2GAHC

Heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
TPLRHSPAEHLDTVMDAASVAGRVELREIAFTTQISLRCAPGTQAHAALAAATGAGLPAKVGEVAGEAQGTAVLWLAPDEFLATSAENTELGGVLSAALGDAPGQVVDLSANRSVLELTGPDAPLVLRKSCPADLHPRAFAVNQAIVTSVANIPVLLWRTGEQAWRIMPRASFTEHTVHWLVDAMSEFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution.
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Oxidoreductase
molecule keywords heterotetrameric sarcosine oxidase alpha-subunit
total genus 43
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 2gahC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 2gahC01
3A8IA 3AD8C 1VRQC 1XZQB 4PABA 3GEIA 1WOPA 4PAAA 1PJ5A 1WORA 1PJ7A 3TFJA 1PJ6A 3AD7C 3GEHA 4P9SA 3A8KA 3GIRA 3ADAC 3AD9C 3GSIA 1XZPB 3TFIA 1XZQA 1XZPA 3GEEA 1WOSA 1YX2A 2GAHC 2GAGC 3TFHA 3TTGA 5L46A 3A8JA 1VLOA 1X31C 1WSRA 1V5VA 1WSVA 1WOOA
chains in the Genus database with same CATH superfamily
1NM2A 5GMEA 3OUYB 1XIQA 3DM2B 2VC0A 1SKUB 3D28A 3W2VA 2IRXA 2HFVA 2CG8A 1ULRA 1SL2A 3MPWA 5TMFA 4YG2A 5KFPA 3R1HA 4LR8A 1FRHA 2CPDA 2YNGA 4NYZA 4RW4A 1FKOA 3J7YU 3FUYA 2XO6A 4B3MJ 3UVJA 4AXJA 1BD6A 4RU2A 4QIWD 4RO0A 2VQEJ 3MI7X 5EX0A 1FXDA 5GAGI 3NUHA 2VFTA 3ZZRA 3CJ0A 2Z30B 1O24A 5DS7A 4DV7J 3CCUS 2MHEA 4DX5A 3HVAA 5F3TA 4CO5A 2HZCA 4DEZA 3FGVA 3GTPK 2V2KA 1O2BA 5EHHA 5DG9A 1RWOB 1K0TA 2XCOA 1BWEA 2XMWA 5GADI 3EZUA 1GX6A 4PXDA 4XPCA 1HPZB 1YI2S 4O3PA 1YJVA 3W7BA 3S1NC 3BSCA 4LFCF 4UW2A 2R93A 4X64J 4FM9A 2O67A 1NHUA 4CLSA 4C8LA 2VJUA 3EGNA 4G1QA 4NZ7A 1N34J 4A3KC 1W2IA 1D1UA 2ZZTA 1WQFA 1N6QA 5L1KA 2NVYK 3AB4B 3HVTA 1OY6A 1GXTA 2RQ4A 2LCWA 3G6VA 2KVIA 4PG7A 4BCAA 4QWAA 2AT1B 3S15C 5IYBK 2B4UA 4DBQA 2M52A 3KMSA 2QEXS 4A3FC 5KFKA 3W8GA 4LF8F 2BUNA 1I94J 5TJ3A 4NZ0A 4N76A 4URGA 4NCGB 2OMOA 3QMQA 1UVJA 4CLFA 1HYSA 2GJIA 3OSPA 1TUVA 2MQNA 1TWAA 2V8DA 2A2CA 3GCXP 1HNVB 5JVHQ 1WKKA 4WYWA 3NBPA 4DV5F 1GH8A 3I0SB 1TK8A 3H0GC 2B51A 1JLEB 1SC1B 4YB1P 5B0EA 3SDEA 4YR3A 2HS4A 2OPSA 3KJVA 3SZ2A 1VGYA 4KFBB 5HJXA 2Q43A 4O23A 2IM1A 3L4KA 3MUTP 2EBGA 3VQSA 1J98A 1Y00A 3DC2A 3EGVA 2HYIB 4RNHA 4LVNP 2KG0A 2V9WA 5IP7C 3WIVA 3IN5A 4BLAA 2RF2B 1RU2A 2UVVA 3TO8A 4ELVA 2RUGA 2PA8D 1ZQ1C 3PO4A 4HH0A 1GMWD 2QL7B 2DNNA 2C3PA 3KHHA 2YQ0A 1G1XA 2GMLA 1XMQF 1DARA 2E9ZA 3MPVA 3ENAA 1S9GB 3NCPA 4J3NA 1XZQA 5C2CA 3BZQA 3R7NB 2UV8A 1UFKA 3PYDA 4AT1B 3FC9A 2CPEA 1WQHA 5KFEA 3POTB 4NCAA 2RVJA 1HBMA 1ZM9A 3IM9A 3I4NK 1LFPA 3M8PA 4B3MF 3M32B 4B9TA 4MIWA 3MECB 4ECZA 3NS6A 4S0MA 3GZ7A 4OIQA 1D3WA 3DLGA 4WIQA 1PIEA 2ZJPQ 3GTQC 1NK6A 2M88A 2ZHBA 3PNIA 1AFJA 2Y8YA 4OQJA 2NSCA 5BR8J 4K7QA 5KFSA 3LP0A 5ETPA 3LP2A 1VOMA 2CJBA 2WVBA 4C3IC 3DLKA 3L7PA 3BGUA 1Y1WC 2GVZB 1EP4B 2C2MB 4IG3A 2MJUA 3TEHB 3RAQA 5KFXA 1XNRJ 4XLPA 2CDQA 4PRFA 1VQ6S 1FD2A 4WXOA 3ICLA 3RZAA 1XMOF 4EYHB 4C3MA 2FLPA 1QLNA 2CNOB 4P2SA 3FBEA 2KJVA 4C48A 4AYBL 1KR4A 3K8VA 3GTYX 2RNEA 1WELA 3NMAA 4ZVGA 2C2ZB 4I68A 4WWSA 4Q8FA 3GDZA 5FLMC 1CJVB 4WCEQ 2ZOMA 4F26A 4RW7A 1Z4UA 1H0HB 1PBUA 2R7ZA 1VFJA 2NPFA 3FEXB 5B0BA 1TKXB 1CPZA 3SMZA 5IWAF 3Q8PB 2OTJS 3N28A 4QWDA 2W8KA 3HFZB 3CJ2A 4UOFA 1AT1B 1I3QC 3FFIB 2NSBA 4ZH4A 1JKHB 4NPOA 3KG0A 4H4OA 4USWA 2JOQA 2WZ1A 1KQ4A 1FNMA 1DRZA 4KMDA 1NPPA 3HHLB 3R2CJ 1QSYA 1SH0A 1XZPB 2WSEC 2ZWPA 1AZSB 4ITSA 2KI2A 4C3IK 3PJXA 1BE4A 2VJVA 1U6BA 1HARA 4QIWL 2G4BA 2LMIA 3CJKB 1PJ7A 4F7VA 5D0GA 4Y6IA 2DYAA 2MDAA 4IO1A 4W4MA 1D9AA 2LECA 3BUEA 3QYYA 3NEKA 2NLWA 1IM4A 2B63K 2FVQA 4A8OA 1TFWA 1WG5A 2VBYA 3SFGA 3UR3C 2MSTA 4M5IA 2FY1A 4CZCA 4ILRA 1FJGJ 4C2MK 4Q8EA 3NCQA 2Y1IA 4I67A 3LAJA 5IQ6A 2MLYA 1SJQA 1VMBA 1U7LA 2J9CA 2K3KA 2CW0A 5HP1B 4ICLB 3QIDA 4LSZB 3KK2B 2RDJA 2X1FA 3VVTA 4PPZA 1U2FA 1BQXA 2PFDA 2KRBA 2KDOA 1I3OB 1HBNA 2MXYA 2VBWA 2EG1A 3JB9k 1Q5YA 3P5BP 4FS2A 1O29A 2MEWA 3RBDA 3P4UB 1VIOA 2CQBA 3D1HA 4OI4A 2GIQA 2GMJA 4CH7A 5MAOA 2P5MA 2YNHB 3WBZA 2IDLA 1SL1A 1CBKA 4OX9J 1QAJA 4O44B 1Q16B 3MF5A 4TN2A 4EWTA 2QTWA 2KT3A 5L1LA 2FVRA 2LXIA 3TAMA 2HFOA 1KQKA 2CJKA 2IVMA 3S01A 4FKYA 5KG0A 1LK7A 4I2PB 4IOBA 3N4WA 1KOHA 4XSXA 2C28A 4MEXA 1SFOC 1G7CB 5DM6Q 2K2PA 3R5GA 1A7GE 1C1CA 3A3NB 5LXYA 3HCXA 3D68A 4MYUA 5IYDC 3DOKA 1YRTA 1VQ5S 1WHXA 3S2DC 1TUWA 4KN7A 1IW7A 3SQOP 4A48A 2AV5A 2DD8S 2UU9J 3HKZD 3KLHA 1NDPA 1I50C 2XMTA 4FN5A 1KBRA 2BRKA 2YU9C 2MLZA 4C2MC 3I0RA 4ZPDA 4L75A 5B0AA 2XMVA 3CAGA 1Q7LB 2DR6A 2JRSA 4ZS6A 1ZPWX 1HD0A 1FKPB 2ZDPA 4LF2A 2DGTA 1HI9A 3NAHA 1USMA 3FHZA 3JSTA 3UDEA 4MIBA 4BBSK 4TQRA 1RJJA 2WAQL 3CCZA 3IWXA 2LXUA 1NSPA 1TWAK 1VJEA 1C0TA 1FX4A 5IP9C 1TL3A 2CPZA 3M4XA 1RI7A 3DMJB 3NS7B 4NE9C 4QR2A 2GFFA 1FK9A 3BKFA 2HAFA 4JV2A 2U1AA 2XGQA 2DNMA 5IOQA 4YHHJ 4NZ6A 4HT5A 4FZVA 1S6PA 3GTJA 5C42A 3H59A 4PWDA 4AH6A 5HVFA 1XWLA 4AE5A 4JI5J 3SXLA 5CZXA 2DNKA 3MUMP 2A10A 3G71S 3OTCA 3HJFA 1TKTA 1K47A 5CAAA 2DH8A 3OFHA 3GFZA 4ZVFA 2C2RA 1BWVA 5IYBC 4DQSA 2R8KA 5DG7A 1U4BA 4J9UE 4DXLA 2GO8A 3MM8A 4IKAA 1UA0A 2B8QA 3L9ZA 4KB2A 2D3UA 2B4VA 3WX8A 3VVUA 1SXLA 4ZHRB 4ZLPA 1FJCA 2B63C 3CDUA 1IKVA 1FJ7A 2FJBB 3LWLA 3AXKA 4JV1A 2KM8B 3BYPA 5B0DA 4FYDA 2BJ9A 1RZMA 3FCVA 3MMLB 5I42B 1C0UB 2BE7D 4KBIA 2IC3B 5LSLA 1U0SA 4J9RA 4EO6A 1R7IA 2AJ1A 2XB2D 3GTGK 1VH2A 4C97A 4CRJA 4NLQA 1IBLF 2IBKA 1QVFR 5J2QB 3QT5A 4QR1A 4LK1A 1NUEA 3BSOA 5CA5A 1RU0A 2CQGA 3W5XA 3S14C 5H9EK 2N4CA 4OYIA 4FXDA 3GTQA 2OPQB 4HDHA 4NX9A 1KHVA 1RSCA 3I56S 4A8KA 1VRUA 4QPTA 2V6TA 4QW9A 3M6XA 4EYIB 1ZA1B 4IH6A 5RUBA 5F0WA 4NCBA 3LP1A 4USMA 4ZN1A 5K9FA 3JTNA 1JLFA 1YJWS 1V5IB 4WE1B 5KT6A 3KK3B 3QAEA 3AJ2A 4V19X 2QE5A 5SZTA 3THPA 3TYTA 1LWFA 1JVIA 1URRA 1TAUA 1SCJB 3R5JB 4I6AA 1UVLA 4C8YA 4DSKA 1Y1VK 1LNQA 2XZTB 2R2UA 1UVIA 1ZYQA 1RT5A 4E98A 2GGPB 3SBMA 3C3LA 3D0IE 1VQNS 4X66J 3ZZOA 1FESA 3AAWB 5D0RA 2N7CA 3IXQA 2H5JB 4Y2KA 2AJ4A 3GTLA 4A8QA 1O2AA 1KRPA 3PO2K 1HI0P 4RW6B 4KFBA 1FTRA 4LJZA 3MDFA 3MHYA 3W2WB 4NXNJ 4QCLA 2HPUA 3V81B 2HHVA 1DQ8A 1IBMF 4DCJB 5KT5A 1XJWB 3TI0A 3G4SS 2RQKA 5A0YB 2KN4A 5IT9Y 2DTJA 4NLTA 1YJNS 3BYRA 1WOSA 1ZM3A 3CDAA 2GIRA 1NK9A 3K57A 2PA8L 4RWXA 3GJTB 1NK4A 4QJVA 4PYAA 3ETOA 2PI4A 3DLHA 3HFKA 2BBEA 3VV2B 5K5MA 4C3KA 4DV0J 1U2RA 1EK8A 5GVQA 2YWGA 4QIVA 2HVZA 2DNYA 1KFDA 4NASA 3RR8A 2KYXA 3NP5A 3DGPA 1MN9A 2EFQA 2Y8WA 5A8RA 1E6YB 4M5NA 4P7VA 3BDEA 2WCXA 3GTKK 3OLBA 3ZC4A 5CXTA 1VYAA 4CM2A 3M3YC 2L9WA 4ID5A 4WFBQ 3CJ5A 4ILLA 2C22A 1RK8A 4CO2A 4EUVA 3QO9A 5GMDA 2EK6A 3D6TB 3LP0B 2ZH6A 2DGOA 1KLMB 1Q0NA 4QR0A 4N5SA 2J9EA 2CFAB 1TVRA 4FVCA 4L76A 4LF6F 4LT6A 1NKBA 2JA6A 4C11A 4YHHF 2ZH2A 2DCUB 4TLRA 2XCAA 4QWBA 1SJ4P 4IG3B 5KG1A 4P74A 1VR6A 2EEYA 3Q0AA 1XNQF 1NPRA 3TUZC 2D3OR 2J7WA 4L6V3 2HQFA 1BQMB 3DLBA 1CULB 2YWEA 4WP3A 3VZIA 5EGEA 3CIMA 4QYRA 4Y2IA 3M30B 3P6YC 2HBQB 1O6XA 5THWA 3OT9A 1IWGA 2UU9F 5HJYA 5IXUA 1SFOA 4Q2MA 2BVZA 5H1SV 4DSEA 2F4FA 3K5MA 3V4MA 3OR1A 2C2OB 1A0OB 1VGXA 1O5JA 1F0XA 4B3TJ 3QQCD 4P5AA 3I32A 5E7OB 4O4GB 5LMNJ 1FKAF 5CYJA 2I6WA 1SPBP 2RAQA 2PT0A 3ZZTA 2BJEA 2DNPA 1YDLA 3G82A 5ETMA 4NLYA 2QMWA 3V4IB 2B4PA 2NXJA 5B0FA 4Q44A 4DV1F 2C3OA 4OI1A 3D3CJ 1AZSA 1NEEA 2D6FC 1IE0A 1QAIA 2VA2A 4A8MP 3OR2B 2YWKA 2QLXA 1JLGB 2V4RA 3M1VA 3AHPA 3NL0A 4CTAB 2MQQA 2RIJA 2PEBA 2YTCA 4UTGA 1OQ6A 2B43A 3U1LA 1S1XA 1U26A 1P1TA 3T5KA 2NZCA 3S16C 3PW0A 3HOXC 3CD7A 4USTA 3UVJB 1R43A 1XMOJ 4DF4A 3DM2A 1JJCB 1RAJA 4KO0A 1Y9OA 3Q8SB 1K73T 4CO0A 4IH5A 3FSXA 2XCQA 3MMAA 1RACB 3SYZA 4JYAF 3ERED 2MKKA 1Y1VC 4A3CC 5L1JA 1Z2LA 3GFXA 3R97A 3EDQB 4URQU 2F7VA 4DDQA 3MAAB 4F50A 4WJ3M 2C3MA 4V1Ak 3FSYA 1UKUA 2GIFA 5JVOA 1MG7A 1S0VA 1LXJA 2H51B 3MPDA 4PG5A 4XO0A 3PW5A 5A8KB 2FZGB 4DV3J 2W24A 2X1AA 4RWWA 3AOAA 2FPHX 1VISA 3DU5A 1JQWA 1J5OA 4AYBD 2CQ4A 3CXCR 1Q1KA 5DDPC 4OI6A 1HPZA 3CULA 3BKUA 3V2UC 3T00A 4P52A 4KARA 1SJRA 3QT8A 1UZDA 1RTHA 2CPIA 1V6HA 3HT0A 1AXQA 3HKZL 3MM7A 3QFWA 5L39A 3RW6A 2HS3A 3OW2R 1KVKA 3OL7A 2LQBA 3AJDA 2VPWB 1ZM4A 2W7OA 3S7RA 2KFNA 4ES1A 2AYEA 3AD8C 2N7YA 1LEOA 2WK4A 2YKQA 4CWBA 4AL6A 1NMEB 3KYLA 5F8NA 3AA8A 1NO8A 4HH1A 1NZAA 5KFMA 2P9EA 2L48A 2E2IK 3GIJA 1DQAA 2DR5A 2V6AA 2BM1A 3HHLC 2JVRA 1QSSA 2ZM6F 3UPFA 3J80Y 3DLEA 2UUCF 1SIWB 3CO0P 2BE2B 3FVYA 4KHRA 1TV6A 3EXYA 3HOZC 4TY8A 2N3LA 3A1YG 4OIPA 3BR9A 4KJIA 1G51A 1S1TA 3KJVB 5DZ6A 4XTTA 3JSYA 3V6HA 3CCLS 2NUHA 3BSAA 4Q5VA 4IFVB 1R89A 2RGRA 1USOA 2GVDB 4FBUA 4C0HA 4JI6J 1JLEA 1HBUB 2F9JA 4DJBA 3ISND 1EFWA 3ZTPA 1XC9A 4KGMA 5KOXA 1FX2A 1ZVUA 2EK1A 2VG7A 5KT7A 2OP5A 3M8QA 4I2QA 4IRDA 3E01A 1Y1VA 4OHVA 2CWKA 3FEZA 2ZUEA 1SV5A 5EUHA 2WVFA 3WIUA 2IJNA 3HOVC 3O5TB 1R9TC 2ADCA 3NGTA 3L3CA 2I5JB 3AQPA 2KXHA 3GEHA 2ZZMA 4WYLA 1NLKL 1JLBB 2H5IB 2R8JA 4U96A 2F8MA 4ZPCA 5B09A 3TQ1A 1F5CA 1EH1A 3MXHP 5D4OA 1TWFA 2NXNA 5D4NA 4FF2A 2OMLA 2ZE2A 4KATA 4LF7F 3LAMA 2VG5B 4K4TA 2LEPA 3EZ5A 2W1BA 3N79A 4CLKA 2WVDA 3QJJA 2CPYA 2W9CA 3MURP 4DV6F 2Q6BA 3FCWA 2DGWA 4A3IC 1QM9A 1RUSA 4P2MA 1QE1A 2EVZA 4J9OA 2AU0A 3S1QK 4C3HK 3VALA 1C0UA 4KY3A 4K2JA 2VUMA 3B82A 2MKCA 2BQRA 2V6SA 1TL4A 2OELA 2NVYC 2YX1A 1I5OB 2YKNA 4I6YA 4PG8A 3MMCA 3I4MC 2I1RA 2M8HA 3UN3A 4WBFA 4K0KF 4GTEA 4ECSA 4JI4J 2YWHA 3MPUB 2OPQA 3PCOB 2YNFA 1REVB 2VKZG 2FGCA 3MOJB 3DRPB 4B9LA 4DV5J 3OVSA 1KFSA 1Q81T 4N47A 2UXDF 1M5HA 2IMWP 1RT6A 3TZXA 3L95X 2A18A 4F4XA 1LFWA 4ECUA 3PY8A 4KASA 3V6DB 3OD2A 3KLFA 2DISA 4BKWA 3NXZA 2VBZA 1D09B 4M1KA 1REGX 4PUOA 3W64A 1AA1B 2QFJA 4ZCMA 3IO1A 4RX6A 5TMCA 2CNNB 4ES2A 4HDGA 4WP9A 2FLNA 4JI7J 5BXIA 4IH7A 1UFWA 1Y10A 2BKOA 4ZLJA 2B56A 1MNEA 1LXNA 2R42A 1YG0A 3FKIA 1A9NB 3D1OA 2YQ1A 1HNWJ 4LREA 3VGVA 2HQDA 5BYQA 4DPTA 5KFHA 4D3GA 1FERA 3R7SB 1HNZJ 4P9SA 1L3TA 2YBVA 2RUSA 2HIQA 1X5OA 4DR3F 3H42A 3O8WA 3C16A 4YFNA 4J9NA 5AXKA 1FWPA 1PCAA 4OX9F 1QSLA 3H0PA 2WBMA 3HD1A 5E3CA 3H3VD 1S9EB 4QOTA 5FD1A 1S48A 4Y00A 4LR7A 3VHQA 5KG4A 5IORA 5D6GA 4P2XA 3TR5A 3O6QA 1K9MT 4NLVA 1EETA 4G0VA 1HHTP 3VAKA 2XM3A 4DR7J 3JSBA 4RJVA 4GMKA 2RHQB 2FTRA 2VOPA 3E8OA 4KB7A 5IOTA 1N0UA 5J2NB 1D9FA 2VPYB 2YWFA 4QPXA 1NK0A 2KVQE 2IJFA 2ALZA 3KLIB 1T02A 3T1HF 1ZTTA 1HBOA 2K3IA 1EZZB 4A3KK 2CXEA 1UEVA 1VQ4S 1Q86T 2JJ4D 1S1VB 3M05A 4DR2J 2HNZA 1HMVA 2JEJA 1ZOTA 1IN0A 4LQ9A 1EKSA 1GK8A 4F2RA 3IWNC 3SV4A 3SCJE 2IAJA 1F2GA 5A2QY 3QIPB 4LSNA 4G0UA 3QFHA 3UD3P 1DZ5A 7FD1A 2L9NA 2OHDA 1JLCB 3I4MK 4GO5X 4GTAA 1X0PA 1P6TA 1IBKF 1FDAA 1UETA 3VQTA 1N48A 2W9BA 3RG6A 3HVTB 3I55S 3TOQA 1G4CA 5FDLA 2KXNB 2FB0A 1IR2A 3M32A 3BJYA 1RAEB 3AOCA 1PAEX 4OZ5A 4AD6A 2F4VF 1ZS6A 1RYSA 1RT4A 4OV1A 2DIVA 2DO4A 2DCLA 4ZVTB 3LALA 2FDNA 2I9SA 2VL1A 3QBCA 2GCFA 4KV8B 2HLUA 2PEHA 1RAHB 3KLHB 4DR6J 5L1IA 5ETLA 4ZITA 3TA0A 3P49B 3UQSA 2QYCA 2E44A 4M95A 3LP2B 2HNDA 1OSDA 1ZM2A 1NJWA 2NVTK 2XC9A 5C4JK 5EWFA 1SKRA 1NRKA 2ZH1A 1WJ9A 3IGVA 3G96A 4ZCIA 5L8RC 4GVLA 1JXLA 3MEEA 4QBUA 4DF8A 1ZTWA 3SEOA 4DCOB 3T9NA 2UZAA 3K5OA 2IA6A 2RDDA 2EFPA 3PKMA 3GTOK 4GTBA 3I6PA 3AXMA 1BJTA 1ZH5A 2IYGA 2KHDA 2QL5B 4MMOA 2OPRB 3H90A 4X62J 1DBDA 5KFZA 3M2VA 5EDWA 3OJUA 4AXIA 3CQZK 4B08A 5FLXU 3D66A 3T6JA 2QYGA 5F8LA 2EFOA 2LXFA 1UPPA 5KFLA 2H3EB 4DR7F 3UFCX 3V5RA 3IG1B 3Q23A 1HIYA 1LKZA 2V67A 1GMVA 2PMZD 2A6MA 2X1BA 3CJ3A 2AD9A 1RT2A 2BOAA 2HAIA 1ZXOA 2PN6A 4DZDA 3NGRA 2F4VJ 3P45B 2DNOA 2J0XA 2K06A 2XHCA 4ZDNA 1RGVA 1WC6A 4ZCKA 1JXVA 3N5FA 4GFQA 4OZJA 1M1HA 2MPUA 4O4RA 1Q82T 4N8OA 