC A;  1OMS A;  1OQ3 A;  2W7A A;  1Y1V C;  2LFV A;  1KQ4 A;  4I2Q B;  3GTM K;  3GFH A;  2FHO B;  4U7U D;  4LRE A;  2P5M A;  3VWS A;  3FK4 A;  2W2O P;  4LF7 J;  1RWP B;  1N4L A;  1LWX A;  4P2S A;  5LSO A;  1FRJ A;  5T7L A;  5TJ3 A;  3L4K A;  3MEE A;  2X1B A;  3VGU A;  1VIO A;  4DPY A;  1VHF A;  3T5H A;  4KN7 A;  5KFT A;  4ZVR B;  1HW9 A;  1SH0 A;  2Q6C A;  1IBM F;  2MKI A;  4IFY B;  4XDD A;  2XTJ P;  3J7A N;  3FSI A;  2CQ4 A;  3Q8V A;  1HNV B;  2Y1L B;  1I6H C;  3O2I A;  1Q95 G;  2E2J K;  2IBK A;  4M5D A;  1IE0 A;  4J9M A;  3MDF A;  3VVU A;  4J37 A;  3B8H A;  4P2X A;  1U6B A;  3CCV S;  1VI7 A;  4OZ3 A;  5J1E A;  4KM9 A;  2J9D E;  4H4O A;  3SQO P;  4A3J C;  5G4D A;  3S01 A;  3PV8 A;  1LFW A;  3J81 Y;  1EET B;  5CQG A;  5IP9 K;  4KH0 B;  2J6U A;  3JYT B;  3FFI B;  4DR4 J;  4TY9 A;  3V4G A;  2P6S A;  2ZJR Q;  1ZPW X;  1V9O A;  1TUG B;  1UJ4 A;  2UUW A;  1NM2 A;  2DH9 A;  2RDI A;  1PKU A;  4J9Q A;  2PE8 A;  3F44 A;  2BXJ A;  2HK2 A;  2DIU A;  4HHJ A;  3BKF A;  4KO0 B;  1S0M A;  5K8M A;  2XUL A;  4B3R F;  5L1I A;  3WC2 A;  3H7H B;  3GR0 A;  2DIV A;  4DV6 J;  1GXU A;  2ZH1 A;  5IOT A;  4KHP F;  2XCQ A;  4Y3C A;  4YN3 B;  1VIS A;  2DR5 A;  3K7A C;  2U2F A;  4LFC J;  2Y1J A;  2FZC B;  3OR2 B;  3UFC X;  2QLF B;  3GII A;  3NGT A;  1F3V A;  3IR7 B;  4L72 B;  4ECT A;  4WZM A;  2WOM A;  5FII A;  4GKJ J;  1Y0H A;  1RYR A;  2UV8 A;  1M5V C;  2R2S A;  3NGR A;  3BJY A;  3P3D A;  4NI2 A;  1K83 A;  2CQB A;  3MR6 A;  5G0R B;  2GQQ A;  3DKD A;  5J2N A;  3OLA A;  1CSJ A;  4PAA A;  4DUY J;  3OTD A;  5F9N A;  4IRD A;  2XG8 A;  2CQP A;  1RE1 B;  1K47 A;  4ZP7 A;  1ZAW A;  2C2Z B;  3M2U A;  2JA5 C;  3VAH A;  2YU9 A;  2K8G A;  2CJB A;  3GZ7 A;  5E7O B;  2KO1 A;  2B43 A;  5DQH A;  3PYG A;  2NVQ K;  4LBP A;  2HVI A;  1DY3 A;  2HHH F;  3PO5 A;  5HRO A;  1SFO K;  3GTK A;  3DOM A;  3UE2 A;  1HMV A;  2IIH A;  3DYA B;  4KRW A;  1FTC A;  1O26 A;  1S1W B;  4PXC A;  4NLY A;  3P45 B;  3GTO K;  3FCH A;  1M1K T;  4NZ0 A;  4KHR A;  5A2Q Y;  3CWJ A;  3AXK A;  3M9N B;  1H6K X;  2I8E A;  2MQL A;  1BLU A;  2LQ5 A;  3HHK A;  1U6Z A;  2GVD A;  1AZS B;  5B0F A;  1H2U X;  5CYQ B;  2VIH A;  4FZV A;  3K8V A;  4GTE A;  2R7Z A;  2IM2 A;  3ISN D;  2HHT A;  1RHM B;  3FBC A;  4URG A;  2ILY A;  1I50 C;  3UD5 A;  2B4U A;  4YFK A;  2WAQ D;  3GTL K;  1PJ5 A;  4IDK A;  4C3J C;  1SV5 B;  2UXD J;  1P9Q C;  4ZCL A;  3T1H J;  1HHQ A;  2P9C A;  4ZJL A;  4JV2 A;  3MCN A;  5LM7 E;  1O2A A;  1XK8 A;  1GNK A;  2CVE A;  4IOA Q;  3VAI A;  3AOB A;  3MM5 A;  1N5Y A;  4BLG A;  1C0T B;  4L74 A;  4EUV A;  3EVM A;  2VDI A;  4PQA A;  3V6K A;  3VAK A;  4DPW A;  1NK5 A;  4DSF A;  3KK2 B;  3QJJ A;  1I6J A;  4EGL A;  4DN9 A;  3UQS A;  1N5S A;  2R92 A;  3HD2 A;  3N4W A;  4H4M A;  2ZUG A;  5C3E C;  3SZY A;  2VBW A;  4M5I A;  2HZV A;  5CD4 A;  3ZZY A;  1WKJ A;  2ZBC A;  4I64 A;  2C3Y A;  5T14 A;  1J5E F;  4BWJ A;  3RR7 A;  3EGV A;  4A47 A;  3TA2 A;  4TYA A;  3CUN A;  4OYB A;  3HOW C;  2KYX A;  2VDH A;  2G0C A;  1ZM3 A;  3SSR