2GAHC

Heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
b'TPLRHSPAEHLDTVMDAASVAGRVELREIAFTTQISLRCAPGTQAHAALAAATGAGLPAKVGEVAGEAQGTAVLWLAPDEFLATSAENTELGGVLSAALGDAPGQVVDLSANRSVLELTGPDAPLVLRKSCPADLHPRAFAVNQAIVTSVANIPVLLWRTGEQAWRIMPRASFTEHTVHWLVDAMSEFAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heterotetrameric sarcosine oxidase alpha-subunit
publication title Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution.
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Oxidoreductase
total genus 43
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 2gahC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 2gahC01
3GSIA 3ADAC 1WOPA 4PAAA 3A8IA 2GAHC 5L46A 3GEIA 1WSVA 3GEEA 3GEHA 3AD9C 3A8JA 4PABA 4P9SA 1WSRA 1XZQB 3TTGA 1PJ6A 1YX2A 1XZPA 1PJ5A 3TFJA 1WOSA 1X31C 1WORA 3TFHA 1VRQC 1XZQA 3A8KA 1V5VA 1VLOA 3TFIA 3AD7C 1WOOA 3AD8C 3GIRA 1PJ7A 1XZPB 2GAGC
chains in the Genus database with same CATH superfamily
1L3UA 1S6PA 3DM2A 2OTJS 4RBUA 2OUGA 4W90B 1IJEB 2PMHA 4FF1A 3HOVK 5HANA 4BXXC 2B3TB 3HF5A 3BR9A 4MK7A 4PWDB 4YY3F 4YB1P 1GH8A 3J80Y 3M05A 1N36J 4G6VB 2YKNB 3QJJA 2NVXA 3T6BA 2BJ3A 1NSAA 4TKTA 2H9ZA 3GWCA 5HAOA 3D6MB 4C3IC 4A8KA 3UCZP 1UEUA 4USTA 5KFKA 1LWCB 3LGMA 1KWMA 1REGX 3GU0A 2JA6C 2HAFA 2R7ZA 1IBMJ 4WU2A 2VONA 1RHMB 3TA2A 2KG1A 2F4VJ 4NA2A 2C2ZB 4NCGA 4GKJF 3HJVA 2OH2A 3PKMA 4G65A 4YQWA 3TEHB 3GTLK 3NWRA 2IBOA 2HURA 4NLGA 1LFWA 2Q6CA 1XERA 2JJ4D 2CQ4A 2V5HG 1YKWA 1NNDA 1RACB 3LP1A 2NR0A 1U0HA 3BP3A 3TZXA 5KFFA 5KT7A 3EZUA 4BY7K 1Q81T 3KNAA 2HHPA 4ED2A 3ZZTA 2VBYA 4F4XA 2KKHA 2PFFB 3CAGA 2AW0A 2I5JA 3RUBL 5IC4B 3OLBA 3PW0A 4B9MA 3VAFA 2JZ5A 2KJWA 4PZVA 3BO2A 4ZLLA 1QSSA 3HO1A 5AXKA 3SCJE 5L8RC 2R9LA 5KT3A 1DLOA 2MZTA 3FNNA 1NLKL 3BH6B 2E2HA 3OPFA 4FYWB 4ZKAA 1WC5A 3J7Z5 3ZZRA 3KJQB 4LSLA 2NXJA 1DTTB 2P8TA 3PJXA 4NLPA 2MKIA 1T11A 1JLQB 1DQ9A 3NGUA 2J6SA 4QIGA 4O3QA 2RNEA 5C3EK 2V4JA 2DGWA 3MZIA 1S1TA 2R92A 4X4UA 4JK1A 3IWXA 1WJ9A 2Y8YA 3QYYA 4LIWA 1WQGA 2IRYA 4QWAA 2W9CA 2HIYA 4DG1A 3JTPA 5HJXA 2PC6A 4TU9A 2OAUA 2OHDA 1J6XA 2A2DA 2Y1JA 1S0OA 4F2RA 1SCJB 3UO0A 2LDYA 1RT3B 4JBCA 2FY1A 4OYOA 2RH6A 3W8PA 3HOUC 1DQAA 1V9OA 3SQGA 5KFJA 1Q8KA 4A3GK 4ILMA 3DC2A 1LXNA 1Q95G 2XTJP 5AT1B 1M5OC 4PG8A 2DO4A 4HKQA 2IM2A 3PO2K 4L72B 3UFCX 1Q5YA 4K7QA 4RW8A 2EC0A 5DQGA 1R9TK 1YBTA 2R93C 1TAQA 2DR5A 1WCMC 2O1PA 3CIZA 3MD3A 4P10A 3KHHA 4DX7A 4M5DB 2V2VA 4ETZA 1HWIA 3LALA 1RHKB 3EYZA 4DL5A 4WJ4A 4PAAA 4KGKA 1TTHB 1LQ9A 1EP4B 2YWFA 3KLEA 5DDPC 1JJHA 4Y00A 1HI1A 3MM6B 2IVYA 2W9AA 2JA5C 4F0HA 2I2YA 2UXCF 2WSEC 3BGRB 2X7IA 2DNRA 4U9RA 2YNHA 4DL3A 2GSNA 4OHWA 2D9PA 1X4HA 5FDLB 4ZVPB 4DV7F 1ZZNA 4CCHA 1UA1A 2YY3A 2ZH9A 3SCIE 4P71A 1HQUA 3MM9B 1FJ7A 2YX1A 3TUIC 3GTMA 2XGQA 1DQ8A 2VIHA 2IA0A 3P5BP 5A8WA 2UVWA 2ZITA 4WFBQ 4M5KA 2IAJA 2D41A 4LR7A 2DR7A 5KFRA 1R31A 4C45A 1N32J 4GT9A 1QLNA 1FRJA 4H4MA 3FOEA 3WC0A 5AE3A 4MKVA 3NG8A 4DR4F 4JI4F 4J9OA 1RAJA 2UV8G 2NVQK 4YP3A 4ED6A 4ZA1A 1YJUA 2OGUA 1GX6A 4PUOA 1I6HC 3JQKA 2GW8A 3CDWA 3CJ4A 1O2FB 4NCGB 3R3TA 1NDCA 2KVQE 2CNKB 3MCNA 1ZPWX 1RTHA 2AJ1A 3DYAA 2FQOA 2WTFA 4IOAQ 3MEGA 5GAHU 2FVSA 4O3PA 4X84A 1H73A 3IN5A 4NRUA 1S12A 1Y5LB 1N5SA 2ALYB 2LXUA 2UUBJ 2RB7A 3BKTA 1D9FA 2APOA 2I0XA 3FEXB 5LXRA 2P9GA 3JTOA 2B5JA 4M8LA 1H7XA 1RU1A 4EMDA 2W9BA 4NLTA 4NXMJ 2PMWA 1N54B 3MGJA 4ZLJA 3D28A 5HROB 2V0NA 4U8YA 2RU9A 3H42A 3MXHP 1RJJA 4U7UD 1RAIB 1JOEA 1WELA 1RAGB 3T5JA 2MQ8A 4P75A 2RVJA 1DLOB 2MLYA 1SKSA 3SYZA 1A9NB 1IKYA 1RUSA 3ICLA 4GVLA 5KFPA 1YJWS 3ZZOA 3V2UC 3Q86A 1WEYA 4OL8A 3HXAA 5B0DA 2O5DA 1U45A 1LNQA 2BQ3A 1ZOTA 1ZA1B 5C44K 4LSLB 1SJ1A 2MEWA 3TANA 2XM3A 1VQ9S 1USOA 4DX6A 2RKIB 2E5LJ 4OZ5A 2IC3B 1L3SA 3PTWA 2CDQA 3KFWX 4PYAA 1HA1A 2D3OR 4NI2A 3TX0A 3BKUA 3HSGA 1RAAB 1S1TB 1N6QB 4F7VA 3HZEA 2N3OA 3BSOA 1L5UA 4LF7J 1C0AA 1FXLA 3RRKA 1KOOA 4DV5F 2BE5A 5KFNA 2DITA 1QTMA 2NYIA 4UT4A 2EPIA 4J5OA 4JUZA 1YITS 3RG6A 1FKPA 4C3LA 5D4NA 2CIMA 2LKZA 5EX0A 3BR8A 1XIQA 1J5OB 3I6PA 1JKHB 5BR8J 3MWBA 3AODA 5K14A 5IYDK 3I9V9 4OX8A 1TKDA 4MKAA 3SQGB 4P6QA 5IOTA 4L76A 4A3FK 2MB0B 1BHNA 4I7FA 5LSRA 1ELOA 1KS2A 3Q8YA 4RNNA 2MQLA 4L75A 2EKNA 1UETA 3W63A 1P1LA 3BPSP 2OFHX 2MKCA 1MN9A 1DARA 1C1CA 3M8QA 1URRA 1TWGA 1F5AA 2DNOA 2EK1A 3PJWA 1U24A 3BB5A 2BJ7A 1B7YB 1HWKA 4S0MA 1TELA 4I69A 1TFWA 3S1MC 4KB4A 2KXFA 4DWIA 3CJSA 1PJ7A 1PC4A 3W1YC 3KLEB 5JVOA 1DY3A 2AWZA 3RBDA 1X5SA 1RHUB 4CQ1A 1QD1A 3MUTP 3MCSA 4MIWA 5HVGA 2C2EA 4M5IA 3UN2A 4DR3F 1NSQA 1GE9A 3J7A1 2YNHB 3MFIA 1ZBTA 2FUG9 3DDNA 4KAWX 4I56A 2AZ3A 4CNYA 1WD6A 3M6VA 2CNLB 1QAJA 2MKHA 1X9SA 2UUCF 4DN0A 2VG5B 1LWXA 3IG1B 3L4JA 4CLWA 2NXUA 2WW8A 5A8WB 3KK2B 3Q24A 2NPFA 4ECYA 2IAJB 2K1RB 2BJDA 1FNXH 4V1Ak 3ISND 4B3SF 3GTLA 5D4OA 3ONQA 1YBAA 4LVOP 1R8BA 1REVB 1VC0A 4USVA 4H4MB 4ZITA 1SIWB 4Y2CA 4DV1J 2MPUA 3JSYA 1KTVA 2I6WA 1EZZB 1IM4A 2DRAA 2POKA 3B4MA 4ELTA 2E2IK 2CJXB 2PEHA 2CQ3A 1TWFA 4NLOA 4ECZA 1FVSA 1KDNA 3IWLA 4G0UA 4FPIA 3DRPB 5M5WK 1IR0A 2AF6A 2ZKUA 2AMCB 3K2YA 5SUHA 4A3DK 1RTHB 2DEIA 1G6BA 4CH0S 5EGEA 2VV5A 3UD3P 2D3UA 3UDLA 1O26A 4B02A 1T8EA 3DHXA 1JX4A 2QJ3A 2B9EA 1ZAWA 2LQBA 4RBVA 4LBIA 4DR6F 2RAQA 2B5JB 2W9BB 5KFQA 1I3QK 2L48A 4M5NA 2YWKA 2RF2B 4LFCJ 2IA6A 4U96A 2CRLA 1TK0A 4NLQA 4ED5A 5F0UA 1F93A 3HHKA 3IGNA 2OEMA 1N56A 1VISA 3G4CA 2WRMA 3NKYA 3UE2A 2V63A 2EFGA 1CLFA 1P9YA 2EK6A 3MM7A 4I2PA 2LA6A 3OHBA 3FQLA 1IKYB 3MCMA 4LRAA 4F50A 3HKWA 3FBBA 1EIYB 2WVFA 1KNZA 2Q6BA 1TKXB 3L7PA 1YZ6A 3T19A 1S9FA 4B3OB 1WHXA 2E1RA 4HYKA 4BBRK 3NY0A 4B9SA 3HSZA 2UXBJ 1G4CA 1VBYA 5KFBA 1U6FA 4ZP9A 3QGPA 4DX5A 2IMOA 3G6XA 2Q66A 2NVTK 1YNJA 3FEYB 3U1LA 2ZH1A 1YI2S 2IBKA 2R7VA 2E1PA 3W65A 2JFKA 3TR5A 1P1TA 1Z4UA 2BANA 1RCXB 3AAWB 3M2UA 3M4OK 4WFZA 3C14A 4A47A 4DI6A 2F3JA 2XEXA 4KIAA 2JC1A 3D7SB 3LPYA 1XNQF 4LR2A 4FBUA 4ZCLA 1U0SA 1R9TA 2IJNA 1Q79A 3PR4A 3QT5A 3TX8A 2LEBA 3VAJA 3HD1A 1TKZB 1TWHK 3T01A 4KPCA 1P27B 1FFGB 3HD2A 4CO2A 2D74B 1K44A 2MDAA 1KVJA 5IOQA 1KP6A 2VG6B 5IYBK 3QT6A 3E3XA 4IQXA 8RUCA 2HHUA 2HQFA 2NCKL 1F5CA 2BM1A 2Q3PA 3FKIK 2HGNA 3MOJB 4ID5A 2G9OA 3GLJA 1CULA 2B9WA 2BABA 1IQTA 4KM9A 3H5SA 2V9WA 4K4UA 2I9SA 5C2CA 1X31C 2GZOA 5EX3A 3GFZA 1QE1B 2OEJA 3ZZYA 1NDLA 5B0AA 2XLIA 1TK5A 3R7BB 2Y3PA 1LW0A 5M5YK 3L95X 3MF5A 4GVBA 4B9VA 1NHUA 3H40A 4B17A 1N34F 4ZHRB 3L09A 4CT9A 3PW2A 4EYIB 5GMDA 3HT0A 3TUJC 2LEAA 1X5PA 4WCEQ 3QZ7A 4X66F 4WTYA 4A4JA 1S0MA 2GSOA 4U7CA 2R7ZC 1L0WA 1SKUB 4PQAA 4ITSA 1VDHA 1TQLA 4DV2F 3LH2S 1HBOB 1B70B 5J2PA 2MYFA 2VOOA 3LPXA 1APSA 1XTZA 1GQEA 1RTIA 3M6XA 4UZCA 3CCLS 3ZTOA 2HQCA 4C3KA 1C1BA 2PE8A 3MMCB 1RE1B 2V9KA 4YUDA 5CYQB 3TA0A 2OTLS 3FK4A 1EQRA 2KDOA 5A0YA 2Z2LA 5C2GA 1G3OA 2EFNA 2YNGA 3DGPA 2HSEB 2DNGA 3WODA 4F4YA 4NE9C 4ZIWA 1VRQC 3OVAA 3AD7C 2CQPA 4LF2A 3Q8UA 5B0FA 1DRZA 1U1NA 4BBSC 1UFLA 2IYIA 2PGCA 3SZZA 2WOMB 1FFSB 3S1RK 3FZ2A 2QA1A 1FHTA 1S7HA 4ZJQA 2J0QD 3KHGA 3C66A 3UNYA 3HHLB 4MJKA 2HVEA 2E2HC 1X4AA 1XR6A 3TAQA 3CEDA 4JI5J 1NBEB 1RWMB 4AXJA 4NEZA 4JYAJ 2JX2A 4OIQA 4P7VA 2EW9A 5DGAA 3S2DC 1VRUA 3CPWR 2Z8QA 3W61A 4ELVA 3BDPA 3OBIA 4CYUB 2AT1B 3KK3B 2G1HA 2PMZD 2MQMA 4I2PB 3LGHA 2CAJA 2R92C 3RRHA 1KLNA 3GTKK 2AYBA 1N52B 4DPTA 1FKOA 1SUQB 2XCQA 2A18A 2EBBA 2HGLA 2LFVA 2DNZA 4PEOA 2B4PA 2HHHF 4LFAJ 1FXDA 1ZETA 1NPRA 4K4ZA 2BR0A 4QIEA 2E7XA 3LGNA 2H5EA 2V6AA 1HWJA 2WW4A 4DV4F 3GCXP 3CDEA 4A3BK 4LF4J 1N4LA 3D6TB 3M2UB 2BJ1A 2VD3A 4ZVEA 3G8QA 1KC8T 3NCPA 3LP0A 2VF3A 3NS5A 4DCJB 2L08A 4ZPDA 1NMEB 4K0KJ 2M70A 2DJWA 5H9EK 3GYXB 3H25A 2YPZA 1SC6A 2CJYB 3VA7A 3KLFB 3HOWC 2J0WA 4WYWA 1JMTA 3MR7A 4E0DA 1RLDA 1VQ7S 2B63A 4N8OA 3SV4A 2Q43A 4BXXK 4EO6A 4ED0A 3RJMB 3ZO7A 3IS9B 4LRCA 4NL5A 3M9OB 4IKAA 3EDRB 2GJIA 4GKKJ 3THTA 3C6UA 1CULB 4C3IK 3JS9A 3HLUA 4PXDA 4PPZA 3ENVA 2JA6K 3KDNA 3BKFA 1T95A 3DI6A 3GIMA 2XO6A 5IC6B 2DNYA 2MKYA 2DCLA 3CCTA 3HSJA 3G6YA 2HLUA 1Y5NB 5E0OA 3OT9A 2AJ4A 2L9DA 1WF2A 3B54A 3BYPA 4OYMA 5KFAA 3N0VA 2UVVA 4F3QA 3CCJS 4QYZJ 2HFUA 3BQ0A 1S1VA 5IT9U 2CQ0A 1ZA2B 2FDNA 1RTIB 4DSLA 3AXMA 2W1BA 4A48A 4O2DA 4DR5J 1FK9A 3NGKA 4E2FB 1PG5B 4DR3J 3W66A 1R8CA 5AXNA 2PA3A 2K7JA 3B8HA 2HNDA 3H8YA 3WQPA 3M8RA 2CNNB 2KYXA 2YNGB 3DGPB 3I5CA 2XMAA 4DV0F 1I3QA 3M2VA 2YTCA 1BQXA 1HNZJ 4OLOA 4GZYA 4OJHA 3Q23A 1I1GA 4QPTA 5KFOA 3VAIA 1RWWB 4OX9F 5LMUF 1SJFA 1NUEA 4RW7B 2WAQL 3C2PA 3K5MA 2MSSA 3KYLA 3PIOQ 5J2QA 1U26A 3A8JA 3C6TA 3OFFA 1HQMA 2B4VA 2F9JA 4LT6A 4RU9A 4XK8C 2NS1B 2ASLA 3ZZ0A 1YRUA 2F5GA 1OSDA 3G82A 4HI2A 2VHGA 1SC4B 1RP5A 1X5TA 1FWPA 2OELA 3M1VA 4HHHA 1UVKA 5KG0A 1NSKL 4TLRA 4ELUA 4LREA 3V4IB 4Q0BB 1NM2A 4PXEA 1VRUB 2HFVA 3BDEA 1GFWB 4HL9A 4JV5F 4X2BA 4OHYA 4A3EK 3DXJA 3HOUK 1N8RT 1JLGA 3AQOA 1B4BA 1ZVUA 2RUSA 3POTB 1NPPA 4PQUB 4YS2A 4YFKA 3JSRA 4KRWA 2KXHA 4ZP8A 2P6SA 4MYTA 1TKTB 5D0RA 5ETPA 4QJVA 4DUTA 2ZUGA 4JI7F 2R93K 3OEPA 1JLAA 2YNFB 4WZMA 1AROP 3U02A 3C8YA 4X65J 1Y11A 1A0OB 4ZLPA 3DFEA 4I67A 2RHQB 1I94F 1TWHA 1L3VA 1HBNB 4KB2A 2DHXA 4HH0A 5G0RA 2B7BB 5T41A 4IFYB 2R7UA 3LP0B 4QIFA 5ETQA 1Q5VA 4C7QA 2JA5K 2GIQA 4KTQA 3DOMA 1WF0A 3NCRA 2L9WA 5JVHQ 5J2NA 3ZTRA 1T03A 4HR2A 1EHWA 3EVOA 1TWGC 3DLKA 3PFOA 2UU9J 5J1EA 4A8SA 1OQ6A 1VIOA 4J9MA 3OXGA 4DFKA 1RT6B 4RW9A 4CLSA 3KUEA 3UDCA 3RAXA 2RIJA 3RRGA 1FE4A 2V34A 1BJTA 4LF9J 2RDJA 1SFOA 2XS5A 3W7BA 4Z7CA 3VR1A 4G1PA 3VTIA 3TQ1A 4FYXB 3NLCA 3D0GE 3FMWA 5M5XK 1RKIA 1YHQS 3D67A 2VPWB 1HI0P 3FBCA 1RT1A 3DRRB 1S59A 1N5VA 2B0GA 1VHIA 1S6OA 3QWUA 4CH7A 5I3PA 5A76A 2B4UA 4JI1J 2X1GA 2AU0A 4PXBA 3QGHA 3LPEA 3KMSA 3DMJA 1O51A 5C24B 3I0SB 1TAUA 2XMMA 3GPAA 1F7UA 4KM8A 3ITHB 1Q86T 1X7VA 2ZE2B 3CCVS 4J9RA 3LP2A 2MMYA 3CD5A 5I3UA 4P5BA 3J81U 4MFBA 4CNZA 2KT5A 3CJKB 2WK4A 4UOGA 1TWFC 1BQMA 4WKRA 1CS4B 1S1VB 1SJRA 1URNA 3NOGA 2J0XA 3T1YF 1WHVA 3MEEA 2A68A 4BY1C 4NLSA 2ZNYA 1UP1A 2P9EA 2B8PA 1PGZA 3CMQA 1VQYA 1FK9B 3BN4A 3RU0A 3AHPA 1U48A 3ETOA 3VAGA 2ALZA 2EXUA 3T9NA 2MZSA 4GC6A 5J1NA 1I51B 1PJ6A 1U47A 4C6AA 1X8DA 3AY0A 4U67Q 2ZOFA 4C0HA 2CJQA 2DCUB 5CYJA 2JA7C 4KO0A 1AUDA 1BS2A 2LMIA 2X51A 4KB7A 2GMLA 2Q79A 1GAOA 1OPIA 2HQ3A 2XWXA 3Q8SB 2DXDA 4RUHA 1VBXA 5F8IA 3QLHA 4NMXA 3QMQA 2UZAA 1FRHA 5J2QB 3QIDA 3I5AA 5LM7E 4QCLA 4G1IA 3GTOA 1MMNA 1UVJA 2M0GB 3QO9A 4LVNP 4MH8A 3G6ES 2J9DA 3G82B 3I96A 4EYHB 1J2VA 3GTKA 3M1VB 1J5EJ 3R9LA 2BE2A 4JI0J 1F7VA 4QW9A 4D3GA 1EX8A 1Z1ZA 1DD5A 2VQFF 2D9OA 3KLGA 3ENQA 4KQZA 4B3RF 2YH1A 5DS7A 1RT4A 2JLEA 2XNRA 1BQNA 3SFGA 1R89A 4N7TA 5IT4A 3W9HA 4QWDA 5IS2A 4Y3CA 1EAYC 1H7WA 1SBRA 3TRGA 3Q2SC 3PO2C 2KM8B 3LA0A 2AX1A 1GK8A 3ADAC 4XDCA 4MAKA 1JLAB 1R9TC 2QLXA 1UPMB 2DNKA 2DH8A 3NCQA 1R6VA 2J9CA 2KL8A 2ZH5A 2E44A 3T5KA 1BY9A 1E6VB 4IO9Q 3MDFA 3ZFVA 3GILA 1Q16B 4B3TF 3ZTSA 3DOMB 1QTNB 5J2NB 1T0TV 2FC9A 3M30A 1IL2A 5L9XA 