4UY8T 4XK8C 3MMBB 4ZPVR 4NRUA 3RW7A 3MAAA 3HJVA 2DRDA 3I5BA 2NVXA 5IS2A 2AYBA 4KKOA 4U8VA 4ED7A 3A12A 4ZP7A 3ZZUA 2ZKUA 3AA9A 2CWXA 1L3KA 2Y0SL 3CB4A 4ZHRA 2HK3A 3PX4A 3ZTQA 3LPXA 1KDNA 4Y52K 4YB5A 1EX8A 1WKJA 3PIOQ 1Y3JA 3UDCA 1NK8A 4LBPA 4KHPF 4OJGA 4LIRA 4WKYA 1A6LA 4KSEB 2KU7A 4KC5A 2JA7A 1HWLA 3IBCB 1FNXH 4J9LA 4UF4A 2DR9A 5C25A 5DO2A 2M5YA 3LPYA 4USKA 4ZJOA 4FPIA 3Q2SC 3ENVA 1X4EA 1JX4A 3GWCA 3I31A 3AY0A 1VQ7S 1KC8T 1FKOB 4RBUA 4DR4F 1YHQS 5SUHA 3TWZA 5CABA 1NH7A 3AJ1A 4XDCA 2LYVA 4LF4F 4DHVA 5IT0A 2BJ1A 1NU4A 4K4YA 5HQMA 4DUZJ 4KGZB 1FRKA 1YBUA 3UDVA 2P9GA 2RQCA 3BSNA 1J5EJ 1WCMA 1TKXA 2YX4A 1JLFB 5M5XK 4OI3A 3T1HJ 2C2EA 3PIPQ 2BYCA 1F7UA 2YNIB 2DNQA 4GRSA 1F7VA 3MM6B 5KFBA 1FXRA 1WG4A 2GGPA 2CQHA 1TWGK 2GC8A 2MGZB 5GAGU 2GMHA 3PM9A 2E2HA 3B78A 4H4OB 3TQEA 1T8EA 1DAXA 1JQGA 4DFKA 1SUQA 3GTJK 4DUYF 4ZCLA 2P8IA 3GFYA 2QLFB 3T01A 3UWTA 2FQTA 5HROB 2G2YA 2E7VA 3DRRA 3HZEA 3T41A 4TXSA 5HI7A 1VQOS 4DV2J 1DLOA 4ZP9A 2VICA 2F5GA 4AQYF 1TZ0A 2UUBF 4FDFA 2YY3A 3S15K 1HHSA 2X51A 2V6UA 4P7TA 4QQBA 3KJFB 2FY8A 4NLGA 2F40A 2E5JA 1MWQA 1HYSB 1M90T 1AYEA 4KGKA 1T95A 1YCLA 1RTIB 2B4OA 3NBPB 3MTKA 3UN5A 5HO4A 1ZZFA 2GHVC 3TVYA 3W5ZA 2AP6A 3JS9A 2DGSA 1F2HA 2L3MA 2XSJB 3HHLD 4FYYB 1X0FA 5KFVA 2JLEA 2ZBIA 4QJVB 5F8IA 1T05A 1Q78A 3UN2A 2JA5K 1X60A 2HIYA 1F93A 2GHWA 2IHR1 2JDJA 4ECRA 2R7QA 3TARA 1NK7A 1RAAB 5KAKA 1S0OA 1I51B 2Z4PA 1X9SA 3ILOA 3F0NA 3A8KA 3CCJS 2DO0A 5DLFA 4A3IK 1S6QA 4EZ9A 1K44A 5U47A 2G13A 3OVAA 4C6AA 1NSKL 5KFYA 4H4MA 3UCZP 2OI2A 3G6XA 3F73A 4JI1J 1WF1A 1B4BA 2VASA 2G9OA 4UQTA 4WTYA 4CYUA 1RWXB 3VAJA 4BWJA 5D3GB 4Y52C 1ROFA 4ZP6A 1SQGA 4NRTA 5K8OA 1IBLJ 5C42B 1J6WA 1N54B 2YKNB 3TA1A 3TA2A 1CJUA 1PAUB 3K5PA 4RUCA 1KQGB 1IR0A 1VDHA 3KNGA 1TVRB 1TKTB 4WK3A 2CJQA 3HSDA 5IWAJ 4ECXA 1XZQB 5FLXY 1PGZA 2KRRA 2V9KA 1Q5VA 4EBCA 1VHFA 3MCSA 3R6GB 3GLJA 5T7LB 4YFUA 4MT1A 1HBMB 4CH1A 1W2BR 1BQMA 4WIIA 1TMJA 2RSQA 2LKZA 3IGNA 3A13A 1FJEB 1FO1A 2HHXA 2D7SA 1U2CA 1N33J 1EP4A 2VDHA 4WJ4A 2DNHA 4FNHA 4L3NA 3ZNUA 4ZJLA 4M5DB 1Z1ZA 4JOUA 1B7FA 4NLWA 3H4DA 3WHIA 1N33F 2BANA 2C3UA 4A8SA 3T5LA 2QIFA 3W9JA 4HVZA 4JI0F 4PZVA 4X65F 2GVZA 2VQFF 3ILLA 2PA3A 5HBMB 2NVXC 1HA1A 3I5CA 4M5JA 4Z37A 2HHPA 3G86A 4JV5J 5IP7K 2IM2A 1GX5A 3A8IA 2EI5A 2WB1L 2DB1A 4HKQA 3SV3A 1U09A 1BS2A 1M5VC 3FQLA 4ZLNA 2XWXA 4BHQA 4NI2A 3QNWB 4Y65A 4KPYA 2FJAB 4FXVA 2CRLA 1JJ4A 3GSDA 5GMKa 2EBBA 4DR3J 2O5DA 3FKIK 4GTDA 1FVSA 3VAMA 4KO0B 3U02A 3PX6A 3JYTB 1JIHA 2E2IA 5ETQA 3NNAA 3VZHA 4U8YA 1Q53A 1B70B 4A93K 3QPIA 4J9PA 5LT5A 1I50A 3FFIA 3C66A 4YR2A 3D2WA 3K0JA 3G6YA 2E2JC 2QZ8A 3CGIA 3Q8RB 3R5CA 2VC1A 1CLFA 3LANA 3BREA 1LWCB 1OQ3A 3G6ES 5A6WA 2R7ZK 3GTPA 3T5JA 2GHPA 5KFNA 2CQ3A 1UCNA 2HGLA 1AW0A 3D1QA 5E3PA 3HOZK 1SI9A 1SC3B 2CZ9A 4A3EK 3EYZA 2I2YA 1NPKA 1VRTB 1HFEL 5IV4A 4YY3F 2KWAA 3CCTA 1TKZB 3V81A 4YOEA 4J7CA 3OTEA 1WHWA 4CQ1A 2DPIA 1KD1T 1X8DA 3EQLA 4ANEA 1NNDA 3T9ZA 2E5GA 2CJAA 1RTHB 2XQCA 3AH6A 5G0RA 5A8KA 4JI2J 5L9NA 4ICLA 3DN9A 4BBRK 2BZ2A 1KNZA 2MZ1A 4WXWA 4LSNB 4DR5F 2E29A 4Y2CA 4DUTA 4A3MK 2LFVA 4DX8H 1SH2A 4BY1C 3RZOK 4YS2A 2CQ1A 4DPWA 2C2DA 3B8HA 4F0KA 2VODA 2ZOFA 4RBVA 4F67A 3H4BA 1EAYC 3QRQA 1XTZA 3J7AN 3DXBA 1RE1B 1KTQA 1Y5NB 2H48B 2BMBA 3BF4A 4KM9A 1FWLA 1WHVA 1MWYA 1AUSL 2FQOA 2AYGA 1S7IA 1FDBA 3IBFB 3IPJA 2VFSA 3D4JA 4QU7A 2HRTA 2NXEA 3Q86A 1WOPA 3FKIC 4KV8A 3G8SA 2O01C 2BE2A 4EMDA 2O3DA 3H8YA 3L4JA 4C9DA 2A1BA 3RB0A 4QYZK 4OLOA 2HHUA 3QGGA 1I6HK 1RT5B 3KG1A 4OYAA 1KLMA 2ZUAA 2ZJRQ 3UI3A 1RA6A 2Y3YA 4BBYA 1GEHA 3BH6B 2GV1A 2OJ3A 4GZYA 1SMYA 1XR7A 3FOFA 1HWKA 3NGSA 1TV6B 3N9UC 1T9XA 2XZDB 5HLFA 1UWBB 1VIXA 1GAOA 1M1KT 2JLGA 4X4RA 3T3FA 2XYGB 4DV1J 4LUBA 4I2QB 3QT6A 2NYIA 4E2FB 2G0CA 4BXXC 1HBUA 2NUUG 3FCHA 6FD1A 2WB1D 3GB0A 4U95A 1X7VA 5GAHI 2E5IA 4ZJQA 1GNKA 3S14K 2AJ2A 2MSSA 3VAFA 3RRGA 3HKWA 3QT7A 3RRHA 3SZZA 2QLBB 4LFBF 2P6SA 3GIKA 5IOSA 2CPJA 2HNYA 5CYQA 3BQ2A 3OPKA 1UEUA 1K83A 4ZPTR 3CMES 4O0NA 1IBMJ 1RAFB 1VQPS 2GSNA 2QV6A 3G2XA 4I4BA 4KM8A 1G6BA 4OHYA 2OPSB 4PQAA 3FMWA 4DN9A 1RWUA 1TL3B 3FZBA 5BYSA 2NXCA 2ZUGA 2E1AA 4Y34A 4RW9A 3ZO7A 4C3JC 4O0IA 1I3QA 4UOGA 4AFFA 2JLFA 1X4BA 1U47A 3BQ1A 4BC7A 2PPBA 1JLGA 3MFHA 4F0MA 2JFDA 4CO1A 3PRBA 4TQSA 3M1VB 2GS8A 3KK1B 1X4AA 2B9EA 5KG3A 3GV7B 4M5LA 4CTAA 3DLLQ 3MMCB 4LF5J 2IRYA 1XK8A 4ID8A 3VA7A 3M2UA 3GTMK 2KZZA 4X4SA 1S79A 1S9GA 1CJTA 3CEDA 1TWCA 1R0AA 5HMZA 4FNIA 1FFGB 2MQPA 3PHTA 1RTDA 3DDKA 3DU6A 4F3QA 3ZTSA 2J5AA 2DY9A 3HT3A 4Y0FA 2BJ3A 2VF3A 3QX3A 1DTQA 3A4TA 3BPSP 4RU9A 3PR4A 2XWYA 3UNGC 1PYTA 2BE9B 4ANCA 3DRPA 3MCMA 4BS2A 1XQIA 1VBYA 4WP8A 4YUDA 1RBLA 2LEBA 3ONQA 4P2FA 4IYQA 2XGPA 3VAIA 3IM8A 1WTFA 2E9TA 4NXNF 4LRAA 4QU6A 1R31A 1RT6B 1HQUB 2UUTA 5JVGQ 2OTLS 4DLEA 1X4GA 3BGRB 2R2TA 2ROPA 1IKXB 3J7YI 2CNKB 2XMUA 2JA8K 4JI8J 4ECVA 1NSAA 1IM6A 3N0VA 1VQYA 1YNNA 4IUFA 4OI2A 4KH0B 3ZFVA 3M4OK 5HROA 2FLOA 4ALZA 1CS4B 4JI1F 2RRNA 4TKTA 2BOPA 1NJZA 1O0PA 3UD5A 3EMTA 1TU0B 3OL6A 3MAQA 2HSEB 4UZCA 1RAOA 3LH2S 2V8VA 1HQEA 1QTMA 1S9EA 4CNYA 2V4JA 1HWJA 3VTIA 5J2PA 3T1AA 4H54A 1HR0F 2J7UA 1VQMS 3KTQA 1FRMA 2CZVC 7AT1B 4OYWA 2HHHF 1S4EA 2E2HK 3U1NA 4RUHA 4OYBA 4XDDA 1LWFB 1TK5A 1H6KX 1O26A 4UY85 2QG9B 3CCRS 1RT3B 4ZPBA 2E2HC 4LQ3A 5JJBA 3GR1A 3LAPA 2FVSA 3TZWA 2FHKA 1XZPA 2CA9A 4AL7A 3UR0A 3A8JA 2DNLA 4MTPA 1JK9B 1YSJA 4URSA 1K0VA 3NY0A 3D0GE 5HK4A 4DL5A 3VCDA 3HULA 1YQHA 2CIMA 5FJ8K 4C45A 1XERA 4NLPA 4WFZA 3WZ0A 3EPGA 3MR6A 5LMNF 3GYNA 2CJYB 4RW6A 3M8QB 2ZFHA 1CG2A 3GP9A 1PC4A 1F1BB 5KT4A 2ZH9A 2QRRA 2DHSA 1O8BA 1CQMA 2V2VA 3KDNA 5DDRC 1NAQA 4OL8A 1CSJA 2YXLA 4F36A 4K50A 3RJMB 4XAKA 1HNWF 1TAQA 1JMTA 1VCTA 1VRQC 3RZDK 4NLDA 3CJ8A 1LW0A 3SIPB 2M8DB 1X4DA 4UQGA 5KFRA 1JLBA 2FGOA 5F8MA 3C2PA 5KFAA 4LF4J 4L74A 3PYGA 4ECTA 3DXJA 2RMLA 1UVMA 2XY6A 3E2EA 2HWIA 2VH7A 5E33A 2WVEA 5D4DA 5K20B 3OFEA 5LSOA 3AOBA 3ISZA 2R8GA 3J81j 1OYDA 2QLJB 2HQIA 3CD0A 3WODA 1YZ6A 2XSFA 3QWUA 4HHJA 1APSA 4DL3A 2YKMA 2R92C 2G2ZA 1GFWB 2ZKTA 1UV7A 1FF2A 3IMQJ 2YKPA 3GIRA 4ECQA 3W66A 4OJHA 2A6OA 2FJWA 4OZ1A 5LL6d 3CMQA 1KONA 1X5PA 3G8QA 5DZ7A 2KFYA 2ACMA 4OYZA 3MCNA 2KT5A 4TNOA 2HVEA 3CT9A 4PAAA 3QZ8A 3MD1A 3GYGA 5DQGA 2HVIA 3AD9C 5ETRA 3ENQA 4ELTA 4C8MA 2FLLA 3KLGA 4C4WA 2G2OA 3CD5A 4Q2LA 2CPFA 3Q2TC 3RRKA 3I4NC 1NDLA 4LF7J 1WDTA 2XEXA 2DHHA 1HNIB 5B0GA 4UOCA 2FC9A 4DSIA 1PSDA 2H4YB 1VBKA 1T9VA 1UW9A 1T9UA 1YRXA 4LRBA 1CULA 1RAIB 1RHKB 3GTOA 3OXLA 4F04B 2VKRA 3CJRA 1JJ2R 5C7PA 1FRXA 4FF1A 1RWWB 4DV4F 3JSMB 4XCHA 1KWMA 3MTJA 3BGFA 1C4AA 2IDEA 1KVIA 1F9EB 4F4YA 5M5WK 4DU8A 3LW5C 3AQOA 3QJPA 3OR1B 2P5VA 2KYZA 2NYHA 1WC0A 1SQEA 4KMHA 3GJRB 2JEIA 3ZZZA 5F41A 4QIGA 2B9YA 4WK1A 2QSWA 3S1TA 4DS5A 1N56A 3I82A 4BBSC 4ED3A 3NGDA 2HHQA 3MEGB 2KB2A 4IO9Q 4F25A 4WZQA 3HHDA 2HHSA 4ZKAA 2ZE2B 1KOOA 2VOOA 3S1MC 2W7AA 2HFZA 3MM9A 3PHEA 1PO6A 2VBXA 2BV3A 2YPYA 1R6VA 3TX0A 1X4HA 2DITA 1IBCB 4YFKA 2J0WA 1FK9B 4IDKA 2AEFA 1NJYA 1UEKA 1J5EF 3RB6A 1KQSR 2R7SA 2KL8A 4I7FA 4DX6A 3DFEA 4C0BA 3TUPA 1CEZA 4X6AC 4FBTA 4IOCQ 5E68A 4WF9Q 4KHPJ 3I4PA 3EM1A 4U9RA 3MMAB 2F3JA 5DLGA 5MLCV 5C44K 2CJXB 4CLUA 3F44A 1PYSB 1SQFA 5D15A 1WG1A 1U6FA 3GMGA 2YNFB 1XBWA 1ITPA 3IR7B 2MZQA 4MFBA 2WW8A 3J81Y 4DCPB 1WC4A 1O2FB 4X4QA 2Z2MA 1RHMB 1UAWA 2POKA 2A6HA 2FZKB 2QGFB 3CCQS 5IZHA 1RBAA 2DH7A 3R2DJ 5DQIA 4EBEA 4Q45A 3TJ8A 3IWLA 2AZ1A 1WD6A 1UVNA 3M6VA 4DQIA 1U49A 3KOAA 4A3LC 3HXAA 2IYIA 3LTOA 3HP6A 4K59A 1L5UA 1VS3A 1ZETA 1RKJA 4ZVHA 3NGKA 3OXFA 1UPMB 2IAJB 2OKQA 1PKUA 1OY9A 3CTRA 3HMJG 3J7A1 3CCMS 2QA4S 2LA6A 2ILYA 5HQLA 2F8HA 1RKIA 2PE8A 1TWFK 2MZRA 4BY7C 2F1FA 3PRDA 4OFZA 4N77A 4R8UB 1Q4RA 1TUGB 1NZ8A 2W9BB 1S9FA 2NCKL 4JBCA 3M2RB 2DHXA 5AT1B 1YRUA 3K7AK 3BO3A 1IJFB 1LQ9A 1FE4A 5H9FJ 2UVUA 3PO3K 3PEHA 1JLQB 3BS9A 5IQQA 2RRAA 1U45A 1XXAA 3DLEB 3EDRB 7FDRA 1RHRB 5A76A 1LW2A 1FFSB 5K8MA 2RD5C 2Q3PA 3PW2A 1IVZA 1S12A 5ETNA 3QAUA 2HNDB 4RL1A 4ZPWR 3I5AA 2FHJA 5A8WA 3SCIE 4X4VA 1O28A 3PG9A 4EK2A 4ANDA 4NA3A 2Z0GA 2AJFE 4LRCA 3TP2A 4TY8B 1BMQB 4EU0A 1MWZA 1H73A 3JAMU 3HSGA 4ZVEA 2MTLA 5D77A 3CQZA 2MYFA 2GA7A 3FKBA 3BH7B 1C0AA 1R6YA 4ECYA 4ZVOB 4RW9B 4H4KC 4W92B 2GVDA 4WU2A 1IBAA 4XSZA 1HBOB 4X4NA 3AH5A 1SV5B 1TK0A 3C19A 1DQ9A 1VC0A 4LMZA 2ERRA 4BXXK 4Z7YA 2LU2A 4O3SA 1S6QB 1WQGA 3HX9A 5GAEI 1FI4A 3LF0A 3ET6A 1EB0A 5I3UA 3TVZA 3CJQA 1MN7A 4IOAQ 1KN6A 1IKWA 3M8ZA 4X84A 5JFEA 3BQ0A 4WU3A 3O2IA 5AJ3F 1UA1A 4M5KA 1F3FA 4GKJF 5KFGA 1R0CB 1R0AB 1ZAVA 3T6BA 2V63A 3CC2S 3SCLE 4PR6A 2XMAA 1FEHA 3FDSA 1VQ9S 4JI4F 2JA7K 1XXCA 1Y1WK 2JEGA 2NS1B 1GQEA 1QE1B 5DJBA 4KYZA 2RH3A 3DI6B 1N0VC 5LJ3Y 4USIA 3GV8B 4M94A 2GO9A 3RYLA 2OD4A 3I9V9 3Q89A 4YFXA 3RB3A 4Q43A 2MY8A 2DGXA 1GT8A 2MJNA 4HTIA 1U1KA 2K7KA 2WONA 1PILA 5GAEU 4QWCA 4L3KA 1MU2A 4C11B 8ATCB 3W9IA 3RB4A 4TY9A 3RZOC 1YWXA 5HBMA 3HSJA 4PYDA 1IKXA 3BBCA 3CCSS 1NDKA 1RYRA 2X1GA 4KDDA 3OFFA 4C2MA 1KKHA 4OJ1A 2DXFA 1BHNA 2P9CA 3FNNA 4FYVB 1DTTB 4ECWA 4BY7K 1GTEA 3G4AA 2M7SA 4OX8A 1Y11A 2HHTA 3MEDB 1PJ5A 3J80U 3WC2A 4DPYA 3M6UA 3KLFB 2M4MA 4RBTA 3CPWR 2YKOA 1HQEB 3IAM9 4DV4J 4B3OA 5LM7E 2WW4A 1E6VA 3LAKA 5J2PB 1UWAA 1CC8A 2EKNA 3CJ4A 2Q66A 3ENWA 2APOA 4JI0J 3MM6A 4DX7A 5BJRA 4LRFA 4A8FA 3FEYB 2ZH8A 3BBBA 1IKYA 2IA0A 2CADA 2VDIA 2Y1RI 5T14A 4B3RJ 3RU0A 3JYTA 1TWHC 2PDAA 1XEZA 5C24A 1RT1B 3F56A 3ELHA 2WSCC 4YDXA 3A3OB 4A93C 3HPOA 3F41A 2HQCA 5CCMA 2LEAA 4MK8A 4C7QA 2MLXA 5HMWA 4OIRA 2NVYA 2GAGC 4YB7A 4CO4A 4F8RA 1W7WA 3KUGA 3S1MK 4QZVB 2R8IA 5ETVA 5F8HA 2DRBA 5ETSA 1CC7A 4CLYA 2W9AA 3NS5A 1LV5A 1Y7PA 1N32F 2XI3A 3M8SA 4FF3A 4J9SA 2JFKA 4DL0C 4C3HC 1VI7A 5F9NA 3TZYA 3FBBA 2WTFA 4A3GK 4GKJJ 3THTA 2AEJA 1JJHA 3BO2A 1TKZA 4HR2A 1VC5A 4OIOA 3KXDA 1WKLA 2D1CA 5M3MK 2KKHA 3W9HA 4DSJA 5KFWA 4RLEA 5K8PA 1U24A 3BN7A 3M8RA 4YR0A 2NVQC 2HQGA 1UJ4A 1N8RT 1YJRA 2X3DA 2IY5B 2ZH5A 5C44C 3ZZPA 3QSIA 3KHLA 3DOMB 1S10A 3OXGA 3PFEA 5F8GA 4FS1A 4CDIA 2BJ7A 2HRYA 1BGXT 3B4MA 3BB5A 4ENOA 2FJDB 4YY3J 2EFNA 1YJ7A 3M9MB 9ATCB 2CJ9A 2J6TA 1DCHA 4K2XA 3GTLC 2DVIA 1B4SA 2DH9A 5AJ3J 1MW7A 3BM7A 2HG4A 1B7YB 2HNZB 1H74A 1YGYA 1MROA 3H25A 5LJ5Y 2CZ4A 4DLGA 4H4MB 2JC0A 2YNIA 2ALYB 4G7HA 4A3LK 1F60B 4JV5F 4HTJA 2OSRA 4IRCA 2HHHJ 1C2PA 3IA0A 2M9KA 4EBDA 1U1MA 3C14A 1R8BA 3NAIA 3B54A 1K83K 4FYWB 2ZJQQ 2DR7A 4FF4A 1HMVB 2IIHA 1TWHK 4M1XA 4F2SA 3WC0A 1TWCK 2EFGA 3HXMA 2XS7A 1HW8A 2BW2A 3VR1A 3UW1A 4PXBA 5KFJA 4DDFA 1ZYRA 1U25A 2QMUB 5D0EA 4DQQA 4ELUA 2QSFA 3D67A 2JC1A 5KG7A 2UXCJ 5KTQA 2H9ZA 4GT9A 4PWUA 3A3PB 1S77D 3P8BB 4NA2A 1V3RA 2JA5A 1I50K 3PKYA 1XNRF 4UUXA 4A4JA 4Y7NK 3PO5A 2W4CA 1HKAA 1T11A 4NOHA 3BN4A 3BBFA 4PCQA 4QW8A 2VFVA 3R7BB 4XPEA 2IBOA 3MZIA 1IUJA 2CPXA 1NB7A 4OHWA 3C6UA 1N5YA 3LGMA 4A8WA 1OMSA 1Q8IA 3HOUC 2FJVA 1F5AA 3LPEA 4L73A 4JI6F 1OWXA 1T05B 2CPHA 1TL7B 1NXIA 1R9TK 3T19A 2OSQA 5I3QA 2HS0A 1VQLS 4IFVA 3T1YJ 2X7IA 3J7ZT 5CYMB 2JL9A 1T94A 1K83C 1H3DA 4P71A 3TJAA 4UOHA 3S1NK 3KK1A 1R8CA 2HBZB 3LUYA 3O44A 3GYXB 3E01B 3LO3A 2I8EA 2EC2A 1GE9A 2ZH7A 1RTJA 4OZNA 2RS8A 2ROEA 2OFGX 2EFVA 4P72A 4BLBA 1TWHA 5D3GA 5F8JA 1RT2B 3EUNA 1S1WA 2BKPA 1RHJB 3M9OB 5IV3A 1TQLA 3UCGA 3OUYA 1ZA2B 3BGOP 2ACYA 5J1NA 5B0CA 4CI0B 5IYCC 3IG1A 4XIUA 2GJFA 2W2MP 1WC5A 2CG4A 3GV5B 2NVTC 2KHCA 