A;  3U27 A;  1WC1 A;  2FQQ B;  1HBU A;  3OSN A;  3FHZ A;  1VRU A;  3CJT A;  5T7L B;  2HEK A;  3ZZT A;  3MEE B;  2BJ8 A;  4IO1 A;  1A9N B;  1SJQ A;  3CED A;  4DR1 F;  2HHV A;  4PQU A;  5M3M K;  3QT5 A;  4ZVF A;  1O0P A;  1R0C B;  3BYP A;  4FM9 A;  4HT7 A;  1TKZ A;  4DG1 A;  1B4B A;  4DQR A;  4I56 A;  1PBA A;  2R4F A;  2DJW A;  3QRP A;  1TKX B;  3CD6 S;  1RWM B;  1XNQ F;  4FNI A;  5L39 A;  3P4U B;  2HQI A;  4A3G C;  1ZAX A;  3CXC R;  2JHE A;  5D3G A;  1SIZ A;  4JI3 J;  4ENO A;  4J9N A;  3PDN A;  1TWA K;  2KTQ A;  1YSJ A;  5J1E B;  2M4M A;  1NDP A;  3F56 A;  4H4O B;  2GJI A;  2RUS A;  3BEG B;  2E29 A;  2RHS B;  1S7H A;  1CJV A;  3O3L A;  5KFE A;  2UXB J;  2GW8 A;  4WKY A;  2R2T A;  3OFF A;  1PAU B;  4G1Q A;  2J5A A;  1RLC L;  1SH2 A;  5DG9 A;  2HVZ A;  5H9F J;  1FJC A;  4WFX A;  4BXX K;  3HSJ A;  2E2I A;  4TLR A;  4CNY A;  4LF8 J;  5E5N A;  2QTW A;  3A3P B;  4NLS A;  3NL0 A;  4F4Y A;  3GFY A;  2AP6 A;  3G8S A;  3FCV A;  1CS4 B;  3UR0 A;  5E41 A;  4QJV B;  5F9L A;  3CCJ S;  2ZH9 A;  3CQZ C;  4ELT A;  1JXV A;  3S2H C;  3GON A;  2QLJ B;  1ZM2 A;  4MQ9 A;  1ICE B;  1L3K A;  1FRL A;  4A8S A;  1D09 B;  2YX7 A;  4EK2 A;  3CD0 A;  1QJH A;  1WI8 A;  1KOO A;  4NI2 B;  1FFG B;  1RHR B;  1NU4 A;  5JMN A;  4LFB J;  2XMW A;  2DGS A;  5IC6 B;  4B08 A;  3GTP A;  4NXM J;  3U1N A;  4WK3 A;  2J9D A;  5J2N B;  2FLP A;  1GE9 A;  1RQ0 A;  4KY3 A;  2NSC A;  4DV2 J;  5EHH A;  3J80 Y;  1F5C A;  3NS5 A;  3ZTR A;  2C2K B;  4CO4 A;  4LMZ A;  2WVE A;  4W98 A;  4G0U A;  1RT7 A;  2GFF A;  2HIY A;  2F3J A;  3FRY A;  5CHC B;  3Q89 A;  4B3M J;  3I87 A;  4KPC A;  1HMV B;  3BBF A;  1GXT A;  3L4J A;  2JLE A;  2VKR A;  3MMA B;  2V6S A;  1HFE L;  1S0N A;  5D15 A;  1U09 A;  4MFB A;  1DUR A;  1ACM B;  4J9S A;  2EVZ A;  2RB7 A;  3OJS A;  5C4J C;  4KC5 A;  1RKJ A;  2KG1 A;  2KFN A;  2CPZ A;  4CLS A;  1OWX A;  3HOV C;  3CJK B;  2GVD B;  2BE2 A;  4K0K J;  2WZ1 A;  4YG2 A;  3HCX A;  1CLF A;  1Z2Z A;  1WQH A;  5KFP A;  3FKI C;  5FLM C;  3Q22 A;  5C5J A;  4A3F C;  2DNQ A;  1D9A A;  3K57 A;  5HN0 A;  3K17 A;  4LIW A;  2QLX A;  1HR0 J;  4IDK B;  1TR0 A;  4J90 A;  2B63 A;  1DHM A;  4F3O A;  2R7V A;  3SI8 A;  1LW0 B;  2VUM C;  3PX6 A;  1Y10 A;  1VQS A;  1UZH A;  1XPP A;  3MD1 A;  3DRP A;  3JXO A;  1R7I A;  4LJM A;  2XY6 A;  1I3Q C;  1TWF K;  3CVK A;  4A3E K;  2EFQ A;  3RAX A;  4H4M B;  1M1H A;  3TVZ A;  2YNI A;  3R3T A;  4RR5 A;  1ZXO A;  2L9N A;  2HGL A;  3R8Y A;  2X51 A;  4BY7 C;  2CPJ A;  2YY3 A;  2UVR A;  3GIM A;  3ULH A;  1TWG A;  4EWT A;  1QSL A;  3C15 A;  1L3U A;  4YEA A;  4KFB A;  4LOW A;  1VCT A;  1F60 B;  1VRU B;  3CCE S;  2ZM6 F;  5T41 A;  4DX7 A;  3TOQ A;  4C9D A;  2O5I A;  2LKZ A;  2V67 A;  5LSL A;  4GO5 X;  4PQU B;  2NXE A;  3FOE A;  3PM9 A;  4UTG A;  2LCW A;  3GQC A;  4N76 A;  3Q23 A;  3TR5 A;  4LQY A;  2HAF A;  4A48 A;  3HVW A;  3KYL A;  2X3G A;  3MGJ A;  4X4S A;  1N33 F;  2LU1 A;  4CLU A;  3AOA A;  3LPE A;  2BAC A;  4CO3 A;  3H2V E;  4JYA J;  4Y28 C;  4X6A C;  4YB7 A;  5FD1 