2ZNZA 2LDIA 1DURA 2IVMA 3DLKB 3T5LA 1F5BA 5DQHA 1D09B 4IRCA 1V3RA 4RW9B 4QZVB 2Z30B 4U6PA 5D78A 3D68A 1YSJA 4WP3A 4URGA 2Z4PA 3QRRA 2NXNA 3H5XA 3DHWC 4GTBA 3EPIA 4FPRA 4LBHA 4KN7A 5KFTA 1HR0J 5F8LA 3KLIA 4TN2A 3OD2A 3T1HF 2DISA 1VQLS 5K5MA 1PCAA 1LEOA 1X4FA 2KU7A 2L3MA 5LL6d 3R7NB 4OJGA 2NVQC 3HPOA 3P49B 2YU9C 2CPEA 4X4NA 1RWPB 3NNAA 1RZMA 3DMJB 1CQMA 4ZVGA 3H2LA 3PG9A 4DLGA 4CLLA 3GV8B 1R8AA 3WDOA 4LF6J 2QL9B 4EK2A 3G9CA 3SV3A 1YG0A 5A6PA 5I3UB 4C8YA 3P4UB 2QEXS 2ZBQA 1Q7YT 4PR6A 1RT7B 2GAGC 4LF8F 4MFBB 3V6JA 4ENOA 4YG2A 2CG8A 3CT9A 1B7FA 1Y4ZB 5KFWA 5HVFA 5LT5A 1BQMB 2B9YA 5AJ3F 3KDOA 2F9DA 3MEEB 5CYMA 3CCZA 4PWUA 4USHA 3K7RA 5DRKA 3DLEA 2B51A 1VGXA 2X1BA 2VU5A 1GX5A 1EARA 3N6LA 4R0EA 2WONA 1VBZA 1U6BA 4G7OA 1YDLA 2C2KB 3RBEA 2NXEA 3RW7A 4J3NA 5DLFA 3HZGA 1I3OB 4PPDA 4F02A 1CJTA 3DU5A 4F0MA 1SH3A 4KO0B 2NPIA 1U09A 1N33F 2HQGA 2ZBIA 3MMAA 1YRXA 3KK1A 2BE9B 4ZVTB 1FTRA 1Y0HA 4O4RA 3HMJG 3MM5A 1P9QC 2NYHA 1HFEL 2MQOA 1S9EA 5F9LA 4NLDA 4IDKA 2AGQA 1TL3B 1KFDA 4FF2A 1YJNS 3T5HA 1R7IA 3TVYA 3EE3A 1JLEB 2BYCA 1WI8A 2FGOA 4ILRA 2Y1LB 2VBZA 2C3YA 2BE2B 5F9NA 1RGVA 2KFZA 3SSSA 5D3GB 5EGHA 4N77A 4DL0C 2OLWA 4E98A 2R93A 2ASYA 4BHQA 1M1KT 4O3NA 3NWGA 1YK9A 5KOWA 3PHTA 1RT4B 3M2RB 1BQNB 4I2QB 3ETMA 5LMUJ 2ZWOA 4M5HA 2HG4A 3FVYA 2LQ8A 4X4QA 3R1HA 1CSJA 2CPHA 2F4FA 3WX4A 2R8KA 1EETB 4P9SA 1XC9A 1OJ4A 4QWEA 2ASJA 1TUWA 1HWUA 3TFJA 3OSNA 1IBLJ 2RDDA 1DCHA 3DLGB 2O3DA 4RX6A 3N3YA 2R2SA 3TFIA 3B78A 3NL0A 3KLHB 2HWTA 4FYVB 2JEIA 3L3CA 3ZZPA 4HDHA 2M8DB 2VA3A 2I38A 1R0AB 4RWXA 2LU2A 1RB0A 2B63C 3EGZA 3N79A 4YFNA 1CBKA 2VFTA 2Z56B 4K4WA 4IH7A 3T1AA 1VI7A 3IBFB 2EFVA 3M30B 1IS1A 2P9CA 1K0TA 2K7KA 3N9UC 2MLXA 3GJQB 2K06A 4FN5A 4F3OA 3KJFB 3HM9A 2GO9A 3DGVA 3OJUA 4A3CK 2R7ZK 5E41A 2VKRA 3CJ3A 4URQU 1VYAA 4OMFG 1CC7A 2QMXA 3KLIB 3PRDA 4DR7J 3GV7B 1RA6A 6AT1B 2K3KA 1MWQA 2KVIA 2JEJA 1IWAA 3QIPA 1KTQA 1U8SA 3KG1A 3R6GB 3T6JA 2CQBA 2FPHX 4CWBA 2C3PA 5HSPA 3CW2C 5DG8A 1C0TA 4GTEA 3TYTA 3HKZL 5CCLA 1UWAA 2BKNA 2K3IA 5D6GA 2ROGA 3CF5Q 4BBSK 2QA4S 2ROPA 3EXCX 3NGRA 2V94A 2VASA 1U1QA 1WQFA 2XMUA 3BZQA 4KV8A 3JSTA 4CTAA 2XLJA 4LFBF 1TL1A 1N88A 5KFLA 1SV5A 3HDSA 1AA1B 3W8GA 1MU2B 1HNXF 1KR4A 1NDPA 3PHEA 4AE5A 4DPUA 4R5PA 3N0BA 1XQIA 1OS5A 3L7OA 5CYMB 1NZAA 1ZS6A 3AOCA 5KFVA 3FCVA 4J90A 5U47A 4C11A 3PW7A 4LRBA 5F3TA 3SI8A 2F8MA 2W4PA 5FLXU 1RU0A 1VQ4S 3CNQP 3HVAA 4OHVA 3S2DK 2WONB 4X6AC 2CQIA 3K5NA 4RBTA 1E6YB 1WC1A 4YHHF 5LJ5Y 4X64F 1PC5A 5L39A 4Q7AA 4AT1B 2R92K 2OSQA 4QIWD 2H51B 3KKFA 3BBCA 4F4ZA 4R8UA 1HIYA 4C8ZA 4W98A 1WSVA 1IKVA 3MMAB 1GMWD 2MY7A 5IQQA 2W24A 2FVRA 2FZKB 3GZ7A 3T1YJ 2R2RA 5L1KA 1QSLA 2OPRA 1RXOB 3U1NA 5BJRA 3UR3C 1Y1WK 1XZPB 4AQYJ 2HMIA 1N0UA 4X4VA 2X1AA 5DDOC 1RCOB 1ZYQA 5GADU 5JMNA 3H98A 1FNMA 5T7LA 3P6YC 1S49A 4RW4A 2FJWA 2UUWA 3B6BA 3NOCA 1IQZA 3BSNA 2CW0A 4C8NA 3C15B 4CDIA 2F8HA 5GAGU 2WSFC 1T9WA 5L9NA 5CD4H 3OXLA 4K5SA 2ZJRQ 1CJKA 1X0PA 3CUNA 3HOWK 3JXOA 4LQ9A 4OZ0A 1X4EA 1SJ3P 1TWHC 4BKWA 4CO4A 1DBDA 3CULA 3OUYB 3G4SS 2R7SA 3H2VE 1Y3KA 5C4JC 5HK4A 1UPPA 1NJXA 3GSDA 3HCXA 2QA4G 4TY8A 4DV3F 1XXBA 4PYDA 4ES1A 5FIIA 1SKRA 5D0HA 4DL4A 3R5JB 1CEZA 1S72S 3CO0P 3AA8A 5IXUA 4WIQA 2BQUA 2RQMA 5LSLA 2LCWA 3H7HB 2VQFJ 1NSPA 3QRPA 4OI0A 4OIXA 1YCLA 2QE5A 1RBOB 2OIHA 1XR5A 3D4JA 3HOYK 1HBMB 4WXWA 1SFOC 1AT1B 1YVFA 4USUA 4IUFA 1FDBA 4JI8J 4NYZA 4GTCA 2O01C 4TNOA 2VFSA 5I42A 5A2QU 4Q4ZA 1DTQA 3W3SA 3QWPA 4DUZJ 2XCPA 3RAQA 3MEDB 1S6QA 5EDWA 3N5BA 1FNOA 3MMJA 1LV5A 2EEYA 4JV2A 2H65B 4UQTA 4UOFA 3GONA 1RAEB 3BS9A 1CG2A 4ATNA 2R7XA 1MNEA 2PHCB 3MAAA 4UW2A 2JFDA 3RZAA 4AL6A 2VPXB 1Q8IA 4C3HK 3LW5C 3I4MC 1C0TB 4TU8A 4GO5X 4KHRA 1UEKA 3T9ZA 4YR3A 1XJWB 5GADI 2AYEA 3D3BJ 3PW5A 5KFHA 3P8BB 3Q8VA 4OLPA 1M90T 3KHRA 3VQTA 4NOIA 2C2NA 1KBRA 1JNZB 2QLJB 4M5GA 4RU2A 2JNJA 4X62F 3T1HJ 4LF5F 1HMVA 2M88A 5IZHA 3HFVA 1TMJA 1Q7LB 5ADZA 4QWBA 4X4RA 1GXLA 1OY9A 5KOXA 4WPAA 2HNZA 1RHQB 1SV5B 1DJ0A 1RTDA 4JI2J 4H4OB 1KLMB 4XSZA 1IBKF 1IBAA 2DR8A 3MMLB 4C11B 4DV6J 2ZH7A 4A8MP 3AH6A 1FI4A 1RBLA 2PA8D 4YB5A 4IOCQ 3IGVA 2XB2D 3IA0A 3GEEA 1YJVA 1GT8A 5HBMA 4ZVRB 2HZAA 4DS5A 4KFBB 3GTOC 3BYRA 2CVIA 1SMYA 3H4BA 3GDZA 5IT0A 3GTJA 3MD1A 2OKQA 1Y3JA 1NK8A 4DOZA 2E7VA 1DHMA 2XO7A 2YKMB 1IKVB 3GTKC 2E5GA 4JI6F 3CQZK 3RYLA 4L73A 1H38A 1FDDA 4LR9A 5AJ3J 3PEJA 2PFDA 5GVQA 3H59A 2K8GA 2ACYA 3CDBA 2G0IA 4IRKA 3GJSB 2XMJA 1WKJA 4L3KA 4RW4B 5K8NA 3WHIA 2A3JA 4KGZB 2E1AA 2CDRB 1LWFA 3A4TA 1F3FA 2LQ5A 5HMYA 2KZZA 5C7PA 3D66A 3HI9A 2ZM6J 1WDDA 3SEOA 4NLUA 2BEFA 1GMWA 3W2VA 1UJ6A 4O4GA 3GR1A 1TWGK 1AB4A 1XNRF 1GMVA 4FBTA 4ANCA 3L4BC 4FS2A 2RRNA 4J91A 3L4KA 4DUYJ 1FRLA 4DQPA 2DBBA 1K1QA 2VG7B 3M9NB 4M94A 1F9HA 2EG1A 2XCRB 4C2MC 3TAMA 1YQHA 2A6OA 4TY8B 4K2XA 3BGLA 4UZBA 3GG0A 3TUPA 4G1QA 4M5LA 1WSRA 2VFUA 2PD1A 1TL7A 2Y0BB 1U8WA 4KAIA 4KC6A 1W26A 3MPDA 1KQ4A 4A8WA 3I4NC 5IYCK 5IOSA 1AZSA 1S1XA 3JAMY 2GAHC 4NXNJ 3K59A 1FTCA 2FVPA 3D3CJ 4F04B 1O25A 4DR2J 4DXLA 3DOLA 2DNNA 1AXQA 1CPZA 2WSCC 3NBPA 5IM0A 3JTNA 3M8SA 3M32A 1OPZA 4PABA 5I3QA 2D7SA 2DGUA 4FZBA 3O44A 4WTOB 2OFGX 1ZYRA 1DTQB 1Q53A 3EICA 4HACA 1NJWA 1TWFK 2EFPA 2EI5A 1RTJB 1S6QB 4MQ9A 4RL1A 2XY6A 3V4GA 1B4AA 2EKYA 4BY1K 5IORA 4AUKA 4E8UA 3N5FA 4KATA 1VJWA 2YWGA 3CMAS 3M6WA 5F41A 5THWA 4F26A 3TWZA 3MAAB 3DLBA 1H2UX 3DDKA 3SDEA 2FJXA 1D8ZA 1WC4A 1VIXA 2B9XA 2KO1A 2HGMA 5ITHA 4GTDA 3PACA 2HNYA 2RUGA 2R8HA 3GQCA 1LWEB 3W5YA 1C0UB 2JA7K 1B3TA 2ZUFA 1LW2A 4FYYB 1UVMA 1F9EB 2NZ4A 1S9GB 3KTQA 3FOFA 1RLCL 4C9DA 5AXMA 2HIQA 4NX9A 3NRBA 1U1MA 2AEMA 2QSFA 3TJAA 4AYBD 4A8OA 5DG9A 3QJLA 2O67A 2H1YA 2XCAA 3SSQA 2YWWA 1CJUA 3ULHA 3IRWP 4IRDA 2E9RX 3VF0B 5IP9C 1ZM4A 2C2RA 4DSEA 4ED4A 2GJ2A 3CD7A 4ES3A 1JLBA 1IN0A 1NZ8A 3UR0A 3OTOJ 3EPGA 3EWGA 2V8GA 2CFAB 3FCWA 1HWLA 2I8EA 4FXWA 3JYTA 4DF8A 4O23A 1Y1WA 4XIUA 1XMQJ 4ZMMA 3S14C 4HTJA 4EFAC 2V8HA 2QYGA 4A3EC 1XMOJ 4B9LA 1YJTA 5M2RA 4USWA 2VUMA 4HLBA 1FA0A 4U7UK 1NB7A 2ZC3A 4ZPVR 3OSPA 3KG4A 3KOAA 3OR2B 3RBZA 1BUXA 2IMWP 3CCSS 3Q8QB 4MEXA 3PXGa 4ECTA 1WOSA 3LAPA 2UV8A 2QV6A 4BCAA 1XMBA 2D1CA 4K5RA 1HNXJ 4C8MA 4WZQA 4W92B 1GTHA 2ZD1A 1VK3A 2HVZA 3I32A 4NA1A 3S1NC 2OSRA 3FFIA 4IFVA 3DLHA 3IMQJ 4F25A 7AT1B 4EGLA 1T9TA 4DPYA 4ECRA 1NU4A 2CXEA 2GQQA 4X4TA 1LXJA 1LWFB 1IW7A 1OYDA 2XHCA 4K4XA 5EWGA 1F60B 5J2MA 4A3JK 3QJPA 3US5A 2ZEJA 5HQ8A 4DR1J 3W2VB 4O4GB 3NEKA 1O8BA 2HK2A 3QFWA 2UXDJ 1ZZFA 2AKWB 1I5OB 3WX8A 3W9IA 1Q0NA 2VFVA 2GA7A 2MLZA 5ETSA 2G13A 2R7RA 2JDJA 2DNMA 1R8HA 2FZCB 1Z2LA 4A8FA 1S6PB 3DM2B 2DY9A 5EWEA 2P8IA 2GVDA 3CDAA 4RW6A 1HD0A 2QIFA 3T00A 2R42A 2DPIA 4LJZA 1F0XA 2ROEA 2QLBB 1S1UA 1RK8A 4TVAB 4G1QB 1ITPA 2W7OA 5ETMA 1K1SA 2YX7A 4XAKA 3PO5A 3H3VD 2ZC4A 2AYGA 3M3YC 4NCBA 3FCHA 1VHFA 1SL2A 2X3GA 2W01A 4C3MA 2YU9K 2GIFA 1KKHA 2YWEA 1WOPA 3J81j 3T41A 3DOLB 3C16A 1U7LA 4P74A 2RH3A 2MJUA 2V8PA 2LXIA 3NBPB 3M32B 3QT8A 2W4DA 3IR5B 3QRQA 4FYDA 2JLFA 1MLAA 2CQ2A 3LP1B 9RUBA 3AJ2A 5BYSA 1U0HB 2BW2A 2MZRA 3H3VL 1IBMF 3BM7A 3B4DA 4UQGA 3GB0A 2MHEA 3BPDA 1ZPVA 2AQ4A 4DSIA 4Z2XA 2F4VF 3LF0A 1HKAA 2I5JB 2AEJA 3CWJA 4Q2LA 1NXIA 4NYOA 3HSDA 3R5DA 5HMZA 3PX4A 4CLUA 3DNCA 3FQKA 4ZPTR 3SDEB 3NS7B 4FXDA 2GQCA 4DX8H 4F2SA 2HNYB 1S1WA 1JXLA 1IKXA 2EFQA 3HFKA 1FXRA 4F8RA 2FJEB 1JXEA 1S79A 2DNPA 1FESA 4JB8B 3PNIA 4O3OA 1R43A 1NEEA 3LWLA 2YWHA 2CQDA 5CQGA 5IWAJ 3G6VA 3I5BA 3SQOP 1KSPA 3VGSA 3UVJA 3QSYB 5K8OA 1WUUA 3TARA 2DXFA 1BD6A 4DF4A 3TZYA 4OZNA 2MGZA 2V4JB 4ZP7A 4USIA 1RT5A 3HVWA 1MSWD 2HS3A 1H74A 1S77D 4OINA 1RISA 3FSYA 2W9CB 4CIOA 3CQZA 3ZXWA 1F2HA 4UY8T 4DG1B 5DM7Q 1XWLA 4MIAA 5KT4A 2QC3A 2DGOA 2XULA 1D9DA 3SIPB 2NSBA 3M8PA 1ZH5A 4AL5A 1ZTTA 1HNWF 1T9VA 2H4WB 1G2EA 1UWBA 1IM6A 4X62J 1NK5A 3OFHA 3GTYX 2HS0A 1IKWA 4P52A 2KXNB 3IAM9 3BSCA 4M5JA 4GRSA 4OZ2A 4DPWA 5D15A 2DD8S 4OYIA 3DOKA 1PO6A 1YGYA 2BJ8A 2ZD1B 2KFYA 4RW8B 4WILA 1OSCA 4IFVB 1T3OA 1R0CB 5T14A 3FSXA 4WIIA 4LOWA 2RD5C 1C4CA 1W7WA 2VPYB 4CRJA 4WE1A 1QSYA 3AB2B 1TL4A 3IC1A 2OD6A 4L74A 4OYBA 1SIZA 2B63K 4MT1A 1NRKA 2ZUEA 4Y2KA 2ZFZA 4I0WA 1UVNA 3HVRA 2AHOB 2RRAA 4Z37A 4XPEA 2YH0A 1QUPA 2DGVA 3R5BA 5E3PA 3MR2A 2C3MA 2L9NA 3CJ5A 5F8GA 2FLPA 5GMKa 3EDQB 4NLYA 1YNNA 1WF1A 4IH5A 1HQUB 4CO1A 2PSZA 3P3DA 2QSWA 4IOBA 3OFGA 4OHZA 2DGXA 2RDIA 3JAMU 2CPXA 2Z2MA 5KT5A 2CJBA 1UVLA 5EWFA 2FTRA 4ZOSA 3OTDA 3FBEA 3ZC4A 3KNGA 1OYEA 3G8SA 2OD4A 1R6YA 2CPZA 4GTLA 4J7CA 2YXLA 4OV1A 1CJVA 2OMOA 2GHWA 3AD9C 1I50C 3S1QK 5IT9Y 4GMKA 3UQSA 1FKAF 4YR2A 2QL7B 2CPDA 4PUOB 4J37A 4BWJA 1JNRB 1RU2A 4ILLA 2GS8A 2BJ9A 4LBPA 1LK5A 4Q5VA 2MTLA 3DYAB 2CPIA 1WIHA 1P8GA 2BA9A 3MEGB 2QMUB 1RBAA 4CLZA 4YY3J 3IAS9 1MWZA 1JLCA 3HK2A 4YR0A 2VOPA 3EZOA 2GX8A 4DN9A 4OZLA 3CJQA 4ES2A 3CSKA 2CJAA 3QT7A 1EKRA 1SQGA 2ZVIA 2VDIA 2JA7A 4G3IA 4NOHA 4IO1A 5HATA 2FLLA 4LIRA 4IYQA 4NWBA 4GKJJ 4X6AK 3MPYA 2KFNA 4OYZA 2UUBF 2YKNA 3MFHA 1B4SA 3F41A 4R0JA 1NK9A 1S1WB 3K58A 3S15C 1IKXB 4PG4A 4LSNA 3RAMA 2KYZA 5CD4A 1RDRA 1TWAK 2J9DE 3NGTA 4I4BA 2BMBA 4CLFA 1FRKA 1D3WA 2HFSA 1M5VC 4BLBA 4NXMF 5IOLA 2DXEA 2G1DA 5E2QA 4OI6A 2QLWA 1MN7A 2PN6A 4UTGA 4OQJA 2IJFA 2QFJA 4ZCKA 3G86A 2FHOB 5LMNF 3TNVA 2EBEA 2IFXA 1DFDA 1GMUA 2MGZB 5L1IA 3GE9A 5HO4A 4NI2B 2B4OA 2LLZA 3JQMA 4F3MA 2J9EA 3GTJC 4DDQA 5E68A 3TVZA 5B0GA 2E5IA 3W9JA 3A12A 4DSKA 1T02A 2JEGA 1AUSL 3QATA 3N4WA 4J9NA 1FKPB 2E2JK 4RO0A 1YJ9S 1ULRA 2E5LF 1DZ5A 3GTPA 2XZTB 3FEZA 1GEHA 4U95A 3R97A 1ZBSA 5K14B 3UD5A 1S76D 1UWBB 3ILLA 5IFMA 7FD1A 2AGOA 1AW0A 3N01A 4BC7A 4LF7F 3PCOB 4JI3F 3GIRA 4I7FB 2KWAA 3ZTQA 1HNVA 5KG3A 4RUAA 5C4JK 2HWHA 3P96A 4I64A 2CADA 5HN0A 4A46A 2A2CA 4WJBA 1TL5A 1HYSA 3PYGA 4JP8A 3DOKB 2B43A 3BF4A 1O6XA 2BDPA 4Y7NC 1NO8A 1C1CB 1IXKA 3M8QB 1B64A 3GFYA 2N4DA 5HP1A 3SXLA 2DY1A 5E33A 1SC3B 3PW4A 1YX2A 1LFPA 1JLQA 1VC6A 1SQEA 2FQTA 3OL9A 2Y0SD 3CGIA 4GTFA 1SFOK 4H4KA 4G7ZA 3A3PB 1N5TA 3R1LA 1JQWA 3SFUA 3GCWP 3OV7A 3J7YU 3S01A 2AJFE 4ZVOB 1VQ8S 5E3QA 3CCES 4XSXA 3VAMA 1NKEA 4NZ0A 3NXZA 2OEKA 4IG3A 2DR9A 4J9SA 4X4SA 5ETOA 2XWYA 4A3CC 5GAEI 3CCWA 1S7IA 3AH5A 2R7TA 3V5RA 1XR7A 3C19A 2KRRA 1RT3A 1U49A 2UUAF 1PKUA 1BXNA 1GXUA 2XHWA 2YU9A 3R5CA 5IP7C 4ECUA 1O2BA 2H3EB 3I55S 5HJYA 2MZQA 3ZZZA 1SVDA 1MROA 4P2SA 3GV5B 3J81Y 2UXCJ 2WB1D 3ERED 3MMBA 3WZ0A 3HULA 3K7AC 4C0OC 1DCOA 4KKOA 4DV7J 5KAKA 3I4MK 1TZ0A 1FVQA 2HHVA 3MOZA 3CCQS 3GIKA 4BBYA 2QO3A 4QYZK 3K57A 1NJZA 1MMDA 4C8OA 3OL6A 4V19J 2UUTA 4NLRA 3UCGA 3PVXA 3S0XA 3SSRA 1R27B 1SC1B 1YWXA 4CM0A 1HW8A 1JLCB 1F2GA 3TOQA 3BGRA 1FDNA 4DV1F 1V3SA 4DU8A 2H5IB 4DR4J 2DR6A 3QGIA 3PX6A 2HWIA 4JI4J 4RPFA 4B9NA 3PJ9A 2HBRB 3V6KA 4KMHA 3MM9A 1F9NA 3EGWB 3DDIA 2RQKA 1WC0A 4ERDA 4URSA 1PYTA 2W8KA 3BN7A 4WU3A 2CKWA 1SJ4P 1TV6A 3MM7B 4WP9A 2KJVA 3GTOK 3GYGA 4OYWA 4ED7A 4LSNB 1VR6A 