1ZZNA 3M2UB 3S2HK 2D69A 5J1EA 3H5SA 2DXEA 2PD1A 1CJTB 2V5HG 2YPZA 4C8NA 3SQGB 4I0WA 2PMZL 5CJ9A 1D8YA 5D8HB 1GXLA 1I94F 2MKYA 4KKOB 2R9LA 3S2HC 4DUYJ 1D0EA 3ILJA 3R1LA 3MR7A 1RWKB 3EX7B 1N5SA 1KP6A 2AMCB 3R5AA 3JTOA 2DXDA 4RW8A 2PFFB 4W90B 1DTQB 1TR0A 4RPFA 2OFHX 3BEGB 2WRMA 1S76D 1VRTA 1UP1A 4K4WA 1CVJA 1H2VZ 4A3EC 4DN0A 4LBIA 4OV6A 2DR8A 4OX6A 1OSCA 1L0WA 4KRWA 4PABA 2ADBA 3GEIA 4M5DA 1TTHB 4HT7A 3OQ2A 2W25A 5G0RB 2L08A 2PO4A 4DG1B 4PPDA 1TP7A 4BWMA 2IRUA 3ZNJ1 4X64F 4BDPA 1AROP 4BBRC 4DR4J 2FYXA 5HANA 1REVA 2RKIB 4QIEA 2L41A 5C25B 3DKDA 2DJWA 2DEJA 4DV0F 3EZOA 3CUNA 4A47A 3QLHB 3BPDA 4LVOP 5K14B 5C4XC 2W2OP 3CJTA 2DPJA 5IC6B 4ED5A 3HM9A 5EGYA 3HFVA 3GJSB 3UCUP 2V69A 4LF1A 1FA0A 4LR9A 2XNRA 3TJ9A 3EVMA 4LF9J 2AGQA 4LLGA 1L3UA 1WDDA 3NLCA 1OIAA 4ZA1A 2R7RA 3W63A 2V94A 3AFGA 1SJ3P 3D6FB 1SUQB 5IFMA 3QZ7A 1RT7B 4USUA 4OYMA 3TEGA 1N52B 5M2UA 4U7UK 4MKAA 2J76E 4I6WA 1PBAA 2I38A 1NSQA 3SFUA 1FCAA 1VJWA 3TFJA 5A8WB 2IM3A 2UP1A 1SFOK 4B3TF 2FZCB 2RU3A 1R0BG 1Y5LB 4DPUA 1B4AA 3NG8A 4G3IA 2XCRB 4Q5SA 2BM0A 2HWTA 2Z8QA 3FMBA 3PW7A 2J6UA 4JI3F 3DRRB 2DNRA 4B17A 4HEA9 3MWBA 2HZVA 1EJ7L 2GQQA 5KFIA 4K8RA 4BC9A 1RABB 4F4AA 1KS2A 2HEKA 4CLTA 2V4QA 4HI1A 2HBYB 4M5MA 1I1GA 4G0WA 2LDYA 3HOUK 1RTIA 3C6TB 4ED1A 2OEKA 3FBCA 3IAS9 4ZK7M 2AYMA 2JA6K 2IPOB 3PW4A 1NCLA 1LW0B 2BEFA 2D41A 2GAHC 5I3UB 2XSJA 4OHXA 4NLOA 1X5TA 1EETB 1OPIA 1U1LA 3HHNB 4DFJA 4ZOSA 4Q4ZA 2V8HA 3T02A 2XI2A 2J0QD 3TX8A 5BR8F 4OZ0A 1VQ8S 5IYCK 4HHHA 3CQZC 1FDNA 4C3JK 4DZ6A 4WFYA 4DSFA 2B6AA 4TYAA 2D9OA 2JA7C 3PVXA 4TU8A 1G3OA 1LWEB 4I1TA 5JMNA 2NREA 2DT9A 1AB8A 1SC4B 2B0GA 5D4PA 1C1BA 4CT8A 4CYUB 3RAXA 3UD4P 4E0DA 4KB4A 4RNFA 4QWEA 1N36F 1I6HC 3W60A 2B9XA 3TTGA 3MUVP 3SI8A 2YVSA 3MCOA 3MMJA 3KLGB 2J6SA 3TNVA 5G4DA 2F65A 1JLCA 3DXSX 1DY3A 4A3BK 3H0GK 4USHA 1RHQB 3DHXA 4EGLA 1RTDB 3UE2A 1RAGB 3CE8A 2J9DE 1RBOB 2MZTA 4WTOB 2R7TA 5KFQA 2AQ4A 2DIUA 2HGMA 1VBXA 2CQ2A 2VZ9A 4K4UA 4ATNA 1RT4B 4A46A 1JNRB 1WOOA 3C46A 2Y9HA 1TFYA 1F9NA 4R25A 3K8WA 2R2RA 4TVAB 2XNQA 4OZLA 4J91A 4B3OB 4GTFA 5E3AA 2NVQK 1Y3KA 2W4DA 2QC3A 2BANB 2ZH4A 1HR0J 1HQUA 4ZN3A 2UXBF 1T03A 1U6ZA 3GG1A 3IC1A 5HL7Q 5DQHA 2YKAA 1K8AT 3OBIA 3S8SA 1ZPVA 3CCWA 4MEYA 1MLAA 2AJ0A 3DYAA 5C24B 4GVBA 4ZVQB 2N3OA 1S0NA 4B3RF 3GR0A 2MQOA 4MKYA 2BW7A 3C15A 3HOXK 1LWXA 4R5PA 4DFMA 1YX2A 2AEMA 3PV8A 1ISEA 2OPRA 1CS4A 1M1GA 3R6LB 4U7CA 1UW4A 1H72C 2ASYA 3QGIA 1U0HA 1R27B 5AE1A 2J7KA 4B9NA 2YX7A 1UZHA 3SZYA 2MKJA 3GTQK 2VFUA 3OVBA 3CDEA 2V4JB 4N41A 1QUVA 4ES3A 3S1RK 3GJQB 2QA4G 1P9YA 1SC6A 2XLJA 2YNGB 3K58A 1N32J 4CH0S 4NI2B 3BDPA 1TL1B 4A3BC 4NL5A 2IVFB 2ZM6J 4DMZA 5IC4B 1VQKS 4IG0B 3RBXA 1IL2A 3OFGA 4O3RA 4DL6A 3UNYA 5DM7Q 4F3OA 3NWRA 4N56A 1P1LA 4LK0A 3D9BA 1B0TA 1S99A 3IS9B 5KFDA 3GEEA 4YN3B 3AODA 2BA9A 4DI6A 2OGUA 3MMBA 2Z57B 4KIAA 3ETMA 1U48A 4GKKJ 1DCPA 3T5HA 5BYRA 1LWCA 5EN1A 3OTOF 4OHZA 4J9VA 4NMXA 2R8HA 1S6UA 2Y0SD 2CQPA 1JLAA 2O66A 1MROB 3GTKA 4DFPA 2QMXA 1RCXB 1S6OA 3HK2A 4USJC 1OYEA 2ATLA 1SB6A 4KPCA 4Y3CA 2FHOB 3Q3QA 4ED8A 4G7OA 4ILMA 2CVIA 2K8GA 1BDFA 2VG6A 2CFXA 1YIJS 4DR1F 2B5JA 3Q8UA 4LJMA 4CLWA 4E8UA 5KFUA 5B08A 4DR1J 2D9PA 1RWPB 5E0OA 1VJQA 2CDRB 2LQJA 3NOCA 1U02A 2G0JA 2AIRB 2XZWA 2RILA 3S1QC 4KHMA 4IQXA 2KJWA 3GTMA 4L72B 1S0MA 2NPIA 1T9YA 3CMAS 4NCGA 1SL0A 8AT1B 1T7PA 2OEMA 4KT0C 1RLCL 3H5YA 4R0EA 2XCPA 2ABYA 3RBEA 1NJIT 5HVGA 3BV8A 4JI7F 1AUDA 4JI2F 2HVHA 1K1SA 1HI8A 4EEYA 3GE9A 1N5YB 1PC5A 2V2ZA 5KT2A 1RHUB 5L38A 3U27A 1U1RA 2UUCJ 1QD1A 3ILIA 4USVA 1BLUA 2UUAJ 3BR8A 2UUBJ 4U6PA 1NB2A 2R7ZC 1OO0B 2W4PA 3OL9A 4G6VB 4N7TA 3AB2B 2Y0BB 4DV2F 1DLOB 5CYMA 2QO3A 4PWWA 3IR5B 3V6JA 5M3FK 2BJ8A 2BQ3A 5HLFB 1UWBA 1BGWA 1I6JA 3GIIA 2VU5A 1S1UB 2RF2A 4GO7X 2FD2A 3WX4A 3SDEB 2LU1A 1AB4A 4LRDA 1BY9A 4F0HA 4JK1A 2OIHA 2WHOA 2W7PA 4NXMJ 2KTQA 3G8TA 5I3PA 1BXNA 2F8EX 2GQCA 1NK5A 3GTPC 2XHWA 4A3DC 4RMFA 5C5JA 3NGUA 3ZTOA 3HHEA 5T41A 3L09A 1WSVA 4J9QA 2XYHB 3IFEA 2XY5A 4DR6F 2R2SA 3PRVA 1G2EA 2MQLA 1IKWB 2OO4A 2R7OA 2MQ8A 3GTKC 3E3XA 2HNYB 5CYQB 2R7XA 4EI2A 2V8GA 4B02A 1GTHA 3OV7A 3N0CA 2QLWA 3GPAA 3MECA 5GADU 3BP3A 5HL8A 3DOLA 5FLMK 2QJ3A 2KH9A 4PG4A 4UZBA 4TU7A 1IXKA 2COLA 3EVOA 2P2CB 3MPYA 2N82B 2MKSA 2E2IC 2GZOA 2VA3A 2UV8G 4X65J 3IRXA 4IR9A 4PQUA 4MJKA 4WFAQ 3GTJC 5I42A 1ZAWA 3ITHB 4I7FB 2XBPA 4M5GA 1UTAA 2A68A 4NOIA 2RB7A 2BRLA 1CJUB 3Q24A 4A8YA 3H5XA 5HAOA 1FD8A 2DKOB 4I56A 4RW4B 3B6BA 4DL7A 2E9RX 4CO3A 3J81U 4C8KA 2Q6CA 3GQCA 1WORA 4DWIA 4MFBB 4JI8F 5CHCB 3CJSA 4RW7B 2ZBCA 4WILA 1SJ1A 5FJ4A 2ZC3A 2WOMB 3R5BA 1S7HA 4IFYB 2ZHOA 2NVXK 1DTTA 2MB0B 1UJ5A 5J2MB 1F9HA 2Y3PA 1S59A 4J37A 3VWSA 4KR0B 3K17A 3RUBL 3NCRA 2R3VA 3BGRA 3KHGA 2LQ9A 1PYOB 3JQKA 5CHPA 1QDUB 4NMLA 2BJDA 1P27B 3CIZA 4WZMA 3W65A 4RR5A 1RWVB 2CYYA 2WSFC 4Q0BA 1JNZB 2JA8C 4J90A 1U1OA 2DHGA 4X66F 2VQFJ 2QN6B 2QX0A 3MFIA 1HQ2A 1ICEB 1XMQJ 1H98A 5C3EC 2DGUA 3CJKA 5LOQA 1S97A 1YJTA 2ZC4A 5IOLA 3M9NB 3KJQB 4R8UA 3QGHA 1R9TA 2VB6A 3KWMA 2N4DA 4A3CK 5DG8A 4M63A 4Y2AA 3W2WA 3NWGA 3H2LA 1X4CA 2HW3A 4ZVSB 1DCOA 5L46A 3Q8QB 4GTLA 2GSUA 2W2NP 2QA1A 3M3YK 3C6TA 2B7BB 3H0GA 1H2TZ 4RUAA 2LLZA 4F4KA 4NXMF 2P6TA 1RT3A 1VC6A 2NZ4A 2E5LF 1QVGR 1RP5A 5IM0B 2PIIA 3GTOC 2AZ3A 2HMIB 5D0HA 3TZZA 3MAHA 3NMRA 5ADZA 3HOYC 2ILZA 1HBNB 3TAPA 4Z7CA 1WEYA 3DDNA 4OJ3A 2VUGA 4WFXA 1OJ4A 3OTBA 2R4FA 3LQVA 3M4OC 3S2DK 1KQFB 2UUAF 1JXEA 1NDCA 1IQZA 4LBHA 4CLZA 3KLVA 3KG4A 1FNOA 1XR6A 3J7Z5 4OMFG 1EQRA 1Y0HA 3MOZA 2Z58B 1YVFA 3C14B 2ZBQA 2EW9A 5D4LA 1YZ7A 1YJ9S 3VGSA 1Q95G 3I4HX 2ZITA 1RXOB 3N6NA 4F02A 5K8NA 4FKXA 3DRXA 1X4FA 4K4VA 5J1PA 3HOVK 2DGVA 4X4TA 2R7WA 3UDLA 4O44A 4KE5A 5M5YK 4FVMA 2C42A 2FJXA 2XTJP 2CFAA 4MKBA 4TLQA 4C8ZA 3GILA 2EG2A 3FRYA 5CCLA 4DUZF 4ED2A 2NR0A 3RAMA 5A6PA 5F9LA 2V68A 4U7UD 1V9OA 1HLWA 3PZPA 1YKWA 3O3LA 2HWHA 3BGLA 3KNAA 1IS1A 2M70A 4ZVUB 1M5OC 4RZRA 2YKMB 3A8EA 5KT3A 6AT1B 5C2GA 2E7WA 5LSRA 1QAXA 5DDQC 2A69A 1MMNA 3DOKB 2P8TA 2RU9A 2R92K 1JLQA 3T1YF 4B9MA 2NXUA 4B9VA 4KN4A 5KOWA 3I0RB 1N34F 2DNZA 1EHWA 1LW2B 4MK9A 3MD3A 2XY7A 3LA0A 2WAQD 4CLPA 2YH1A 4B9SA 4KQZA 3S16K 2YU9A 1W26A 3PEJA 1HNVA 1UFLA 3CC7S 1XR5A 3JQMA 4Y2MA 4JV0A 3KLEB 4DL2A 2PHCB 1GXUA 4KAIA 3RZDC 1DFDA 1FKPA 1BQNA 2VIHA 1VBZA 2DK2A 4GC7A 3MEKA 1KTVA 1HI1A 3C8YA 1S57A 4A3DK 3NNHA 3HVRA 4MAKA 1RCOB 2CQDA 1W25A 4R5PB 1YTYA 2ZEJA 2AWZA 2R93C 1R8HA 4K5RA 2V0NA 3N6LA 1U0HB 3JSMA 4OIXA 1O25A 1EARA 2IVYA 1HQMA 3MEDA 4LF6J 4CP5A 3FOEA 1UVKA 4OYXA 1S6PB 2AJQA 3PXGa 3NKYA 2M0GB 5E2QA 1HL6A 1U1PA 2U2FA 3DRSB 4PG6A 2B7CB 4F4ZA 3W3SA 4RUBA 4P10A 5JXSA 5KG2A 5I4MA 3FK4A 3SQGA 1S1WB 5CH7B 2R92A 2ZNYA 2ZBPA 2KZMA 1QUPA 2F63A 3MM8B 2BE5A 1RT1A 3POTA 5KFOA 2BABA 2W7VA 3IS9A 1U8WA 5E3RA 1TL5A 1J2VA 3Q22A 3PO3C 1QTNB 3S17K 1DHMA 2G0IA 5ETKA 4X4PA 2IC3A 2JH3A 3QGPA 3MM9B 1CJKA 2SXLA 5HQ8A 4C98A 1X9MA 1YLXA 2RRBA 5M2PA 4CNZA 3K59A 2WONB 4I69A 2DGQA 4IDKB 1HNXJ 2GW8A 3CD6S 2Q79A 2KFZA 4EZ6A 3K5LA 3GTGA 1J5OB 5EGHA 3E51A 2ZVIA 2LP4A 3HOWC 2E2JK 2XULA 1T3OA 2H4WB 4F3MA 1B99A 3FRZA 4HACA 2B9WA 3PX0A 2YWWA 5AE3A 2RHSB 3QLHA 4DG1A 1GMUA 3FJ2A 1TKDA 2AF6A 2B5JB 3JXOA 2UVWA 3H20A 1Z2ZA 3GFHA 3EGZA 2BX6A 3VAGA 2AHOB 5EWEA 4RKUC 2RKIA 2CVEA 4YP3A 2QA2A 4WPAA 3THVA 1EQ0A 4BY1K 5HMXA 3O1LA 4MQ9A 3N0BA 1RWNB 3LGNA 4NEYA 2MMYA 3HDSA 5K14A 2VV5A 3D3BJ 2FQQB 1WNEA 1WSRA 3TUIC 2KG1A 4NYPA 2EWHA 1I3QK 9RUBA 3JSRA 3CNQP 5GAHU 4WE1A 2EC0A 3KFWX 2FJEB 3TFIA 1VK8A 3X1LB 4JUZA 1WIHA 1SVDA 1JKHA 1GMWA 4HLBA 3K7AC 1Q8BA 2XYPB 1MMLA 4G1QB 4K4SA 3I9ZA 4LSLB 4GTCA 1JB0C 1RT7A 2ZZNA 5HN0A 3KHRA 1WWHA 1WI8A 2ATCB 5AXNA 2ZWOA 1FXLA 2V34A 4KGVB 3EVWA 1VLOA 4PKDB 3IP0A 3EJMA 2C2NA 1HNXF 4LFAF 5ITHA 2XO7A 4A8XA 1H2UX 1IWAA 1HD1A 5D78A 2M3DA 3D0HE 4FYXB 3ADAC 4CCHA 3VAHA 4ETZA 2MZJA 2W01A 4G1IA 1N6QB 3EXCX 5A0YA 2HFSA 4ED4A 5AE2A 2DEIA 3SSSA 1MMDA 1I6VA 3ZZ0A 3OL8A 2G1DA 1J6VA 4WKRA 2XS2A 4RNNA 3TANA 3PJ9A 3EWGA 1VK3A 1WHYA 4B3SF 2HBRB 2OUGA 1RU1A 4C3LA 3LOUA 3HVWA 4P5BA 1NH8A 1RA7A 3K89A 2JZ5A 1S72S 1WCMC 1Q8LA 4LFBJ 2I5JA 3KJNB 3NOGA 3P5TL 2A0FB 2F9DA 1EKRA 3R27A 3KMQA 1IJEB 4UT4A 2R93K 3R3TA 4DPXA 2BKNA 3PYEA 5E5NA 1C1BB 3PJWA 3DOLB 3QRRA 1MSWD 1F9FA 2DHAA 3CVKA 3H5UA 3N01A 3SCKE 4DR5J 2MZSA 2I0XA 3ET6B 5A8RB 3IRXB 1XMBA 2Z56B 4NLRA 2K1RB 1EIYB 3CO9A 4CT9A 4XLNA 2KT2A 3TW0A 1H7WA 4LOWA 4ER8A 2FVCA 3K5NA 3BKTA 3JTPA 2EKYA 2KM8C 1ELOA 5LMUJ 1M5SA 1R8AA 3GSIA 2GNKA 2PI5A 1TWFC 3BP8C 2CQIA 3U7JA 2ZDOA 2D3ZA 3GCWP 3S1RC 1LOUA 2M2BA 1K1QA 3S0XA 1FTCA 4DL4A 1U1QA 2O5IA 3TAQA 4Q7AA 3D54A 4ED0A 3D7SB 3CWJA 3AT1B 3HHKA 2JVOA 5DGBA 1IKVB 5KFCA 4IFYA 2ZD1A 3M8PB 1O27A 2ASLA 2RQMA 4A3FK 5J2MA 2OPPA 3RR7A 2PSZA 4A3MC 4NWBA 3MM5B 4D3HA 1Q7YT 1N88A 1MU2B 3R5DA 1HNZF 3SSRA 2RDIA 2RS2A 4A3JK 2H65B 1OS5A 2E1PA 5HVHA 1QY7A 4OINA 2FUG9 3MR3A 1IR1A 3V6KA 4JB8B 2LA4A 2X3GA 3CF5Q 1SKWA 5AXLA 4I64A 3EPIA 2UVRA 4AQYJ 3P3DA 4A3JC 1TL7A 3DLKB 4U67Q 3KKFA 2AX1A 4OX7A 1UJ6A 3PDNA 4MH8A 1HNIA 2V8PA 3G82B 1KVJA 2IMOA 4ZPAA 2JA6C 3DYAB 4B9UA 1CJVA 4CM0A 3CDBA 4YDDB 2KO1A 1C0TB 4RNOA 2J0SD 2HK2A 4ZVPB 5DETA 1RTZA 4DV6J 2MKIA 1J27A 1O51A 3PYFA 4MYTA 2D74B 4EFAC 1S1XB 3VF0B 3C16B 2Z2LA 1URNA 3PACA 4ED6A 1V3ZA 2Z2YB 1WACA 4IG0A 4PWDB 2IM0A 1RWMB 1E6VB 4P73A 1FRLA 2HQ3A 3K2YA 5A2QU 2E5HA 3QRPA 1B3TA 2D3O1 4ERDA 3OTDA 1WEZA 4LIWA 3H98A 2HMIA 3TFHA 3DLJA 4OI0A 3MEGA 4YMEA 4KTQA 1N4LA 2RE1A 1EQMA 1RB0A 3PTWA 4KGXB 1NHKL 1UL3A 5C4JC 1V5VA 3HHLA 3KUEA 1Y4ZB 1P8GA 1Y1WA 1J6XA 3B4DA 4RW8B 4DS4A 5EX3A 4LR2A 1JLAB 3K7RA 4FXWA 3KLIA 3D6MB 1UMJA 2EXUA 4R0JA 5KG6A 1S5ZA 1YBAA 5B7WA 5E41A 1R8PA 4K4XA 1SJFA 2V50A 2Z2ZA 2WVCA 2GJ2A 1CQNA 4QYZJ 2J9DA 1S1VA 5KG5A 2UXCF 3W2VB 2B3TB 3PFOA 3DNCA 5HMYA 2E1RA 1QAYA 1HWIA 2Q1LA 3MM7B 3DOMA 3CCVS 2ZOGA 1N5TA 3W8PA 4TU9A 2ZUFA 1JWWA 1DD5A 1OY8A 4AUKA 1T3NA 1TWGC 1FT8A 2XMKA 1VRUB 2JX2A 1F6TA 4NYOA 2JA5C 3OSNA 3HZGA 1M5PC 4M8LA 1IQTA 3OHAA 3KK2A 2FHJD 2VUMC 4Z2XA 5HATA 3Q8YA 3U1MA 1KEKA 3MGJA 2HKEA 2VUMK 2PMWA 1VLYA 1FE0A 2FVPA 2FC8A 3GIMA 3EGWB 2VONA 4X4UA 3DHWC 4ZP8A 4BLGA 2B63A 1PG5B 2IJRA 4FPRA 2UXBJ 3CSKA 2HLTA 4ZVRB 2UUWA 4YEAA 1C1CB 4PEOA 1FEEA 1D8ZA 2RJZA 2HFUA 3L7UA 4CLLA 4X4OA 1ZBSA 3MEEB 1LK5A 4DQRA 1S1UA 3KDOA 3ISNC 2CUYA 3H3VL 2R7VA 1BQNB 3L4BC 2J8AA 3HO1A 2XLKA 3M2RA 1R3NA 2BXJA 2W2PP 3VGTA 2CAJA 1XXBA 1XPPA 3NRBA 2GSOA 3V4GA 1C4CA 2AKWB 3M30A 1KHWA 2JSXA 4J9KA 3OEPA 1INNA 4JYAJ 2HVDA 3KUHA 3W62A 4NLXA 4A3GC 4F4WA 2FHMA 3I87A 2H54B 2CKWA 2K7JA 3ZXWA 1KLNA 3AD7C 2BQUA 1XN9A 2VG7B 4PXEA 5IT4A 3FBFA 4G65A 4X2BA 4P6QA 4ZIWA 1RISA 1X9WA 3DRSA 4JI3J 3M8WA 4ILDA 4G1PA 4G7ZA 2LDIA 1HWUA 1S49A 3W5YA 3I0SA 2MHNA 4DV3F 4WJBA 2AGPA 1YJUA 3C6UB 2IFXA 3ZTRA 3H7HB 3CC4S 2A6EA 2HFNA 1JOEA 1WTBA 1B64A 3BO4A 2ROGA 2PMHA 4J5OA 2FIUA 2DBBA 3RTVA 2W9CB 1IQ0A 2DRAA 1BC6A 2OLWA 1E6YA 1SBRA 4EO8A 3Q83A 5JUMA 2VG5A 1TMMA 4M5HA 3M7VA 4O3NA 1CJKB 2ZBRA 1T9TA 3DGVA 5CZVA 2WB4A 3DMJA 4MKVA 3SSQA 4MK7A 3QO9B 1S4FA 4PQUB 2ZVSA 4LQYA 4DU7A 4JI5F 2XMJA 2DY1A 3WQPA 3H40A 1RTJB 5F0UA 3RBZA 3TVKA 1ZAXA 2OAUA 4V19J 4FZBA 1RQ0A 5J1EB 1PJ6A 3R8YA 3ZZYA 2LVWA 3IR6B 2W8LA 3M8YA 3GTMC 2V2QA 3W1YC 5H9FK 4HACB 1FDDA 1WI6A 3H2UB 1L3SA 5KFFA 2XG8A 3P96A 4DSLA 1SIZA 2WOMA 4KMAA 3R9LA 