A;  4ED4 A;  3H0G K;  1ZS6 A;  4WWS A;  2HQG A;  4S0M A;  1AB8 A;  3ONQ A;  2Z2Y B;  5D3G B;  3QO9 A;  1IJE B;  1UVM A;  2IY5 B;  3DOK A;  4GTD A;  1FJG J;  3DLH A;  5DQG A;  1RU1 A;  2F5G A;  4BBY A;  4DR4 F;  3GTK K;  1CJV B;  4TVA B;  5IC4 B;  2RRN A;  1ZPV A;  1Q7L B;  4QR1 A;  1TL7 A;  4LQ9 A;  1RZM A;  1S7I A;  2R2U A;  5IYD C;  4YY3 J;  2K2P A;  2ZDO A;  1M5O C;  1OPI A;  2Z2M A;  1ZZF A;  4BS2 A;  2DGT A;  2NCK L;  2L3M A;  3FOF A;  2YNH B;  2QC3 A;  3LOU A;  2AJ4 A;  2A18 A;  3DLK A;  4LFC F;  3IS9 B;  3TAQ A;  2R7Z K;  1Y3J A;  1HWJ A;  5JVH Q;  3SYZ A;  1QM9 A;  3ET6 A;  4PWD B;  1RAG B;  3H5U A;  3HHL C;  5I3U A;  2I2Y A;  3EZ5 A;  3TI0 A;  3HT3 A;  3G96 A;  5RUB A;  3M6X A;  4GTA A;  1LV5 A;  1Q0N A;  4WPA A;  3DI6 A;  1JMT A;  4OYA A;  1UW9 A;  2YXL A;  1KBR A;  3HFV A;  4W4M A;  1Q5Y A;  5FDL A;  4ECR A;  5KG6 A;  3HSZ A;  2RIL A;  4N47 A;  3AQO A;  3ZTO A;  3AH6 A;  1H73 A;  2HAI A;  2ZBP A;  2XHC A;  2F7V A;  3R5C A;  4ERD A;  4GKK F;  2IA0 A;  1N5V A;  5DJB A;  2AZ3 A;  1WC4 A;  1XMQ F;  3CGI A;  2FVP A;  2B51 A;  4V19 X;  2BJ1 A;  1RT7 B;  3IAS 9;  4LF4 J;  2CYY A;  4EYI B;  3OV7 A;  2W2M P;  2KB2 A;  3W8G A;  3TA0 A;  4UW2 A;  5E0O A;  4DQS A;  1J6W A;  1S12 A;  1TV6 A;  2P2C B;  1OSD A;  2WSE C;  5HAN A;  1YKW A;  4HYK A;  1WC5 A;  3FJ2 A;  4OIP A;  4MFB B;  1UFW A;  4JP8 A;  1Y1W K;  3AT1 B;  4MYT A;  1B70 B;  1S1U A;  1S9E A;  1RA7 A;  2DXD A;  4AH6 A;  2BE2 B;  4B9M A;  4JBC A;  4WTO B;  3A8E A;  1TWC K;  4NMX A;  1VK3 A;  2D74 B;  3HOZ C;  3NAI A;  1K0V A;  2FUG 9;  3LAN A;  1K0T A;  4EMD A;  1GEH A;  2DNO A;  1UL3 A;  4OX7 A;  3T1H F;  1FJ7 A;  1DQ9 A;  2I1R A;  2KVI A;  3L95 X;  4X65 F;  3EVW A;  4K4Y A;  2DXE A;  5GAD I;  1G1X A;  3K5P A;  2V8D A;  3BQ2 A;  1X9M A;  1O2F B;  2QGF B;  5F8H A;  3BV8 A;  4ZS6 A;  3DRP B;  1RU0 A;  1JLF A;  2IA6 A;  4ZKA A;  3PO2 K;  4DS4 A;  3KNG A;  2VBX A;  1YWX A;  1LW2 B;  3SZ2 A;  1URR A;  2UV8 G;  5CXT A;  1FHT A;  3DNC A;  3EJM A;  2DRB A;  1UA1 A;  2XMK A;  4LF2 A;  2NUH A;  2YNI B;  3CJ4 A;  2OUG A;  1N52 B;  2HPU A;  2U1A A;  4RZR A;  2V69 A;  2VFR A;  1FEH A;  4GRS A;  4M8L A;  2ZH3 A;  2GHW A;  3HSG A;  5HMZ A;  3GE9 A;  3D3B J;  1Q78 A;  2E1M C;  3V4I A;  1S9F A;  4OI6 A;  4A93 K;  4BHQ A;  1TK0 A;  4RU9 A;  4JB8 B;  4DOZ A;  3EGZ A;  4JI7 J;  5HVG A;  2ZNY A;  2KH9 A;  1DRZ A;  2WK4 A;  4DU8 A;  4ZCK A;  5KFK A;  3GTP K;  3AJ2 A;  2CXE A;  4NLO A;  2E66 A;  2JLF A;  3CJ2 A;  3ENA A;  2B0G A;  5EX0 A;  8ATC B;  2CVI A;  2H4Y B;  4RBV A;  5D0E A;  4D3G A;  3M2R A;  4JI3 F;  2AYB A;  1RT2 B;  5CCM A;  2ASY A;  2JSX A;  1YDL A;  1XTZ A;  3K5O A;  1FWK A;  3GEI A;  5I42 A;  4ZN1 A;  7FDR A;  2JVR A;  3PJW A;  2MDA A;  5ETP A;  5FLX U;  4IO9 Q;  1VQY A;  1WTB A;  4LR7 A;  4P2M A;  4DX6 A;  2YBV A;  5IOS A;  4L3N A;  2KT3 A;  5BR8 F;  1TL7 B;  3IWN C;  3GTO C;  3OL7 A;  5IYC C;  1HLW A;  4A3B K;  4ETZ A;  2AZ1 A;  3SZZ A;  2YNF A;  3KG0 A;  3TZY A;  2OPP A;  2VV5 A;  2Z56 