1H6KX 2QT7A 2AV5A 5LSOA 3GYNA 3F44A 5TMFA 4LFCF 3BQ2A 2ZOGA 2JRSA 2O5JA 5K20B 2C2DA 1RAOA 2DB1A 4UOCA 4DL7A 1Y1WC 2MKSA 1RI7A 1S0NA 3IPJA 1NKCA 3MHYA 2VUMC 4YB7A 4RNOA 3VWSA 4OZ1A 3A13A 2PMZL 2V2KA 1TWCA 3J7YI 4FS1A 2BANB 3C14B 1UA0A 1WTBA 1VRTA 1VQSA 2V6SA 2UXBF 4Q5SA 2DKOB 2XMWA 1WI6A 3ISZA 3OTBA 1LK7A 3EZ5A 1R3NA 2R2TA 1WOOA 3HT3A 1VQ6S 5A6WA 5HROA 2MJNA 3PV8A 1U1RA 5EHHA 2BUNA 2CJKA 4C2MK 3R7SB 2D69A 5H9FJ 2M9KA 1HNVB 2ZBRA 4AXIA 2FD2A 1FWLA 1HYSB 3LAKA 3M6UA 4DV5J 3IRXA 2HBZB 4ID5B 5HP1B 2ZVSA 2ASDA 1RYRA 1T9UA 3QNWB 1GNKA 5CHPA 1KQKA 5F8JA 2RKIA 2VJUA 2YX4A 3UDVA 2UP1A 4ER8A 3I4NK 2IC3A 2Z58B 2W2OP 1T9XA 2WHOA 3KMQA 3HOYC 2BOPA 3K17A 2J0SD 1HNWJ 3E2EA 1U2CA 1KVKA 1N6QA 1RWKB 3IXQA 3D1QA 1LW0B 2ZH2A 2FHKA 2CA9A 4GVBB 3D0HE 5IQ6A 4Y0FA 3FMBA 4IG3B 2XBPA 2RQ4A 1VOMA 3OW2R 4GC7A 4J9UE 3VALA 4EBCA 4DFJA 1F1BB 4IQMA 4NZ6A 3LQVA 3UW1A 1J5OA 1BDFA 2EVZA 1JKHA 2LXFA 4I68A 4TYBA 1SB6A 3MAHA 2A0FB 5M3MK 4USJC 5J2PB 2GV1A 2DNQA 1N5QA 4KH1B 3E51A 3V6DA 3M7VA 4CZCA 3X3UA 3CCMS 1RAHB 1MROB 5DGBA 1C1BB 4XO0A 2YKOA 3AA9A 2NVYA 1MWYA 2UVUA 3MMBB 4ALZA 3IO1A 2V6TA 3P45B 4ILDA 3AOAA 2XS7A 3V4MA 2Y3YA 2O66A 1ZTWA 2QX0A 4KKOB 4WWSA 5A0YB 2QA2A 2AIRB 4C3HC 4FVMA 1Y1VA 2HKEA 1I6JA 5K8PA 1Q4RA 4NYPA 1HQEA 3OQ2A 2UUCJ 5G4DA 2AX0A 4KMAA 4UOHA 2XC9A 3DU6A 4OX7A 3PKYA 3MI7X 1W2BR 3S16C 1FX4A 4B3SJ 2D3ZA 1QAXA 3H0GA 5IP9K 1K83K 3S17C 2H48B 2B6AA 1RWVB 4LQ3A 1TWAA 5BYRA 2PPBA 4RJVA 1WG5A 4OYPA 5DO2A 2KZMA 1XXCA 3I4PA 2VG5A 4K50A 3IG1A 2DIUA 2ZH8A 3KK2A 1KRPA 2ZZMA 4LLGA 1M5KC 2K1RA 1X0FA 4F4WA 2DGQA 4NA3A 3S14K 5ETLA 3KLVA 1TV6B 3THPA 2YBVA 3BV8A 1U02A 1REVA 4OI3A 2MKKA 1Y10A 5B0EA 3TW0A 1J6WA 3CJ8A 3HHLD 3EVWA 2XYHB 1FKOB 2IYGA 3PFEA 4DR6J 3RZOC 3CQZC 4JI5F 2E1MC 1RA7A 2Q1LA 4JYAF 3FUYA 4WXOA 1KD1T 3DRPA 4Y34A 3S1NK 3EJMA 2FJBB 2XCOA 5E3CA 2GO8A 2PIIA 1IVZA 1U1KA 2LA4A 3QZ8A 2VKZG 4ZVSB 1H98A 5FJ8K 4EZ6A 3RB3A 4BLAA 1TMMA 2VODA 3D1OA 4LFAF 1VRTB 2IM3A 3C46A 5D4DA 2RF2A 2NUHA 1J27A 5HI7A 1VQKS 2EFOA 4DCOB 4ZPCA 5LMNJ 2OPQA 5A8RA 4LF4F 3LANA 2DGSA 3PRBA 3R6LB 4ZDNA 1M1GA 3MAQA 1BC6A 1VLYA 2IRXA 2F63A 2DRDA 5KFUA 1UFKA 4ED1A 3TFHA 2J7KA 3Q8RB 1FEHA 1TKXA 4K0KF 2W7VA 3IRXB 1O0PA 2GC8A 4YB6A 5KFDA 3OREA 4B3OA 2V67A 3C6UB 1FDAA 2DGTA 2GNKA 2NQPA 4QOTA 4C97A 2W8LA 3GEIA 1XK8A 3WIVA 3M3YK 1XNQJ 2CWXA 4J9KA 3PO4A 5AXLA 3R27A 4K4VA 3HHDA 5IYCC 2A6HA 3DI6B 3EX7B 3LOUA 2JLGA 2ZBPA 2F8EX 4WBFA 1YZ7A 4JI3J 4KGVB 2WVEA 2HRYA 1PAEX 4GKKF 3ZNJ1 5D77A 1ACMB 2VC0A 1JJ2R 3GTQC 3FDSA 2N4CA 3GIIA 2V68A 2RT3A 2R2UA 2V2ZA 2XYGB 5LJ3Y 1WEXA 5DM6Q 4A3IC 4ECQA 3FRZA 3K5PA 4WJ3M 2RMLA 2B7CB 1TKZA 1SJQA 4WK3A 1FERA 4CM2A 3I9ZA 3V6DB 2B8QA 4JV0A 3SCKE 1X4GA 2VG6A 3N28A 2L41A 2ACMA 1S10A 3O2IA 2JVRA 5KFCA 4RKUC 4ZIVA 2JHEA 3NGSA 2HNDB 1N34J 1TVRA 1U4BA 4QQBA 4Y6IA 5KG2A 1EJ7L 2Y8WA 4QPXA 2HVDA 5HLFA 2KHCA 1KOHA 4X66J 4TU7A 3GFHA 1PBAA 1HQEB 1WC3A 1OIAA 3M2VB 4D3HA 3CIMA 3CC4S 5FLXY 5GAHI 2GIRA 2UUAJ 3UWTA 4DV2J 1G51A 2FLOA 1QE1A 2N82B 4DR5F 1CQNA 1J6VA 3CDUA 1S57A 4MTPA 3AOBA 2VUGA 1BGWA 4HDGA 4LSZB 4ZPAA 1KN6A 3M8YA 1YJRA 2Z2YB 3C6TB 4ZHRA 2RILA 3SCLE 3M4XA 4K4YA 4DJBA 3A1YG 3RZDC 2B6AB 5DETA 3J80U 5LXYA 4CLKA 3BBBA 4QU6A 1OQ3A 1RT2A 9ATCB 3PM9A 1HNZF 3K8WA 4KDDA 1HBOA 1VS3A 2MQPA 1UAWA 3OPKA 2KT3A 4OIPA 6FDRA 4DHVA 1U2RA 4ZK7M 4L3NA 2Z57B 5K8MA 1UZHA 1D8YA 3NAIA 5KFSA 3AB4B 1PYOB 2KI2A 1JLGB 4DL2A 3MMCA 3BUEA 4ZJOA 4C0BA 4C8KA 5KFMA 2W7PA 5JFEA 4DS4A 1S97A 5CYQA 4B3MF 3VAHA 4NEYA 3I31A 3RBXA 1IQ0A 4KGXB 3BO3A 2FB0A 2LYVA 5DJBA 4QJVB 1NJIT 1K9MT 2YPYA 3GTPC 3PR5B 2BKPA 1PJ5A 1Y00A 3TO8A 2FJVA 3FHZA 2E9ZA 4TXSA 5F8HA 2PEBA 5CAAA 5HQMA 1ZM2A 1G1XA 2ADCA 1SL0A 4YOEA 1NK6A 2WOMA 4HT5A 5LOQA 4C3JC 5G0RB 4C2MA 4K4SA 2M8HA 1ROFA 3ENWA 2UVRA 3O3LA 3CCRS 2HFNA 4A3JC 3WIUA 4KE5A 3HHLA 2Z0GA 2FHJD 3H5YA 1T03B 1MG7A 1TUGB 2FZGB 4KYZA 5ETKA 4HVZA 5J1EB 2HHHJ 4X65F 2G2YA 3O1LA 5ETVA 2OPQB 5A8RB 2HS4A 3CXCR 5B0BA 1M5PC 3HOZK 2KB2A 5HL8A 4CYUA 3KK3A 4ZS6A 3AD8C 2JH3A 3JSMA 4H4KC 4DV4J 2OMLA 1QAYA 2JVOA 3FZBA 1NJYA 2VB6A 3O6QA 1KQSR 3DXSX 2IDEA 3KUHA 5A2QY 1Q82T 2BX6A 1SUQA 2VPZB 3CE8A 1RT1B 3TUZC 4BDPA 2UU9F 5CABA 1VQMS 1VQNS 3SBMA 1FT8A 3LTOA 2XYPB 4RNMA 1PYSB 2E5JA 2IPOB 2RQCA 3FKBA 3GR0A 3BH7B 1I50K 2ZH3A 5HL7Q 4DPXA 5CA5A 3K5OA 3EM1A 4LF9F 2XMTA 4ZN3A 5KT6A 1H3DA 4TYAA 4I6AA 4ZCMA 1VFJA 1M5SA 4GO7X 4XDDA 4PKDB 3OLAA 3LP2B 3HVTA 4ECWA 1WACA 1IJFB 4QBUA 3G71S 1QJHA 2CPJA 4V19X 2DYAA 1T94A 3S6EA 4IR1A 1NK7A 2HYIB 3KLFA 3OTCA 4JI1F 4FNIA 3DKDA 3GMGA 5C5JA 2PDAA 2RRBA 1NH8A 3IBCB 8AT1B 2XGPA 3GTGC 2QRRA 2ZUAA 3S7RA 3HOXK 2RS2A 3U27A 2A1BA 1EH1A 4M95A 3PZPA 3H4DA 3IS9A 2VJVA 4LF1A 1TVRB 5JVGQ 4EWTA 2DK2A 4MIBA 2J8AA 4TY9A 3CC2S 4DDFA 2JEFA 2E5HA 4IH6A 1FJGF 3UD4P 4LQYA 2G4BA 3S15K 1K83A 5HLFB 2GMHA 4DU7A 2CG4A 1TP7A 3PIPQ 2HRTA 1TFYA 2FY8A 1B0PA 3NMRA 2ATCB 1RABB 4EI2A 2MXYA 1LOUA 3QLHB 3AJDA 1RYSA 4ANEA 1ZQ1C 2EC2A 4AFFA 4OI4A 5HMWA 4ZN1A 1V6HA 3Q8PB 1UW4A 1JJCB 2NVXC 5DDQC 2C3OA 3GTJK 5KFZA 3QO9B 2YVSA 2GHPA 2V50A 1FRIA 1KQGB 1RT2B 2G0JA 2E1CA 4QU7A 1RAFB 2M52A 3AJ1A 1RHJB 3IP0A 1JWWA 1ISEA 4ID8A 2KG0A 4DV0J 2HPUA 3KLGB 1L3KA 2ATLA 1OO0B 4J9QA 2DNHA 3IFEA 2JOQA 3HX9A 2BVZA 4YDXA 4F4KA 4OX9J 2R8GA 4N76A 3IM8A 3MUMP 1TWCC 4W4MA 3HXMA 2H54B 1RWNB 2ZKTA 1J5EF 8ATCB 4Q2MA 4ED8A 4JI0F 5KG6A 4DZDA 4A3MC 1VQ5S 4N56A 4UY85 4PRFA 3KXDA 4Y7NK 1QM9A 5C42A 1BWEA 1SH2A 1KHVA 5C4XC 4K2JA 1B0TA 3EMTA 3PO3C 2NSCA 4CLYA 2JWNA 3TTGA 3PYFA 4RW7A 4NPOA 4JV5J 4EBDA 1O24A 4MK8A 2JC0A 1WWHA 1RTZA 3QSIA 2ZHBA 1YTYA 1WG1A 4UUWA 2OI2A 3CD0A 4NLXA 3E01A 1T05A 4BLGA 4G0VA 1VGYA 2CVEA 3W5ZA 5FLMK 3RGIA 5D0GA 5DG7A 3EVMA 1USMA 1JVIA 2MQNA 4OFZA 1W25A 3V4IA 4FZVA 3UCUP 4Q0BA 5DZ7A 4C98A 1UEVA 1EQ0A 4JI7J 1VH2A 2DRBA 4L6V3 4O0NA 4DSFA 3JSMB 1I94J 5IP7K 4A3LC 1U6ZA 3J7AN 4A93C 3POTA 4LRDA 3W5XA 4M1KA 4ZPBA 4PQUA 4LMZA 1FJEB 4KGMA 2FJAB 4DSJA 2MY8A 2G2OA 3UNGC 2JA8K 3W2WA 3MR5A 3A8EA 4RMFA 2FHJA 1FFWB 5CH7B 4RNHA 1TKTA 2XNQA 3K7AK 4MYUA 2CQGA 3A3OB 2YNFA 1EKSA 5F8MA 1D1UA 3S1QC 3SZYA 1FJCA 4QIVA 3MPUB 1HBNA 4PXCA 2BRKA 1HR0F 4IFYA 2HHXA 2D3O1 1X9MA 1L3TA 1N0VC 2BV3A 2NVYC 4DFMA 3HVTB 2HHTA 4QR0A 1Y9OA 2GFFA 1XZQA 3F0NA 2GJFA 3DRXA 3BSAA 2WVDA 1Q78A 1BGXT 2J8SA 2HZVA 1Y1VC 2XMVA 1RT6A 2PO4A 2OPSA 1RSCA 4EBEA 1VC5A 3I56S 3QAUA 3DLEB 1SI9A 1IR2A 2KH9A 3FGVA 4HHJA 4KHMA 4ETXA 5D4PA 3CJ2A 5CXTA 4LF6F 4BC9A 3T02A 4X4PA 4FDFA 2AJQA 2NUUG 3H0GC 3DRRA 1CJTB 2ZJPQ 4WF9Q 2FLNA 1NK4A 1TWAC 3MTKA 2QZ8A 1P6TA 4Q44A 4FF3A 1RWOB 3ILIA 5JXSA 3K8VA 3KK1B 3GTMC 3DLLQ 3SZ2A 2LEPA 4X4OA 4IR9A 3PYDA 3PEHA 1SKWA 4KC5A 4M63A 2H4YB 1HNIA 2ADBA 3MM5B 2V69A 5C24A 3I0SA 2CYYA 1S9EB 2A6MA 4DLEA 2VUMK 3VGTA 4IDKB 3ITHA 5E5NA 2P5VA 3S8SA 2ZE2A 4QIWL 3MUVP 3BEGB 5I4MA 4KPYA 3TJ8A 3CJKA 2E2IA 1TK8A 3BGFA 4RUCA 1CS4A 2E2JC 4Y28C 3J7ZT 1A7GE 3O8WA 4Y52C 2M7SA 2ZHOA 2DNLA 2J5AA 3TI0A 1WHWA 2ZH4A 2WAQD 2DH9A 3OTEA 1BLUA 3NMAA 3MPVA 2AD9A 3D6FB 5M3FK 4WK1A 2FYXA 3KWMA 5A8KA 4YFUA 3BGOP 4Q8EA 3CC7S 3TQEA 2W2NP 3GJTB 1UL3A 3JQJA 2P6TA 1HLWA 2H5JB 3D6HB 4WP8A 4F0KA 5EUHA 3OL7A 2LVWA 2PI5A 3DCAA 3H20A 5C42B 1NHVA 3G96A 1BE4A 3U1MA 4DEZA 3OR1A 2K2PA 4EO8A 3V6HA 2DH7A 2ZDPA 5L46A 2IHR1 4B3RJ 4DPOA 4P2XA 3S2HC 5EN1A 4QR2A 2W4CA 3OHAA 1PAUB 4ICLA 5D8HB 1IBLF 1RKJA 2VQEF 3DLJA 3E01B 4B3MJ 1T05B 1QAIA 3QGGA 3VQSA 1ZM9A 1SH0A 3OVBA 1EB0A 4DBQA 3NP5A 5M2UA 3WBZA 1KQFB 2NXCA 4C48A 4A3KC 1I50A 2HBQB 3AXKA 1T3NA 2CNOB 4FM9A 3D9BA 2YQ3A 3QPIA 1IE0A 3X1LB 1MW7A 2ERRA 3T3FA 4NZ7A 4J9PA 3D2WA 5KFGA 4LUBA 4KSEB 4QR1A 1S99A 4Z7YA 5H9EJ 2E66A 4B3TJ 4OIOA 3W2WB 3L7UA 3QIPB 2AEFA 4NRTA 3UDEA 2WBMA 3P5TL 2R4FA 1WCMK 1X4CA 1YRTA 2KRBA 4NLWA 1AFIA 4ZVQB 3TAPA 2R3VA 4CO5A 3LWMA 1NB2A 2HVHA 5SZTA 4WYLA 1E6VA 1HI9A 4Q45A 2GGPA 4DR7F 1S5ZA 5F8NA 4YEAA 2C2OB 2QFIA 4F67A 3D0IE 1Q8BA 2HHSA 3CJTA 2YKAA 1KVIA 3FJ2A 3S16K 1WG4A 5KG4A 3Q89A 3GEHA 2C1EB 1XZQB 2XY7A 3FKIA 4KV8B 2CQ1A 3S17K 1M5HA 3HP6A 4CTAB 1TL1B 1Y7PA 1XXAA 2C2MB 4R5PB 4P2MA 1NDKA 1VK8A 2OPSB 2ABYA 1SXLA 3BGUA 4ZLNA 5E3RA 1QVFR 4Y2IA 3HOVC 5E7OB 4ECXA 2WZ1A 2FIUA 1IBCB 4DQIA 4KN4A 3JB9k 2VFRA 4F36A 3TA1A 4FXVA 3UN5A 1VQPS 1JLFA 1X4BA 2VBXA 1C2PA 1PSDA 5DDRC 2VDHA 2VH7A 4R8UB 1FO1A 4LF8J 2R7QA 2VICA 2J7WA 2GHVC 3RZOK 1I6HK 2ZHAA 2XQCA 4DZ6A 2OPRB 4HEA9 3G4AA 1HNIB 4GTAA 2HMIB 2OP5A 4LR8A 1S4FA 3GTLC 2Y9HA 5BYQA 3W64A 2PA8L 2VBWA 3H0PA 2J76E 1QDUB 2VL1A 4OIRA 1UV7A 5T7LB 1ICEB 5AE2A 3HHEA 4HTIA 5DQIA 1RT7A 4QWCA 1RWXB 1WORA 1FJGJ 3VVUA 1HQ2A 4ANDA 2JSXA 2IVFB 4WFXA 5KFXA 1UZDA 5B08A 4BY7C 3PX0A 4R25A 2C3UA 1WQHA 1N33J 7FDRA 3DRYA 1UJ4A 4AQYF 3IBWA 2AZ1A 3G87A 1WDTA 2HRUA 1KFSA 4LK1A 1CJKB 4USKA 1O5JA 1AFJA 1F3VA 4KHPF 2QTWA 2OPPA 1UTAA 4RLEA 2HLTA 5KG1A 5A8KB 2R8JA 1HHQA 4Y2MA 1V5IB 3V81A 5D0EA 1EQMA 4YFXA 2E9TA 4YDDB 3HHLC 3ENAA 2P2CB 4H54A 1WKLA 2IDLA 2KHDA 4O3SA 1B0VA 3GFXA 3NUHA 4OHXA 3OR1B 4J9LA 4RR5A 1VCTA 4P72A 4P5AA 1BMQB 5C3EC 2WCXA 1TL3A 3TZWA 1S0VA 4ICLB 2FVQA 1X9WA 4F4AA 1MMLA 1JLEA 4P73A 3O5TB 5DLGA 2ZH6A 1U1LA 1NKBA 1PILA 2RU3A 3HFZB 2BOAA 4CLTA 1WKKA 4HH1A 2CZ4A 4B08A 2KN4A 4G0WA 5D3GA 5I42B 3Q83A 1R8PA 1X60A 3GTQK 3R2CJ 4CO3A 3RB4A 3VVTA 3PY8A 3CJ0A 1UJ5A 1JK9B 4A3IK 4CP5A 4U8VA 3M2RA 4I2QA 2BXJA 3IM9A 4AD6A 2ZJQQ 5C25A 4JI8F 4A3GC 2LECA 2ZZNA 4XLPA 2AGPA 3D54A 3ZTPA 3GIJA 3N6NA 1EETA 3FSIA 1JJ4A 4P2FA 2HZCA 3OJSA 3DLGA 2BQRA 4WKYA 3PRVA 4DUZF 3KLHA 1U1OA 5KG7A 1Q8LA 5HQLA 2R8IA 1ZXOA 5KTQA 2YQ0A 1YBUA 4RZRA 2LP4A 1R0AA 1FWKA 2E7WA 3S1MK 2GGPB 2RJZA 3GSIA 4HT7A 4ZH4A 4PG6A 4GFQA 2F1FA 3UPFA 3FC9A 2BJEA 2V4RA 1U1PA 3TJ9A 5L1LA 3I87A 1VJEA 1F6TA 1SQFA 5CZXA 4CH1A 2FGCA 1HMVB 3RZDK 4ZP6A 4I1TA 4I6WA 1K83C 2J7UA 3QX3A 4OX6A 5CHCB 2HNZB 4OJ3A 2PI4A 4DL6A 1FE0A 1RTDB 1YJ7A 2JA6A 3D1HA 4B9UA 2CPYA 3MM8A 4CLPA 1N5YA 2R7OA 1WTFA 2A6EA 5RUBA 4OJ1A 1EK8A 4AL7A 4NMLA 4KR0B 4K59A 2C22A 2QN6B 1HPZA 3NGDA 3NNHA 1R0BG 3OFEA 4DQRA 2G2ZA 1INNA 2A69A 2BACA 5HBMB 3S1TA 1JLFB 4AYBL 3KHLA 1IR1A 4RUBA 1W2IA 3QQCD 1O27A 1HHTP 4JI2F 1RADB 4ZVFA 4DQQA 4OZJA 4LFBJ 3MTJA 1XEZA 1H2TZ 3EUNA 4O3RA 3M8ZA 4DV6F 4ED3A 4ECVA 1LKZA 2XI3A 2DVIA 2C28A 3GTPK 4NLVA 2DHGA 2CUYA 1BWVA 2V8DA 4HHUA 1O28A 2Y1RI 3RB6A 1HD1A 2MZ1A 5IV4A 4KJIA 3CB4A 3N6MA 4KARA 2M5YA 4YHHJ 4C3JK 5B7WA 2HAIA 4X64J 2COLA 3IR6B 2XSJA 4A8YA 1MU2A 4FP9A 4YN3B 4ZVUB 1UKUA 5JUMA 3PDNA 2XMKA 3KUGA 4ZPWR 2FQQB 2A10A 1WC6A 5TJ3A 3ISNC 2OPPB 1FRMA 3R8YA 2CQCA 4XPCA 2CJ9A 1E6YA 3MPWA 1O29A 3TAMB 2RE1A 4FF4A 1M1HA 3V81B 1V3ZA 2W2PP 2N7YA 2ZM6F 4XTTA 1ZAVA 1UCNA 1X4DA 3H90A 3F56A 2I1RA 5C44C 5ETNA 1YIJS 5BXIA 4B9TA 1TL7B 2CPFA 1N48A 4DUYF 1XZPA 3VCDA 1RWUA 1FEEA 1TUVA 4DCPB 1AZSB 1S1XB 3CTRA 3KJNB 1NCLA 1WHYA 4M5MA 4CO0A 1S6UA 1AYEA 4YMEA 4IG0A 