1T9WA 1FHTA 4ZLLA 1NJXA 2GQ2A 2E66A 4OZ3A 2A2DA 1B0PA 1M5KC 3DI6A 2ASJA 2H5EA 2VPXB 3PR5B 1ACMB 3QSYB 1U8SA 4GC6A 4KC6A 3QATA 5ETOA 4WFNQ 3V6DA 1RLDA 3DLGB 2HRUA 3HOYK 3JAMY 1Y5IB 4MIAA 4PUOB 1Q79A 1WF2A 2Y1JA 2R7UA 4KAWX 4ETXA 4O4GA 3D6HB 2YH0A 2MY7A 4YQWA 1OPZA 5C3EK 3HSZA 3CCES 5IP9K 4J9MA 4RNMA 4NEZA 2MGZA 2HURA 3N6MA 3V4IA 3GTLK 5CQGA 5J2QA 4PXCA 4GVBB 4LSLA 1HHQA 1VQSA 1FJGF 1FVQA 2J8SA 2JWNA 3OPFA 2A3JA 2G1HA 1VHIA 1Q8KA 4Y28C 1SKSA 4TYBA 2NQPA 2EBEA 3NNCA 4GKKF 1WC3A 5AXMA 3LP1B 5H9EJ 3OTOJ 4O2DA 4LF8J 2JHEA 1N5QA 5HSPA 1WEXA 3S17C 3H2VE 4X62F 1D9DA 1AFIA 4K0KJ 5EWGA 3KK3A 4X6AK 2EPIA 1TL1A 1WUUA 1N5VA 1NKCA 1IKYB 1KSPA 4B3SJ 4NA1A 5J2NA 4LFCJ 3QWPA 4N8NA 5IYDK 2PGCA 4IR1A 2BR0A 2VD3A 3X3UA 4DV7F 2CNLB 5IM0A 2E1CA 4ZIVA 5M2RA 1XNQJ 2AX0A 2UXDJ 3D5MA 3GTGC 2Y1LB 1NBEB 4DPOA 2O5JA 1H7XA 2HGNA 1WCMK 4W98A 4IQMA 2YU9K 3OREA 2WBRA 2BDPA 1FRJA 2L9DA 3MR5A 3HI9A 1TELA 3G87A 1DJ0A 4LF9F 1YK9A 4KH1B 3UO0A 2VPZB 1BUXA 2LQ8A 3S6EA 2JNJA 4DQPA 2E5LJ 2K1RA 3TUJC 3LWMA 2RT3A 3US5A 3HF5A 8RUCA 2GX8A 2QT7A 4P75A 1WF0A 1NHVA 2PC6A 2QFIA 3N3YA 1ZBTA 3IRWP 5ETTA 2B8PA 3M6WA 2B6AB 4KMUA 5HP1A 2VG6B 1HW9A 5C4XK 2AGOA 3QIPA 4OZ2A 2CQ0A 1RADB 1F3VA 4HHUA 2ZFZA 4UUWA 4O3OA 2ASDA 4ZMMA 3OHBA 1DURA 3WDOA 6FDRA 4K4ZA 4QIFA 5DDOC 3N5BA 5LMUF 1X5SA 4AL5A 3EICA 2W2QP 4ID5B 5T7LA 1M0SA 3VGUA 2YNHA 2VQEF 1YNJA 3OJSA 4OYPA 3DGPB 5F3ZA 1P9QC 1LWEA 3GG0A 5FDLB 2ZD1B 1NKEA 4HL9A 1N36J 2ZH3A 4H4KA 3TRGA 2HHWA 2OEJA 4HYKA 1SH3A 2OPPB 1TWCC 3MM5A 3Q8VA 3L7OA 5LXRA 3FZ2A 3HLUA 2OD6A 3ITHA 4HI2A 1L3VA 1YITS 2OH2A 3PO2C 5FIIA 3TAMB 3ULHA 3EE3A 2E1MC 3DRYA 2VFRA 1FRIA 3LGHA 2LQ5A 2QL9B 4I2PA 1QJHA 1S1TB 3DCAA 3GONA 4O3QA 3QJLA 4C8OA 5KFTA 2RH6A 4DR2F 3KLEA 5DRKA 4YB6A 5L9XA 3G4CA 3HOWK 4Y7NC 1FFWB 3RGIA 4JP8A 1T0TV 1B0VA 3MR2A 2JEFA 2VHGA 2H1YA 2ZHAA 1F5BA 4LFAJ 3M2VB 1EI6A 2MQMA 2HZAA 1T03B 4OLPA 1IBKJ 3FSIA 4K5SA 3W61A 2DNGA 3CDWA 3GU0A 1X31C 2C1EB 2YQ3A 2ZNZA 3OLAA 1WC1A 4IRKA 2AW0A 2O1PA 2MKHA 3IBWA 3CW2C 5E3QA 1H38A 3HD2A 4OYOA 1YBTA 4Q0BB 4C0OC 2CQCA 3OR2A 4NLUA 3I96A 4DOZA 2E7XA 3DDIA 2C3YA 4CIOA 4NLSA 5CD4H 1RDRA 2BACA 2XMMA 1V3SA 1U1NA 3JQJA 5DGAA 3C15B 1TWAC 3G9CA 5CD4A 2C2KB 2XLIA 1FWKA 2KXFA 5IT9U 1TWGA 4FP9A 3FQKA 2XS5A 4LF5F
chains in the Genus database with same CATH topology
3A8IA 3AD8C 1VRQC 1XZQB 4PABA 3GEIA 1WOPA 4PAAA 1PJ5A 1WORA 1PJ7A 3TFJA 1PJ6A 3AD7C 3GEHA 4P9SA 3A8KA 3GIRA 3ADAC 3AD9C 3GSIA 1XZPB 3TFIA 1XZQA 1XZPA 3GEEA 1WOSA 1YX2A 2GAHC 2GAGC 3TFHA 3TTGA 5L46A 3A8JA 1VLOA 1X31C 1WSRA 1V5VA 1WSVA 1WOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8I A;  3AD8 C;  1VRQ C;  1XZQ B;  4PAB A;  3GEI A;  1WOP A;  4PAA A;  1PJ5 A;  1WOR A;  1PJ7 A;  3TFJ A;  1PJ6 A;  3AD7 C;  3GEH A;  4P9S A;  3A8K A;  3GIR A;  3ADA C;  3AD9 C;  3GSI A;  1XZP B;  3TFI A;  1XZQ A;  1XZP A;  3GEE A;  1WOS A;  1YX2 A;  2GAH C;  2GAG C;  3TFH A;  3TTG A;  5L46 A;  3A8J A;  1VLO A;  1X31 C;  1WSR A;  1V5V A;  1WSV A;  1WOO A; 
#chains in the Genus database with same CATH topology
 1NM2 A;  5GME A;  3OUY B;  1XIQ A;  3DM2 B;  2VC0 A;  1SKU B;  3D28 A;  3W2V A;  2IRX A;  2HFV A;  2CG8 A;  1ULR A;  1SL2 A;  3MPW A;  5TMF A;  4YG2 A;  5KFP A;  3R1H A;  4LR8 A;  1FRH A;  2CPD A;  2YNG A;  4NYZ A;  4RW4 A;  1FKO A;  3J7Y U;  3FUY A;  2XO6 A;  4B3M J;  3UVJ A;  4AXJ A;  1BD6 A;  4RU2 A;  4QIW D;  4RO0 A;  2VQE J;  3MI7 X;  5EX0 A;  1FXD A;  5GAG I;  3NUH A;  2VFT A;  3ZZR A;  3CJ0 A;  2Z30 B;  1O24 A;  5DS7 A;  4DV7 J;  3CCU S;  2MHE A;  4DX5 A;  3HVA A;  5F3T A;  4CO5 A;  2HZC A;  4DEZ A;  3FGV A;  3GTP K;  2V2K A;  1O2B A;  5EHH A;  5DG9 A;  1RWO B;  1K0T A;  2XCO A;  1BWE A;  2XMW A;  5GAD I;  3EZU A;  1GX6 A;  4PXD A;  4XPC A;  1HPZ B;  1YI2 S;  4O3P A;  1YJV A;  3W7B A;  3S1N C;  3BSC A;  4LFC F;  4UW2 A;  2R93 A;  4X64 J;  4FM9 A;  2O67 A;  1NHU A;  4CLS A;  4C8L A;  2VJU A;  3EGN A;  4G1Q A;  4NZ7 A;  1N34 J;  4A3K C;  1W2I A;  1D1U A;  2ZZT A;  1WQF A;  1N6Q A;  5L1K A;  2NVY K;  3AB4 B;  3HVT A;  1OY6 A;  1GXT A;  2RQ4 A;  2LCW A;  3G6V A;  2KVI A;  4PG7 A;  4BCA A;  4QWA A;  2AT1 B;  3S15 C;  5IYB K;  2B4U A;  4DBQ A;  2M52 A;  3KMS A;  2QEX S;  4A3F C;  5KFK A;  3W8G A;  4LF8 F;  2BUN A;  1I94 J;  5TJ3 A;  4NZ0 A;  4N76 A;  4URG A;  4NCG B;  2OMO A;  3QMQ A;  1UVJ A;  4CLF A;  1HYS A;  2GJI A;  3OSP A;  1TUV A;  2MQN A;  1TWA A;  2V8D A;  2A2C A;  3GCX P;  1HNV B;  5JVH Q;  1WKK A;  4WYW A;  3NBP A;  4DV5 F;  1GH8 A;  3I0S B;  1TK8 A;  3H0G C;  2B51 A;  1JLE B;  1SC1 B;  4YB1 P;  5B0E A;  3SDE A;  4YR3 A;  2HS4 A;  2OPS A;  3KJV A;  3SZ2 A;  1VGY A;  4KFB B;  5HJX A;  2Q43 A;  4O23 A;  2IM1 A;  3L4K A;  3MUT P;  2EBG A;  3VQS A;  1J98 A;  1Y00 A;  3DC2 A;  3EGV A;  2HYI B;  4RNH A;  4LVN P;  2KG0 A;  2V9W A;  5IP7 C;  3WIV A;  3IN5 A;  4BLA A;  2RF2 B;  1RU2 A;  2UVV A;  3TO8 A;  4ELV A;  2RUG A;  2PA8 D;  1ZQ1 C;  3PO4 A;  4HH0 A;  1GMW D;  2QL7 B;  2DNN A;  2C3P A;  3KHH A;  2YQ0 A;  1G1X A;  2GML A;  1XMQ F;  1DAR A;  2E9Z A;  3MPV A;  3ENA A;  1S9G B;  3NCP A;  4J3N A;  1XZQ A;  5C2C A;  3BZQ A;  3R7N B;  2UV8 A;  1UFK A;  3PYD A;  4AT1 B;  3FC9 A;  2CPE A;  1WQH A;  5KFE A;  3POT B;  4NCA A;  2RVJ A;  1HBM A;  1ZM9 A;  3IM9 A;  3I4N K;  1LFP A;  3M8P A;  4B3M F;  3M32 B;  4B9T A;  4MIW A;  3MEC B;  4ECZ A;  3NS6 A;  4S0M A;  3GZ7 A;  4OIQ A;  1D3W A;  3DLG A;  4WIQ A;  1PIE A;  2ZJP Q;  3GTQ C;  1NK6 A;  2M88 A;  2ZHB A;  3PNI A;  1AFJ A;  2Y8Y A;  4OQJ A;  2NSC A;  5BR8 J;  4K7Q A;  5KFS A;  3LP0 A;  5ETP A;  3LP2 A;  1VOM A;  2CJB A;  2WVB A;  4C3I C;  3DLK A;  3L7P A;  3BGU A;  1Y1W C;  2GVZ B;  1EP4 B;  2C2M B;  4IG3 A;  2MJU A;  3TEH B;  3RAQ A;  5KFX A;  1XNR J;  4XLP A;  2CDQ A;  4PRF A;  1VQ6 S;  1FD2 A;  4WXO A;  3ICL A;  3RZA A;  1XMO F;  4EYH B;  4C3M A;  2FLP A;  1QLN A;  2CNO B;  4P2S A;  3FBE A;  2KJV A;  4C48 A;  4AYB L;  1KR4 A;  3K8V A;  3GTY X;  2RNE A;  1WEL A;  3NMA A;  4ZVG A;  2C2Z B;  4I68 A;  4WWS A;  4Q8F A;  3GDZ A;  5FLM C;  1CJV B;  4WCE Q;  2ZOM A;  4F26 A;  4RW7 A;  1Z4U A;  1H0H B;  1PBU A;  2R7Z A;  1VFJ A;  2NPF A;  3FEX B;  5B0B A;  1TKX B;  1CPZ A;  3SMZ A;  5IWA F;  3Q8P B;  2OTJ S;  3N28 A;  4QWD A;  2W8K A;  3HFZ B;  3CJ2 A;  4UOF A;  1AT1 B;  1I3Q C;  3FFI B;  2NSB A;  4ZH4 A;  1JKH B;  4NPO A;  3KG0 A;  4H4O A;  4USW A;  2JOQ A;  2WZ1 A;  1KQ4 A;  1FNM A;  1DRZ A;  4KMD A;  1NPP A;  3HHL B;  3R2C J;  1QSY A;  1SH0 A;  1XZP B;  2WSE C;  2ZWP A;  1AZS B;  4ITS A;  2KI2 A;  4C3I K;  3PJX A;  1BE4 A;  2VJV A;  1U6B A;  1HAR A;  4QIW L;  2G4B A;  2LMI A;  3CJK B;  1PJ7 A;  4F7V A;  5D0G A;  4Y6I A;  2DYA A;  2MDA A;  4IO1 A;  4W4M A;  1D9A A;  2LEC A;  3BUE A;  3QYY A;  3NEK A;  2NLW A;  1IM4 A;  2B63 K;  2FVQ A;  4A8O A;  1TFW A;  1WG5 A;  2VBY A;  3SFG A;  3UR3 C;  2MST A;  4M5I A;  2FY1 A;  4CZC A;  4ILR A;  1FJG J;  4C2M K;  4Q8E A;  3NCQ A;  2Y1I A;  4I67 A;  3LAJ A;  5IQ6 A;  2MLY A;  1SJQ A;  1VMB A;  1U7L A;  2J9C A;  2K3K A;  2CW0 A;  5HP1 B;  4ICL B;  3QID A;  4LSZ B;  3KK2 B;  2RDJ A;  2X1F A;  3VVT A;  4PPZ A;  1U2F A;  1BQX A;  2PFD A;  2KRB A;  2KDO A;  1I3O B;  1HBN A;  2MXY A;  2VBW A;  2EG1 A;  3JB9 k;  1Q5Y A;  3P5B P;  4FS2 A;  1O29 A;  2MEW A;  3RBD A;  3P4U B;  1VIO A;  2CQB A;  3D1H A;  4OI4 A;  2GIQ A;  2GMJ A;  4CH7 A;  5MAO A;  2P5M A;  2YNH B;  3WBZ A;  2IDL A;  1SL1 A;  1CBK A;  4OX9 J;  1QAJ A;  4O44 B;  1Q16 B;  3MF5 A;  4TN2 A;  4EWT A;  2QTW A;  2KT3 A;  5L1L A;  2FVR A;  2LXI A;  3TAM A;  2HFO A;  1KQK A;  2CJK A;  2IVM A;  3S01 A;  4FKY A;  5KG0 A;  1LK7 A;  4I2P B;  4IOB A;  3N4W A;  1KOH A;  4XSX A;  2C28 A;  4MEX A;  1SFO C;  1G7C B;  5DM6 Q;  2K2P A;  3R5G A;  1A7G E;  1C1C A;  3A3N B;  5LXY A;  3HCX A;  3D68 A;  4MYU A;  5IYD C;  3DOK A;  1YRT A;  1VQ5 S;  1WHX A;  3S2D C;  1TUW A;  4KN7 A;  1IW7 A;  3SQO P;  4A48 A;  2AV5 A;  2DD8 S;  2UU9 J;  3HKZ D;  3KLH A;  1NDP A;  1I50 C;  2XMT A;  4FN5 A;  1KBR A;  2BRK A;  2YU9 C;  2MLZ A;  4C2M C;  3I0R A;  4ZPD A;  4L75 A;  5B0A A;  2XMV A;  3CAG A;  1Q7L B;  2DR6 A;  2JRS A;  4ZS6 A;  1ZPW X;  1HD0 A;  1FKP B;  2ZDP A;  4LF2 A;  2DGT A;  1HI9 A;  3NAH A;  1USM A;  3FHZ A;  3JST A;  3UDE A;  4MIB A;  4BBS K;  4TQR A;  1RJJ A;  2WAQ L;  3CCZ A;  3IWX A;  2LXU A;  1NSP A;  1TWA K;  1VJE A;  1C0T A;  1FX4 A;  5IP9 C;  1TL3 A;  2CPZ A;  3M4X A;  1RI7 A;  3DMJ B;  3NS7 B;  4NE9 C;  4QR2 A;  2GFF A;  1FK9 A;  3BKF A;  2HAF A;  4JV2 A;  2U1A A;  2XGQ A;  2DNM A;  5IOQ A;  4YHH J;  4NZ6 A;  4HT5 A;  4FZV A;  1S6P A;  3GTJ A;  5C42 A;  3H59 A;  4PWD A;  4AH6 A;  5HVF A;  1XWL A;  4AE5 A;  4JI5 J;  3SXL A;  5CZX A;  2DNK A;  3MUM P;  2A10 A;  3G71 S;  3OTC A;  3HJF A;  1TKT A;  1K47 A;  5CAA A;  2DH8 A;  3OFH A;  3GFZ A;  4ZVF A;  2C2R A;  1BWV A;  5IYB C;  4DQS A;  2R8K A;  5DG7 A;  1U4B A;  4J9U E;  4DXL A;  2GO8 A;  3MM8 A;  4IKA A;  1UA0 A;  2B8Q A;  3L9Z A;  4KB2 A;  2D3U A;  2B4V A;  3WX8 A;  3VVU A;  1SXL A;  4ZHR B;  4ZLP A;  1FJC A;  2B63 C;  3CDU A;  1IKV A;  1FJ7 A;  2FJB B;  3LWL A;  3AXK A;  4JV1 A;  2KM8 B;  3BYP A;  5B0D A;  4FYD A;  2BJ9 A;  1RZM A;  3FCV A;  3MML B;  5I42 B;  1C0U B;  2BE7 D;  4KBI A;  2IC3 B;  5LSL A;  1U0S A;  4J9R A;  4EO6 A;  1R7I A;  2AJ1 A;  2XB2 D;  3GTG K;  1VH2 A;  4C97 A;  4CRJ A;  4NLQ A;  1IBL F;  2IBK A;  1QVF R;  5J2Q B;  3QT5 A;  4QR1 A;  4LK1 A;  1NUE A;  3BSO A;  5CA5 A;  1RU0 A;  2CQG A;  3W5X A;  3S14 C;  5H9E K;  2N4C A;  4OYI A;  4FXD A;  3GTQ A;  2OPQ B;  4HDH A;  4NX9 A;  1KHV A;  1RSC A;  3I56 S;  4A8K A;  1VRU A;  4QPT A;  2V6T A;  4QW9 A;  3M6X A;  4EYI B;  1ZA1 B;  4IH6 A;  5RUB A;  5F0W A;  4NCB A;  3LP1 A;  4USM A;  4ZN1 A;  5K9F A;  3JTN A;  1JLF A;  1YJW S;  1V5I B;  4WE1 B;  5KT6 A;  3KK3 B;  3QAE A;  3AJ2 A;  4V19 X;  2QE5 A;  5SZT A;  3THP A;  3TYT A;  1LWF A;  1JVI A;  1URR A;  1TAU A;  1SCJ B;  3R5J B;  4I6A A;  1UVL A;  4C8Y A;  4DSK A;  1Y1V K;  1LNQ A;  2XZT B;  2R2U A;  1UVI A;  1ZYQ A;  1RT5 A;  4E98 A;  2GGP B;  3SBM A;  3C3L A;  3D0I E;  1VQN S;  4X66 J;  3ZZO A;  1FES A;  3AAW B;  5D0R A;  2N7C A;  3IXQ A;  2H5J B;  4Y2K A;  2AJ4 A;  3GTL A;  4A8Q A;  1O2A A;  1KRP A;  3PO2 K;  1HI0 P;  4RW6 B;  4KFB A;  1FTR A;  4LJZ A;  3MDF A;  3MHY A;  3W2W B;  4NXN J;  4QCL A;  2HPU A;  3V81 B;  2HHV A;  1DQ8 A;  1IBM F;  4DCJ B;  5KT5 A;  1XJW B;  3TI0 A;  3G4S S;  2RQK A;  5A0Y B;  2KN4 A;  5IT9 Y;  2DTJ A;  4NLT A;  1YJN S;  3BYR A;  1WOS A;  1ZM3 A;  3CDA A;  2GIR A;  1NK9 A;  3K57 A;  2PA8 L;  4RWX A;  3GJT B;  1NK4 A;  4QJV A;  4PYA A;  3ETO A;  2PI4 A;  3DLH A;  3HFK A;  2BBE A;  3VV2 B;  5K5M A;  4C3K A;  4DV0 J;  1U2R A;  1EK8 A;  5GVQ A;  2YWG A;  4QIV A;  2HVZ A;  2DNY A;  1KFD A;  4NAS A;  3RR8 A;  2KYX A;  3NP5 A;  3DGP A;  1MN9 A;  2EFQ A;  2Y8W A;  5A8R A;  1E6Y B;  4M5N A;  4P7V A;  3BDE A;  2WCX A;  3GTK K;  3OLB A;  3ZC4 A;  5CXT A;  1VYA A;  4CM2 A;  3M3Y C;  2L9W A;  4ID5 A;  4WFB Q;  3CJ5 A;  4ILL A;  2C22 A;  1RK8 A;  4CO2 A;  4EUV A;  3QO9 