B;  4M5G A;  1W26 A;  2C42 A;  2MZS A;  4M5L A;  4IFV B;  4QIW D;  2RD5 C;  4A3I K;  1FKO B;  3QJP A;  4GVB A;  2XMJ A;  2HHP A;  4MH8 A;  1RBO B;  3BPD A;  2CQH A;  3UI3 A;  4M5H A;  3ET6 B;  2EXU A;  2QA2 A;  3GTY X;  2W2N P;  3GTL C;  3R5G A;  4A8Y A;  5I3U B;  4KB2 A;  1NPK A;  2JA6 A;  4P2F A;  2WB1 D;  4B3T F;  3DI6 B;  2OML A;  3TP2 A;  4CRJ A;  1RAE B;  4L3K A;  3QJL A;  4GC6 A;  1VJQ A;  4WFY A;  2OJ3 A;  4IUF A;  2JLG A;  1WOP A;  4F2R A;  3UWT A;  4HKQ A;  4LFB F;  3HOX C;  1FRI A;  3DLJ A;  4BDP A;  3KLE A;  5FDL B;  5KFU A;  2ZHA A;  3D3C J;  2HVH A;  1HKA A;  4DSL A;  1JVI A;  3ENW A;  3SSQ A;  2VFU A;  2WRM A;  3ZTQ A;  2RDD A;  3DRX A;  3EM1 A;  3FVY A;  1IQ0 A;  2R9L A;  5D77 A;  4OIX A;  1TWH C;  4DL6 A;  4DJB A;  3GG0 A;  3OPF A;  1QSY A;  2HVD A;  3VAL A;  3C3L A;  4Q7A A;  3BGU A;  3G4S S;  2ZBQ A;  5KTQ A;  1TWG K;  3M9O B;  4Z7Y A;  1QLN A;  3DRS A;  3QID A;  2KXH A;  1TV6 B;  4JI1 F;  2IAJ A;  2BMB A;  5K8N A;  3WZ0 A;  2YKP A;  4RX6 A;  3GCW P;  2XEX A;  5KFR A;  2R7O A;  1TU0 B;  4Y7N K;  4OZ5 A;  2HFN A;  1XR6 A;  5GAH U;  1RTH A;  3DCA A;  1S1U B;  2D1C A;  4CLT A;  3C2P A;  5AE3 A;  4OZN A;  2VOO A;  1HBM A;  2Q3P A;  3QZ8 A;  4CM2 A;  2J7W A;  1WEY A;  2BJ7 A;  1T94 A;  1QE1 A;  5H9E J;  3LAL A;  1U4B A;  3O1L A;  2LQB A;  2F8M A;  2C3O A;  5B0D A;  5HBM A;  2GSN A;  2LQ8 A;  1Y1V A;  1GMW A;  4JI0 J;  2QX0 A;  4X4U A;  2AJ1 A;  2BKN A;  2KJV A;  1TL5 A;  2XS5 A;  2QEX S;  1RK8 A;  1VQP S;  5M2U A;  2VB6 A;  4RKU C;  1KLN A;  1WF0 A;  5BYR A;  1EFW A;  4ZIW A;  4MIB A;  1JLF B;  3M6V A;  4DHV A;  1SXL A;  4IQM A;  2NPF A;  2M70 A;  2QA4 S;  2JEJ A;  4I1T A;  4BXX C;  1ZA1 B;  3DU5 A;  3OHB A;  1BGX T;  4USI A;  4KHM A;  3K59 A;  2R7S A;  3K5M A;  4C3H K;  4IYQ A;  1NPP A;  3E8O A;  2HHS A;  3FEZ A;  3GIK A;  1MML A;  1ZOT A;  3S17 K;  3OTB A;  4DSI A;  3H25 A;  4CQ1 A;  3K58 A;  4DQI A;  2Z57 B;  1RT1 A;  3BDE A;  1I1G A;  2WW4 A;  4K8R A;  4LRA A;  1HNX J;  4A8X A;  2KKH A;  3OR1 B;  3ZTP A;  3I0S B;  4FN5 A;  2DNR A;  1GH8 A;  2NVX C;  3S1M C;  5DG8 A;  5EWF A;  4USW A;  3OTC A;  1PBU A;  2XMV A;  2P8T A;  4JI5 F;  2A6M A;  3CD5 A;  1HNZ F;  1XNR F;  2RH3 A;  2VUG A;  3UNY A;  4ZVU B;  1TZ0 A;  2OI2 A;  1XXB A;  1DCP A;  3PRV A;  3AD8 C;  3DGP B;  3M2R B;  3NP5 A;  3UR3 C;  4MEX A;  1LNQ A;  3NCR A;  3QFH A;  3CCR S;  3V5R A;  1YCL A;  4OX8 A;  1JNZ B;  1LWE A;  1K73 T;  5D4D A;  2BV3 A;  1Z2L A;  3VGT A;  3GTG K;  2O66 A;  1GXL A;  1WOS A;  4O0N A;  4FXW A;  4OIO A;  2UUA F;  5THW A;  4BBS K;  1KN6 A;  2HWH A;  3AAW B;  4DR6 F;  3MCO A;  4K5R A;  1EJ7 L;  3AOD A;  5JVG Q;  2OPP B;  3HZE A;  3CMA S;  1RHJ B;  1HIY A;  4P52 A;  3A8I A;  3H42 A;  2HHW A;  2AW0 A;  1HQE A;  2COL A;  1LQ9 A;  2CW0 A;  2F4F A;  1O24 A;  4LBH A;  3GV5 B;  2CPH A;  4P10 A;  2V8V A;  1YLX A;  3Q24 A;  1WEZ A;  2BEF A;  4ZLJ A;  3Q3Q A;  2YNG B;  1FRM A;  4HHH A;  4DCJ B;  3HHL D;  4FKX A;  3G71 S;  2QA1 A;  4B3O B;  2CJX B;  4LK1 