2RHSB 2IJRA 1N36F 2QGFB 5IM0B 3BO4A 3GJRB 1A6LA 4DV3J 3C15A 5K9FA 1WNEA 4I6YA 4HACB 3D5MA 3I0RA 1WCMA 2B56A 4FKXA 4NXNF 2EG2A 5IYDC 3PYEA 3N0CA 1RHRB 4TQRA 3K0JA 5C25B 2EBGA 4DR2F 2V6UA 1FX2A 4LRFA 3OUYA 3MR6A 1EI6A 4PCQA 4A3FC 3F73A 3SMZA 3GTGK 4PG7A 2IM0A 2XS2A 4DFPA 4Q43A 4OV6A 2JA5A 3C3LA 2YQ1A 2BBEA 3ZZUA 4LJMA 4WFYA 2VQEJ 4JOUA 1T9YA 3MURP 5F0WA 3U7JA 2F65A 2M2BA 3THVA 2NLWA 3BJYA 1DAXA 3CO9A 2AYMA 1LW2B 1S48A 2RSQA 1SL1A 3VV2B 1RQ0A 2HVIA 5HMXA 1HBMA 3B82A 3DN9A 3ET6A 2CZ9A 2BKOA 5L38A 2NREA 2ZZTA 1OMSA 1VBKA 2BE7D 3G2XA 2NVXK 5ETRA 4PWWA 4KMUA 1CJUB 3TVKA 4NASA 2R7WA 2WVCA 1JLBB 3RW6A 2PT0A 2CZVC 4O0IA 4AH6A 2J6TA 2W2MP 3MM8B 2N7CA 1HI8A 1HBUA 2P5MA 1VQOS 1N5YB 3RR8A 1V5VA 2MHNA 3HKZD 3I4HX 3MEDA 3JYTB 4FNHA 4WFAQ 3IWNC 1HPZB 3Q22A 2QL5B 4MEYA 5CCMA 4OZ3A 2IIHA 1H0HB 3Q3QA 1TWCK 3I82A 2GVZA 2F40A 2CFXA 2ZBCA 4KMDA 2DPJA 3MR3A 1HHSA 4Y2AA 1AB8A 1XBWA 3KJVA 4LF5J 1GTEA 1D9AA 2O5IA 1UFWA 2LQ9A 2E2IC 3OTOF 4RNFA 2BZ2A 1B99A 1S4EA 4A3MK 5KG5A 2QMWA 1NHKL 3W62A 1IBKJ 1OWXA 2FC8A 2N3LA 1XMQF 3FFIB 5E3AA 4A3DC 2ILYA 5C4XK 3UI3A 3PO3K 1XMOF 1KEKA 2GSUA 1FRXA 5CJ9A 5GMEA 2HHQA 3EQLA 2BW7A 1Q1KA 4K8RA 4N5SA 3MECA 2IY5B 5J2MB 2DHHA 3QBCA 5F3ZA 1HL6A 2XSJB 4XLNA 1FD2A 2YNIA 2E2HK 4KBIA 4H4OA 3FRYA 1I3QC 1KLMA 4JI6J 3DRSA 2GCFA 3Q2TC 4PG5A 3NAHA 4KY3A 4UUXA 3AQPA 3LUYA 2HHWA 2DIVA 2WBRA 4DMZA 2GVDB 3HOZC 4M1XA 4RW6B 2BM0A 1JIHA 3TP2A 4KFBA 4A3LK 4A93K 4KH0B 1XN9A 3FBFA 5H1SV 4EZ9A 1S1UB 1VJQA 5KFEA 2YKMA 4EEYA 4DR1F 3RB0A 2UXDF 2QYCA 4BBRC 2M3DA 2AJ2A 2HFZA 2OJ3A 2Z2ZA 2NZCA 3QAEA 4RWWA 2W2QP 3GTQA 1XNRJ 4FVCA 4MKYA 1JQGA 1FCAA 1QUVA 2ZOMA 3QFHA 2DEJA 4KHPJ 2NVTC 4N41A 2FHMA 5FJ4A 5AE1A 2RGRA 2ZWPA 3Q0AA 4IG0B 1K0VA 4MKBA 3C16B 1UMJA 4G7HA 2XI2A 1Z2ZA 3M8WA 3M4OC 1N32F 2LQJA 5ETTA 1OY8A 3LAMA 5M2PA 3UN3A 5IV3A 2WVBA 2KM8C 3OXFA 2NVYK 3EGVA 1C4AA 2AP6A 2MQQA 3W60A 1J98A 5B09A 4O44A 3I0RB 1KONA 2DO0A 2V4QA 2J6UA 3MEKA 1CVJA 1Y1VK 5MAOA 4TQSA 1T7PA 3ILOA 4KASA 2VG7A 4Q8FA 5GAEU 4NCAA 2ZDOA 3BP8C 4N8NA 5IYBC 3HOXC 1F9FA 2YKPA 4PWDA 3VGVA 1H72C 3GG1A 3R5GA 4CI0B 2X3DA 3FKIC 2XSFA 1Y5IB 1TR0A 5MLCV 4BWMA 3H0GK 4TLQA 3AFGA 2FJDB 2XZWA 4C8LA 4ZJLA 1JB0C 3H5UA 4EUVA 4JV1A 1LWCA 1O2AA 1WEZA 1H2VZ 3VGUA 1NH7A 4WFNQ 1VMBA 2MSTA 3GTMK 1PBUA 3ET6B 2MZJA 1OY6A 3EGNA 2W7AA 3A8KA 2HFOA 3E8OA 3AT1B 2U2FA 2KT2A 2M4MA 1UVIA 3K5LA 3UVJB 2BRLA 4EU0A 5KFYA 2GQ2A 3H2UB 5D4LA 1CC8A 1FF2A 1DCPA 3TZZA 2FVCA 1RT5B 2GMJA 4KT0C 2E29A 3ZNUA 3CD6S 1K8AT 1HBUB 4QYRA 2VA2A 1QVGR 2HQDA 2LU1A 5IWAF 1RTJA 1K47A 1XPPA 1JXVA 1IUJA 2CQHA 4Y52K 2DHSA 4MK9A 4K4TA 5FD1A 5HVHA 4OYXA 2KTQA 2U1AA 4OYAA 3VHQA 1GXTA 2HQIA 3M8PB 3R5AA 4ECSA 5TMCA 2GVZB 3K89A 3KJVB 2SXLA 3CMES 1IKWB 1IWGA 1G7CB 3TEGA 3BQ1A 1LWEA 2XY5A 2G0CA 1C0UA 2DT9A 5B0CA 4LK0A 3OVSA 4MMOA 6FD1A 1S9GA 5JJBA 5BR8F 1TU0B 1DTTA 4FKYA 2C42A 4WE1B 1UW9A 4A8XA 4Y65A 1YLXA 3CJRA 2AJ0A 2XG8A 3S1RC 1NAQA 3S2HK 1EFWA 2W25A 1K73T 3MECB 3JSBA 5GAGI 2YNIB 3VZHA 3DXBA 1M0SA 1ZM3A 1KHWA 4J9VA 5DZ6A 5H9FK 3HJFA 2MKJA 2VZ9A 1HARA 3DRSB 5FLMC 4CT8A 4DQSA 2CFAA 3VZIA 2QLFB 3A3NB 4BS2A 3ILJA 3RTVA 2ZFHA 1VLOA 3M9MB 1QY7A 3LAJA 4A3KK 4C4WA 1PIEA 2VC1A 1X5OA 2V8VA 3CVKA 3NS6A 3LO3A 3HHNB 4QW8A 4HI1A 3NNCA 4N47A 2WB4A 2RS8A 2Y0SL 5J1PA 4OI1A 3OR2A 2V2QA 2XZDB 2YKQA 3RR7A 4UF4A 2HEKA 4XCHA 5CZVA 3A8IA 3BBFA 1FD8A 2IRUA 3GP9A 2JA8C 2HK3A 1NPKA 1CJVB 3WC2A 1ZAXA 5KFIA 4ZCIA 4A8QA 3G8TA 1I6VA 2IM1A 2CWKA 4M5DA 1U25A 4ZVHA 3ELHA 3KG0A 4USMA 4A3BC 1EP4A 2QG9B 5EGYA 4P7TA 2D6FC 3BREA 3GTGA 3L9ZA 3CCUS 2Y1IA 3MM6A 2X1FA 1D0EA 2XLKA 4OI2A 3MCOA 2F7VA 1HW9A 2DTJA 5KT2A 2OO4A 3IR7B 2HBYB 1SPBP 5L1JA 3OL8A 4O44B 2WB1L 3VAKA 2EWHA 1U2FA 2HW3A 2JL9A 5FDLA 2DHAA 3EXYA 2ILZA 1NK0A 3R2DJ
chains in the Genus database with same CATH topology
3GSIA 3ADAC 1WOPA 4PAAA 3A8IA 2GAHC 5L46A 3GEIA 1WSVA 3GEEA 3GEHA 3AD9C 3A8JA 4PABA 4P9SA 1WSRA 1XZQB 3TTGA 1PJ6A 1YX2A 1XZPA 1PJ5A 3TFJA 1WOSA 1X31C 1WORA 3TFHA 1VRQC 1XZQA 3A8KA 1V5VA 1VLOA 3TFIA 3AD7C 1WOOA 3AD8C 3GIRA 1PJ7A 1XZPB 2GAGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GSI A;  3ADA C;  1WOP A;  4PAA A;  3A8I A;  2GAH C;  5L46 A;  3GEI A;  1WSV A;  3GEE A;  3GEH A;  3AD9 C;  3A8J A;  4PAB A;  4P9S A;  1WSR A;  1XZQ B;  3TTG A;  1PJ6 A;  1YX2 A;  1XZP A;  1PJ5 A;  3TFJ A;  1WOS A;  1X31 C;  1WOR A;  3TFH A;  1VRQ C;  1XZQ A;  3A8K A;  1V5V A;  1VLO A;  3TFI A;  3AD7 C;  1WOO A;  3AD8 C;  3GIR A;  1PJ7 A;  1XZP B;  2GAG C; 
#chains in the Genus database with same CATH topology
 1L3U A;  1S6P A;  3DM2 A;  2OTJ S;  4RBU A;  2OUG A;  4W90 B;  1IJE B;  2PMH A;  4FF1 A;  3HOV K;  5HAN A;  4BXX C;  2B3T B;  3HF5 A;  3BR9 A;  4MK7 A;  4PWD B;  4YY3 F;  4YB1 P;  1GH8 A;  3J80 Y;  3M05 A;  1N36 J;  4G6V B;  2YKN B;  3QJJ A;  2NVX A;  3T6B A;  2BJ3 A;  1NSA A;  4TKT A;  2H9Z A;  3GWC A;  5HAO A;  3D6M B;  4C3I C;  4A8K A;  3UCZ P;  1UEU A;  4UST A;  5KFK A;  1LWC B;  3LGM A;  1KWM A;  1REG X;  3GU0 A;  2JA6 C;  2HAF A;  2R7Z A;  1IBM J;  4WU2 A;  2VON A;  1RHM B;  3TA2 A;  2KG1 A;  2F4V J;  4NA2 A;  2C2Z B;  4NCG A;  4GKJ F;  3HJV A;  2OH2 A;  3PKM A;  4G65 A;  4YQW A;  3TEH B;  3GTL K;  3NWR A;  2IBO A;  2HUR A;  4NLG A;  1LFW A;  2Q6C A;  1XER A;  2JJ4 D;  2CQ4 A;  2V5H G;  1YKW A;  1NND A;  1RAC B;  3LP1 A;  2NR0 A;  1U0H A;  3BP3 A;  3TZX A;  5KFF A;  5KT7 A;  3EZU A;  4BY7 K;  1Q81 T;  3KNA A;  2HHP A;  4ED2 A;  3ZZT A;  2VBY A;  4F4X A;  2KKH A;  2PFF B;  3CAG A;  2AW0 A;  2I5J A;  3RUB L;  5IC4 B;  3OLB A;  3PW0 A;  4B9M A;  3VAF A;  2JZ5 A;  2KJW A;  4PZV A;  3BO2 A;  4ZLL A;  1QSS A;  3HO1 A;  5AXK A;  3SCJ E;  5L8R C;  2R9L A;  5KT3 A;  1DLO A;  2MZT A;  3FNN A;  1NLK L;  3BH6 B;  2E2H A;  3OPF A;  4FYW B;  4ZKA A;  1WC5 A;  3J7Z 5;  3ZZR A;  3KJQ B;  4LSL A;  2NXJ A;  1DTT B;  2P8T A;  3PJX A;  4NLP A;  2MKI A;  1T11 A;  1JLQ B;  1DQ9 A;  3NGU A;  2J6S A;  4QIG A;  4O3Q A;  2RNE A;  5C3E K;  2V4J A;  2DGW A;  3MZI A;  1S1T A;  2R92 A;  4X4U A;  4JK1 A;  3IWX A;  1WJ9 A;  2Y8Y A;  3QYY A;  4LIW A;  1WQG A;  2IRY A;  4QWA A;  2W9C A;  2HIY A;  4DG1 A;  3JTP A;  5HJX A;  2PC6 A;  4TU9 A;  2OAU A;  2OHD A;  1J6X A;  2A2D A;  2Y1J A;  1S0O A;  4F2R A;  1SCJ B;  3UO0 A;  2LDY A;  1RT3 B;  4JBC A;  2FY1 A;  4OYO A;  2RH6 A;  3W8P A;  3HOU C;  1DQA A;  1V9O A;  3SQG A;  5KFJ A;  1Q8K A;  4A3G K;  4ILM A;  3DC2 A;  1LXN A;  1Q95 G;  2XTJ P;  5AT1 B;  1M5O C;  4PG8 A;  2DO4 A;  4HKQ A;  2IM2 A;  3PO2 K;  4L72 B;  3UFC X;  1Q5Y A;  4K7Q A;  4RW8 A;  2EC0 A;  5DQG A;  1R9T K;  1YBT A;  2R93 C;  1TAQ A;  2DR5 A;  1WCM C;  2O1P A;  3CIZ A;  3MD3 A;  4P10 A;  3KHH A;  4DX7 A;  4M5D B;  2V2V A;  4ETZ A;  1HWI A;  3LAL A;  1RHK B;  3EYZ A;  4DL5 A;  4WJ4 A;  4PAA A;  4KGK A;  1TTH B;  1LQ9 A;  1EP4 B;  2YWF A;  3KLE A;  5DDP C;  1JJH A;  4Y00 A;  1HI1 A;  3MM6 B;  2IVY A;  2W9A A;  2JA5 C;  4F0H A;  2I2Y A;  2UXC F;  2WSE C;  3BGR B;  2X7I A;  2DNR A;  4U9R A;  2YNH A;  4DL3 A;  2GSN A;  4OHW A;  2D9P A;  1X4H A;  5FDL B;  4ZVP B;  4DV7 F;  1ZZN A;  4CCH A;  1UA1 A;  2YY3 A;  2ZH9 A;  3SCI E;  4P71 A;  1HQU A;  3MM9 B;  1FJ7 A;  2YX1 A;  3TUI C;  3GTM A;  2XGQ A;  1DQ8 A;  2VIH A;  2IA0 A;  3P5B P;  5A8W A;  2UVW A;  2ZIT A;  4WFB Q;  4M5K A;  2IAJ A;  2D41 A;  4LR7 A;  2DR7 A;  5KFR A;  1R31 A;  4C45 A;  1N32 J;  4GT9 A;  1QLN A;  1FRJ A;  4H4M A;  3FOE A;  3WC0 A;  5AE3 A;  4MKV A;  3NG8 A;  4DR4 F;  4JI4 F;  4J9O A;  1RAJ A;  2UV8 G;  2NVQ K;  4YP3 A;  4ED6 A;  4ZA1 A;  1YJU A;  2OGU A;  1GX6 A;  4PUO A;  1I6H C;  3JQK A;  2GW8 A;  3CDW A;  3CJ4 A;  1O2F B;  4NCG B;  3R3T A;  1NDC A;  2KVQ E;  2CNK B;  3MCN A;  1ZPW X;  1RTH A;  2AJ1 A;  3DYA A;  2FQO A;  2WTF A;  4IOA Q;  3MEG A;  5GAH U;  2FVS A;  4O3P A;  4X84 A;  1H73 A;  3IN5 A;  4NRU A;  1S12 A;  1Y5L B;  1N5S A;  2ALY B;  2LXU A;  2UUB J;  2RB7 A;  3BKT A;  1D9F A;  2APO A;  2I0X A;  3FEX B;  5LXR A;  2P9G A;  3JTO A;  2B5J A;  4M8L A;  1H7X A;  1RU1 A;  4EMD A;  2W9B A;  4NLT A;  4NXM J;  2PMW A;  1N54 B;  3MGJ A;  4ZLJ A;  3D28 A;  5HRO B;  2V0N A;  4U8Y A;  2RU9 A;  3H42 A;  3MXH P;  1RJJ A;  4U7U D;  1RAI B;  1JOE A;  1WEL A;  1RAG B;  3T5J A;  2MQ8 A;  4P75 A;  2RVJ A;  1DLO B;  2MLY A;  1SKS A;  3SYZ A;  1A9N B;  1IKY A;  1RUS A;  3ICL A;  4GVL A;  5KFP A;  1YJW S;  3ZZO A;  3V2U C;  3Q86 A;  1WEY A;  4OL8 A;  3HXA A;  5B0D A;  2O5D A;  1U45 A;  1LNQ A;  2BQ3 A;  1ZOT A;  1ZA1 B;  5C44 K;  4LSL B;  1SJ1 A;  2MEW A;  3TAN A;  2XM3 A;  1VQ9 S;  1USO A;  4DX6 A;  2RKI B;  2E5L J;  4OZ5 A;  2IC3 B;  1L3S A;  3PTW A;  2CDQ A;  3KFW X;  4PYA A;  1HA1 A;  2D3O R;  4NI2 A;  3TX0 A;  3BKU A;  3HSG A;  1RAA B;  1S1T B;  1N6Q B;  4F7V A;  3HZE A;  2N3O A;  3BSO A;  1L5U A;  4LF7 J;  1C0A A;  1FXL A;  3RRK A;  1KOO A;  4DV5 F;  2BE5 A;  5KFN A;  2DIT A;  1QTM A;  2NYI A;  4UT4 A;  2EPI A;  4J5O A;  4JUZ A;  1YIT S;  3RG6 A;  1FKP A;  4C3L A;  5D4N A;  2CIM A;  2LKZ A;  5EX0 A;  3BR8 A;  1XIQ A;  1J5O B;  3I6P A;  1JKH B;  5BR8 J;  3MWB A;  3AOD A;  5K14 A;  5IYD K;  3I9V 9;  4OX8 A;  1TKD A;  4MKA A;  3SQG B;  4P6Q A;  5IOT A;  4L76 A;  4A3F K;  2MB0 B;  1BHN A;  4I7F A;  5LSR A;  1ELO A;  1KS2 A;  3Q8Y A;  4RNN A;  2MQL A;  4L75 A;  2EKN A;  1UET A;  3W63 A;  1P1L A;  3BPS P;  2OFH X;  2MKC A;  1MN9 A;  1DAR A;  1C1C A;  3M8Q A;  1URR A;  1TWG A;  1F5A A;  2DNO A;  2EK1 A;  3PJW A;  1U24 A;  3BB5 A;  2BJ7 A;  1B7Y B;  1HWK A;  4S0M A;  1TEL A;  4I69 A;  1TFW A;  3S1M C;  4KB4 A;  2KXF A;  4DWI A;  3CJS A;  1PJ7 A;  1PC4 A;  3W1Y C;  3KLE B;  5JVO A;  1DY3 A;  2AWZ A;  3RBD A;  1X5S A;  1RHU B;  4CQ1 A;  1QD1 A;  3MUT P;  3MCS A;  4MIW A;  5HVG A;  2C2E A;  4M5I A;  3UN2 A;  4DR3 F;  1NSQ A;  1GE9 A;  3J7A 1;  2YNH B;  3MFI A;  1ZBT A;  2FUG 9;  3DDN A;  4KAW X;  4I56 A;  2AZ3 A;  4CNY A;  1WD6 A;  3M6V A;  2CNL B;  1QAJ A;  2MKH A;  1X9S A;  2UUC F;  4DN0 A;  2VG5 B;  1LWX A;  3IG1 B;  3L4J A;  4CLW A;  2NXU A;  2WW8 A;  5A8W B;  3KK2 B;  3Q24 A;  2NPF A;  4ECY A;  2IAJ B;  2K1R B;  2BJD A;  1FNX H;  4V1A k;  3ISN D;  4B3S F;  3GTL A;  5D4O A;  3ONQ A;  1YBA A;  4LVO P;  1R8B A;  1REV B;  1VC0 A;  4USV A;  4H4M B;  4ZIT A;  1SIW B;  4Y2C A;  4DV1 J;  2MPU A;  3JSY A;  1KTV A;  2I6W A;  1EZZ B;  1IM4 A;  2DRA A;  2POK A;  3B4M A;  4ELT A;  2E2I K;  2CJX B;  2PEH A;  2CQ3 A;  1TWF A;  4NLO A;  4ECZ A;  1FVS A;  1KDN A;  3IWL A;  4G0U A;  4FPI A;  3DRP B;  5M5W K;  1IR0 A;  2AF6 A;  2ZKU A;  2AMC B;  3K2Y A;  5SUH A;  4A3D K;  1RTH B;  2DEI A;  1G6B A;  4CH0 S;  5EGE A;  2VV5 A;  3UD3 P;  2D3U A;  3UDL