A;  5GMD A;  2EK6 A;  3D6T B;  3LP0 B;  2ZH6 A;  2DGO A;  1KLM B;  1Q0N A;  4QR0 A;  4N5S A;  2J9E A;  2CFA B;  1TVR A;  4FVC A;  4L76 A;  4LF6 F;  4LT6 A;  1NKB A;  2JA6 A;  4C11 A;  4YHH F;  2ZH2 A;  2DCU B;  4TLR A;  2XCA A;  4QWB A;  1SJ4 P;  4IG3 B;  5KG1 A;  4P74 A;  1VR6 A;  2EEY A;  3Q0A A;  1XNQ F;  1NPR A;  3TUZ C;  2D3O R;  2J7W A;  4L6V 3;  2HQF A;  1BQM B;  3DLB A;  1CUL B;  2YWE A;  4WP3 A;  3VZI A;  5EGE A;  3CIM A;  4QYR A;  4Y2I A;  3M30 B;  3P6Y C;  2HBQ B;  1O6X A;  5THW A;  3OT9 A;  1IWG A;  2UU9 F;  5HJY A;  5IXU A;  1SFO A;  4Q2M A;  2BVZ A;  5H1S V;  4DSE A;  2F4F A;  3K5M A;  3V4M A;  3OR1 A;  2C2O B;  1A0O B;  1VGX A;  1O5J A;  1F0X A;  4B3T J;  3QQC D;  4P5A A;  3I32 A;  5E7O B;  4O4G B;  5LMN J;  1FKA F;  5CYJ A;  2I6W A;  1SPB P;  2RAQ A;  2PT0 A;  3ZZT A;  2BJE A;  2DNP A;  1YDL A;  3G82 A;  5ETM A;  4NLY A;  2QMW A;  3V4I B;  2B4P A;  2NXJ A;  5B0F A;  4Q44 A;  4DV1 F;  2C3O A;  4OI1 A;  3D3C J;  1AZS A;  1NEE A;  2D6F C;  1IE0 A;  1QAI A;  2VA2 A;  4A8M P;  3OR2 B;  2YWK A;  2QLX A;  1JLG B;  2V4R A;  3M1V A;  3AHP A;  3NL0 A;  4CTA B;  2MQQ A;  2RIJ A;  2PEB A;  2YTC A;  4UTG A;  1OQ6 A;  2B43 A;  3U1L A;  1S1X A;  1U26 A;  1P1T A;  3T5K A;  2NZC A;  3S16 C;  3PW0 A;  3HOX C;  3CD7 A;  4UST A;  3UVJ B;  1R43 A;  1XMO J;  4DF4 A;  3DM2 A;  1JJC B;  1RAJ A;  4KO0 A;  1Y9O A;  3Q8S B;  1K73 T;  4CO0 A;  4IH5 A;  3FSX A;  2XCQ A;  3MMA A;  1RAC B;  3SYZ A;  4JYA F;  3ERE D;  2MKK A;  1Y1V C;  4A3C C;  5L1J A;  1Z2L A;  3GFX A;  3R97 A;  3EDQ B;  4URQ U;  2F7V A;  4DDQ A;  3MAA B;  4F50 A;  4WJ3 M;  2C3M A;  4V1A k;  3FSY A;  1UKU A;  2GIF A;  5JVO A;  1MG7 A;  1S0V A;  1LXJ A;  2H51 B;  3MPD A;  4PG5 A;  4XO0 A;  3PW5 A;  5A8K B;  2FZG B;  4DV3 J;  2W24 A;  2X1A A;  4RWW A;  3AOA A;  2FPH X;  1VIS A;  3DU5 A;  1JQW A;  1J5O A;  4AYB D;  2CQ4 A;  3CXC R;  1Q1K A;  5DDP C;  4OI6 A;  1HPZ A;  3CUL A;  3BKU A;  3V2U C;  3T00 A;  4P52 A;  4KAR A;  1SJR A;  3QT8 A;  1UZD A;  1RTH A;  2CPI A;  1V6H A;  3HT0 A;  1AXQ A;  3HKZ L;  3MM7 A;  3QFW A;  5L39 A;  3RW6 A;  2HS3 A;  3OW2 R;  1KVK A;  3OL7 A;  2LQB A;  3AJD A;  2VPW B;  1ZM4 A;  2W7O A;  3S7R A;  2KFN A;  4ES1 A;  2AYE A;  3AD8 C;  2N7Y A;  1LEO A;  2WK4 A;  2YKQ A;  4CWB A;  4AL6 A;  1NME B;  3KYL A;  5F8N A;  3AA8 A;  1NO8 A;  4HH1 A;  1NZA A;  5KFM A;  2P9E A;  2L48 A;  2E2I K;  3GIJ A;  1DQA A;  2DR5 A;  2V6A A;  2BM1 A;  3HHL C;  2JVR A;  1QSS A;  2ZM6 F;  3UPF A;  3J80 Y;  3DLE A;  2UUC F;  1SIW B;  3CO0 P;  2BE2 B;  3FVY A;  4KHR A;  1TV6 A;  3EXY A;  3HOZ C;  4TY8 A;  2N3L A;  3A1Y G;  4OIP A;  3BR9 A;  4KJI A;  1G51 A;  1S1T A;  3KJV B;  5DZ6 A;  4XTT A;  3JSY A;  3V6H A;  3CCL S;  2NUH A;  3BSA A;  4Q5V A;  4IFV B;  1R89 A;  2RGR A;  1USO A;  2GVD B;  4FBU A;  4C0H A;  4JI6 J;  1JLE A;  1HBU B;  2F9J A;  4DJB A;  3ISN D;  1EFW A;  3ZTP A;  1XC9 A;  4KGM A;  5KOX A;  1FX2 A;  1ZVU A;  2EK1 A;  2VG7 A;  5KT7 A;  2OP5 A;  3M8Q A;  4I2Q A;  4IRD A;  3E01 A;  1Y1V A;  4OHV A;  2CWK A;  3FEZ A;  2ZUE A;  1SV5 A;  5EUH A;  2WVF A;  3WIU A;  2IJN A;  3HOV C;  3O5T B;  1R9T C;  2ADC A;  3NGT A;  3L3C A;  2I5J B;  3AQP A;  2KXH A;  3GEH A;  2ZZM A;  4WYL A;  1NLK L;  1JLB B;  2H5I B;  2R8J A;  4U96 A;  2F8M A;  4ZPC A;  5B09 A;  3TQ1 A;  1F5C A;  1EH1 A;  3MXH P;  5D4O A;  1TWF A;  2NXN A;  5D4N A;  4FF2 A;  2OML A;  2ZE2 A;  4KAT A;  4LF7 F;  3LAM A;  2VG5 B;  4K4T A;  2LEP A;  3EZ5 A;  2W1B A;  3N79 A;  4CLK A;  2WVD A;  3QJJ A;  2CPY A;  2W9C A;  3MUR P;  4DV6 F;  2Q6B A;  3FCW A;  2DGW A;  4A3I C;  1QM9 A;  1RUS A;  4P2M A;  1QE1 A;  2EVZ A;  4J9O A;  2AU0 A;  3S1Q K;  4C3H K;  3VAL A;  1C0U A;  4KY3 A;  4K2J A;  2VUM A;  3B82 A;  2MKC A;  2BQR A;  2V6S A;  1TL4 A;  2OEL A;  2NVY C;  2YX1 A;  1I5O B;  2YKN A;  4I6Y A;  4PG8 A;  3MMC A;  3I4M C;  2I1R A;  2M8H A;  3UN3 A;  4WBF A;  4K0K F;  4GTE A;  4ECS A;  4JI4 J;  2YWH A;  3MPU B;  2OPQ A;  3PCO B;  2YNF A;  1REV B;  2VKZ G;  2FGC A;  3MOJ B;  3DRP B;  4B9L A;  4DV5 J;  3OVS A;  1KFS A;  1Q81 T;  4N47 A;  2UXD F;  1M5H A;  2IMW P;  1RT6 A;  3TZX A;  3L95 X;  2A18 A;  4F4X A;  1LFW A;  4ECU A;  3PY8 A;  4KAS A;  3V6D B;  3OD2 A;  3KLF A;  2DIS A;  4BKW A;  3NXZ A;  2VBZ A;  1D09 B;  4M1K A;  1REG X;  4PUO A;  3W64 A;  1AA1 B;  2QFJ A;  4ZCM A;  3IO1 A;  4RX6 A;  5TMC A;  2CNN B;  4ES2 A;  4HDG A;  4WP9 A;  2FLN A;  4JI7 J;  5BXI A;  4IH7 A;  1UFW A;  1Y10 A;  2BKO A;  4ZLJ A;  2B56 A;  1MNE A;  1LXN A;  2R42 A;  1YG0 A;  3FKI A;  1A9N B;  3D1O A;  2YQ1 A;  1HNW J;  4LRE A;  3VGV A;  2HQD A;  5BYQ A;  4DPT A;  5KFH A;  4D3G A;  1FER A;  3R7S B;  1HNZ J;  4P9S A;  1L3T A;  2YBV A;  2RUS A;  2HIQ A;  1X5O A;  4DR3 F;  3H42 A;  3O8W A;  3C16 A;  4YFN A;  4J9N A;  5AXK A;  1FWP A;  1PCA A;  4OX9 F;  1QSL A;  3H0P A;  2WBM A;  3HD1 A;  5E3C A;  3H3V D;  1S9E B;  4QOT A;  5FD1 A;  1S48 A;  4Y00 A;  4LR7 A;  3VHQ A;  5KG4 A;  5IOR A;  5D6G A;  4P2X A;  3TR5 A;  3O6Q A;  1K9M T;  4NLV A;  1EET A;  4G0V A;  1HHT P;  3VAK A;  2XM3 A;  4DR7 J;  3JSB A;  4RJV A;  4GMK A;  2RHQ B;  2FTR A;  2VOP A;  3E8O A;  4KB7 A;  5IOT A;  1N0U A;  5J2N B;  1D9F A;  2VPY B;  2YWF A;  4QPX A;  1NK0 A;  2KVQ E;  2IJF A;  2ALZ A;  3KLI B;  1T02 A;  3T1H F;  1ZTT A;  1HBO A;  2K3I A;  1EZZ B;  4A3K K;  2CXE A;  1UEV A;  1VQ4 S;  1Q86 T;  2JJ4 D;  1S1V B;  3M05 A;  4DR2 J;  2HNZ A;  1HMV A;  2JEJ A;  1ZOT A;  1IN0 A;  4LQ9 A;  1EKS A;  1GK8 A;  4F2R A;  3IWN C;  3SV4 A;  3SCJ E;  2IAJ A;  1F2G A;  5A2Q Y;  3QIP B;  4LSN A;  4G0U A;  3QFH A;  3UD3 P;  1DZ5 A;  7FD1 A;  2L9N A;  2OHD A;  1JLC B;  3I4M K;  4GO5 X;  4GTA A;  1X0P A;  1P6T A;  1IBK F;  1FDA A;  1UET A;  3VQT A;  1N48 A;  2W9B A;  3RG6 A;  3HVT B;  3I55 S;  3TOQ A;  1G4C A;  5FDL A;  2KXN B;  2FB0 A;  1IR2 A;  3M32 A;  3BJY A;  1RAE B;  3AOC A;  1PAE X;  4OZ5 A;  4AD6 A;  2F4V F;  1ZS6 A;  1RYS A;  1RT4 A;  4OV1 A;  2DIV A;  2DO4 A;  2DCL A;  4ZVT B;  3LAL A;  2FDN A;  2I9S A;  2VL1 A;  3QBC A;  2GCF A;  4KV8 B;  2HLU A;  2PEH A;  1RAH B;  3KLH B;  4DR6 J;  5L1I A;  5ETL A;  4ZIT A;  3TA0 A;  3P49 B;  3UQS A;  2QYC A;  2E44 A;  4M95 A;  3LP2 B;  2HND A;  1OSD A;  1ZM2 A;  1NJW A;  2NVT K;  2XC9 A;  5C4J K;  5EWF A;  1SKR A;  1NRK A;  2ZH1 A;  1WJ9 A;  3IGV A;  3G96 A;  4ZCI A;  5L8R C;  4GVL A;  1JXL A;  3MEE A;  4QBU A;  4DF8 A;  1ZTW A;  3SEO A;  4DCO B;  3T9N A;  2UZA A;  3K5O A;  2IA6 A;  2RDD A;  2EFP A;  3PKM A;  3GTO K;  4GTB A;  3I6P A;  3AXM A;  1BJT A;  1ZH5 A;  2IYG A;  2KHD A;  2QL5 B;  4MMO A;  2OPR B;  3H90 A;  4X62 J;  1DBD A;  5KFZ A;  3M2V A;  5EDW A;  3OJU A;  4AXI A;  3CQZ K;  4B08 A;  5FLX U;  3D66 A;  3T6J A;  2QYG A;  5F8L A;  2EFO A;  2LXF A;  1UPP A;  5KFL A;  2H3E B;  4DR7 F;  3UFC X;  3V5R A;  3IG1 B;  3Q23 A;  1HIY A;  1LKZ A;  2V67 A;  1GMV A;  2PMZ D;  2A6M A;  2X1B A;  3CJ3 A;  2AD9 A;  1RT2 A;  2BOA A;  2HAI A;  1ZXO A;  2PN6 A;  4DZD A;  3NGR A;  2F4V J;  3P45 B;  2DNO A;  2J0X A;  2K06 A;  2XHC A;  4ZDN A;  1RGV A;  1WC6 A;  4ZCK A;  1JXV A;  3N5F A;  4GFQ A;  4OZJ A;  1M1H A;  2MPU A;  4O4R A;  1Q82 T;  4N8O A;  4UY8 T;  4XK8 C;  3MMB B;  4ZPV R;  4NRU A;  3RW7 A;  3MAA A;  3HJV A;  2DRD A;  3I5B A;  2NVX A;  5IS2 A;  2AYB A;  4KKO A;  4U8V A;  4ED7 A;  3A12 A;  4ZP7 A;  3ZZU A;  2ZKU A;  3AA9 A;  2CWX A;  1L3K A;  2Y0S L;  3CB4 A;  4ZHR A;  2HK3 A;  3PX4 A;  3ZTQ A;  3LPX A;  1KDN A;  4Y52 K;  4YB5 A;  1EX8 A;  1WKJ A;  3PIO Q;  1Y3J A;  3UDC A;  1NK8 A;  4LBP A;  4KHP F;  4OJG A;  4LIR A;  4WKY A;  1A6L A;  4KSE B;  2KU7 A;  4KC5 A;  2JA7 A;  1HWL A;  3IBC B;  1FNX H;  4J9L A;  4UF4 A;  2DR9 A;  5C25 A;  5DO2 A;  2M5Y A;  3LPY A;  4USK A;  4ZJO A;  4FPI A;  3Q2S C;  3ENV A;  1X4E A;  1JX4 A;  3GWC A;  3I31 A;  3AY0 A;  1VQ7 S;  1KC8 T;  1FKO B;  4RBU A;  4DR4 F;  1YHQ S;  5SUH A;  3TWZ A;  5CAB A;  1NH7 A;  3AJ1 A;  4XDC A;  2LYV A;  4LF4 F;  4DHV A;  5IT0 A;  2BJ1 A;  1NU4 A;  4K4Y A;  5HQM A;  4DUZ J;  4KGZ B;  1FRK A;  1YBU A;  3UDV A;  2P9G A;  2RQC A;  3BSN A;  1J5E J;  1WCM A;  1TKX A;  2YX4 A;  1JLF B;  5M5X K;  4OI3 A;  3T1H J;  2C2E A;  3PIP Q;  2BYC A;  1F7U A;  2YNI B;  2DNQ A;  4GRS A;  1F7V A;  3MM6 B;  5KFB A;  1FXR A;  1WG4 A;  2GGP A;  2CQH A;  1TWG K;  2GC8 A;  2MGZ B;  5GAG U;  2GMH A;  3PM9 A;  2E2H A;  3B78 A;  4H4O B;  3TQE A;  1T8E A;  1DAX A;  1JQG A;  4DFK A;  1SUQ A;  3GTJ K;  4DUY F;  4ZCL A;  2P8I A;  3GFY A;  2QLF B;  3T01 A;  3UWT A;  2FQT A;  5HRO B;  2G2Y A;  2E7V A;  3DRR A;  3HZE A;  3T41 A;  4TXS A;  5HI7 A;  1VQO S;  4DV2 J;  1DLO A;  4ZP9 A;  2VIC A;  2F5G A;  4AQY F;  1TZ0 A;  2UUB F;  4FDF A;  2YY3 A;  3S15 K;  1HHS A;  2X51 A;  2V6U A;  4P7T A;  4QQB A;  3KJF B;  2FY8 A;  4NLG A;  2F40 A;  2E5J A;  1MWQ A;  1HYS B;  1M90 T;  1AYE A;  4KGK A;  1T95 A;  1YCL A;  1RTI B;  2B4O A;  3NBP B;  3MTK A;  3UN5 A;  5HO4 A;  1ZZF A;  2GHV C;  3TVY A;  3W5Z A;  2AP6 A;  3JS9 A;  2DGS A;  1F2H A;  2L3M A;  2XSJ B;  3HHL D;  4FYY B;  1X0F A;  5KFV A;  2JLE A;  2ZBI A;  4QJV B;  5F8I A;  1T05 A;  1Q78 A;  3UN2 A;  2JA5 K;  1X60 A;  2HIY A;  1F93 A;  2GHW A;  2IHR 1;  2JDJ A;  4ECR A;  2R7Q A;  3TAR A;  1NK7 A;  1RAA B;  5KAK A;  1S0O A;  1I51 B;  2Z4P A;  1X9S A;  3ILO A;  3F0N A;  3A8K A;  3CCJ S;  2DO0 A;  5DLF A;  4A3I K;  1S6Q A;  4EZ9 A;  1K44 A;  5U47 A;  2G13 A;  3OVA A;  4C6A A;  1NSK L;  5KFY A;  4H4M A;  3UCZ P;  2OI2 A;  3G6X A;  3F73 A;  4JI1 J;  1WF1 A;  1B4B A;  2VAS A;  2G9O A;  4UQT A;  4WTY A;  4CYU A;  1RWX B;  3VAJ A;  4BWJ A;  5D3G B;  4Y52 C;  1ROF A;  4ZP6 A;  1SQG A;  4NRT A;  5K8O A;  1IBL J;  5C42 B;  1J6W A;  1N54 B;  2YKN B;  3TA1 A;  3TA2 A;  1CJU A;  1PAU B;  3K5P A;  4RUC A;  1KQG B;  1IR0 A;  1VDH A;  3KNG A;  1TVR B;  1TKT B;  4WK3 A;  2CJQ A;  3HSD A;  5IWA J;  4ECX A;  1XZQ B;  5FLX Y;  1PGZ A;  2KRR A;  2V9K A;  1Q5V A;  4EBC A;  1VHF A;  3MCS A;  3R6G B;  3GLJ A;  5T7L B;  4YFU A;  4MT1 A;  1HBM B;  4CH1 A;  1W2B R;  1BQM A;  4WII A;  1TMJ A;  2RSQ A;  2LKZ A;  3IGN A;  3A13 A;  1FJE B;  1FO1 A;  2HHX A;  2D7S A;  1U2C A;  1N33 J;  1EP4 A;  2VDH A;  4WJ4 A;  2DNH A;  4FNH A;  4L3N A;  3ZNU A;  4ZJL A;  4M5D B;  1Z1Z A;  4JOU A;  1B7F A;  4NLW A;  3H4D A;  3WHI A;  1N33 F;  2BAN A;  2C3U A;  4A8S A;  3T5L A;  2QIF A;  3W9J A;  4HVZ A;  4JI0 F;  4PZV A;  4X65 F;  2GVZ A;  2VQF F;  3ILL A;  2PA3 A;  5HBM B;  2NVX C;  1HA1 A;  3I5C A;  4M5J A;  4Z37 A;  2HHP A;  3G86 A;  4JV5 J;  5IP7 K;  2IM2 A;  1GX5 A;  3A8I A;  2EI5 A;  2WB1 L;  2DB1 A;  4HKQ A;  3SV3 A;  1U09 A;  1BS2 A;  1M5V C;  3FQL A;  4ZLN A;  2XWX A;  4BHQ A;  4NI2 A;  3QNW B;  4Y65 A;  4KPY A;  2FJA B;  4FXV A;  2CRL A;  1JJ4 A;  3GSD A;  5GMK a;  2EBB A;  4DR3 J;  2O5D A;  3FKI K;  4GTD A;  1FVS A;  3VAM A;  4KO0 B;  3U02 A;  3PX6 A;  3JYT B;  1JIH A;  2E2I A;  5ETQ A;  3NNA A;  3VZH A;  4U8Y A;  1Q53 A;  1B70 B;  4A93 K;  3QPI A;  4J9P A;  5LT5 A;  1I50 A;  3FFI A;  3C66 A;  4YR2 A;  3D2W A;  