A;  2LP4 A;  4BC7 A;  2RUG A;  3MUR P;  2VF3 A;  4ID8 A;  3EDQ B;  1FXD A;  2HGM A;  3LGH A;  3KWM A;  2GAG C;  4W90 B;  1XQI A;  1VQ6 S;  4EI2 A;  3TUI C;  1TWF C;  2GMH A;  2MQQ A;  3C6T A;  4H4K C;  4ECY A;  4GTL A;  4X4N A;  3C16 B;  2HBY B;  1APS A;  1KQK A;  3QGP A;  1I50 A;  1IWA A;  3WIV A;  2H5J B;  3BGL A;  3DMJ A;  2AMC B;  1T03 A;  2V68 A;  1RU2 A;  3IGV A;  4K2X A;  2V0N A;  3DRS B;  4QW9 A;  2IYG A;  1NND A;  1UVJ A;  4FYV B;  1AT1 B;  4WFZ A;  1VQO S;  3T5L A;  2ZHB A;  5J2P A;  5CHP A;  5E3Q A;  2QLB B;  3IN5 A;  1XJW B;  5M2R A;  2ZKU A;  5HLF A;  1WJ9 A;  3KTQ A;  5F8G A;  1UWB B;  5KG7 A;  3NNH A;  2JNJ A;  2HRY A;  3W2V B;  1T11 A;  4X4T A;  4G1P A;  4GTB A;  3BQ1 A;  2N7C A;  4ILM A;  2EW9 A;  1DTQ A;  3K0J A;  4C48 A;  4F2S A;  4GTC A;  3HD1 A;  3CJS A;  4Q8F A;  4GC7 A;  3HXM A;  4QU6 A;  2DBB A;  2EFN A;  2RVJ A;  1HBM B;  1QE1 B;  4JI4 J;  2RGR A;  2C3M A;  1NUE A;  1S49 A;  3TAP A;  4KKO B;  1PG5 B;  2V8G A;  1SJF A;  2GX8 A;  3D9B A;  1EKR A;  4USM A;  2DCU B;  5HBM B;  3OL8 A;  3Q2S C;  2V6U A;  3MPD A;  1CJU A;  5HAT A;  1HI9 A;  1X9W A;  5J1N A;  1S76 D;  3RZA A;  3CE8 A;  2VG6 A;  1GTE A;  1IJF B;  3CIZ A;  1WC6 A;  1HWL A;  4I69 A;  4E2F B;  3TEG A;  3HUL A;  3LP2 A;  1B4A A;  2PDA A;  4DV3 F;  3PY8 A;  4F3Q A;  2O67 A;  4EZ9 A;  1LXN A;  4CLW A;  3P49 B;  3MED A;  3D1Q A;  1RB0 A;  1EX8 A;  4NLV A;  1TL4 A;  4NLT A;  3RAQ A;  4WCE Q;  4F4K A;  2UVW A;  2CQG A;  1RYS A;  1F7V A;  5GVQ A;  3BP3 A;  4MKA A;  4OJH A;  2ZD1 A;  1PC5 A;  4J9O A;  3DM2 B;  4KDD A;  1X0P A;  1TUW A;  2JFD A;  3MI7 X;  4YFU A;  1RT1 B;  2V2K A;  3W62 A;  4DU7 A;  1FO1 A;  1M1G A;  3L7U A;  6AT1 B;  4G0W A;  2FLO A;  2XYP B;  1VC5 A;  3LAM A;  1PIE A;  2K3K A;  2XQC A;  1NB2 A;  2CPE A;  2EC2 A;  1C1B A;  5LMU J;  4QYZ K;  2B9W A;  4OX9 J;  3R1H A;  2V50 A;  1FRH A;  4KMH A;  3IXQ A;  3M9M B;  3W9J A;  3L4B C;  3SEO A;  3HF5 A;  2H54 B;  3CME S;  1RCO B;  1HBN A;  5A8R B;  2VG5 B;  1CBK A;  4ZLL A;  2AHO B;  3CQZ A;  2V6A A;  2OPS A;  3M8P A;  5L1L A;  4RUC A;  3PNI A;  5CD4 H;  3DXB A;  1MN9 A;  3DXJ A;  2ZJQ Q;  3D6M B;  3CCS S;  1U0H B;  1NKC A;  4P72 A;  4UUX A;  4ZPB A;  2A10 A;  1Y1W C;  5LL6 d;  3GU0 A;  2MKJ A;  2R8H A;  1JOE A;  1HQ2 A;  1Q4R A;  4DFJ A;  2BAN B;  4IRC A;  4MIW A;  3M3Y C;  2O01 C;  1WG1 A;  2AEJ A;  2A6O A;  4ANC A;  4Y52 K;  2ZZN A;  1WG4 A;  1ZBT A;  3GV8 B;  3BN4 A;  1XZQ A;  5CA5 A;  2K1R B;  5K14 A;  1Y1V K;  4K4W A;  1U0S A;  3EZO A;  4Q2L A;  3RBX A;  2DGO A;  1D9D A;  1AW0 A;  1G51 A;  4HTI A;  2XC9 A;  4O4R A;  2AD9 A;  4WFB Q;  4LF6 F;  4IRK A;  4V19 J;  2C3U A;  4RNF A;  2HG4 A;  3BZQ A;  5HVH A;  2OO4 A;  2CUY A;  3AB4 B;  1YIT S;  2F1F A;  2NR0 A;  1SMY A;  1V5I B;  1YJR A;  2DO0 A;  1MG7 A;  1R3N A;  3GTQ K;  3MML B;  2MHE A;  1YIJ S;  2BE7 D;  1IBL F;  3C6T B;  2V34 A;  2A0F B;  2CKW A;  4JV0 A;  2B8Q A;  2XCA A;  4YB6 A;  3O5T B;  1TTH B;  1Q82 T;  3FKI A;  5KT7 A;  4KQZ A;  3C19 A;  2R8K