A;  1O26 A;  4B02 A;  1T8E A;  3DHX A;  1JX4 A;  2QJ3 A;  2B9E A;  1ZAW A;  2LQB A;  4RBV A;  4LBI A;  4DR6 F;  2RAQ A;  2B5J B;  2W9B B;  5KFQ A;  1I3Q K;  2L48 A;  4M5N A;  2YWK A;  2RF2 B;  4LFC J;  2IA6 A;  4U96 A;  2CRL A;  1TK0 A;  4NLQ A;  4ED5 A;  5F0U A;  1F93 A;  3HHK A;  3IGN A;  2OEM A;  1N56 A;  1VIS A;  3G4C A;  2WRM A;  3NKY A;  3UE2 A;  2V63 A;  2EFG A;  1CLF A;  1P9Y A;  2EK6 A;  3MM7 A;  4I2P A;  2LA6 A;  3OHB A;  3FQL A;  1IKY B;  3MCM A;  4LRA A;  4F50 A;  3HKW A;  3FBB A;  1EIY B;  2WVF A;  1KNZ A;  2Q6B A;  1TKX B;  3L7P A;  1YZ6 A;  3T19 A;  1S9F A;  4B3O B;  1WHX A;  2E1R A;  4HYK A;  4BBR K;  3NY0 A;  4B9S A;  3HSZ A;  2UXB J;  1G4C A;  1VBY A;  5KFB A;  1U6F A;  4ZP9 A;  3QGP A;  4DX5 A;  2IMO A;  3G6X A;  2Q66 A;  2NVT K;  1YNJ A;  3FEY B;  3U1L A;  2ZH1 A;  1YI2 S;  2IBK A;  2R7V A;  2E1P A;  3W65 A;  2JFK A;  3TR5 A;  1P1T A;  1Z4U A;  2BAN A;  1RCX B;  3AAW B;  3M2U A;  3M4O K;  4WFZ A;  3C14 A;  4A47 A;  4DI6 A;  2F3J A;  2XEX A;  4KIA A;  2JC1 A;  3D7S B;  3LPY A;  1XNQ F;  4LR2 A;  4FBU A;  4ZCL A;  1U0S A;  1R9T A;  2IJN A;  1Q79 A;  3PR4 A;  3QT5 A;  3TX8 A;  2LEB A;  3VAJ A;  3HD1 A;  1TKZ B;  1TWH K;  3T01 A;  4KPC A;  1P27 B;  1FFG B;  3HD2 A;  4CO2 A;  2D74 B;  1K44 A;  2MDA A;  1KVJ A;  5IOQ A;  1KP6 A;  2VG6 B;  5IYB K;  3QT6 A;  3E3X A;  4IQX A;  8RUC A;  2HHU A;  2HQF A;  2NCK L;  1F5C A;  2BM1 A;  2Q3P A;  3FKI K;  2HGN A;  3MOJ B;  4ID5 A;  2G9O A;  3GLJ A;  1CUL A;  2B9W A;  2BAB A;  1IQT A;  4KM9 A;  3H5S A;  2V9W A;  4K4U A;  2I9S A;  5C2C A;  1X31 C;  2GZO A;  5EX3 A;  3GFZ A;  1QE1 B;  2OEJ A;  3ZZY A;  1NDL A;  5B0A A;  2XLI A;  1TK5 A;  3R7B B;  2Y3P A;  1LW0 A;  5M5Y K;  3L95 X;  3MF5 A;  4GVB A;  4B9V A;  1NHU A;  3H40 A;  4B17 A;  1N34 F;  4ZHR B;  3L09 A;  4CT9 A;  3PW2 A;  4EYI B;  5GMD A;  3HT0 A;  3TUJ C;  2LEA A;  1X5P A;  4WCE Q;  3QZ7 A;  4X66 F;  4WTY A;  4A4J A;  1S0M A;  2GSO A;  4U7C A;  2R7Z C;  1L0W A;  1SKU B;  4PQA A;  4ITS A;  1VDH A;  1TQL A;  4DV2 F;  3LH2 S;  1HBO B;  1B70 B;  5J2P A;  2MYF A;  2VOO A;  3LPX A;  1APS A;  1XTZ A;  1GQE A;  1RTI A;  3M6X A;  4UZC A;  3CCL S;  3ZTO A;  2HQC A;  4C3K A;  1C1B A;  2PE8 A;  3MMC B;  1RE1 B;  2V9K A;  4YUD A;  5CYQ B;  3TA0 A;  2OTL S;  3FK4 A;  1EQR A;  2KDO A;  5A0Y A;  2Z2L A;  5C2G A;  1G3O A;  2EFN A;  2YNG A;  3DGP A;  2HSE B;  2DNG A;  3WOD A;  4F4Y A;  4NE9 C;  4ZIW A;  1VRQ C;  3OVA A;  3AD7 C;  2CQP A;  4LF2 A;  3Q8U A;  5B0F A;  1DRZ A;  1U1N A;  4BBS C;  1UFL A;  2IYI A;  2PGC A;  3SZZ A;  2WOM B;  1FFS B;  3S1R K;  3FZ2 A;  2QA1 A;  1FHT A;  1S7H A;  4ZJQ A;  2J0Q D;  3KHG A;  3C66 A;  3UNY A;  3HHL B;  4MJK A;  2HVE A;  2E2H C;  1X4A A;  1XR6 A;  3TAQ A;  3CED A;  4JI5 J;  1NBE B;  1RWM B;  4AXJ A;  4NEZ A;  4JYA J;  2JX2 A;  4OIQ A;  4P7V A;  2EW9 A;  5DGA A;  3S2D C;  1VRU A;  3CPW R;  2Z8Q A;  3W61 A;  4ELV A;  3BDP A;  3OBI A;  4CYU B;  2AT1 B;  3KK3 B;  2G1H A;  2PMZ D;  2MQM A;  4I2P B;  3LGH A;  2CAJ A;  2R92 C;  3RRH A;  1KLN A;  3GTK K;  2AYB A;  1N52 B;  4DPT A;  1FKO A;  1SUQ B;  2XCQ A;  2A18 A;  2EBB A;  2HGL A;  2LFV A;  2DNZ A;  4PEO A;  2B4P A;  2HHH F;  4LFA J;  1FXD A;  1ZET A;  1NPR A;  4K4Z A;  2BR0 A;  4QIE A;  2E7X A;  3LGN A;  2H5E A;  2V6A A;  1HWJ A;  2WW4 A;  4DV4 F;  3GCX P;  3CDE A;  4A3B K;  4LF4 J;  1N4L A;  3D6T B;  3M2U B;  2BJ1 A;  2VD3 A;  4ZVE A;  3G8Q A;  1KC8 T;  3NCP A;  3LP0 A;  2VF3 A;  3NS5 A;  4DCJ B;  2L08 A;  4ZPD A;  1NME B;  4K0K J;  2M70 A;  2DJW A;  5H9E K;  3GYX B;  3H25 A;  2YPZ A;  1SC6 A;  2CJY B;  3VA7 A;  3KLF B;  3HOW C;  2J0W A;  4WYW A;  1JMT A;  3MR7 A;  4E0D A;  1RLD A;  1VQ7 S;  2B63 A;  4N8O A;  3SV4 A;  2Q43 A;  4BXX K;  4EO6 A;  4ED0 A;  3RJM B;  3ZO7 A;  3IS9 B;  4LRC A;  4NL5 A;  3M9O B;  4IKA A;  3EDR B;  2GJI A;  4GKK J;  3THT A;  3C6U A;  1CUL B;  4C3I K;  3JS9 A;  3HLU A;  4PXD A;  4PPZ A;  3ENV A;  2JA6 K;  3KDN A;  3BKF A;  1T95 A;  3DI6 A;  3GIM A;  2XO6 A;  5IC6 B;  2DNY A;  2MKY A;  2DCL A;  3CCT A;  3HSJ A;  3G6Y A;  2HLU A;  1Y5N B;  5E0O A;  3OT9 A;  2AJ4 A;  2L9D A;  1WF2 A;  3B54 A;  3BYP A;  4OYM A;  5KFA A;  3N0V A;  2UVV A;  4F3Q A;  3CCJ S;  4QYZ J;  2HFU A;  3BQ0 A;  1S1V A;  5IT9 U;  2CQ0 A;  1ZA2 B;  2FDN A;  1RTI B;  4DSL A;  3AXM A;  2W1B A;  4A48 A;  4O2D A;  4DR5 J;  1FK9 A;  3NGK A;  4E2F B;  1PG5 B;  4DR3 J;  3W66 A;  1R8C A;  5AXN A;  2PA3 A;  2K7J A;  3B8H A;  2HND A;  3H8Y A;  3WQP A;  3M8R A;  2CNN B;  2KYX A;  2YNG B;  3DGP B;  3I5C A;  2XMA A;  4DV0 F;  1I3Q A;  3M2V A;  2YTC A;  1BQX A;  1HNZ J;  4OLO A;  4GZY A;  4OJH A;  3Q23 A;  1I1G A;  4QPT A;  5KFO A;  3VAI A;  1RWW B;  4OX9 F;  5LMU F;  1SJF A;  1NUE A;  4RW7 B;  2WAQ L;  3C2P A;  3K5M A;  2MSS A;  3KYL A;  3PIO Q;  5J2Q A;  1U26 A;  3A8J A;  3C6T A;  3OFF A;  1HQM A;  2B4V A;  2F9J A;  4LT6 A;  4RU9 A;  4XK8 C;  2NS1 B;  2ASL A;  3ZZ0 A;  1YRU A;  2F5G A;  1OSD A;  3G82 A;  4HI2 A;  2VHG A;  1SC4 B;  1RP5 A;  1X5T A;  1FWP A;  2OEL A;  3M1V A;  4HHH A;  1UVK A;  5KG0 A;  1NSK L;  4TLR A;  4ELU A;  4LRE A;  3V4I B;  4Q0B B;  1NM2 A;  4PXE A;  1VRU B;  2HFV A;  3BDE A;  1GFW B;  4HL9 A;  4JV5 F;  4X2B A;  4OHY A;  4A3E K;  3DXJ A;  3HOU K;  1N8R T;  1JLG A;  3AQO A;  1B4B A;  1ZVU A;  2RUS A;  3POT B;  1NPP A;  4PQU B;  4YS2 A;  4YFK A;  3JSR A;  4KRW A;  2KXH A;  4ZP8 A;  2P6S A;  4MYT A;  1TKT B;  5D0R A;  5ETP A;  4QJV A;  4DUT A;  2ZUG A;  4JI7 F;  2R93 K;  3OEP A;  1JLA A;  2YNF B;  4WZM A;  1ARO P;  3U02 A;  3C8Y A;  4X65 J;  1Y11 A;  1A0O B;  4ZLP A;  3DFE A;  4I67 A;  2RHQ B;  1I94 F;  1TWH A;  1L3V A;  1HBN B;  4KB2 A;  2DHX A;  4HH0 A;  5G0R A;  2B7B B;  5T41 A;  4IFY B;  2R7U A;  3LP0 B;  4QIF A;  5ETQ A;  1Q5V A;  4C7Q A;  2JA5 K;  2GIQ A;  4KTQ A;  3DOM A;  1WF0 A;  3NCR A;  2L9W A;  5JVH Q;  5J2N A;  3ZTR A;  1T03 A;  4HR2 A;  1EHW A;  3EVO A;  1TWG C;  3DLK A;  3PFO A;  2UU9 J;  5J1E A;  4A8S A;  1OQ6 A;  1VIO A;  4J9M A;  3OXG A;  4DFK A;  1RT6 B;  4RW9 A;  4CLS A;  3KUE A;  3UDC A;  3RAX A;  2RIJ A;  3RRG A;  1FE4 A;  2V34 A;  1BJT A;  4LF9 J;  2RDJ A;  1SFO A;  2XS5 A;  3W7B A;  4Z7C A;  3VR1 A;  4G1P A;  3VTI A;  3TQ1 A;  4FYX B;  3NLC A;  3D0G E;  3FMW A;  5M5X K;  1RKI A;  1YHQ S;  3D67 A;  2VPW B;  1HI0 P;  3FBC A;  1RT1 A;  3DRR B;  1S59 A;  1N5V A;  2B0G A;  1VHI A;  1S6O A;  3QWU A;  4CH7 A;  5I3P A;  5A76 A;  2B4U A;  4JI1 J;  2X1G A;  2AU0 A;  4PXB A;  3QGH A;  3LPE A;  3KMS A;  3DMJ A;  1O51 A;  5C24 B;  3I0S B;  1TAU A;  2XMM A;  3GPA A;  1F7U A;  4KM8 A;  3ITH B;  1Q86 T;  1X7V A;  2ZE2 B;  3CCV S;  4J9R A;  3LP2 A;  2MMY A;  3CD5 A;  5I3U A;  4P5B A;  3J81 U;  4MFB A;  4CNZ A;  2KT5 A;  3CJK B;  2WK4 A;  4UOG A;  1TWF C;  1BQM A;  4WKR A;  1CS4 B;  1S1V B;  1SJR A;  1URN A;  3NOG A;  2J0X A;  3T1Y F;  1WHV A;  3MEE A;  2A68 A;  4BY1 C;  4NLS A;  2ZNY A;  1UP1 A;  2P9E A;  2B8P A;  1PGZ A;  3CMQ A;  1VQY A;  1FK9 B;  3BN4 A;  3RU0 A;  3AHP A;  1U48 A;  3ETO A;  3VAG A;  2ALZ A;  2EXU A;  3T9N A;  2MZS A;  4GC6 A;  5J1N A;  1I51 B;  1PJ6 A;  1U47 A;  4C6A A;  1X8D A;  3AY0 A;  4U67 Q;  2ZOF A;  4C0H A;  2CJQ A;  2DCU B;  5CYJ A;  2JA7 C;  4KO0 A;  1AUD A;  1BS2 A;  2LMI A;  2X51 A;  4KB7 A;  2GML A;  2Q79 A;  1GAO A;  1OPI A;  2HQ3 A;  2XWX A;  3Q8S B;  2DXD A;  4RUH A;  1VBX A;  5F8I A;  3QLH A;  4NMX A;  3QMQ A;  2UZA A;  1FRH A;  5J2Q B;  3QID A;  3I5A A;  5LM7 E;  4QCL A;  4G1I A;  3GTO A;  1MMN A;  1UVJ A;  2M0G B;  3QO9 A;  4LVN P;  4MH8 A;  3G6E S;  2J9D A;  3G82 B;  3I96 A;  4EYH B;  1J2V A;  3GTK A;  3M1V B;  1J5E J;  3R9L A;  2BE2 A;  4JI0 J;  1F7V A;  4QW9 A;  4D3G A;  1EX8 A;  1Z1Z A;  1DD5 A;  2VQF F;  2D9O A;  3KLG A;  3ENQ A;  4KQZ A;  4B3R F;  2YH1 A;  5DS7 A;  1RT4 A;  2JLE A;  2XNR A;  1BQN A;  3SFG A;  1R89 A;  4N7T A;  5IT4 A;  3W9H A;  4QWD A;  5IS2 A;  4Y3C A;  1EAY C;  1H7W A;  1SBR A;  3TRG A;  3Q2S C;  3PO2 C;  2KM8 B;  3LA0 A;  2AX1 A;  1GK8 A;  3ADA C;  4XDC A;  4MAK A;  1JLA B;  1R9T C;  2QLX A;  1UPM B;  2DNK A;  2DH8 A;  3NCQ A;  1R6V A;  2J9C A;  2KL8 A;  2ZH5 A;  2E44 A;  3T5K A;  1BY9 A;  1E6V B;  4IO9 Q;  3MDF A;  3ZFV A;  3GIL A;  1Q16 B;  4B3T F;  3ZTS A;  3DOM B;  1QTN B;  5J2N B;  1T0T V;  2FC9 A;  3M30 A;  1IL2 A;  5L9X A;  2ZNZ A;  2LDI A;  1DUR A;  2IVM A;  3DLK B;  3T5L A;  1F5B A;  5DQH A;  1D09 B;  4IRC A;  1V3R A;  4RW9 B;  4QZV B;  2Z30 B;  4U6P A;  5D78 A;  3D68 A;  1YSJ A;  4WP3 A;  4URG A;  2Z4P A;  3QRR A;  2NXN A;  3H5X A;  3DHW C;  4GTB A;  3EPI A;  4FPR A;  4LBH A;  4KN7 A;  5KFT A;  1HR0 J;  5F8L A;  3KLI A;  4TN2 A;  3OD2 A;  3T1H F;  2DIS A;  1VQL S;  5K5M A;  1PCA A;  1LEO A;  1X4F A;  2KU7 A;  2L3M A;  5LL6 d;  3R7N B;  4OJG A;  2NVQ C;  3HPO A;  3P49 B;  2YU9 C;  2CPE A;  4X4N A;  1RWP B;  3NNA A;  1RZM A;  3DMJ B;  1CQM A;  4ZVG A;  3H2L A;  3PG9 A;  4DLG A;  4CLL A;  3GV8 B;  1R8A A;  3WDO A;  4LF6 J;  2QL9 B;  4EK2 A;  3G9C A;  3SV3 A;  1YG0 A;  5A6P A;  5I3U B;  4C8Y A;  3P4U B;  2QEX S;  2ZBQ A;  1Q7Y T;  4PR6 A;  1RT7 B;  2GAG C;  4LF8 F;  4MFB B;  3V6J A;  4ENO A;  4YG2 A;  2CG8 A;  3CT9 A;  1B7F A;  1Y4Z B;  5KFW A;  5HVF A;  5LT5 A;  1BQM B;  2B9Y A;  5AJ3 F;  3KDO A;  2F9D A;  3MEE B;  5CYM A;  3CCZ A;  4PWU A;  4USH A;  3K7R A;  5DRK A;  3DLE A;  2B51 A;  1VGX A;  2X1B A;  2VU5 A;  1GX5 A;  1EAR A;  3N6L A;  4R0E A;  2WON A;  1VBZ A;  1U6B A;  4G7O A;  1YDL A;  2C2K B;  3RBE A;  2NXE A;  3RW7 A;  4J3N A;  5DLF A;  3HZG A;  1I3O B;  4PPD A;  4F02 A;  1CJT A;  3DU5 A;  4F0M A;  1SH3 A;  4KO0 B;  2NPI A;  1U09 A;  1N33 F;  2HQG A;  2ZBI A;  3MMA A;  1YRX A;  3KK1 A;  2BE9 B;  4ZVT B;  1FTR A;  1Y0H A;  4O4R A;  3HMJ G;  3MM5 A;  1P9Q C;  2NYH A;  1HFE L;  2MQO A;  1S9E A;  5F9L A;  4NLD A;  4IDK A;  2AGQ A;  1TL3 B;  1KFD A;  4FF2 A;  1YJN S;  3T5H A;  1R7I A;  3TVY A;  3EE3 A;  1JLE B;  2BYC A;  1WI8 A;  2FGO A;  4ILR A;  2Y1L B;  2VBZ A;  2C3Y A;  2BE2 B;  5F9N A;  1RGV A;  2KFZ A;  3SSS A;  5D3G B;  5EGH A;  4N77 A;  4DL0 C;  2OLW A;  4E98 A;  2R93 A;  2ASY A;  4BHQ A;  1M1K T;  4O3N A;  3NWG A;  1YK9 A;  5KOW A;  3PHT A;  1RT4 B;  3M2R B;  1BQN B;  4I2Q B;  3ETM A;  5LMU J;  2ZWO A;  4M5H A;  2HG4 A;  3FVY A;  2LQ8 A;  4X4Q A;  3R1H A;  1CSJ A;  2CPH A;  2F4F A;  3WX4 A;  2R8K A;  1EET B;  4P9S A;  1XC9 A;  1OJ4 A;  4QWE A;  2ASJ A;  1TUW A;  1HWU A;  3TFJ A;  3OSN A;  1IBL J;  2RDD A;  1DCH A;  3DLG B;  2O3D A;  4RX6 A;  3N3Y A;  2R2S A;  3TFI A;  3B78 A;  3NL0 A;  3KLH B;  2HWT A;  4FYV