3K0J A;  3G6Y A;  2E2J C;  2QZ8 A;  3CGI A;  3Q8R B;  3R5C A;  2VC1 A;  1CLF A;  3LAN A;  3BRE A;  1LWC B;  1OQ3 A;  3G6E S;  5A6W A;  2R7Z K;  3GTP A;  3T5J A;  2GHP A;  5KFN A;  2CQ3 A;  1UCN A;  2HGL A;  1AW0 A;  3D1Q A;  5E3P A;  3HOZ K;  1SI9 A;  1SC3 B;  2CZ9 A;  4A3E K;  3EYZ A;  2I2Y A;  1NPK A;  1VRT B;  1HFE L;  5IV4 A;  4YY3 F;  2KWA A;  3CCT A;  1TKZ B;  3V81 A;  4YOE A;  4J7C A;  3OTE A;  1WHW A;  4CQ1 A;  2DPI A;  1KD1 T;  1X8D A;  3EQL A;  4ANE A;  1NND A;  3T9Z A;  2E5G A;  2CJA A;  1RTH B;  2XQC A;  3AH6 A;  5G0R A;  5A8K A;  4JI2 J;  5L9N A;  4ICL A;  3DN9 A;  4BBR K;  2BZ2 A;  1KNZ A;  2MZ1 A;  4WXW A;  4LSN B;  4DR5 F;  2E29 A;  4Y2C A;  4DUT A;  4A3M K;  2LFV A;  4DX8 H;  1SH2 A;  4BY1 C;  3RZO K;  4YS2 A;  2CQ1 A;  4DPW A;  2C2D A;  3B8H A;  4F0K A;  2VOD A;  2ZOF A;  4RBV A;  4F67 A;  3H4B A;  1EAY C;  3QRQ A;  1XTZ A;  3J7A N;  3DXB A;  1RE1 B;  1KTQ A;  1Y5N B;  2H48 B;  2BMB A;  3BF4 A;  4KM9 A;  1FWL A;  1WHV A;  1MWY A;  1AUS L;  2FQO A;  2AYG A;  1S7I A;  1FDB A;  3IBF B;  3IPJ A;  2VFS A;  3D4J A;  4QU7 A;  2HRT A;  2NXE A;  3Q86 A;  1WOP A;  3FKI C;  4KV8 A;  3G8S A;  2O01 C;  2BE2 A;  4EMD A;  2O3D A;  3H8Y A;  3L4J A;  4C9D A;  2A1B A;  3RB0 A;  4QYZ K;  4OLO A;  2HHU A;  3QGG A;  1I6H K;  1RT5 B;  3KG1 A;  4OYA A;  1KLM A;  2ZUA A;  2ZJR Q;  3UI3 A;  1RA6 A;  2Y3Y A;  4BBY A;  1GEH A;  3BH6 B;  2GV1 A;  2OJ3 A;  4GZY A;  1SMY A;  1XR7 A;  3FOF A;  1HWK A;  3NGS A;  1TV6 B;  3N9U C;  1T9X A;  2XZD B;  5HLF A;  1UWB B;  1VIX A;  1GAO A;  1M1K T;  2JLG A;  4X4R A;  3T3F A;  2XYG B;  4DV1 J;  4LUB A;  4I2Q B;  3QT6 A;  2NYI A;  4E2F B;  2G0C A;  4BXX C;  1HBU A;  2NUU G;  3FCH A;  6FD1 A;  2WB1 D;  3GB0 A;  4U95 A;  1X7V A;  5GAH I;  2E5I A;  4ZJQ A;  1GNK A;  3S14 K;  2AJ2 A;  2MSS A;  3VAF A;  3RRG A;  3HKW A;  3QT7 A;  3RRH A;  3SZZ A;  2QLB B;  4LFB F;  2P6S A;  3GIK A;  5IOS A;  2CPJ A;  2HNY A;  5CYQ A;  3BQ2 A;  3OPK A;  1UEU A;  1K83 A;  4ZPT R;  3CME S;  4O0N A;  1IBM J;  1RAF B;  1VQP S;  2GSN A;  2QV6 A;  3G2X A;  4I4B A;  4KM8 A;  1G6B A;  4OHY A;  2OPS B;  4PQA A;  3FMW A;  4DN9 A;  1RWU A;  1TL3 B;  3FZB A;  5BYS A;  2NXC A;  2ZUG A;  2E1A A;  4Y34 A;  4RW9 A;  3ZO7 A;  4C3J C;  4O0I A;  1I3Q A;  4UOG A;  4AFF A;  2JLF A;  1X4B A;  1U47 A;  3BQ1 A;  4BC7 A;  2PPB A;  1JLG A;  3MFH A;  4F0M A;  2JFD A;  4CO1 A;  3PRB A;  4TQS A;  3M1V B;  2GS8 A;  3KK1 B;  1X4A A;  2B9E A;  5KG3 A;  3GV7 B;  4M5L A;  4CTA A;  3DLL Q;  3MMC B;  4LF5 J;  2IRY A;  1XK8 A;  4ID8 A;  3VA7 A;  3M2U A;  3GTM K;  2KZZ A;  4X4S A;  1S79 A;  1S9G A;  1CJT A;  3CED A;  1TWC A;  1R0A A;  5HMZ A;  4FNI A;  1FFG B;  2MQP A;  3PHT A;  1RTD A;  3DDK A;  3DU6 A;  4F3Q A;  3ZTS A;  2J5A A;  2DY9 A;  3HT3 A;  4Y0F A;  2BJ3 A;  2VF3 A;  3QX3 A;  1DTQ A;  3A4T A;  3BPS P;  4RU9 A;  3PR4 A;  2XWY A;  3UNG C;  1PYT A;  2BE9 B;  4ANC A;  3DRP A;  3MCM A;  4BS2 A;  1XQI A;  1VBY A;  4WP8 A;  4YUD A;  1RBL A;  2LEB A;  3ONQ A;  4P2F A;  4IYQ A;  2XGP A;  3VAI A;  3IM8 A;  1WTF A;  2E9T A;  4NXN F;  4LRA A;  4QU6 A;  1R31 A;  1RT6 B;  1HQU B;  2UUT A;  5JVG Q;  2OTL S;  4DLE A;  1X4G A;  3BGR B;  2R2T A;  2ROP A;  1IKX B;  3J7Y I;  2CNK B;  2XMU A;  2JA8 K;  4JI8 J;  4ECV A;  1NSA A;  1IM6 A;  3N0V A;  1VQY A;  1YNN A;  4IUF A;  4OI2 A;  4KH0 B;  3ZFV A;  3M4O K;  5HRO A;  2FLO A;  4ALZ A;  1CS4 B;  4JI1 F;  2RRN A;  4TKT A;  2BOP A;  1NJZ A;  1O0P A;  3UD5 A;  3EMT A;  1TU0 B;  3OL6 A;  3MAQ A;  2HSE B;  4UZC A;  1RAO A;  3LH2 S;  2V8V A;  1HQE A;  1QTM A;  1S9E A;  4CNY A;  2V4J A;  1HWJ A;  3VTI A;  5J2P A;  3T1A A;  4H54 A;  1HR0 F;  2J7U A;  1VQM S;  3KTQ A;  1FRM A;  2CZV C;  7AT1 B;  4OYW A;  2HHH F;  1S4E A;  2E2H K;  3U1N A;  4RUH A;  4OYB A;  4XDD A;  1LWF B;  1TK5 A;  1H6K X;  1O26 A;  4UY8 5;  2QG9 B;  3CCR S;  1RT3 B;  4ZPB A;  2E2H C;  4LQ3 A;  5JJB A;  3GR1 A;  3LAP A;  2FVS A;  3TZW A;  2FHK A;  1XZP A;  2CA9 A;  4AL7 A;  3UR0 A;  3A8J A;  2DNL A;  4MTP A;  1JK9 B;  1YSJ A;  4URS A;  1K0V A;  3NY0 A;  3D0G E;  5HK4 A;  4DL5 A;  3VCD A;  3HUL A;  1YQH A;  2CIM A;  5FJ8 K;  4C45 A;  1XER A;  4NLP A;  4WFZ A;  3WZ0 A;  3EPG A;  3MR6 A;  5LMN F;  3GYN A;  2CJY B;  4RW6 A;  3M8Q B;  2ZFH A;  1CG2 A;  3GP9 A;  1PC4 A;  1F1B B;  5KT4 A;  2ZH9 A;  2QRR A;  2DHS A;  1O8B A;  1CQM A;  2V2V A;  3KDN A;  5DDR C;  1NAQ A;  4OL8 A;  1CSJ A;  2YXL A;  4F36 A;  4K50 A;  3RJM B;  4XAK A;  1HNW F;  1TAQ A;  1JMT A;  1VCT A;  1VRQ C;  3RZD K;  4NLD A;  3CJ8 A;  1LW0 A;  3SIP B;  2M8D B;  1X4D A;  4UQG A;  5KFR A;  1JLB A;  2FGO A;  5F8M A;  3C2P A;  5KFA A;  4LF4 J;  4L74 A;  3PYG A;  4ECT A;  3DXJ A;  2RML A;  1UVM A;  2XY6 A;  3E2E A;  2HWI A;  2VH7 A;  5E33 A;  2WVE A;  5D4D A;  5K20 B;  3OFE A;  5LSO A;  3AOB A;  3ISZ A;  2R8G A;  3J81 j;  1OYD A;  2QLJ B;  2HQI A;  3CD0 A;  3WOD A;  1YZ6 A;  2XSF A;  3QWU A;  4HHJ A;  1APS A;  4DL3 A;  2YKM A;  2R92 C;  2G2Z A;  1GFW B;  2ZKT A;  1UV7 A;  1FF2 A;  3IMQ J;  2YKP A;  3GIR A;  4ECQ A;  3W66 A;  4OJH A;  2A6O A;  2FJW A;  4OZ1 A;  5LL6 d;  3CMQ A;  1KON A;  1X5P A;  3G8Q A;  5DZ7 A;  2KFY A;  2ACM A;  4OYZ A;  3MCN A;  2KT5 A;  4TNO A;  2HVE A;  3CT9 A;  4PAA A;  3QZ8 A;  3MD1 A;  3GYG A;  5DQG A;  2HVI A;  3AD9 C;  5ETR A;  3ENQ A;  4ELT A;  4C8M A;  2FLL A;  3KLG A;  4C4W A;  2G2O A;  3CD5 A;  4Q2L A;  2CPF A;  3Q2T C;  3RRK A;  3I4N C;  1NDL A;  4LF7 J;  1WDT A;  2XEX A;  2DHH A;  1HNI B;  5B0G A;  4UOC A;  2FC9 A;  4DSI A;  1PSD A;  2H4Y B;  1VBK A;  1T9V A;  1UW9 A;  1T9U A;  1YRX A;  4LRB A;  1CUL A;  1RAI B;  1RHK B;  3GTO A;  3OXL A;  4F04 B;  2VKR A;  3CJR A;  1JJ2 R;  5C7P A;  1FRX A;  4FF1 A;  1RWW B;  4DV4 F;  3JSM B;  4XCH A;  1KWM A;  3MTJ A;  3BGF A;  1C4A A;  2IDE A;  1KVI A;  1F9E B;  4F4Y A;  5M5W K;  4DU8 A;  3LW5 C;  3AQO A;  3QJP A;  3OR1 B;  2P5V A;  2KYZ A;  2NYH A;  1WC0 A;  1SQE A;  4KMH A;  3GJR B;  2JEI A;  3ZZZ A;  5F41 A;  4QIG A;  2B9Y A;  4WK1 A;  2QSW A;  3S1T A;  4DS5 A;  1N56 A;  3I82 A;  4BBS C;  4ED3 A;  3NGD A;  2HHQ A;  3MEG B;  2KB2 A;  4IO9 Q;  4F25 A;  4WZQ A;  3HHD A;  2HHS A;  4ZKA A;  2ZE2 B;  1KOO A;  2VOO A;  3S1M C;  2W7A A;  2HFZ A;  3MM9 A;  3PHE A;  1PO6 A;  2VBX A;  2BV3 A;  2YPY A;  1R6V A;  3TX0 A;  1X4H A;  2DIT A;  1IBC B;  4YFK A;  2J0W A;  1FK9 B;  4IDK A;  2AEF A;  1NJY A;  1UEK A;  1J5E F;  3RB6 A;  1KQS R;  2R7S A;  2KL8 A;  4I7F A;  4DX6 A;  3DFE A;  4C0B A;  3TUP A;  1CEZ A;  4X6A C;  4FBT A;  4IOC Q;  5E68 A;  4WF9 Q;  4KHP J;  3I4P A;  3EM1 A;  4U9R A;  3MMA B;  2F3J A;  5DLG A;  5MLC V;  5C44 K;  2CJX B;  4CLU A;  3F44 A;  1PYS B;  1SQF A;  5D15 A;  1WG1 A;  1U6F A;  3GMG A;  2YNF B;  1XBW A;  1ITP A;  3IR7 B;  2MZQ A;  4MFB A;  2WW8 A;  3J81 Y;  4DCP B;  1WC4 A;  1O2F B;  4X4Q A;  2Z2M A;  1RHM B;  1UAW A;  2POK A;  2A6H A;  2FZK B;  2QGF B;  3CCQ S;  5IZH A;  1RBA A;  2DH7 A;  3R2D J;  5DQI A;  4EBE A;  4Q45 A;  3TJ8 A;  3IWL A;  2AZ1 A;  1WD6 A;  1UVN A;  3M6V A;  4DQI A;  1U49 A;  3KOA A;  4A3L C;  3HXA A;  2IYI A;  3LTO A;  3HP6 A;  4K59 A;  1L5U A;  1VS3 A;  1ZET A;  1RKJ A;  4ZVH A;  3NGK A;  3OXF A;  1UPM B;  2IAJ B;  2OKQ A;  1PKU A;  1OY9 A;  3CTR A;  3HMJ G;  3J7A 1;  3CCM S;  2QA4 S;  2LA6 A;  2ILY A;  5HQL A;  2F8H A;  1RKI A;  2PE8 A;  1TWF K;  2MZR A;  4BY7 C;  2F1F A;  3PRD A;  4OFZ A;  4N77 A;  4R8U B;  1Q4R A;  1TUG B;  1NZ8 A;  2W9B B;  1S9F A;  2NCK L;  4JBC A;  3M2R B;  2DHX A;  5AT1 B;  1YRU A;  3K7A K;  3BO3 A;  1IJF B;  1LQ9 A;  1FE4 A;  5H9F J;  2UVU A;  3PO3 K;  3PEH A;  1JLQ B;  3BS9 A;  5IQQ A;  2RRA A;  1U45 A;  1XXA A;  3DLE B;  3EDR B;  7FDR A;  1RHR B;  5A76 A;  1LW2 A;  1FFS B;  5K8M A;  2RD5 C;  2Q3P A;  3PW2 A;  1IVZ A;  1S12 A;  5ETN A;  3QAU A;  2HND B;  4RL1 A;  4ZPW R;  3I5A A;  2FHJ A;  5A8W A;  3SCI E;  4X4V A;  1O28 A;  3PG9 A;  4EK2 A;  4AND A;  4NA3 A;  2Z0G A;  2AJF E;  4LRC A;  3TP2 A;  4TY8 B;  1BMQ B;  4EU0 A;  1MWZ A;  1H73 A;  3JAM U;  3HSG A;  4ZVE A;  2MTL A;  5D77 A;  3CQZ A;  2MYF A;  2GA7 A;  3FKB A;  3BH7 B;  1C0A A;  1R6Y A;  4ECY A;  4ZVO B;  4RW9 B;  4H4K C;  4W92 B;  2GVD A;  4WU2 A;  1IBA A;  4XSZ A;  1HBO B;  4X4N A;  3AH5 A;  1SV5 B;  1TK0 A;  3C19 A;  1DQ9 A;  1VC0 A;  4LMZ A;  2ERR A;  4BXX K;  4Z7Y A;  2LU2 A;  4O3S A;  1S6Q B;  1WQG A;  3HX9 A;  5GAE I;  1FI4 A;  3LF0 A;  3ET6 A;  1EB0 A;  5I3U A;  3TVZ A;  3CJQ A;  1MN7 A;  4IOA Q;  1KN6 A;  1IKW A;  3M8Z A;  4X84 A;  5JFE A;  3BQ0 A;  4WU3 A;  3O2I A;  5AJ3 F;  1UA1 A;  4M5K A;  1F3F A;  4GKJ F;  5KFG A;  1R0C B;  1R0A B;  1ZAV A;  3T6B A;  2V63 A;  3CC2 S;  3SCL E;  4PR6 A;  2XMA A;  1FEH A;  3FDS A;  1VQ9 S;  4JI4 F;  2JA7 K;  1XXC A;  1Y1W K;  2JEG A;  2NS1 B;  1GQE A;  1QE1 B;  5DJB A;  4KYZ A;  2RH3 A;  3DI6 B;  1N0V C;  5LJ3 Y;  4USI A;  3GV8 B;  4M94 A;  2GO9 A;  3RYL A;  2OD4 A;  3I9V 9;  3Q89 A;  4YFX A;  3RB3 A;  4Q43 A;  2MY8 A;  2DGX A;  1GT8 A;  2MJN A;  4HTI A;  1U1K A;  2K7K A;  2WON A;  1PIL A;  5GAE U;  4QWC A;  4L3K A;  1MU2 A;  4C11 B;  8ATC B;  3W9I A;  3RB4 A;  4TY9 A;  3RZO C;  1YWX A;  5HBM A;  3HSJ A;  4PYD A;  1IKX A;  3BBC A;  3CCS S;  1NDK A;  1RYR A;  2X1G A;  4KDD A;  3OFF A;  4C2M A;  1KKH A;  4OJ1 A;  2DXF A;  1BHN A;  2P9C A;  3FNN A;  4FYV B;  1DTT B;  4ECW A;  4BY7 K;  1GTE A;  3G4A A;  2M7S A;  4OX8 A;  1Y11 A;  2HHT A;  3MED B;  1PJ5 A;  3J80 U;  3WC2 A;  4DPY A;  3M6U A;  3KLF B;  2M4M A;  4RBT A;  3CPW R;  2YKO A;  1HQE B;  3IAM 9;  4DV4 J;  4B3O A;  5LM7 E;  2WW4 A;  1E6V A;  3LAK A;  5J2P B;  1UWA A;  1CC8 A;  2EKN A;  3CJ4 A;  2Q66 A;  3ENW A;  2APO A;  4JI0 J;  3MM6 A;  4DX7 A;  5BJR A;  4LRF A;  4A8F A;  3FEY B;  2ZH8 A;  3BBB A;  1IKY A;  2IA0 A;  2CAD A;  2VDI A;  2Y1R I;  5T14 A;  4B3R J;  3RU0 A;  3JYT A;  1TWH C;  2PDA A;  1XEZ A;  5C24 A;  1RT1 B;  3F56 A;  3ELH A;  2WSC C;  4YDX A;  3A3O B;  4A93 C;  3HPO A;  3F41 A;  2HQC A;  5CCM A;  2LEA A;  4MK8 A;  4C7Q A;  2MLX A;  5HMW A;  4OIR A;  2NVY A;  2GAG C;  4YB7 A;  4CO4 A;  4F8R A;  1W7W A;  3KUG A;  3S1M K;  4QZV B;  2R8I A;  5ETV A;  5F8H A;  2DRB A;  5ETS A;  1CC7 A;  4CLY A;  2W9A A;  3NS5 A;  1LV5 A;  1Y7P A;  1N32 F;  2XI3 A;  3M8S A;  4FF3 A;  4J9S A;  2JFK A;  4DL0 C;  4C3H C;  1VI7 A;  5F9N A;  3TZY A;  3FBB A;  2WTF A;  4A3G K;  4GKJ J;  3THT A;  2AEJ A;  1JJH A;  3BO2 A;  1TKZ A;  4HR2 A;  1VC5 A;  4OIO A;  3KXD A;  1WKL A;  2D1C A;  5M3M K;  2KKH A;  3W9H A;  4DSJ A;  5KFW A;  4RLE A;  5K8P A;  1U24 A;  3BN7 A;  3M8R A;  4YR0 A;  2NVQ C;  2HQG A;  1UJ4 A;  1N8R T;  1YJR A;  2X3D A;  2IY5 B;  2ZH5 A;  5C44 C;  3ZZP A;  3QSI A;  3KHL A;  3DOM B;  1S10 A;  3OXG A;  3PFE A;  5F8G A;  4FS1 A;  4CDI A;  2BJ7 A;  2HRY A;  1BGX T;  3B4M A;  3BB5 A;  4ENO A;  2FJD B;  4YY3 J;  2EFN A;  1YJ7 A;  3M9M B;  9ATC B;  2CJ9 A;  2J6T A;  1DCH A;  4K2X A;  3GTL C;  2DVI A;  1B4S A;  2DH9 A;  5AJ3 J;  1MW7 A;  3BM7 A;  2HG4 A;  1B7Y B;  2HNZ B;  1H74 A;  1YGY A;  1MRO A;  3H25 A;  5LJ5 