A;  2XWY A;  2BQR A;  2V4R A;  5C4X C;  4CYU B;  3DMJ B;  2W9B A;  1MU2 B;  3H2L A;  1T03 B;  2QZ8 A;  1ISE A;  4ILL A;  1R31 A;  4P6Q A;  1R8B A;  1NK0 A;  2DVI A;  3R7B B;  4A3J K;  1BUX A;  1SH3 A;  1XBW A;  4CLF A;  3J81 U;  4ED7 A;  1U25 A;  3D1O A;  5J2P B;  4EZ6 A;  4IOC Q;  2D69 A;  3I5C A;  2Z0G A;  2RT3 A;  1VQK S;  1XEZ A;  5IP7 C;  5KT6 A;  3UDV A;  2IRY A;  1SVD A;  2BRL A;  4RNH A;  4X4Q A;  3ENV A;  2EPI A;  4C8K A;  1XR5 A;  1CQM A;  3SCK E;  2OPQ A;  3G87 A;  3VAM A;  1UVN A;  1F2G A;  4P71 A;  4JI8 F;  2MGZ A;  1RAA B;  3JB9 k;  1VLO A;  4JI0 F;  2XY7 A;  4DZ6 A;  2XS7 A;  3K7A K;  1QAY A;  3BO2 A;  1J5O A;  3S7R A;  2AGP A;  3Q0A A;  4BKW A;  2GS8 A;  1CJU B;  2OPR B;  4HTJ A;  2QN6 B;  4DL2 A;  3NKY A;  3G4A A;  4A8K A;  1G2E A;  2PC6 A;  5ITH A;  2KRB A;  2BRK A;  4UOH A;  1RWX B;  1NDK A;  4YR0 A;  3MED B;  5I3P A;  2AJF E;  5KFX A;  4A3I C;  5F8N A;  1EP4 A;  1X4E A;  2NVT C;  1U02 A;  4MYU A;  3PZP A;  2LEP A;  1RTJ A;  4LF5 J;  2VPZ B;  2RRB A;  2ZD1 B;  2MST A;  3BKT A;  2JA5 K;  1N32 J;  5K20 B;  3MR7 A;  2HQ3 A;  4AL5 A;  2VKZ G;  4AYB L;  3Q8R B;  1NJY A;  3F0N A;  2GV1 A;  1LWC B;  3OTO F;  1R6Y A;  4OV1 A;  4R5P A;  2XGQ A;  2I6W A;  4RU2 A;  1W2I A;  2HRT A;  4B9N A;  2NXU A;  3RBZ A;  3MM6 A;  1S1V A;  4ER8 A;  1Y5N B;  4ED5 A;  4NYZ A;  3GEH A;  1TL1 B;  3OD2 A;  5F8J A;  1C1C A;  1RT6 B;  3IG1 B;  1OJ4 A;  3MR5 A;  4TLQ A;  4ZPT R;  2ZWP A;  1AB4 A;  9RUB A;  1IBM J;  1ROF A;  1VRT A;  2L9D A;  3H59 A;  3CDU A;  2MTL A;  2M8H A;  3FBB A;  5F8L A;  1C4C A;  5GAH I;  4B9V A;  5BYS A;  2GIR A;  3NGK A;  1I50 K;  2V4J A;  3RB6 A;  5DGA A;  3M8P B;  3D5M A;  4C3J K;  1XMB A;  4PPZ A;  2Q79 A;  2V2V A;  3DU6 A;  1GK8 A;  1I51 B;  4DWI A;  2UP1 A;  3FKB A;  3G8Q A;  2G2Y A;  2EBE A;  2XMA A;  1YZ7 A;  4AXJ A;  2YH1 A;  3M4O C;  5CH7 B;  2AEM A;  4WFA Q;  4LIR A;  4C11 A;  1T05 A;  2HNZ A;  1CEZ A;  1QSS A;  4Q4Z A;  2V8P A;  2XSF A;  4DV1 F;  3MEC A;  4AUK A;  4MK8 A;  4B3R J;  2Y8W A;  4XAK A;  2W9A A;  1UA0 A;  2HW3 A;  5C3E K;  1WCM C;  1VJW A;  1ARO P;  3K5N A;  3I82 A;  3M8Q B;  4F4Z A;  2FJW A;  3C6U A;  4KHP J;  2OTL S;  2XMM A;  3GIJ A;  1SL2 A;  2XLK A;  4TNO A;  3ISZ A;  1YI2 S;  2ROP A;  5KFO A;  1YVF A;  3N0V A;  2W7V A;  1RTI A;  4I67 A;  1JNR B;  3HOW K;  5D4N A;  1JLE A;  4C97 A;  1RUS A;  2BQU A;  4Q8E A;  3EYZ A;  3AB2 B;  4A3K K;  4UOF A;  3DN9 A;  3IP0 A;  1ZBS A;  4IG0 B;  2YX1 A;  3NNA A;  1WSV A;  2KRR A;  3IRX B;  1RT5 A;  4C3H C;  2GQC A;  3S17 C;  4UY8 T;  4A3G K;  3E01 B;  2Q43 A;  3EMT A;  2C22 A;  1FES A;  2UU9 F;  2P9G A;  3T41 A;  1VBZ A;  5CAB A;  2DNL A;  2HHH J;  2E1A A;  2HHX A;  2JA7 C;  4N8O A;  2W1B A;  4Z2X A;  2RQ4 A;  4OMF G;  1IKW B;  3LP0 A;  3OFH A;  4IH6 A;  2JEF A;  1NSK L;  5U47 A;  5KFH A;  2NS1 B;  1D8Y A;  1C0U A;  3LAK A;  2WBR A;  2OPQ B;  2Z8Q A;  4E8U A;  3MCM A;  4ZOS A;  3CTR A;  2C2R A;  1DQA A;  3GTG C;  3PIP Q;  4FP9 A;  5GMK a;  3W2W B;  4LRD A;  2DH7 