B;  2JEI A;  3L3C A;  3ZZP A;  4HDH A;  2M8D B;  2VA3 A;  2I38 A;  1R0A B;  4RWX A;  2LU2 A;  1RB0 A;  2B63 C;  3EGZ A;  3N79 A;  4YFN A;  1CBK A;  2VFT A;  2Z56 B;  4K4W A;  4IH7 A;  3T1A A;  1VI7 A;  3IBF B;  2EFV A;  3M30 B;  1IS1 A;  2P9C A;  1K0T A;  2K7K A;  3N9U C;  2MLX A;  3GJQ B;  2K06 A;  4FN5 A;  4F3O A;  3KJF B;  3HM9 A;  2GO9 A;  3DGV A;  3OJU A;  4A3C K;  2R7Z K;  5E41 A;  2VKR A;  3CJ3 A;  4URQ U;  1VYA A;  4OMF G;  1CC7 A;  2QMX A;  3KLI B;  3PRD A;  4DR7 J;  3GV7 B;  1RA6 A;  6AT1 B;  2K3K A;  1MWQ A;  2KVI A;  2JEJ A;  1IWA A;  3QIP A;  1KTQ A;  1U8S A;  3KG1 A;  3R6G B;  3T6J A;  2CQB A;  2FPH X;  4CWB A;  2C3P A;  5HSP A;  3CW2 C;  5DG8 A;  1C0T A;  4GTE A;  3TYT A;  3HKZ L;  5CCL A;  1UWA A;  2BKN A;  2K3I A;  5D6G A;  2ROG A;  3CF5 Q;  4BBS K;  2QA4 S;  2ROP A;  3EXC X;  3NGR A;  2V94 A;  2VAS A;  1U1Q A;  1WQF A;  2XMU A;  3BZQ A;  4KV8 A;  3JST A;  4CTA A;  2XLJ A;  4LFB F;  1TL1 A;  1N88 A;  5KFL A;  1SV5 A;  3HDS A;  1AA1 B;  3W8G A;  1MU2 B;  1HNX F;  1KR4 A;  1NDP A;  3PHE A;  4AE5 A;  4DPU A;  4R5P A;  3N0B A;  1XQI A;  1OS5 A;  3L7O A;  5CYM B;  1NZA A;  1ZS6 A;  3AOC A;  5KFV A;  3FCV A;  4J90 A;  5U47 A;  4C11 A;  3PW7 A;  4LRB A;  5F3T A;  3SI8 A;  2F8M A;  2W4P A;  5FLX U;  1RU0 A;  1VQ4 S;  3CNQ P;  3HVA A;  4OHV A;  3S2D K;  2WON B;  4X6A C;  2CQI A;  3K5N A;  4RBT A;  1E6Y B;  1WC1 A;  4YHH F;  5LJ5 Y;  4X64 F;  1PC5 A;  5L39 A;  4Q7A A;  4AT1 B;  2R92 K;  2OSQ A;  4QIW D;  2H51 B;  3KKF A;  3BBC A;  4F4Z A;  4R8U A;  1HIY A;  4C8Z A;  4W98 A;  1WSV A;  1IKV A;  3MMA B;  1GMW D;  2MY7 A;  5IQQ A;  2W24 A;  2FVR A;  2FZK B;  3GZ7 A;  3T1Y J;  2R2R A;  5L1K A;  1QSL A;  2OPR A;  1RXO B;  3U1N A;  5BJR A;  3UR3 C;  1Y1W K;  1XZP B;  4AQY J;  2HMI A;  1N0U A;  4X4V A;  2X1A A;  5DDO C;  1RCO B;  1ZYQ A;  5GAD U;  5JMN A;  3H98 A;  1FNM A;  5T7L A;  3P6Y C;  1S49 A;  4RW4 A;  2FJW A;  2UUW A;  3B6B A;  3NOC A;  1IQZ A;  3BSN A;  2CW0 A;  4C8N A;  3C15 B;  4CDI A;  2F8H A;  5GAG U;  2WSF C;  1T9W A;  5L9N A;  5CD4 H;  3OXL A;  4K5S A;  2ZJR Q;  1CJK A;  1X0P A;  3CUN A;  3HOW K;  3JXO A;  4LQ9 A;  4OZ0 A;  1X4E A;  1SJ3 P;  1TWH C;  4BKW A;  4CO4 A;  1DBD A;  3CUL A;  3OUY B;  3G4S S;  2R7S A;  3H2V E;  1Y3K A;  5C4J C;  5HK4 A;  1UPP A;  1NJX A;  3GSD A;  3HCX A;  2QA4 G;  4TY8 A;  4DV3 F;  1XXB A;  4PYD A;  4ES1 A;  5FII A;  1SKR A;  5D0H A;  4DL4 A;  3R5J B;  1CEZ A;  1S72 S;  3CO0 P;  3AA8 A;  5IXU A;  4WIQ A;  2BQU A;  2RQM A;  5LSL A;  2LCW A;  3H7H B;  2VQF J;  1NSP A;  3QRP A;  4OI0 A;  4OIX A;  1YCL A;  2QE5 A;  1RBO B;  2OIH A;  1XR5 A;  3D4J A;  3HOY K;  1HBM B;  4WXW A;  1SFO C;  1AT1 B;  1YVF A;  4USU A;  4IUF A;  1FDB A;  4JI8 J;  4NYZ A;  4GTC A;  2O01 C;  4TNO A;  2VFS A;  5I42 A;  5A2Q U;  4Q4Z A;  1DTQ A;  3W3S A;  3QWP A;  4DUZ J;  2XCP A;  3RAQ A;  3MED B;  1S6Q A;  5EDW A;  3N5B A;  1FNO A;  3MMJ A;  1LV5 A;  2EEY A;  4JV2 A;  2H65 B;  4UQT A;  4UOF A;  3GON A;  1RAE B;  3BS9 A;  1CG2 A;  4ATN A;  2R7X A;  1MNE A;  2PHC B;  3MAA A;  4UW2 A;  2JFD A;  3RZA A;  4AL6 A;  2VPX B;  1Q8I A;  4C3H K;  3LW5 C;  3I4M C;  1C0T B;  4TU8 A;  4GO5 X;  4KHR A;  1UEK A;  3T9Z A;  4YR3 A;  1XJW B;  5GAD I;  2AYE A;  3D3B J;  3PW5 A;  5KFH A;  3P8B B;  3Q8V A;  4OLP A;  1M90 T;  3KHR A;  3VQT A;  4NOI A;  2C2N A;  1KBR A;  1JNZ B;  2QLJ B;  4M5G A;  4RU2 A;  2JNJ A;  4X62 F;  3T1H J;  4LF5 F;  1HMV A;  2M88 A;  5IZH A;  3HFV A;  1TMJ A;  1Q7L B;  5ADZ A;  4QWB A;  4X4R A;  1GXL A;  1OY9 A;  5KOX A;  4WPA A;  2HNZ A;  1RHQ B;  1SV5 B;  1DJ0 A;  1RTD A;  4JI2 J;  4H4O B;  1KLM B;  4XSZ A;  1IBK F;  1IBA A;  2DR8 A;  3MML B;  4C11 B;  4DV6 J;  2ZH7 A;  4A8M P;  3AH6 A;  1FI4 A;  1RBL A;  2PA8 D;  4YB5 A;  4IOC Q;  3IGV A;  2XB2 D;  3IA0 A;  3GEE A;  1YJV A;  1GT8 A;  5HBM A;  4ZVR B;  2HZA A;  4DS5 A;  4KFB B;  3GTO C;  3BYR A;  2CVI A;  1SMY A;  3H4B A;  3GDZ A;  5IT0 A;  3GTJ A;  3MD1 A;  2OKQ A;  1Y3J A;  1NK8 A;  4DOZ A;  2E7V A;  1DHM A;  2XO7 A;  2YKM B;  1IKV B;  3GTK C;  2E5G A;  4JI6 F;  3CQZ K;  3RYL A;  4L73 A;  1H38 A;  1FDD A;  4LR9 A;  5AJ3 J;  3PEJ A;  2PFD A;  5GVQ A;  3H59 A;  2K8G A;  2ACY A;  3CDB A;  2G0I A;  4IRK A;  3GJS B;  2XMJ A;  1WKJ A;  4L3K A;  4RW4 B;  5K8N A;  3WHI A;  2A3J A;  4KGZ B;  2E1A A;  2CDR B;  1LWF A;  3A4T A;  1F3F A;  2LQ5 A;  5HMY A;  2KZZ A;  5C7P A;  3D66 A;  3HI9 A;  2ZM6 J;  1WDD A;  3SEO A;  4NLU A;  2BEF A;  1GMW A;  3W2V A;  1UJ6 A;  4O4G A;  3GR1 A;  1TWG K;  1AB4 A;  1XNR F;  1GMV A;  4FBT A;  4ANC A;  3L4B C;  4FS2 A;  2RRN A;  4J91 A;  3L4K A;  4DUY J;  1FRL A;  4DQP A;  2DBB A;  1K1Q A;  2VG7 B;  3M9N B;  4M94 A;  1F9H A;  2EG1 A;  2XCR B;  4C2M C;  3TAM A;  1YQH A;  2A6O A;  4TY8 B;  4K2X A;  3BGL A;  4UZB A;  3GG0 A;  3TUP A;  4G1Q A;  4M5L A;  1WSR A;  2VFU A;  2PD1 A;  1TL7 A;  2Y0B B;  1U8W A;  4KAI A;  4KC6 A;  1W26 A;  3MPD A;  1KQ4 A;  4A8W A;  3I4N C;  5IYC K;  5IOS A;  1AZS A;  1S1X A;  3JAM Y;  2GAH C;  4NXN J;  3K59 A;  1FTC A;  2FVP A;  3D3C J;  4F04 B;  1O25 A;  4DR2 J;  4DXL A;  3DOL A;  2DNN A;  1AXQ A;  1CPZ A;  2WSC C;  3NBP A;  5IM0 A;  3JTN A;  3M8S A;  3M32 A;  1OPZ A;  4PAB A;  5I3Q A;  2D7S A;  2DGU A;  4FZB A;  3O44 A;  4WTO B;  2OFG X;  1ZYR A;  1DTQ B;  1Q53 A;  3EIC A;  4HAC A;  1NJW A;  1TWF K;  2EFP A;  2EI5 A;  1RTJ B;  1S6Q B;  4MQ9 A;  4RL1 A;  2XY6 A;  3V4G A;  1B4A A;  2EKY A;  4BY1 K;  5IOR A;  4AUK A;  4E8U A;  3N5F A;  4KAT A;  1VJW A;  2YWG A;  3CMA S;  3M6W A;  5F41 A;  5THW A;  4F26 A;  3TWZ A;  3MAA B;  3DLB A;  1H2U X;  3DDK A;  3SDE A;  2FJX A;  1D8Z A;  1WC4 A;  1VIX A;  2B9X A;  2KO1 A;  2HGM A;  5ITH A;  4GTD A;  3PAC A;  2HNY A;  2RUG A;  2R8H A;  3GQC A;  1LWE B;  3W5Y A;  1C0U B;  2JA7 K;  1B3T A;  2ZUF A;  1LW2 A;  4FYY B;  1UVM A;  1F9E B;  2NZ4 A;  1S9G B;  3KTQ A;  3FOF A;  1RLC L;  4C9D A;  5AXM A;  2HIQ A;  4NX9 A;  3NRB A;  1U1M A;  2AEM A;  2QSF A;  3TJA A;  4AYB D;  4A8O A;  5DG9 A;  3QJL A;  2O67 A;  2H1Y A;  2XCA A;  3SSQ A;  2YWW A;  1CJU A;  3ULH A;  3IRW P;  4IRD A;  2E9R X;  3VF0 B;  5IP9 C;  1ZM4 A;  2C2R A;  4DSE A;  4ED4 A;  2GJ2 A;  3CD7 A;  4ES3 A;  1JLB A;  1IN0 A;  1NZ8 A;  3UR0 A;  3OTO J;  3EPG A;  3EWG A;  2V8G A;  2CFA B;  3FCW A;  1HWL A;  2I8E A;  4FXW A;  3JYT A;  4DF8 A;  4O23 A;  1Y1W A;  4XIU A;  1XMQ J;  4ZMM A;  3S14 C;  4HTJ A;  4EFA C;  2V8H A;  2QYG A;  4A3E C;  1XMO J;  4B9L A;  1YJT A;  5M2R A;  4USW A;  2VUM A;  4HLB A;  1FA0 A;  4U7U K;  1NB7 A;  2ZC3 A;  4ZPV R;  3OSP A;  3KG4 A;  3KOA A;  3OR2 B;  3RBZ A;  1BUX A;  2IMW P;  3CCS S;  3Q8Q B;  4MEX A;  3PXG a;  4ECT A;  1WOS A;  3LAP A;  2UV8 A;  2QV6 A;  4BCA A;  1XMB A;  2D1C A;  4K5R A;  1HNX J;  4C8M A;  4WZQ A;  4W92 B;  1GTH A;  2ZD1 A;  1VK3 A;  2HVZ A;  3I32 A;  4NA1 A;  3S1N C;  2OSR A;  3FFI A;  4IFV A;  3DLH A;  3IMQ J;  4F25 A;  7AT1 B;  4EGL A;  1T9T A;  4DPY A;  4ECR A;  1NU4 A;  2CXE A;  2GQQ A;  4X4T A;  1LXJ A;  1LWF B;  1IW7 A;  1OYD A;  2XHC A;  4K4X A;  5EWG A;  1F60 B;  5J2M A;  4A3J K;  3QJP A;  3US5 A;  2ZEJ A;  5HQ8 A;  4DR1 J;  3W2V B;  4O4G B;  3NEK A;  1O8B A;  2HK2 A;  3QFW A;  2UXD J;  1ZZF A;  2AKW B;  1I5O B;  3WX8 A;  3W9I A;  1Q0N A;  2VFV A;  2GA7 A;  2MLZ A;  5ETS A;  2G13 A;  2R7R A;  2JDJ A;  2DNM A;  1R8H A;  2FZC B;  1Z2L A;  4A8F A;  1S6P B;  3DM2 B;  2DY9 A;  5EWE A;  2P8I A;  2GVD A;  3CDA A;  4RW6 A;  1HD0 A;  2QIF A;  3T00 A;  2R42 A;  2DPI A;  4LJZ A;  1F0X A;  2ROE A;  2QLB B;  1S1U A;  1RK8 A;  4TVA B;  4G1Q B;  1ITP A;  2W7O A;  5ETM A;  1K1S A;  2YX7 A;  4XAK A;  3PO5 A;  3H3V D;  2ZC4 A;  2AYG A;  3M3Y C;  4NCB A;  3FCH A;  1VHF A;  1SL2 A;  2X3G A;  2W01 A;  4C3M A;  2YU9 K;  2GIF A;  1KKH A;  2YWE A;  1WOP A;  3J81 j;  3T41 A;  3DOL B;  3C16 A;  1U7L A;  4P74 A;  2RH3 A;  2MJU A;  2V8P A;  2LXI A;  3NBP B;  3M32 B;  3QT8 A;  2W4D A;  3IR5 B;  3QRQ A;  4FYD A;  2JLF A;  1MLA A;  2CQ2 A;  3LP1 B;  9RUB A;  3AJ2 A;  5BYS A;  1U0H B;  2BW2 A;  2MZR A;  3H3V L;  1IBM F;  3BM7 A;  3B4D A;  4UQG A;  3GB0 A;  2MHE A;  3BPD A;  1ZPV A;  2AQ4 A;  4DSI A;  4Z2X A;  2F4V F;  3LF0 A;  1HKA A;  2I5J B;  2AEJ A;  3CWJ A;  4Q2L A;  1NXI A;  4NYO A;  3HSD A;  3R5D A;  5HMZ A;  3PX4 A;  4CLU A;  3DNC A;  3FQK A;  4ZPT R;  3SDE B;  3NS7 B;  4FXD A;  2GQC A;  4DX8 H;  4F2S A;  2HNY B;  1S1W A;  1JXL A;  1IKX A;  2EFQ A;  3HFK A;  1FXR A;  4F8R A;  2FJE B;  1JXE A;  1S79 A;  2DNP A;  1FES A;  4JB8 B;  3PNI A;  4O3O A;  1R43 A;  1NEE A;  3LWL A;  2YWH A;  2CQD A;  5CQG A;  5IWA J;  3G6V A;  3I5B A;  3SQO P;  1KSP A;  3VGS A;  3UVJ A;  3QSY B;  5K8O A;  1WUU A;  3TAR A;  2DXF A;  1BD6 A;  4DF4 A;  3TZY A;  4OZN A;  2MGZ A;  2V4J B;  4ZP7 A;  4USI A;  1RT5 A;  3HVW A;  1MSW D;  2HS3 A;  1H74 A;  1S77 D;  4OIN A;  1RIS A;  3FSY A;  2W9C B;  4CIO A;  3CQZ A;  3ZXW A;  1F2H A;  4UY8 T;  4DG1 B;  5DM7 Q;  1XWL A;  4MIA A;  5KT4 A;  2QC3 A;  2DGO A;  2XUL A;  1D9D A;  3SIP B;  2NSB A;  3M8P A;  1ZH5 A;  4AL5 A;  1ZTT A;  1HNW F;  1T9V A;  2H4W B;  1G2E A;  1UWB A;  1IM6 A;  4X62 J;  1NK5 A;  3OFH A;  3GTY X;  2HS0 A;  1IKW A;  4P52 A;  2KXN B;  3IAM 9;  3BSC A;  4M5J A;  4GRS A;  4OZ2 A;  4DPW A;  5D15 A;  2DD8 S;  4OYI A;  3DOK A;  1PO6 A;  1YGY A;  2BJ8 A;  2ZD1 B;  2KFY A;  4RW8 B;  4WIL A;  1OSC A;  4IFV B;  1T3O A;  1R0C B;  5T14 A;  3FSX A;  4WII A;  4LOW A;  2RD5 C;  1C4C A;  1W7W A;  2VPY B;  4CRJ A;  4WE1 A;  1QSY A;  3AB2 B;  1TL4 A;  3IC1 A;  2OD6 A;  4L74 A;  4OYB A;  1SIZ A;  2B63 K;  4MT1 A;  1NRK A;  2ZUE A;  4Y2K A;  2ZFZ A;  4I0W A;  1UVN A;  3HVR A;  2AHO B;  2RRA A;  4Z37 A;  4XPE A;  2YH0 A;  1QUP A;  2DGV A;  3R5B A;  5E3P A;  3MR2 A;  2C3M A;  2L9N A;  3CJ5 A;  5F8G A;  2FLP A;  5GMK a;  3EDQ B;  4NLY A;  1YNN A;  1WF1 A;  4IH5 A;  1HQU B;  4CO1 A;  2PSZ A;  3P3D A;  2QSW A;  4IOB A;  3OFG A;  4OHZ A;  2DGX A;  2RDI A;  3JAM U;  2CPX A;  2Z2M A;  5KT5 A;  2CJB A;  1UVL A;  5EWF A;  2FTR A;  4ZOS A;  3OTD A;  3FBE A;  3ZC4 A;  3KNG A;  1OYE A;  3G8S A;  2OD4 A;  1R6Y A;  2CPZ A;  4GTL A;  4J7C A;  2YXL A;  4OV1 A;  1CJV A;  2OMO A;  2GHW A;  3AD9 C;  1I50 C;  3S1Q K;  5IT9 Y;  4GMK A;  3UQS A;  1FKA F;  4YR2 A;  2QL7 B;  2CPD A;  4PUO B;  4J37 A;  4BWJ A;  1JNR B;  1RU2 A;  4ILL A;  2GS8 A;  2BJ9 A;  4LBP A;  1LK5 A;  4Q5V A;  2MTL A;  3DYA B;  2CPI A;  1WIH A;  1P8G A;  2BA9 A;  3MEG B;  2QMU B;  1RBA A;  4CLZ A;  4YY3 J;  3IAS 9;  1MWZ A;  1JLC A;  3HK2 A;  4YR0 A;  2VOP A;  3EZO A;  2GX8 A;  4DN9 