Y;  2CZ4 A;  4DLG A;  4H4M B;  2JC0 A;  2YNI A;  2ALY B;  4G7H A;  4A3L K;  1F60 B;  4JV5 F;  4HTJ A;  2OSR A;  4IRC A;  2HHH J;  1C2P A;  3IA0 A;  2M9K A;  4EBD A;  1U1M A;  3C14 A;  1R8B A;  3NAI A;  3B54 A;  1K83 K;  4FYW B;  2ZJQ Q;  2DR7 A;  4FF4 A;  1HMV B;  2IIH A;  1TWH K;  4M1X A;  4F2S A;  3WC0 A;  1TWC K;  2EFG A;  3HXM A;  2XS7 A;  1HW8 A;  2BW2 A;  3VR1 A;  3UW1 A;  4PXB A;  5KFJ A;  4DDF A;  1ZYR A;  1U25 A;  2QMU B;  5D0E A;  4DQQ A;  4ELU A;  2QSF A;  3D67 A;  2JC1 A;  5KG7 A;  2UXC J;  5KTQ A;  2H9Z A;  4GT9 A;  4PWU A;  3A3P B;  1S77 D;  3P8B B;  4NA2 A;  1V3R A;  2JA5 A;  1I50 K;  3PKY A;  1XNR F;  4UUX A;  4A4J A;  4Y7N K;  3PO5 A;  2W4C A;  1HKA A;  1T11 A;  4NOH A;  3BN4 A;  3BBF A;  4PCQ A;  4QW8 A;  2VFV A;  3R7B B;  4XPE A;  2IBO A;  3MZI A;  1IUJ A;  2CPX A;  1NB7 A;  4OHW A;  3C6U A;  1N5Y A;  3LGM A;  4A8W A;  1OMS A;  1Q8I A;  3HOU C;  2FJV A;  1F5A A;  3LPE A;  4L73 A;  4JI6 F;  1OWX A;  1T05 B;  2CPH A;  1TL7 B;  1NXI A;  1R9T K;  3T19 A;  2OSQ A;  5I3Q A;  2HS0 A;  1VQL S;  4IFV A;  3T1Y J;  2X7I A;  3J7Z T;  5CYM B;  2JL9 A;  1T94 A;  1K83 C;  1H3D A;  4P71 A;  3TJA A;  4UOH A;  3S1N K;  3KK1 A;  1R8C A;  2HBZ B;  3LUY A;  3O44 A;  3GYX B;  3E01 B;  3LO3 A;  2I8E A;  2EC2 A;  1GE9 A;  2ZH7 A;  1RTJ A;  4OZN A;  2RS8 A;  2ROE A;  2OFG X;  2EFV A;  4P72 A;  4BLB A;  1TWH A;  5D3G A;  5F8J A;  1RT2 B;  3EUN A;  1S1W A;  2BKP A;  1RHJ B;  3M9O B;  5IV3 A;  1TQL A;  3UCG A;  3OUY A;  1ZA2 B;  3BGO P;  2ACY A;  5J1N A;  5B0C A;  4CI0 B;  5IYC C;  3IG1 A;  4XIU A;  2GJF A;  2W2M P;  1WC5 A;  2CG4 A;  3GV5 B;  2NVT C;  2KHC A;  1ZZN A;  3M2U B;  3S2H K;  2D69 A;  5J1E A;  3H5S A;  2DXE A;  2PD1 A;  1CJT B;  2V5H G;  2YPZ A;  4C8N A;  3SQG B;  4I0W A;  2PMZ L;  5CJ9 A;  1D8Y A;  5D8H B;  1GXL A;  1I94 F;  2MKY A;  4KKO B;  2R9L A;  3S2H C;  4DUY J;  1D0E A;  3ILJ A;  3R1L A;  3MR7 A;  1RWK B;  3EX7 B;  1N5S A;  1KP6 A;  2AMC B;  3R5A A;  3JTO A;  2DXD A;  4RW8 A;  2PFF B;  4W90 B;  1DTQ B;  1TR0 A;  4RPF A;  2OFH X;  3BEG B;  2WRM A;  1S76 D;  1VRT A;  1UP1 A;  4K4W A;  1CVJ A;  1H2V Z;  4A3E C;  4DN0 A;  4LBI A;  4OV6 A;  2DR8 A;  4OX6 A;  1OSC A;  1L0W A;  4KRW A;  4PAB A;  2ADB A;  3GEI A;  4M5D A;  1TTH B;  4HT7 A;  3OQ2 A;  2W25 A;  5G0R B;  2L08 A;  2PO4 A;  4DG1 B;  4PPD A;  1TP7 A;  4BWM A;  2IRU A;  3ZNJ 1;  4X64 F;  4BDP A;  1ARO P;  4BBR C;  4DR4 J;  2FYX A;  5HAN A;  1REV A;  2RKI B;  4QIE A;  2L41 A;  5C25 B;  3DKD A;  2DJW A;  2DEJ A;  4DV0 F;  3EZO A;  3CUN A;  4A47 A;  3QLH B;  3BPD A;  4LVO P;  5K14 B;  5C4X C;  2W2O P;  3CJT A;  2DPJ A;  5IC6 B;  4ED5 A;  3HM9 A;  5EGY A;  3HFV A;  3GJS B;  3UCU P;  2V69 A;  4LF1 A;  1FA0 A;  4LR9 A;  2XNR A;  3TJ9 A;  3EVM A;  4LF9 J;  2AGQ A;  4LLG A;  1L3U A;  1WDD A;  3NLC A;  1OIA A;  4ZA1 A;  2R7R A;  3W63 A;  2V94 A;  3AFG A;  1SJ3 P;  3D6F B;  1SUQ B;  5IFM A;  3QZ7 A;  1RT7 B;  4USU A;  4OYM A;  3TEG A;  1N52 B;  5M2U A;  4U7U K;  4MKA A;  2J76 E;  4I6W A;  1PBA A;  2I38 A;  1NSQ A;  3SFU A;  1FCA A;  1VJW A;  3TFJ A;  5A8W B;  2IM3 A;  2UP1 A;  1SFO K;  4B3T F;  2FZC B;  2RU3 A;  1R0B G;  1Y5L B;  4DPU A;  1B4A A;  3NG8 A;  4G3I A;  2XCR B;  4Q5S A;  2BM0 A;  2HWT A;  2Z8Q A;  3FMB A;  3PW7 A;  2J6U A;  4JI3 F;  3DRR B;  2DNR A;  4B17 A;  4HEA 9;  3MWB A;  2HZV A;  1EJ7 L;  2GQQ A;  5KFI A;  4K8R A;  4BC9 A;  1RAB B;  4F4A A;  1KS2 A;  2HEK A;  4CLT A;  2V4Q A;  4HI1 A;  2HBY B;  4M5M A;  1I1G A;  4G0W A;  2LDY A;  3HOU K;  1RTI A;  3C6T B;  4ED1 A;  2OEK A;  3FBC A;  3IAS 9;  4ZK7 M;  2AYM A;  2JA6 K;  2IPO B;  3PW4 A;  1NCL A;  1LW0 B;  2BEF A;  2D41 A;  2GAH C;  5I3U B;  2XSJ A;  4OHX A;  4NLO A;  1X5T A;  1EET B;  1OPI A;  1U1L A;  3HHN B;  4DFJ A;  4ZOS A;  4Q4Z A;  2V8H A;  3T02 A;  2XI2 A;  2J0Q D;  3TX8 A;  5BR8 F;  4OZ0 A;  1VQ8 S;  5IYC K;  4HHH A;  3CQZ C;  1FDN A;  4C3J K;  4DZ6 A;  4WFY A;  4DSF A;  2B6A A;  4TYA A;  2D9O A;  2JA7 C;  3PVX A;  4TU8 A;  1G3O A;  1LWE B;  4I1T A;  5JMN A;  2NRE A;  2DT9 A;  1AB8 A;  1SC4 B;  2B0G A;  5D4P A;  1C1B A;  4CT8 A;  4CYU B;  3RAX A;  3UD4 P;  4E0D A;  4KB4 A;  4RNF A;  4QWE A;  1N36 F;  1I6H C;  3W60 A;  2B9X A;  3TTG A;  3MUV P;  3SI8 A;  2YVS A;  3MCO A;  3MMJ A;  3KLG B;  2J6S A;  3TNV A;  5G4D A;  2F65 A;  1JLC A;  3DXS X;  1DY3 A;  4A3B K;  3H0G K;  4USH A;  1RHQ B;  3DHX A;  4EGL A;  1RTD B;  3UE2 A;  1RAG B;  3CE8 A;  2J9D E;  1RBO B;  2MZT A;  4WTO B;  2R7T A;  5KFQ A;  2AQ4 A;  2DIU A;  2HGM A;  1VBX A;  2CQ2 A;  2VZ9 A;  4K4U A;  4ATN A;  1RT4 B;  4A46 A;  1JNR B;  1WOO A;  3C46 A;  2Y9H A;  1TFY A;  1F9N A;  4R25 A;  3K8W A;  2R2R A;  4TVA B;  2XNQ A;  4OZL A;  4J91 A;  4B3O B;  4GTF A;  5E3A A;  2NVQ K;  1Y3K A;  2W4D A;  2QC3 A;  2BAN B;  2ZH4 A;  1HR0 J;  1HQU A;  4ZN3 A;  2UXB F;  1T03 A;  1U6Z A;  3GG1 A;  3IC1 A;  5HL7 Q;  5DQH A;  2YKA A;  1K8A T;  3OBI A;  3S8S A;  1ZPV A;  3CCW A;  4MEY A;  1MLA A;  2AJ0 A;  3DYA A;  5C24 B;  4GVB A;  4ZVQ B;  2N3O A;  1S0N A;  4B3R F;  3GR0 A;  2MQO A;  4MKY A;  2BW7 A;  3C15 A;  3HOX K;  1LWX A;  4R5P A;  4DFM A;  1YX2 A;  2AEM A;  3PV8 A;  1ISE A;  2OPR A;  1CS4 A;  1M1G A;  3R6L B;  4U7C A;  1UW4 A;  1H72 C;  2ASY A;  3QGI A;  1U0H A;  1R27 B;  5AE1 A;  2J7K A;  4B9N A;  2YX7 A;  1UZH A;  3SZY A;  2MKJ A;  3GTQ K;  2VFU A;  3OVB A;  3CDE A;  2V4J B;  4N41 A;  1QUV A;  4ES3 A;  3S1R K;  3GJQ B;  2QA4 G;  1P9Y A;  1SC6 A;  2XLJ A;  2YNG B;  3K58 A;  1N32 J;  4CH0 S;  4NI2 B;  3BDP A;  1TL1 B;  4A3B C;  4NL5 A;  2IVF B;  2ZM6 J;  4DMZ A;  5IC4 B;  1VQK S;  4IG0 B;  3RBX A;  1IL2 A;  3OFG A;  4O3R A;  4DL6 A;  3UNY A;  5DM7 Q;  4F3O A;  3NWR A;  4N56 A;  1P1L A;  4LK0 A;  3D9B A;  1B0T A;  1S99 A;  3IS9 B;  5KFD A;  3GEE A;  4YN3 B;  3AOD A;  2BA9 A;  4DI6 A;  2OGU A;  3MMB A;  2Z57 B;  4KIA A;  3ETM A;  1U48 A;  4GKK J;  1DCP A;  3T5H A;  5BYR A;  1LWC A;  5EN1 A;  3OTO F;  4OHZ A;  4J9V A;  4NMX A;  2R8H A;  1S6U A;  2Y0S D;  2CQP A;  1JLA A;  2O66 A;  1MRO B;  3GTK A;  4DFP A;  2QMX A;  1RCX B;  1S6O A;  3HK2 A;  4USJ C;  1OYE A;  2ATL A;  1SB6 A;  4KPC A;  4Y3C A;  2FHO B;  3Q3Q A;  4ED8 A;  4G7O A;  4ILM A;  2CVI A;  2K8G A;  1BDF A;  2VG6 A;  2CFX A;  1YIJ S;  4DR1 F;  2B5J A;  3Q8U A;  4LJM A;  4CLW A;  4E8U A;  5KFU A;  5B08 A;  4DR1 J;  2D9P A;  1RWP B;  5E0O A;  1VJQ A;  2CDR B;  2LQJ A;  3NOC A;  1U02 A;  2G0J A;  2AIR B;  2XZW A;  2RIL A;  3S1Q C;  4KHM A;  4IQX A;  2KJW A;  3GTM A;  4L72 B;  1S0M A;  2NPI A;  1T9Y A;  3CMA S;  4NCG A;  1SL0 A;  8AT1 B;  1T7P A;  2OEM A;  4KT0 C;  1RLC L;  3H5Y A;  4R0E A;  2XCP A;  2ABY A;  3RBE A;  1NJI T;  5HVG A;  3BV8 A;  4JI7 F;  1AUD A;  4JI2 F;  2HVH A;  1K1S A;  1HI8 A;  4EEY A;  3GE9 A;  1N5Y B;  1PC5 A;  2V2Z A;  5KT2 A;  1RHU B;  5L38 A;  3U27 A;  1U1R A;  2UUC J;  1QD1 A;  3ILI A;  4USV A;  1BLU A;  2UUA J;  3BR8 A;  2UUB J;  4U6P A;  1NB2 A;  2R7Z C;  1OO0 B;  2W4P A;  3OL9 A;  4G6V B;  4N7T A;  3AB2 B;  2Y0B B;  4DV2 F;  1DLO B;  5CYM A;  2QO3 A;  4PWW A;  3IR5 B;  3V6J A;  5M3F K;  2BJ8 A;  2BQ3 A;  5HLF B;  1UWB A;  1BGW A;  1I6J A;  3GII A;  2VU5 A;  1S1U B;  2RF2 A;  4GO7 X;  2FD2 A;  3WX4 A;  3SDE B;  2LU1 A;  1AB4 A;  4LRD A;  1BY9 A;  4F0H A;  4JK1 A;  2OIH A;  2WHO A;  2W7P A;  4NXM J;  2KTQ A;  3G8T A;  5I3P A;  1BXN A;  2F8E X;  2GQC A;  1NK5 A;  3GTP C;  2XHW A;  4A3D C;  4RMF A;  5C5J A;  3NGU A;  3ZTO A;  3HHE A;  5T41 A;  3L09 A;  1WSV A;  4J9Q A;  2XYH B;  3IFE A;  2XY5 A;  4DR6 F;  2R2S A;  3PRV A;  1G2E A;  2MQL A;  1IKW B;  2OO4 A;  2R7O A;  2MQ8 A;  3GTK C;  3E3X A;  2HNY B;  5CYQ B;  2R7X A;  4EI2 A;  2V8G A;  4B02 A;  1GTH A;  3OV7 A;  3N0C A;  2QLW A;  3GPA A;  3MEC A;  5GAD U;  3BP3 A;  5HL8 A;  3DOL A;  5FLM K;  2QJ3 A;  2KH9 A;  4PG4 A;  4UZB A;  4TU7 A;  1IXK A;  2COL A;  3EVO A;  2P2C B;  3MPY A;  2N82 B;  2MKS A;  2E2I C;  2GZO A;  2VA3 A;  2UV8 G;  4X65 J;  3IRX A;  4IR9 A;  4PQU A;  4MJK A;  4WFA Q;  3GTJ C;  5I42 A;  1ZAW A;  3ITH B;  4I7F B;  2XBP A;  4M5G A;  1UTA A;  2A68 A;  4NOI A;  2RB7 A;  2BRL A;  1CJU B;  3Q24 A;  4A8Y A;  3H5X A;  5HAO A;  1FD8 A;  2DKO B;  4I56 A;  4RW4 B;  3B6B A;  4DL7 A;  2E9R X;  4CO3 A;  3J81 U;  4C8K A;  2Q6C A;  3GQC A;  1WOR A;  4DWI A;  4MFB B;  4JI8 F;  5CHC B;  3CJS A;  4RW7 B;  2ZBC A;  4WIL A;  1SJ1 A;  5FJ4 A;  2ZC3 A;  2WOM B;  3R5B A;  1S7H A;  4IFY B;  2ZHO A;  2NVX K;  1DTT A;  2MB0 B;  1UJ5 A;  5J2M B;  1F9H A;  2Y3P A;  1S59 A;  4J37 A;  3VWS A;  4KR0 B;  3K17 A;  3RUB L;  3NCR A;  2R3V A;  3BGR A;  3KHG A;  2LQ9 A;  1PYO B;  3JQK A;  5CHP A;  1QDU B;  4NML A;  2BJD A;  1P27 B;  3CIZ A;  4WZM A;  3W65 A;  4RR5 A;  1RWV B;  2CYY A;  2WSF C;  4Q0B A;  1JNZ B;  2JA8 C;  4J90 A;  1U1O A;  2DHG A;  4X66 F;  2VQF J;  2QN6 B;  2QX0 A;  3MFI A;  1HQ2 A;  1ICE B;  1XMQ J;  1H98 A;  5C3E C;  2DGU A;  3CJK A;  5LOQ A;  1S97 A;  1YJT A;  2ZC4 A;  5IOL A;  3M9N B;  3KJQ B;  4R8U A;  3QGH A;  1R9T A;  2VB6 A;  3KWM A;  2N4D A;  4A3C K;  5DG8 A;  4M63 A;  4Y2A A;  3W2W A;  3NWG A;  3H2L A;  1X4C A;  2HW3 A;  4ZVS B;  1DCO A;  5L46 A;  3Q8Q B;  4GTL A;  2GSU A;  2W2N P;  2QA1 A;  3M3Y K;  3C6T A;  2B7B B;  3H0G A;  1H2T Z;  4RUA A;  2LLZ A;  4F4K A;  4NXM F;  2P6T A;  1RT3 A;  1VC6 A;  2NZ4 A;  2E5L F;  1QVG R;  1RP5 A;  5IM0 B;  2PII A;  3GTO C;  2AZ3 A;  2HMI B;  5D0H A;  3TZZ A;  3MAH A;  3NMR A;  5ADZ A;  3HOY C;  2ILZ A;  1HBN B;  3TAP A;  4Z7C A;  1WEY A;  3DDN A;  4OJ3 A;  2VUG A;  4WFX A;  1OJ4 A;  3OTB A;  2R4F A;  3LQV A;  3M4O C;  3S2D K;  1KQF B;  2UUA F;  1JXE A;  1NDC A;  1IQZ A;  4LBH A;  4CLZ A;  3KLV A;  3KG4 A;  1FNO A;  1XR6 A;  3J7Z 5;  4OMF G;  1EQR A;  1Y0H A;  3MOZ A;  2Z58 B;  1YVF A;  3C14 B;  2ZBQ A;  2EW9 A;  5D4L A;  1YZ7 A;  1YJ9 S;  3VGS A;  1Q95 G;  3I4H X;  2ZIT A;  1RXO B;  3N6N A;  4F02 A;  5K8N A;  4FKX A;  3DRX A;  1X4F A;  4K4V A;  5J1P A;  3HOV K;  2DGV A;  4X4T A;  2R7W A;  3UDL A;  4O44 A;  4KE5 A;  5M5Y K;  4FVM A;  2C42 A;  2FJX A;  2XTJ P;  2CFA A;  4MKB A;  4TLQ A;  4C8Z A;  3GIL A;  2EG2 A;  3FRY A;  5CCL A;  4DUZ F;  4ED2 A;  2NR0 A;  3RAM A;  5A6P A;  5F9L A;  2V68 A;  4U7U D;  1V9O A;  1HLW A;  3PZP A;  1YKW A;  3O3L A;  2HWH A;  3BGL A;  3KNA A;  1IS1 A;  2M70 A;  4ZVU B;  1M5O C;  4RZR A;  2YKM B;  3A8E A;  5KT3 A;  6AT1 B;  5C2G A;  2E7W A;  5LSR A;  1QAX A;  5DDQ C;  2A69 A;  1MMN A;  3DOK B;  2P8T A;  2RU9 A;  2R92 K;  1JLQ A;  3T1Y F;  4B9M A;  2NXU A;  4B9V A;  4KN4 A;  5KOW A;  3I0R B;  1N34 F;  2DNZ A;  1EHW A;  1LW2 B;  4MK9 A;  3MD3 A;  2XY7 A;  3LA0 A;  2WAQ D;  4CLP A;  2YH1 A;  4B9S A;  4KQZ A;  3S16 K;  2YU9 A;  1W26 A;  3PEJ A;  1HNV A;  1UFL A;  3CC7 S;  1XR5 A;  3JQM A;  4Y2M A;  4JV0 A;  3KLE B;  4DL2 A;  2PHC B;  1GXU A;  4KAI A;  3RZD C;  1DFD A;  1FKP A;  1BQN A;  2VIH A;  1VBZ A;  2DK2 A;  4GC7 A;  3MEK A;  1KTV A;  1HI1 A;  3C8Y A;  1S57 A;  4A3D K;  3NNH A;  3HVR A;  4MAK A;  1RCO B;  2CQD A;  1W25 A;  4R5P B;  1YTY A;  