A;  4AFF A;  2ATC B;  3I31 A;  3S2H K;  4MEY A;  4RW9 A;  1YG0 A;  1T9X A;  3QWP A;  2ZOF A;  2MQN A;  3UD4 P;  3W9H A;  1SC3 B;  3QYY A;  4DUZ J;  1AUD A;  1FE0 A;  1HI0 P;  1Y5I B;  2DHS A;  1UMJ A;  2BW2 A;  5CZX A;  1M5S A;  9ATC B;  2JFK A;  1K8A T;  1N0U A;  3S14 K;  1EHW A;  3RJM B;  3ZZO A;  2G2O A;  4KAI A;  2J8A A;  3NS7 B;  1JIH A;  1HD1 A;  4NML A;  3M4X A;  2JX2 A;  1EP4 B;  3I9Z A;  4PWU A;  1Q7Y T;  3THP A;  4RW6 A;  1KVJ A;  2M8D B;  1RTJ B;  2DYA A;  3J80 U;  2H4W B;  1B64 A;  4WE1 A;  3MXH P;  1F0X A;  1T9Y A;  5LXY A;  2RDJ A;  2XM3 A;  5HMX A;  4A8F A;  1SFO A;  1B4S A;  4DV0 J;  2V2Z A;  4O3P A;  1D8Z A;  1J5E J;  1L0W A;  4R5P B;  4ZVH A;  4ZHR A;  2P5V A;  3KKF A;  2R3V A;  4UOC A;  3OT9 A;  1U1K A;  3TUP A;  3GTO A;  3NRB A;  3M30 B;  3W7B A;  4FF2 A;  2RML A;  4QYR A;  3T5K A;  3EPG A;  4OV6 A;  5D78 A;  4DR3 F;  1C1C B;  4F4A A;  4A3D K;  1WF1 A;  5C4J K;  3OBI A;  4TU7 A;  3MTJ A;  2OD6 A;  4GT9 A;  5EDW A;  4DR1 J;  3HOV K;  3IMQ J;  4C0B A;  2FDN A;  4IFY A;  2F9J A;  3KLI B;  5KT5 A;  2EWH A;  3DGV A;  1W7W A;  2XCR B;  1K1Q A;  5F8M A;  1RI7 A;  1VRT B;  4NLD A;  3DLL Q;  4U67 Q;  1FNO A;  2DEI A;  5EUH A;  3FKI K;  1LFP A;  3QBC A;  4K2J A;  3KLF A;  1B0T A;  4R0J A;  4OL8 A;  5FLM K;  3VVT A;  3HHL B;  2V4J B;  3GTL A;  4A3F K;  5IOR A;  2RIJ A;  1XNQ J;  4C3M A;  3G6Y A;  3TO8 A;  4YDX A;  3I9V 9;  3KHL A;  2HNY A;  5IWA F;  2HS4 A;  1B3T A;  2DCL A;  2AJQ A;  4K4Z A;  2JWN A;  4EBE A;  5KFS A;  3FRZ A;  4N77 A;  2VUM K;  2AGQ A;  3IGN A;  4ZCM A;  2BVZ A;  4QR0 A;  2PMW A;  2NLW A;  3FNN A;  4DPT A;  2BE5 A;  2CZ9 A;  1OYE A;  1PYT A;  4CZC A;  4C11 B;  3BF4 A;  5ETR A;  4C2M K;  5EWG A;  4DI6 A;  1I3Q K;  2HHQ A;  1VHI A;  4B3S F;  3VGV A;  3MEC B;  5C42 A;  3OL6 A;  1PIL A;  5IYB K;  4N56 A;  1OY8 A;  2M5Y A;  5F0W A;  2HZA A;  4USJ C;  2DD8 S;  4PXD A;  2FVR A;  3C6U B;  3OR2 A;  4BY7 K;  4JOU A;  2PPB A;  1HPZ A;  2BR0 A;  3R5A A;  5HJX A;  5D6G A;  4WU2 A;  1RTI B;  5KG3 A;  4J9V A;  1RBL A;  1JLE B;  3AA8 A;  1Y7P A;  1RHK B;  1FVS A;  2FIU A;  3ILO A;  2RJZ A;  1VDH A;  2UXC F;  4A3C C;  1NKB A;  3DOL A;  4NLP A;  1BWV A;  2E5L F;  5G0R A;  4QIV A;  2VHG A;  4M1X A;  3MAA B;  1U6F A;  2VBY A;  2ZUE A;  5A76 A;  4LR8 A;  4PG4 A;  4U95 A;  3HHD A;  5KG0 A;  2KVQ E;  2PI5 A;  5FJ8 K;  2ZH5 A;  2MKK A;  2E5I A;  4KGK A;  1NKE A;  1GFW B;  4NL5 A;  2QLW A;  2MZ1 A;  1M5K C;  1MN7 A;  3HJF A;  3AHP A;  3NUH A;  3T19 A;  1U7L A;  2VJU A;  2N7Y A;  3GV7 B;  4HT5 A;  1S6P B;  3W61 A;  4UT4 A;  5CJ9 A;  4DR5 F;  2R7Q A;  3DYA A;  4A8W A;  1S1W A;  3HOY K;  4OQJ A;  4C8M A;  2XO7 A;  4AQY F;  1SUQ B;  3GPA A;  3SDE A;  4A3L C;  1X4H A;  2MXY A;  2HLU A;  2G0I A;  4CIO A;  4ECW A;  2FD2 A;  5CCL A;  5K9F A;  4CM0 A;  2WON A;  1C0U B;  2GO8 A;  1XR7 A;  5CYQ A;  2PA8 L;  1U1N A;  2ZUF A;  3AA9 A;  4XSZ A;  3NY0 A;  1EIY B;  1WWH A;  5KFZ A;  1NK7 A;  2A2D A;  3PO4 A;  3FMB A;  1S59 A;  2CWK A;  2XHW A;  1Q81 