A;  4OZL A;  3CJQ A;  4ES2 A;  3CSK A;  2CJA A;  3QT7 A;  1EKR A;  1SQG A;  2ZVI A;  2VDI A;  2JA7 A;  4G3I A;  4NOH A;  4IO1 A;  5HAT A;  2FLL A;  4LIR A;  4IYQ A;  4NWB A;  4GKJ J;  4X6A K;  3MPY A;  2KFN A;  4OYZ A;  2UUB F;  2YKN A;  3MFH A;  1B4S A;  3F41 A;  4R0J A;  1NK9 A;  1S1W B;  3K58 A;  3S15 C;  1IKX B;  4PG4 A;  4LSN A;  3RAM A;  2KYZ A;  5CD4 A;  1RDR A;  1TWA K;  2J9D E;  3NGT A;  4I4B A;  2BMB A;  4CLF A;  1FRK A;  1D3W A;  2HFS A;  1M5V C;  4BLB A;  4NXM F;  5IOL A;  2DXE A;  2G1D A;  5E2Q A;  4OI6 A;  2QLW A;  1MN7 A;  2PN6 A;  4UTG A;  4OQJ A;  2IJF A;  2QFJ A;  4ZCK A;  3G86 A;  2FHO B;  5LMN F;  3TNV A;  2EBE A;  2IFX A;  1DFD A;  1GMU A;  2MGZ B;  5L1I A;  3GE9 A;  5HO4 A;  4NI2 B;  2B4O A;  2LLZ A;  3JQM A;  4F3M A;  2J9E A;  3GTJ C;  4DDQ A;  5E68 A;  3TVZ A;  5B0G A;  2E5I A;  3W9J A;  3A12 A;  4DSK A;  1T02 A;  2JEG A;  1AUS L;  3QAT A;  3N4W A;  4J9N A;  1FKP B;  2E2J K;  4RO0 A;  1YJ9 S;  1ULR A;  2E5L F;  1DZ5 A;  3GTP A;  2XZT B;  3FEZ A;  1GEH A;  4U95 A;  3R97 A;  1ZBS A;  5K14 B;  3UD5 A;  1S76 D;  1UWB B;  3ILL A;  5IFM A;  7FD1 A;  2AGO A;  1AW0 A;  3N01 A;  4BC7 A;  4LF7 F;  3PCO B;  4JI3 F;  3GIR A;  4I7F B;  2KWA A;  3ZTQ A;  1HNV A;  5KG3 A;  4RUA A;  5C4J K;  2HWH A;  3P96 A;  4I64 A;  2CAD A;  5HN0 A;  4A46 A;  2A2C A;  4WJB A;  1TL5 A;  1HYS A;  3PYG A;  4JP8 A;  3DOK B;  2B43 A;  3BF4 A;  1O6X A;  2BDP A;  4Y7N C;  1NO8 A;  1C1C B;  1IXK A;  3M8Q B;  1B64 A;  3GFY A;  2N4D A;  5HP1 A;  3SXL A;  2DY1 A;  5E33 A;  1SC3 B;  3PW4 A;  1YX2 A;  1LFP A;  1JLQ A;  1VC6 A;  1SQE A;  2FQT A;  3OL9 A;  2Y0S D;  3CGI A;  4GTF A;  1SFO K;  4H4K A;  4G7Z A;  3A3P B;  1N5T A;  3R1L A;  1JQW A;  3SFU A;  3GCW P;  3OV7 A;  3J7Y U;  3S01 A;  2AJF E;  4ZVO B;  1VQ8 S;  5E3Q A;  3CCE S;  4XSX A;  3VAM A;  1NKE A;  4NZ0 A;  3NXZ A;  2OEK A;  4IG3 A;  2DR9 A;  4J9S A;  4X4S A;  5ETO A;  2XWY A;  4A3C C;  5GAE I;  3CCW A;  1S7I A;  3AH5 A;  2R7T A;  3V5R A;  1XR7 A;  3C19 A;  2KRR A;  1RT3 A;  1U49 A;  2UUA F;  1PKU A;  1BXN A;  1GXU A;  2XHW A;  2YU9 A;  3R5C A;  5IP7 C;  4ECU A;  1O2B A;  2H3E B;  3I55 S;  5HJY A;  2MZQ A;  3ZZZ A;  1SVD A;  1MRO A;  4P2S A;  3GV5 B;  3J81 Y;  2UXC J;  2WB1 D;  3ERE D;  3MMB A;  3WZ0 A;  3HUL A;  3K7A C;  4C0O C;  1DCO A;  4KKO A;  4DV7 J;  5KAK A;  3I4M K;  1TZ0 A;  1FVQ A;  2HHV A;  3MOZ A;  3CCQ S;  3GIK A;  4BBY A;  2QO3 A;  4QYZ K;  3K57 A;  1NJZ A;  1MMD A;  4C8O A;  3OL6 A;  4V19 J;  2UUT A;  4NLR A;  3UCG A;  3PVX A;  3S0X A;  3SSR A;  1R27 B;  1SC1 B;  1YWX A;  4CM0 A;  1HW8 A;  1JLC B;  1F2G A;  3TOQ A;  3BGR A;  1FDN A;  4DV1 F;  1V3S A;  4DU8 A;  2H5I B;  4DR4 J;  2DR6 A;  3QGI A;  3PX6 A;  2HWI A;  4JI4 J;  4RPF A;  4B9N A;  3PJ9 A;  2HBR B;  3V6K A;  4KMH A;  3MM9 A;  1F9N A;  3EGW B;  3DDI A;  2RQK A;  1WC0 A;  4ERD A;  4URS A;  1PYT A;  2W8K A;  3BN7 A;  4WU3 A;  2CKW A;  1SJ4 P;  1TV6 A;  3MM7 B;  4WP9 A;  2KJV A;  3GTO K;  3GYG A;  4OYW A;  4ED7 A;  4LSN B;  1VR6 A;  1H6K X;  2QT7 A;  2AV5 A;  5LSO A;  3GYN A;  3F44 A;  5TMF A;  4LFC F;  3BQ2 A;  2ZOG A;  2JRS A;  2O5J A;  5K20 B;  2C2D A;  1RAO A;  2DB1 A;  4UOC A;  4DL7 A;  1Y1W C;  2MKS A;  1RI7 A;  1S0N A;  3IPJ A;  1NKC A;  3MHY A;  2VUM C;  4YB7 A;  4RNO A;  3VWS A;  4OZ1 A;  3A13 A;  2PMZ L;  2V2K A;  1TWC A;  3J7Y I;  4FS1 A;  2BAN B;  3C14 B;  1UA0 A;  1WTB A;  1VRT A;  1VQS A;  2V6S A;  2UXB F;  4Q5S A;  2DKO B;  2XMW A;  1WI6 A;  3ISZ A;  3OTB A;  1LK7 A;  3EZ5 A;  1R3N A;  2R2T A;  1WOO A;  3HT3 A;  1VQ6 S;  5A6W A;  5HRO A;  2MJN A;  3PV8 A;  1U1R A;  5EHH A;  2BUN A;  2CJK A;  4C2M K;  3R7S B;  2D69 A;  5H9F J;  2M9K A;  1HNV B;  2ZBR A;  4AXI A;  2FD2 A;  1FWL A;  1HYS B;  3LAK A;  3M6U A;  4DV5 J;  3IRX A;  2HBZ B;  4ID5 B;  5HP1 B;  2ZVS A;  2ASD A;  1RYR A;  1T9U A;  3QNW B;  1GNK A;  5CHP A;  1KQK A;  5F8J A;  2RKI A;  2VJU A;  2YX4 A;  3UDV A;  2UP1 A;  4ER8 A;  3I4N K;  2IC3 A;  2Z58 B;  2W2O P;  1T9X A;  2WHO A;  3KMQ A;  3HOY C;  2BOP A;  3K17 A;  2J0S D;  1HNW J;  3E2E A;  1U2C A;  1KVK A;  1N6Q A;  1RWK B;  3IXQ A;  3D1Q A;  1LW0 B;  2ZH2 A;  2FHK A;  2CA9 A;  4GVB B;  3D0H E;  5IQ6 A;  4Y0F A;  3FMB A;  4IG3 B;  2XBP A;  2RQ4 A;  1VOM A;  3OW2 R;  4GC7 A;  4J9U E;  3VAL A;  4EBC A;  4DFJ A;  1F1B B;  4IQM A;  4NZ6 A;  3LQV A;  3UW1 A;  1J5O A;  1BDF A;  2EVZ A;  1JKH A;  2LXF A;  4I68 A;  4TYB A;  1SB6 A;  3MAH A;  2A0F B;  5M3M K;  4USJ C;  5J2P B;  2GV1 A;  2DNQ A;  1N5Q A;  4KH1 B;  3E51 A;  3V6D A;  3M7V A;  4CZC A;  3X3U A;  3CCM S;  1RAH B;  1MRO B;  5DGB A;  1C1B B;  4XO0 A;  2YKO A;  3AA9 A;  2NVY A;  1MWY A;  2UVU A;  3MMB B;  4ALZ A;  3IO1 A;  2V6T A;  3P45 B;  4ILD A;  3AOA A;  2XS7 A;  3V4M A;  2Y3Y A;  2O66 A;  1ZTW A;  2QX0 A;  4KKO B;  4WWS A;  5A0Y B;  2QA2 A;  2AIR B;  4C3H C;  4FVM A;  1Y1V A;  2HKE A;  1I6J A;  5K8P A;  1Q4R A;  4NYP A;  1HQE A;  3OQ2 A;  2UUC J;  5G4D A;  2AX0 A;  4KMA A;  4UOH A;  2XC9 A;  3DU6 A;  4OX7 A;  3PKY A;  3MI7 X;  1W2B R;  3S16 C;  1FX4 A;  4B3S J;  2D3Z A;  1QAX A;  3H0G A;  5IP9 K;  1K83 K;  3S17 C;  2H48 B;  2B6A A;  1RWV B;  4LQ3 A;  1TWA A;  5BYR A;  2PPB A;  4RJV A;  1WG5 A;  4OYP A;  5DO2 A;  2KZM A;  1XXC A;  3I4P A;  2VG5 A;  4K50 A;  3IG1 A;  2DIU A;  2ZH8 A;  3KK2 A;  1KRP A;  2ZZM A;  4LLG A;  1M5K C;  2K1R A;  1X0F A;  4F4W A;  2DGQ A;  4NA3 A;  3S14 K;  5ETL A;  3KLV A;  1TV6 B;  3THP A;  2YBV A;  3BV8 A;  1U02 A;  1REV A;  4OI3 A;  2MKK A;  1Y10 A;  5B0E A;  3TW0 A;  1J6W A;  3CJ8 A;  3HHL D;  3EVW A;  2XYH B;  1FKO B;  2IYG A;  3PFE A;  4DR6 J;  3RZO C;  3CQZ C;  4JI5 F;  2E1M C;  1RA7 A;  2Q1L A;  4JYA F;  3FUY A;  4WXO A;  1KD1 T;  3DRP A;  4Y34 A;  3S1N K;  3EJM A;  2FJB B;  2XCO A;  5E3C A;  2GO8 A;  2PII A;  1IVZ A;  1U1K A;  2LA4 A;  3QZ8 A;  2VKZ G;  4ZVS B;  1H98 A;  5FJ8 K;  4EZ6 A;  3RB3 A;  4BLA A;  1TMM A;  2VOD A;  3D1O A;  4LFA F;  1VRT B;  2IM3 A;  3C46 A;  5D4D A;  2RF2 A;  2NUH A;  1J27 A;  5HI7 A;  1VQK S;  2EFO A;  4DCO B;  4ZPC A;  5LMN J;  2OPQ A;  5A8R A;  4LF4 F;  3LAN A;  2DGS A;  3PRB A;  3R6L B;  4ZDN A;  1M1G A;  3MAQ A;  1BC6 A;  1VLY A;  2IRX A;  2F63 A;  2DRD A;  5KFU A;  1UFK A;  4ED1 A;  3TFH A;  2J7K A;  3Q8R B;  1FEH A;  1TKX A;  4K0K F;  2W7V A;  3IRX B;  1O0P A;  2GC8 A;  4YB6 A;  5KFD A;  3ORE A;  4B3O A;  2V67 A;  3C6U B;  1FDA A;  2DGT A;  2GNK A;  2NQP A;  4QOT A;  4C97 A;  2W8L A;  3GEI A;  1XK8 A;  3WIV A;  3M3Y K;  1XNQ J;  2CWX A;  4J9K A;  3PO4 A;  5AXL A;  3R27 A;  4K4V A;  3HHD A;  5IYC C;  2A6H A;  3DI6 B;  3EX7 B;  3LOU A;  2JLG A;  2ZBP A;  2F8E X;  4WBF A;  1YZ7 A;  4JI3 J;  4KGV B;  2WVE A;  2HRY A;  1PAE X;  4GKK F;  3ZNJ 1;  5D77 A;  1ACM B;  2VC0 A;  1JJ2 R;  3GTQ C;  3FDS A;  2N4C A;  3GII A;  2V68 A;  2RT3 A;  2R2U A;  2V2Z A;  2XYG B;  5LJ3 Y;  1WEX A;  5DM6 Q;  4A3I C;  4ECQ A;  3FRZ A;  3K5P A;  4WJ3 M;  2RML A;  2B7C B;  1TKZ A;  1SJQ A;  4WK3 A;  1FER A;  4CM2 A;  3I9Z A;  3V6D B;  2B8Q A;  4JV0 A;  3SCK E;  1X4G A;  2VG6 A;  3N28 A;  2L41 A;  2ACM A;  1S10 A;  3O2I A;  2JVR A;  5KFC A;  4RKU C;  4ZIV A;  2JHE A;  3NGS A;  2HND B;  1N34 J;  1TVR A;  1U4B A;  4QQB A;  4Y6I A;  5KG2 A;  1EJ7 L;  2Y8W A;  4QPX A;  2HVD A;  5HLF A;  2KHC A;  1KOH A;  4X66 J;  4TU7 A;  3GFH A;  1PBA A;  1HQE B;  1WC3 A;  1OIA A;  3M2V B;  4D3H A;  3CIM A;  3CC4 S;  5FLX Y;  5GAH I;  2GIR A;  2UUA J;  3UWT A;  4DV2 J;  1G51 A;  2FLO A;  1QE1 A;  2N82 B;  4DR5 F;  1CQN A;  1J6V A;  3CDU A;  1S57 A;  4MTP A;  3AOB A;  2VUG A;  1BGW A;  4HDG A;  4LSZ B;  4ZPA A;  1KN6 A;  3M8Y A;  1YJR A;  2Z2Y B;  3C6T B;  4ZHR A;  2RIL A;  3SCL E;  3M4X A;  4K4Y A;  4DJB A;  3A1Y G;  3RZD C;  2B6A B;  5DET A;  3J80 U;  5LXY A;  4CLK A;  3BBB A;  4QU6 A;  1OQ3 A;  1RT2 A;  9ATC B;  3PM9 A;  1HNZ F;  3K8W A;  4KDD A;  1HBO A;  1VS3 A;  2MQP A;  1UAW A;  3OPK A;  2KT3 A;  4OIP A;  6FDR A;  4DHV A;  1U2R A;  4ZK7 M;  4L3N A;  2Z57 B;  5K8M A;  1UZH A;  1D8Y A;  3NAI A;  5KFS A;  3AB4 B;  1PYO B;  2KI2 A;  1JLG B;  4DL2 A;  3MMC A;  3BUE A;  4ZJO A;  4C0B A;  4C8K A;  5KFM A;  2W7P A;  5JFE A;  4DS4 A;  1S97 A;  5CYQ A;  4B3M F;  3VAH A;  4NEY A;  3I31 A;  3RBX A;  1IQ0 A;  4KGX B;  3BO3 A;  2FB0 A;  2LYV A;  5DJB A;  4QJV B;  1NJI T;  1K9M T;  2YPY A;  3GTP C;  3PR5 B;  2BKP A;  1PJ5 A;  1Y00 A;  3TO8 A;  2FJV A;  3FHZ A;  2E9Z A;  4TXS A;  5F8H A;  2PEB A;  5CAA A;  5HQM A;  1ZM2 A;  1G1X A;  2ADC A;  1SL0 A;  4YOE A;  1NK6 A;  2WOM A;  4HT5 A;  5LOQ A;  4C3J C;  5G0R B;  4C2M A;  4K4S A;  2M8H A;  1ROF A;  3ENW A;  2UVR A;  3O3L A;  3CCR S;  2HFN A;  4A3J C;  3WIU A;  4KE5 A;  3HHL A;  2Z0G A;  2FHJ D;  3H5Y A;  1T03 B;  1MG7 A;  1TUG B;  2FZG B;  4KYZ A;  5ETK A;  4HVZ A;  5J1E B;  2HHH J;  4X65 F;  2G2Y A;  3O1L A;  5ETV A;  2OPQ B;  5A8R B;  2HS4 A;  3CXC R;  5B0B A;  1M5P C;  3HOZ K;  2KB2 A;  5HL8 A;  4CYU A;  3KK3 A;  4ZS6 A;  3AD8 C;  2JH3 A;  3JSM A;  4H4K C;  4DV4 J;  2OML A;  1QAY A;  2JVO A;  3FZB A;  1NJY A;  2VB6 A;  3O6Q A;  1KQS R;  3DXS X;  2IDE A;  3KUH A;  5A2Q Y;  1Q82 T;  2BX6 A;  1SUQ A;  2VPZ B;  3CE8 A;  1RT1 B;  3TUZ C;  4BDP A;  2UU9 F;  5CAB A;  1VQM S;  1VQN S;  3SBM A;  1FT8 A;  3LTO A;  2XYP B;  4RNM A;  1PYS B;  2E5J A;  2IPO B;  2RQC A;  3FKB A;  3GR0 A;  3BH7 B;  1I50 K;  2ZH3 A;  5HL7 Q;  4DPX A;  5CA5 A;  3K5O A;  3EM1 A;  4LF9 F;  2XMT A;  4ZN3 A;  5KT6 A;  1H3D A;  4TYA A;  4I6A A;  4ZCM A;  1VFJ A;  1M5S A;  4GO7 X;  4XDD A;  4PKD B;  3OLA A;  3LP2 B;  3HVT A;  4ECW A;  1WAC A;  1IJF B;  4QBU A;  3G71 S;  1QJH A;  2CPJ A;  4V19 X;  2DYA A;  1T94 A;  3S6E A;  4IR1 A;  1NK7 A;  2HYI B;  3KLF A;  3OTC A;  4JI1 F;  4FNI A;  3DKD A;  3GMG A;  5C5J A;  2PDA A;  2RRB A;  1NH8 A;  3IBC B;  8AT1 B;  2XGP A;  3GTG C;  2QRR A;  2ZUA A;  3S7R A;  3HOX K;  2RS2 A;  3U27 A;  2A1B A;  1EH1 A;  4M95 A;  3PZP A;  3H4D A;  3IS9 A;  2VJV A;  4LF1 A;  1TVR B;  5JVG Q;  4EWT A;  2DK2 A;  4MIB A;  2J8A A;  4TY9 A;  3CC2 S;  4DDF A;  2JEF A;  2E5H A;  4IH6 A;  1FJG F;  3UD4 P;  4LQY A;  2G4B A;  3S15 K;  1K83 A;  5HLF B;  2GMH A;  4DU7 A;  2CG4 A;  1TP7 A;  3PIP Q;  2HRT A;  1TFY A;  2FY8 A;  1B0P A;  3NMR A;  2ATC B;  1RAB B;  4EI2 A;  2MXY A;  1LOU A;  3QLH B;  3AJD A;  1RYS A;  4ANE A;  1ZQ1 C;  2EC2 A;  4AFF A;  4OI4 A;  5HMW A;  4ZN1 A;  1V6H A;  3Q8P B;  1UW4 A;  1JJC B;  2NVX C;  5DDQ C;  2C3O A;  3GTJ K;  5KFZ A;  3QO9 B;  2YVS A;  2GHP A;  2V50 A;  1FRI A;  1KQG B;  1RT2 B;  2G0J A;  2E1C A;  4QU7 A;  1RAF B;  2M52 