2ZEJ A;  2AWZ A;  2R93 C;  1R8H A;  4K5R A;  2V0N A;  3N6L A;  1U0H B;  3JSM A;  4OIX A;  1O25 A;  1EAR A;  2IVY A;  1HQM A;  3MED A;  4LF6 J;  4CP5 A;  3FOE A;  1UVK A;  4OYX A;  1S6P B;  2AJQ A;  3PXG a;  3NKY A;  2M0G B;  5E2Q A;  1HL6 A;  1U1P A;  2U2F A;  3DRS B;  4PG6 A;  2B7C B;  4F4Z A;  3W3S A;  4RUB A;  4P10 A;  5JXS A;  5KG2 A;  5I4M A;  3FK4 A;  3SQG A;  1S1W B;  5CH7 B;  2R92 A;  2ZNY A;  2ZBP A;  2KZM A;  1QUP A;  2F63 A;  3MM8 B;  2BE5 A;  1RT1 A;  3POT A;  5KFO A;  2BAB A;  2W7V A;  3IS9 A;  1U8W A;  5E3R A;  1TL5 A;  1J2V A;  3Q22 A;  3PO3 C;  1QTN B;  3S17 K;  1DHM A;  2G0I A;  5ETK A;  4X4P A;  2IC3 A;  2JH3 A;  3QGP A;  3MM9 B;  1CJK A;  2SXL A;  5HQ8 A;  4C98 A;  1X9M A;  1YLX A;  2RRB A;  5M2P A;  4CNZ A;  3K59 A;  2WON B;  4I69 A;  2DGQ A;  4IDK B;  1HNX J;  2GW8 A;  3CD6 S;  2Q79 A;  2KFZ A;  4EZ6 A;  3K5L A;  3GTG A;  1J5O B;  5EGH A;  3E51 A;  2ZVI A;  2LP4 A;  3HOW C;  2E2J K;  2XUL A;  1T3O A;  2H4W B;  4F3M A;  1B99 A;  3FRZ A;  4HAC A;  2B9W A;  3PX0 A;  2YWW A;  5AE3 A;  2RHS B;  3QLH A;  4DG1 A;  1GMU A;  3FJ2 A;  1TKD A;  2AF6 A;  2B5J B;  3JXO A;  2UVW A;  3H20 A;  1Z2Z A;  3GFH A;  3EGZ A;  2BX6 A;  3VAG A;  2AHO B;  5EWE A;  4RKU C;  2RKI A;  2CVE A;  4YP3 A;  2QA2 A;  4WPA A;  3THV A;  1EQ0 A;  4BY1 K;  5HMX A;  3O1L A;  4MQ9 A;  3N0B A;  1RWN B;  3LGN A;  4NEY A;  2MMY A;  3HDS A;  5K14 A;  2VV5 A;  3D3B J;  2FQQ B;  1WNE A;  1WSR A;  3TUI C;  2KG1 A;  4NYP A;  2EWH A;  1I3Q K;  9RUB A;  3JSR A;  3CNQ P;  5GAH U;  4WE1 A;  2EC0 A;  3KFW X;  2FJE B;  3TFI A;  1VK8 A;  3X1L B;  4JUZ A;  1WIH A;  1SVD A;  1JKH A;  1GMW A;  4HLB A;  3K7A C;  1Q8B A;  2XYP B;  1MML A;  4G1Q B;  4K4S A;  3I9Z A;  4LSL B;  4GTC A;  1JB0 C;  1RT7 A;  2ZZN A;  5HN0 A;  3KHR A;  1WWH A;  1WI8 A;  2ATC B;  5AXN A;  2ZWO A;  1FXL A;  2V34 A;  4KGV B;  3EVW A;  1VLO A;  4PKD B;  3IP0 A;  3EJM A;  2C2N A;  1HNX F;  4LFA F;  5ITH A;  2XO7 A;  4A8X A;  1H2U X;  1IWA A;  1HD1 A;  5D78 A;  2M3D A;  3D0H E;  4FYX B;  3ADA C;  4CCH A;  3VAH A;  4ETZ A;  2MZJ A;  2W01 A;  4G1I A;  1N6Q B;  3EXC X;  5A0Y A;  2HFS A;  4ED4 A;  5AE2 A;  2DEI A;  3SSS A;  1MMD A;  1I6V A;  3ZZ0 A;  3OL8 A;  2G1D A;  1J6V A;  4WKR A;  2XS2 A;  4RNN A;  3TAN A;  3PJ9 A;  3EWG A;  1VK3 A;  1WHY A;  4B3S F;  2HBR B;  2OUG A;  1RU1 A;  4C3L A;  3LOU A;  3HVW A;  4P5B A;  1NH8 A;  1RA7 A;  3K89 A;  2JZ5 A;  1S72 S;  1WCM C;  1Q8L A;  4LFB J;  2I5J A;  3KJN B;  3NOG A;  3P5T L;  2A0F B;  2F9D A;  1EKR A;  3R27 A;  3KMQ A;  1IJE B;  4UT4 A;  2R93 K;  3R3T A;  4DPX A;  2BKN A;  3PYE A;  5E5N A;  1C1B B;  3PJW A;  3DOL B;  3QRR A;  1MSW D;  1F9F A;  2DHA A;  3CVK A;  3H5U A;  3N01 A;  3SCK E;  4DR5 J;  2MZS A;  2I0X A;  3ET6 B;  5A8R B;  3IRX B;  1XMB A;  2Z56 B;  4NLR A;  2K1R B;  1EIY B;  3CO9 A;  4CT9 A;  4XLN A;  2KT2 A;  3TW0 A;  1H7W A;  4LOW A;  4ER8 A;  2FVC A;  3K5N A;  3BKT A;  3JTP A;  2EKY A;  2KM8 C;  1ELO A;  5LMU J;  1M5S A;  1R8A A;  3GSI A;  2GNK A;  2PI5 A;  1TWF C;  3BP8 C;  2CQI A;  3U7J A;  2ZDO A;  2D3Z A;  3GCW P;  3S1R C;  1LOU A;  2M2B A;  1K1Q A;  3S0X A;  1FTC A;  4DL4 A;  1U1Q A;  2O5I A;  3TAQ A;  4Q7A A;  3D54 A;  4ED0 A;  3D7S B;  3CWJ A;  3AT1 B;  3HHK A;  2JVO A;  5DGB A;  1IKV B;  5KFC A;  4IFY A;  2ZD1 A;  3M8P B;  1O27 A;  2ASL A;  2RQM A;  4A3F K;  5J2M A;  2OPP A;  3RR7 A;  2PSZ A;  4A3M C;  4NWB A;  3MM5 B;  4D3H A;  1Q7Y T;  1N88 A;  1MU2 B;  3R5D A;  1HNZ F;  3SSR A;  2RDI A;  2RS2 A;  4A3J K;  2H65 B;  1OS5 A;  2E1P A;  5HVH A;  1QY7 A;  4OIN A;  2FUG 9;  3MR3 A;  1IR1 A;  3V6K A;  4JB8 B;  2LA4 A;  2X3G A;  3CF5 Q;  1SKW A;  5AXL A;  4I64 A;  3EPI A;  2UVR A;  4AQY J;  3P3D A;  4A3J C;  1TL7 A;  3DLK B;  4U67 Q;  3KKF A;  2AX1 A;  4OX7 A;  1UJ6 A;  3PDN A;  4MH8 A;  1HNI A;  2V8P A;  3G82 B;  1KVJ A;  2IMO A;  4ZPA A;  2JA6 C;  3DYA B;  4B9U A;  1CJV A;  4CM0 A;  3CDB A;  4YDD B;  2KO1 A;  1C0T B;  4RNO A;  2J0S D;  2HK2 A;  4ZVP B;  5DET A;  1RTZ A;  4DV6 J;  2MKI A;  1J27 A;  1O51 A;  3PYF A;  4MYT A;  2D74 B;  4EFA C;  1S1X B;  3VF0 B;  3C16 B;  2Z2L A;  1URN A;  3PAC A;  4ED6 A;  1V3Z A;  2Z2Y B;  1WAC A;  4IG0 A;  4PWD B;  2IM0 A;  1RWM B;  1E6V B;  4P73 A;  1FRL A;  2HQ3 A;  3K2Y A;  5A2Q U;  2E5H A;  3QRP A;  1B3T A;  2D3O 1;  4ERD A;  3OTD A;  1WEZ A;  4LIW A;  3H98 A;  2HMI A;  3TFH A;  3DLJ A;  4OI0 A;  3MEG A;  4YME A;  4KTQ A;  1N4L A;  2RE1 A;  1EQM A;  1RB0 A;  3PTW A;  4KGX B;  1NHK L;  1UL3 A;  5C4J C;  1V5V A;  3HHL A;  3KUE A;  1Y4Z B;  1P8G A;  1Y1W A;  1J6X A;  3B4D A;  4RW8 B;  4DS4 A;  5EX3 A;  4LR2 A;  1JLA B;  3K7R A;  4FXW A;  3KLI A;  3D6M B;  1UMJ A;  2EXU A;  4R0J A;  5KG6 A;  1S5Z A;  1YBA A;  5B7W A;  5E41 A;  1R8P A;  4K4X A;  1SJF A;  2V50 A;  2Z2Z A;  2WVC A;  2GJ2 A;  1CQN A;  4QYZ J;  2J9D A;  1S1V A;  5KG5 A;  2UXC F;  3W2V B;  2B3T B;  3PFO A;  3DNC A;  5HMY A;  2E1R A;  1QAY A;  1HWI A;  2Q1L A;  3MM7 B;  3DOM A;  3CCV S;  2ZOG A;  1N5T A;  3W8P A;  4TU9 A;  2ZUF A;  1JWW A;  1DD5 A;  1OY8 A;  4AUK A;  1T3N A;  1TWG C;  1FT8 A;  2XMK A;  1VRU B;  2JX2 A;  1F6T A;  4NYO A;  2JA5 C;  3OSN A;  3HZG A;  1M5P C;  4M8L A;  1IQT A;  3OHA A;  3KK2 A;  2FHJ D;  2VUM C;  4Z2X A;  5HAT A;  3Q8Y A;  3U1M A;  1KEK A;  3MGJ A;  2HKE A;  2VUM K;  2PMW A;  1VLY A;  1FE0 A;  2FVP A;  2FC8 A;  3GIM A;  3EGW B;  2VON A;  4X4U A;  3DHW C;  4ZP8 A;  4BLG A;  2B63 A;  1PG5 B;  2IJR A;  4FPR A;  2UXB J;  3CSK A;  2HLT A;  4ZVR B;  2UUW A;  4YEA A;  1C1C B;  4PEO A;  1FEE A;  1D8Z A;  2RJZ A;  2HFU A;  3L7U A;  4CLL A;  4X4O A;  1ZBS A;  3MEE B;  1LK5 A;  4DQR A;  1S1U A;  3KDO A;  3ISN C;  2CUY A;  3H3V L;  2R7V A;  1BQN B;  3L4B C;  2J8A A;  3HO1 A;  2XLK A;  3M2R A;  1R3N A;  2BXJ A;  2W2P P;  3VGT A;  2CAJ A;  1XXB A;  1XPP A;  3NRB A;  2GSO A;  3V4G A;  1C4C A;  2AKW B;  3M30 A;  1KHW A;  2JSX A;  4J9K A;  3OEP A;  1INN A;  4JYA J;  2HVD A;  3KUH A;  3W62 A;  4NLX A;  4A3G C;  4F4W A;  2FHM A;  3I87 A;  2H54 B;  2CKW A;  2K7J A;  3ZXW A;  1KLN A;  3AD7 C;  2BQU A;  1XN9 A;  2VG7 B;  4PXE A;  5IT4 A;  3FBF A;  4G65 A;  4X2B A;  4P6Q A;  4ZIW A;  1RIS A;  1X9W A;  3DRS A;  4JI3 J;  3M8W A;  4ILD A;  4G1P A;  4G7Z A;  2LDI A;  1HWU A;  1S49 A;  3W5Y A;  3I0S A;  2MHN A;  4DV3 F;  4WJB A;  2AGP A;  1YJU A;  3C6U B;  2IFX A;  3ZTR A;  3H7H B;  3CC4 S;  2A6E A;  2HFN A;  1JOE A;  1WTB A;  1B64 A;  3BO4 A;  2ROG A;  2PMH A;  4J5O A;  2FIU A;  2DBB A;  3RTV A;  2W9C B;  1IQ0 A;  2DRA A;  1BC6 A;  2OLW A;  1E6Y A;  1SBR A;  4EO8 A;  3Q83 A;  5JUM A;  2VG5 A;  1TMM A;  4M5H A;  3M7V A;  4O3N A;  1CJK B;  2ZBR A;  1T9T A;  3DGV A;  5CZV A;  2WB4 A;  3DMJ A;  4MKV A;  3SSQ A;  4MK7 A;  3QO9 B;  1S4F A;  4PQU B;  2ZVS A;  4LQY A;  4DU7 A;  4JI5 F;  2XMJ A;  2DY1 A;  3WQP A;  3H40 A;  1RTJ B;  5F0U A;  3RBZ A;  3TVK A;  1ZAX A;  2OAU A;  4V19 J;  4FZB A;  1RQ0 A;  5J1E B;  1PJ6 A;  3R8Y A;  3ZZY A;  2LVW A;  3IR6 B;  2W8L A;  3M8Y A;  3GTM C;  2V2Q A;  3W1Y C;  5H9F K;  4HAC B;  1FDD A;  1WI6 A;  3H2U B;  1L3S A;  5KFF A;  2XG8 A;  3P96 A;  4DSL A;  1SIZ A;  2WOM A;  4KMA A;  3R9L A;  1T9W A;  1FHT A;  4ZLL A;  1NJX A;  2GQ2 A;  2E66 A;  4OZ3 A;  2A2D A;  1B0P A;  1M5K C;  3DI6 A;  2ASJ A;  2H5E A;  2VPX B;  3PR5 B;  1ACM B;  3QSY B;  1U8S A;  4GC6 A;  4KC6 A;  3QAT A;  5ETO A;  4WFN Q;  3V6D A;  1RLD A;  3DLG B;  2HRU A;  3HOY K;  3JAM Y;  1Y5I B;  4MIA A;  4PUO B;  1Q79 A;  1WF2 A;  2Y1J A;  2R7U A;  4KAW X;  4ETX A;  4O4G A;  3D6H B;  2YH0 A;  2MY7 A;  4YQW A;  1OPZ A;  5C3E K;  3HSZ A;  3CCE S;  5IP9 K;  4J9M A;  4RNM A;  4NEZ A;  2MGZ A;  2HUR A;  3N6M A;  3V4I A;  3GTL K;  5CQG A;  5J2Q A;  4PXC A;  4GVB B;  4LSL A;  1HHQ A;  1VQS A;  1FJG F;  1FVQ A;  2J8S A;  2JWN A;  3OPF A;  2A3J A;  2G1H A;  1VHI A;  1Q8K A;  4Y28 C;  1SKS A;  4TYB A;  2NQP A;  2EBE A;  3NNC A;  4GKK F;  1WC3 A;  5AXM A;  3LP1 B;  5H9E J;  3OTO J;  4O2D A;  4LF8 J;  2JHE A;  1N5Q A;  5HSP A;  1WEX A;  3S17 C;  3H2V E;  4X62 F;  1D9D A;  1AFI A;  4K0K J;  5EWG A;  3KK3 A;  4X6A K;  2EPI A;  1TL1 A;  1WUU A;  1N5V A;  1NKC A;  1IKY B;  1KSP A;  4B3S J;  4NA1 A;  5J2N A;  4LFC J;  3QWP A;  4N8N A;  5IYD K;  2PGC A;  4IR1 A;  2BR0 A;  2VD3 A;  3X3U A;  4DV7 F;  2CNL B;  5IM0 A;  2E1C A;  4ZIV A;  5M2R A;  1XNQ J;  2AX0 A;  2UXD J;  3D5M A;  3GTG C;  2Y1L B;  1NBE B;  4DPO A;  2O5J A;  1H7X A;  2HGN A;  1WCM K;  4W98 A;  4IQM A;  2YU9 K;  3ORE A;  2WBR A;  2BDP A;  1FRJ A;  2L9D A;  3MR5 A;  3HI9 A;  1TEL A;  3G87 A;  1DJ0 A;  4LF9 F;  1YK9 A;  4KH1 B;  3UO0 A;  2VPZ B;  1BUX A;  2LQ8 A;  3S6E A;  2JNJ A;  4DQP A;  2E5L J;  2K1R A;  3TUJ C;  3LWM A;  2RT3 A;  3US5 A;  3HF5 A;  8RUC A;  2GX8 A;  2QT7 A;  4P75 A;  1WF0 A;  1NHV A;  2PC6 A;  2QFI A;  3N3Y A;  1ZBT A;  3IRW P;  5ETT A;  2B8P A;  3M6W A;  2B6A B;  4KMU A;  5HP1 A;  2VG6 B;  1HW9 A;  5C4X K;  2AGO A;  3QIP A;  4OZ2 A;  2CQ0 A;  1RAD B;  1F3V A;  4HHU A;  2ZFZ A;  4UUW A;  4O3O A;  2ASD A;  4ZMM A;  3OHB A;  1DUR A;  3WDO A;  6FDR A;  4K4Z A;  4QIF A;  5DDO C;  3N5B A;  5LMU F;  1X5S A;  4AL5 A;  3EIC A;  2W2Q P;  4ID5 B;  5T7L A;  1M0S A;  3VGU A;  2YNH A;  2VQE F;  1YNJ A;  3OJS A;  4OYP A;  3DGP B;  5F3Z A;  1P9Q C;  1LWE A;  3GG0 A;  5FDL B;  2ZD1 B;  1NKE A;  4HL9 A;  1N36 J;  2ZH3 A;  4H4K A;  3TRG A;  2HHW A;  2OEJ A;  4HYK A;  1SH3 A;  2OPP B;  1TWC C;  3MM5 A;  3Q8V A;  3L7O A;  5LXR A;  3FZ2 A;  3HLU A;  2OD6 A;  3ITH A;  4HI2 A;  1L3V A;  1YIT S;  2OH2 A;  3PO2 C;  5FII A;  3TAM B;  3ULH A;  3EE3 A;  2E1M C;  3DRY A;  2VFR A;  1FRI A;  3LGH A;  2LQ5 A;  2QL9 B;  4I2P A;  1QJH A;  1S1T B;  3DCA A;  3GON A;  4O3Q A;  3QJL A;  4C8O A;  5KFT A;  2RH6 A;  4DR2 F;  3KLE A;  5DRK A;  4YB6 A;  5L9X A;  3G4C A;  3HOW K;  4Y7N C;  1FFW B;  3RGI A;  4JP8 A;  1T0T V;  1B0V A;  3MR2 A;  2JEF A;  2VHG A;  2H1Y A;  2ZHA A;  1F5B A;  4LFA J;  3M2V B;  1EI6 A;  2MQM A;  2HZA A;  1T03 B;  4OLP A;  1IBK J;  3FSI A;  4K5S A;  3W61 A;  2DNG A;  3CDW A;  3GU0 A;  1X31 C;  2C1E B;  2YQ3 A;  2ZNZ A;  3OLA A;  1WC1 A;  4IRK A;  2AW0 A;  2O1P A;  2MKH A;  3IBW A;  3CW2 C;  5E3Q A;  1H38 A;  3HD2 A;  4OYO A;  1YBT A;  4Q0B B;  4C0O C;  2CQC A;  3OR2 A;  4NLU A;  3I96 A;  4DOZ A;  2E7X A;  3DDI A;  2C3Y A;  4CIO A;  4NLS A;  5CD4 H;  1RDR A;  2BAC A;  2XMM A;  1V3S A;  1U1N A;  3JQJ A;  5DGA A;  3C15 B;  1TWA C;  3G9C A;  5CD4 A;  2C2K B;  2XLI A;  1FWK A;  2KXF A;  5IT9 U;  1TWG A;  4FP9 A;  3FQK A;  2XS5 A;  4LF5 F; 
#chains in the Genus database with same CATH homology
 3A8I A;  3AD8 C;  1VRQ C;  1XZQ B;  4PAB A;  3GEI A;  1WOP A;  4PAA A;  1PJ5 A;  1WOR A;  1PJ7 A;  3TFJ A;  1PJ6 A;  3AD7 C;  3GEH A;  4P9S A;  3A8K A;  3GIR A;  3ADA C;  3AD9 C;  3GSI A;  1XZP B;  3TFI A;  1XZQ A;  1XZP A;  3GEE A;  1WOS A;  1YX2 A;  2GAH C;  2GAG C;  3TFH A;  3TTG A;  5L46 A;  3A8J A;  1VLO A;  1X31 C;  1WSR A;  1V5V A;  1WSV A;  1WOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...