T;  4O4G B;  4WFN Q;  5KT3 A;  4LFA F;  1IN0 A;  1SV5 A;  2F40 A;  3SSS A;  2VG7 B;  3GYN A;  1K83 C;  3L7O A;  1QTN B;  3LWM A;  1TKD A;  5I3Q A;  3S6E A;  1NK9 A;  3HJV A;  4KIA A;  4URS A;  5ETQ A;  1T9V A;  3KJQ B;  2KFZ A;  1G4C A;  2NVX A;  2JC1 A;  2HQC A;  2DEJ A;  3L09 A;  1R6V A;  4Q2M A;  3LUY A;  1H0H B;  3UCU P;  2YU9 C;  2UVV A;  3KK2 A;  2CQ1 A;  3J7Z T;  2MYF A;  4ECU A;  4RW6 B;  2HQF A;  2OD4 A;  1FX4 A;  3T1Y F;  1QUP A;  2ASD A;  1HWK A;  5KFD A;  2CNN B;  1BQX A;  4FF3 A;  1U8W A;  4F50 A;  4G65 A;  4DLE A;  4NPO A;  4EO6 A;  1C2P A;  2HYI B;  2AYG A;  4DV7 F;  2FHJ A;  1PO6 A;  3HOU K;  2HGN A;  3E2E A;  2J7U A;  4ES1 A;  3H5S A;  3R27 A;  4ZHR B;  1DZ5 A;  4WP8 A;  2PT0 A;  1RP5 A;  4Y2M A;  5EX3 A;  1AUS L;  3CAG A;  5B08 A;  4HH0 A;  4RL1 A;  3KUG A;  2ZM6 J;  2UUB J;  3GTQ C;  1T02 A;  3TVY A;  2DT9 A;  3NBP B;  4R25 A;  2NQP A;  5F8I A;  1BHN A;  4F02 A;  3CJ3 A;  1SQF A;  2V9W A;  4DZD A;  4FS1 A;  2HFS A;  1TKX A;  1QTM A;  2DIT A;  5BXI A;  4C6A A;  1N33 J;  3HOZ K;  3M2V A;  3KLF B;  2ROG A;  4NLG A;  3H20 A;  2DO4 A;  4RPF A;  2DPI A;  2YKN A;  2YX4 A;  3PEJ A;  3BB5 A;  4N5S A;  2VQF F;  2ACM A;  5LOQ A;  1FVQ A;  1BE4 A;  4CT9 A;  2AF6 A;  2HNY B;  1Q8B A;  3D4J A;  1TUV A;  3RW7 A;  2XO6 A;  5C24 B;  2PD1 A;  4NXN F;  2VZ9 A;  1VBK A;  2ZDP A;  1X4A A;  5EGE A;  1JQG A;  3HDS A;  3QT7 A;  5H9F K;  1BC6 A;  5HP1 B;  1NAQ A;  3RZO C;  2W7O A;  1IW7 A;  3QLH A;  3SCJ E;  1TWF A;  4ZPW R;  5C42 B;  3DHX A;  4XPC A;  4H4K A;  5AT1 B;  3TX8 A;  2CIM A;  5GAD U;  1IKY B;  3CJR A;  1MNE A;  4UZC A;  1CS4 A;  1BQN A;  2M3D A;  4WXW A;  1FER A;  2J9C A;  1XIQ A;  4QJV A;  3B54 A;  5KT2 A;  4UUW A;  2EG2 A;  1HPZ B;  4ANE A;  3UCZ P;  3KHR A;  4U7C A;  3BRE A;  3TNV A;  3WHI A;  3GJR B;  2NSB A;  2JDJ A;  1SKU B;  3HI9 A;  2H51 B;  3TFH A;  1PYS B;  1UZD A;  3DOL B;  3S16 C;  5IM0 B;  4ED6 A;  4X84 A;  2C2O B;  2YQ1 A;  5M3F K;  4L75 A;  3NOC A;  3JSY A;  1FNM A;  3PFE A;  4UST A;  5JXS A;  3THT A;  1Q8K A;  2GML A;  5M5Y K;  4GKK J;  1SJ1 A;  5A8W A;  2VA3 A;  1FRK A;  3H0G A;  4CO0 A;  1XMQ J;  3DHW C;  2HQD A;  1AFI A;  1X7V A;  3PR5 B;  4WBF A;  4A4J A;  4KB4 A;  1TKT B;  3RB0 A;  1U48 A;  2GMJ A;  2LEA A;  4FPI A;  2YWK A;  4HEA 9;  5KG4 A;  4C3I C;  2KT2 A;  4OYO A;  2ZVI A;  4WP3 A;  2E2I C;  4KGZ B;  4OHW A;  3MMA A;  1TMJ A;  1HWI A;  2ALY B;  5IYC K;  2QG9 B;  4A3M C;  1DFD A;  4H54 A;  1RAO A;  3SDE B;  4NZ7 A;  3S1T A;  5AXK A;  3KDN A;  2OLW A; 
#chains in the Genus database with same CATH homology
 3AD8 C;  2GAH C;  1YX2 A;  3GEE A;  3GEH A;  3TTG A;  5L46 A;  3GIR A;  3GEI A;  3ADA C;  3TFJ A;  1PJ5 A;  4P9S A;  3TFI A;  4PAB A;  3A8J A;  3AD9 C;  3A8I A;  3GSI A;  1X31 C;  1V5V A;  1PJ6 A;  1WSR A;  1WOR A;  1XZQ A;  1WOO A;  1WOP A;  1VRQ C;  1XZP A;  2GAG C;  1PJ7 A;  1WOS A;  4PAA A;  3AD7 C;  1VLO A;  1XZQ B;  1WSV A;  3A8K A;  1XZP B;  3TFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...