A;  3AJ1 A;  1RHJ B;  3IP0 A;  1JWW A;  1ISE A;  4ID8 A;  2KG0 A;  4DV0 J;  2HPU A;  3KLG B;  1L3K A;  2ATL A;  1OO0 B;  4J9Q A;  2DNH A;  3IFE A;  2JOQ A;  3HX9 A;  2BVZ A;  4YDX A;  4F4K A;  4OX9 J;  2R8G A;  4N76 A;  3IM8 A;  3MUM P;  1TWC C;  4W4M A;  3HXM A;  2H54 B;  1RWN B;  2ZKT A;  1J5E F;  8ATC B;  4Q2M A;  4ED8 A;  4JI0 F;  5KG6 A;  4DZD A;  4A3M C;  1VQ5 S;  4N56 A;  4UY8 5;  4PRF A;  3KXD A;  4Y7N K;  1QM9 A;  5C42 A;  1BWE A;  1SH2 A;  1KHV A;  5C4X C;  4K2J A;  1B0T A;  3EMT A;  3PO3 C;  2NSC A;  4CLY A;  2JWN A;  3TTG A;  3PYF A;  4RW7 A;  4NPO A;  4JV5 J;  4EBD A;  1O24 A;  4MK8 A;  2JC0 A;  1WWH A;  1RTZ A;  3QSI A;  2ZHB A;  1YTY A;  1WG1 A;  4UUW A;  2OI2 A;  3CD0 A;  4NLX A;  3E01 A;  1T05 A;  4BLG A;  4G0V A;  1VGY A;  2CVE A;  3W5Z A;  5FLM K;  3RGI A;  5D0G A;  5DG7 A;  3EVM A;  1USM A;  1JVI A;  2MQN A;  4OFZ A;  1W25 A;  3V4I A;  4FZV A;  3UCU P;  4Q0B A;  5DZ7 A;  4C98 A;  1UEV A;  1EQ0 A;  4JI7 J;  1VH2 A;  2DRB A;  4L6V 3;  4O0N A;  4DSF A;  3JSM B;  1I94 J;  5IP7 K;  4A3L C;  1U6Z A;  3J7A N;  4A93 C;  3POT A;  4LRD A;  3W5X A;  4M1K A;  4ZPB A;  4PQU A;  4LMZ A;  1FJE B;  4KGM A;  2FJA B;  4DSJ A;  2MY8 A;  2G2O A;  3UNG C;  2JA8 K;  3W2W A;  3MR5 A;  3A8E A;  4RMF A;  2FHJ A;  1FFW B;  5CH7 B;  4RNH A;  1TKT A;  2XNQ A;  3K7A K;  4MYU A;  2CQG A;  3A3O B;  2YNF A;  1EKS A;  5F8M A;  1D1U A;  3S1Q C;  3SZY A;  1FJC A;  4QIV A;  3MPU B;  1HBN A;  4PXC A;  2BRK A;  1HR0 F;  4IFY A;  2HHX A;  2D3O 1;  1X9M A;  1L3T A;  1N0V C;  2BV3 A;  2NVY C;  4DFM A;  3HVT B;  2HHT A;  4QR0 A;  1Y9O A;  2GFF A;  1XZQ A;  3F0N A;  2GJF A;  3DRX A;  3BSA A;  2WVD A;  1Q78 A;  1BGX T;  2J8S A;  2HZV A;  1Y1V C;  2XMV A;  1RT6 A;  2PO4 A;  2OPS A;  1RSC A;  4EBE A;  1VC5 A;  3I56 S;  3QAU A;  3DLE B;  1SI9 A;  1IR2 A;  2KH9 A;  3FGV A;  4HHJ A;  4KHM A;  4ETX A;  5D4P A;  3CJ2 A;  5CXT A;  4LF6 F;  4BC9 A;  3T02 A;  4X4P A;  4FDF A;  2AJQ A;  2NUU G;  3H0G C;  3DRR A;  1CJT B;  2ZJP Q;  4WF9 Q;  2FLN A;  1NK4 A;  1TWA C;  3MTK A;  2QZ8 A;  1P6T A;  4Q44 A;  4FF3 A;  1RWO B;  3ILI A;  5JXS A;  3K8V A;  3KK1 B;  3GTM C;  3DLL Q;  3SZ2 A;  2LEP A;  4X4O A;  4IR9 A;  3PYD A;  3PEH A;  1SKW A;  4KC5 A;  4M63 A;  2H4Y B;  1HNI A;  2ADB A;  3MM5 B;  2V69 A;  5C24 A;  3I0S A;  2CYY A;  1S9E B;  2A6M A;  4DLE A;  2VUM K;  3VGT A;  4IDK B;  3ITH A;  5E5N A;  2P5V A;  3S8S A;  2ZE2 A;  4QIW L;  3MUV P;  3BEG B;  5I4M A;  4KPY A;  3TJ8 A;  3CJK A;  2E2I A;  1TK8 A;  3BGF A;  4RUC A;  1CS4 A;  2E2J C;  4Y28 C;  3J7Z T;  1A7G E;  3O8W A;  4Y52 C;  2M7S A;  2ZHO A;  2DNL A;  2J5A A;  3TI0 A;  1WHW A;  2ZH4 A;  2WAQ D;  2DH9 A;  3OTE A;  1BLU A;  3NMA A;  3MPV A;  2AD9 A;  3D6F B;  5M3F K;  4WK1 A;  2FYX A;  3KWM A;  5A8K A;  4YFU A;  3BGO P;  4Q8E A;  3CC7 S;  3TQE A;  2W2N P;  3GJT B;  1UL3 A;  3JQJ A;  2P6T A;  1HLW A;  2H5J B;  3D6H B;  4WP8 A;  4F0K A;  5EUH A;  3OL7 A;  2LVW A;  2PI5 A;  3DCA A;  3H20 A;  5C42 B;  1NHV A;  3G96 A;  1BE4 A;  3U1M A;  4DEZ A;  3OR1 A;  2K2P A;  4EO8 A;  3V6H A;  2DH7 A;  2ZDP A;  5L46 A;  2IHR 1;  4B3R J;  4DPO A;  4P2X A;  3S2H C;  5EN1 A;  4QR2 A;  2W4C A;  3OHA A;  1PAU B;  4ICL A;  5D8H B;  1IBL F;  1RKJ A;  2VQE F;  3DLJ A;  3E01 B;  4B3M J;  1T05 B;  1QAI A;  3QGG A;  3VQS A;  1ZM9 A;  1SH0 A;  3OVB A;  1EB0 A;  4DBQ A;  3NP5 A;  5M2U A;  3WBZ A;  1KQF B;  2NXC A;  4C48 A;  4A3K C;  1I50 A;  2HBQ B;  3AXK A;  1T3N A;  2CNO B;  4FM9 A;  3D9B A;  2YQ3 A;  3QPI A;  1IE0 A;  3X1L B;  1MW7 A;  2ERR A;  3T3F A;  4NZ7 A;  4J9P A;  3D2W A;  5KFG A;  4LUB A;  4KSE B;  4QR1 A;  1S99 A;  4Z7Y A;  5H9E J;  2E66 A;  4B3T J;  4OIO A;  3W2W B;  3L7U A;  3QIP B;  2AEF A;  4NRT A;  3UDE A;  2WBM A;  3P5T L;  2R4F A;  1WCM K;  1X4C A;  1YRT A;  2KRB A;  4NLW A;  1AFI A;  4ZVQ B;  3TAP A;  2R3V A;  4CO5 A;  3LWM A;  1NB2 A;  2HVH A;  5SZT A;  4WYL A;  1E6V A;  1HI9 A;  4Q45 A;  2GGP A;  4DR7 F;  1S5Z A;  5F8N A;  4YEA A;  2C2O B;  2QFI A;  4F67 A;  3D0I E;  1Q8B A;  2HHS A;  3CJT A;  2YKA A;  1KVI A;  3FJ2 A;  3S16 K;  1WG4 A;  5KG4 A;  3Q89 A;  3GEH A;  2C1E B;  1XZQ B;  2XY7 A;  3FKI A;  4KV8 B;  2CQ1 A;  3S17 K;  1M5H A;  3HP6 A;  4CTA B;  1TL1 B;  1Y7P A;  1XXA A;  2C2M B;  4R5P B;  4P2M A;  1NDK A;  1VK8 A;  2OPS B;  2ABY A;  1SXL A;  3BGU A;  4ZLN A;  5E3R A;  1QVF R;  4Y2I A;  3HOV C;  5E7O B;  4ECX A;  2WZ1 A;  2FIU A;  1IBC B;  4DQI A;  4KN4 A;  3JB9 k;  2VFR A;  4F36 A;  3TA1 A;  4FXV A;  3UN5 A;  1VQP S;  1JLF A;  1X4B A;  2VBX A;  1C2P A;  1PSD A;  5DDR C;  2VDH A;  2VH7 A;  4R8U B;  1FO1 A;  4LF8 J;  2R7Q A;  2VIC A;  2J7W A;  2GHV C;  3RZO K;  1I6H K;  2ZHA A;  2XQC A;  4DZ6 A;  2OPR B;  4HEA 9;  3G4A A;  1HNI B;  4GTA A;  2HMI B;  2OP5 A;  4LR8 A;  1S4F A;  3GTL C;  2Y9H A;  5BYQ A;  3W64 A;  2PA8 L;  2VBW A;  3H0P A;  2J76 E;  1QDU B;  2VL1 A;  4OIR A;  1UV7 A;  5T7L B;  1ICE B;  5AE2 A;  3HHE A;  4HTI A;  5DQI A;  1RT7 A;  4QWC A;  1RWX B;  1WOR A;  1FJG J;  3VVU A;  1HQ2 A;  4AND A;  2JSX A;  2IVF B;  4WFX A;  5KFX A;  1UZD A;  5B08 A;  4BY7 C;  3PX0 A;  4R25 A;  2C3U A;  1WQH A;  1N33 J;  7FDR A;  3DRY A;  1UJ4 A;  4AQY F;  3IBW A;  2AZ1 A;  3G87 A;  1WDT A;  2HRU A;  1KFS A;  4LK1 A;  1CJK B;  4USK A;  1O5J A;  1AFJ A;  1F3V A;  4KHP F;  2QTW A;  2OPP A;  1UTA A;  4RLE A;  2HLT A;  5KG1 A;  5A8K B;  2R8J A;  1HHQ A;  4Y2M A;  1V5I B;  3V81 A;  5D0E A;  1EQM A;  4YFX A;  2E9T A;  4YDD B;  3HHL C;  3ENA A;  2P2C B;  4H54 A;  1WKL A;  2IDL A;  2KHD A;  4O3S A;  1B0V A;  3GFX A;  3NUH A;  4OHX A;  3OR1 B;  4J9L A;  4RR5 A;  1VCT A;  4P72 A;  4P5A A;  1BMQ B;  5C3E C;  2WCX A;  1TL3 A;  3TZW A;  1S0V A;  4ICL B;  2FVQ A;  1X9W A;  4F4A A;  1MML A;  1JLE A;  4P73 A;  3O5T B;  5DLG A;  2ZH6 A;  1U1L A;  1NKB A;  1PIL A;  2RU3 A;  3HFZ B;  2BOA A;  4CLT A;  1WKK A;  4HH1 A;  2CZ4 A;  4B08 A;  2KN4 A;  4G0W A;  5D3G A;  5I42 B;  3Q83 A;  1R8P A;  1X60 A;  3GTQ K;  3R2C J;  4CO3 A;  3RB4 A;  3VVT A;  3PY8 A;  3CJ0 A;  1UJ5 A;  1JK9 B;  4A3I K;  4CP5 A;  4U8V A;  3M2R A;  4I2Q A;  2BXJ A;  3IM9 A;  4AD6 A;  2ZJQ Q;  5C25 A;  4JI8 F;  4A3G C;  2LEC A;  2ZZN A;  4XLP A;  2AGP A;  3D54 A;  3ZTP A;  3GIJ A;  3N6N A;  1EET A;  3FSI A;  1JJ4 A;  4P2F A;  2HZC A;  3OJS A;  3DLG A;  2BQR A;  4WKY A;  3PRV A;  4DUZ F;  3KLH A;  1U1O A;  5KG7 A;  1Q8L A;  5HQL A;  2R8I A;  1ZXO A;  5KTQ A;  2YQ0 A;  1YBU A;  4RZR A;  2LP4 A;  1R0A A;  1FWK A;  2E7W A;  3S1M K;  2GGP B;  2RJZ A;  3GSI A;  4HT7 A;  4ZH4 A;  4PG6 A;  4GFQ A;  2F1F A;  3UPF A;  3FC9 A;  2BJE A;  2V4R A;  1U1P A;  3TJ9 A;  5L1L A;  3I87 A;  1VJE A;  1F6T A;  1SQF A;  5CZX A;  4CH1 A;  2FGC A;  1HMV B;  3RZD K;  4ZP6 A;  4I1T A;  4I6W A;  1K83 C;  2J7U A;  3QX3 A;  4OX6 A;  5CHC B;  2HNZ B;  4OJ3 A;  2PI4 A;  4DL6 A;  1FE0 A;  1RTD B;  1YJ7 A;  2JA6 A;  3D1H A;  4B9U A;  2CPY A;  3MM8 A;  4CLP A;  1N5Y A;  2R7O A;  1WTF A;  2A6E A;  5RUB A;  4OJ1 A;  1EK8 A;  4AL7 A;  4NML A;  4KR0 B;  4K59 A;  2C22 A;  2QN6 B;  1HPZ A;  3NGD A;  3NNH A;  1R0B G;  3OFE A;  4DQR A;  2G2Z A;  1INN A;  2A69 A;  2BAC A;  5HBM B;  3S1T A;  1JLF B;  4AYB L;  3KHL A;  1IR1 A;  4RUB A;  1W2I A;  3QQC D;  1O27 A;  1HHT P;  4JI2 F;  1RAD B;  4ZVF A;  4DQQ A;  4OZJ A;  4LFB J;  3MTJ A;  1XEZ A;  1H2T Z;  3EUN A;  4O3R A;  3M8Z A;  4DV6 F;  4ED3 A;  4ECV A;  1LKZ A;  2XI3 A;  2DVI A;  2C28 A;  3GTP K;  4NLV A;  2DHG A;  2CUY A;  1BWV A;  2V8D A;  4HHU A;  1O28 A;  2Y1R I;  3RB6 A;  1HD1 A;  2MZ1 A;  5IV4 A;  4KJI A;  3CB4 A;  3N6M A;  4KAR A;  2M5Y A;  4YHH J;  4C3J K;  5B7W A;  2HAI A;  4X64 J;  2COL A;  3IR6 B;  2XSJ A;  4A8Y A;  1MU2 A;  4FP9 A;  4YN3 B;  4ZVU B;  1UKU A;  5JUM A;  3PDN A;  2XMK A;  3KUG A;  4ZPW R;  2FQQ B;  2A10 A;  1WC6 A;  5TJ3 A;  3ISN C;  2OPP B;  1FRM A;  3R8Y A;  2CQC A;  4XPC A;  2CJ9 A;  1E6Y A;  3MPW A;  1O29 A;  3TAM B;  2RE1 A;  4FF4 A;  1M1H A;  3V81 B;  1V3Z A;  2W2P P;  2N7Y A;  2ZM6 F;  4XTT A;  1ZAV A;  1UCN A;  1X4D A;  3H90 A;  3F56 A;  2I1R A;  5C44 C;  5ETN A;  1YIJ S;  5BXI A;  4B9T A;  1TL7 B;  2CPF A;  1N48 A;  4DUY F;  1XZP A;  3VCD A;  1RWU A;  1FEE A;  1TUV A;  4DCP B;  1AZS B;  1S1X B;  3CTR A;  3KJN B;  1NCL A;  1WHY A;  4M5M A;  4CO0 A;  1S6U A;  1AYE A;  4YME A;  4IG0 A;  2RHS B;  2IJR A;  1N36 F;  2QGF B;  5IM0 B;  3BO4 A;  3GJR B;  1A6L A;  4DV3 J;  3C15 A;  5K9F A;  1WNE A;  4I6Y A;  4HAC B;  3D5M A;  3I0R A;  1WCM A;  2B56 A;  4FKX A;  4NXN F;  2EG2 A;  5IYD C;  3PYE A;  3N0C A;  1RHR B;  4TQR A;  3K0J A;  5C25 B;  2EBG A;  4DR2 F;  2V6U A;  1FX2 A;  4LRF A;  3OUY A;  3MR6 A;  1EI6 A;  4PCQ A;  4A3F C;  3F73 A;  3SMZ A;  3GTG K;  4PG7 A;  2IM0 A;  2XS2 A;  4DFP A;  4Q43 A;  4OV6 A;  2JA5 A;  3C3L A;  2YQ1 A;  2BBE A;  3ZZU A;  4LJM A;  4WFY A;  2VQE J;  4JOU A;  1T9Y A;  3MUR P;  5F0W A;  3U7J A;  2F65 A;  2M2B A;  3THV A;  2NLW A;  3BJY A;  1DAX A;  3CO9 A;  2AYM A;  1LW2 B;  1S48 A;  2RSQ A;  1SL1 A;  3VV2 B;  1RQ0 A;  2HVI A;  5HMX A;  1HBM A;  3B82 A;  3DN9 A;  3ET6 A;  2CZ9 A;  2BKO A;  5L38 A;  2NRE A;  2ZZT A;  1OMS A;  1VBK A;  2BE7 D;  3G2X A;  2NVX K;  5ETR A;  4PWW A;  4KMU A;  1CJU B;  3TVK A;  4NAS A;  2R7W A;  2WVC A;  1JLB B;  3RW6 A;  2PT0 A;  2CZV C;  4O0I A;  4AH6 A;  2J6T A;  2W2M P;  3MM8 B;  2N7C A;  1HI8 A;  1HBU A;  2P5M A;  1VQO S;  1N5Y B;  3RR8 A;  1V5V A;  2MHN A;  3HKZ D;  3I4H X;  3MED A;  3JYT B;  4FNH A;  4WFA Q;  3IWN C;  1HPZ B;  3Q22 A;  2QL5 B;  4MEY A;  5CCM A;  4OZ3 A;  2IIH A;  1H0H B;  3Q3Q A;  1TWC K;  3I82 A;  2GVZ A;  2F40 A;  2CFX A;  2ZBC A;  4KMD A;  2DPJ A;  3MR3 A;  1HHS A;  4Y2A A;  1AB8 A;  1XBW A;  3KJV A;  4LF5 J;  1GTE A;  1D9A A;  2O5I A;  1UFW A;  2LQ9 A;  2E2I C;  3OTO F;  4RNF A;  2BZ2 A;  1B99 A;  1S4E A;  4A3M K;  5KG5 A;  2QMW A;  1NHK L;  3W62 A;  1IBK J;  1OWX A;  2FC8 A;  2N3L A;  1XMQ F;  3FFI B;  5E3A A;  4A3D C;  2ILY A;  5C4X K;  3UI3 A;  3PO3 K;  1XMO F;  1KEK A;  2GSU A;  1FRX A;  5CJ9 A;  5GME A;  2HHQ A;  3EQL A;  2BW7 A;  1Q1K A;  4K8R A;  4N5S A;  3MEC A;  2IY5 B;  5J2M B;  2DHH A;  3QBC A;  5F3Z A;  1HL6 A;  2XSJ B;  4XLN A;  1FD2 A;  2YNI A;  2E2H K;  4KBI A;  4H4O A;  3FRY A;  1I3Q C;  1KLM A;  4JI6 J;  3DRS A;  2GCF A;  3Q2T C;  4PG5 A;  3NAH A;  4KY3 A;  4UUX A;  3AQP A;  3LUY A;  2HHW A;  2DIV A;  2WBR A;  4DMZ A;  2GVD B;  3HOZ C;  4M1X A;  4RW6 B;  2BM0 A;  1JIH A;  3TP2 A;  4KFB A;  4A3L K;  4A93 K;  4KH0 B;  1XN9 A;  3FBF A;  5H1S V;  4EZ9 A;  1S1U B;  1VJQ A;  5KFE A;  2YKM A;  4EEY A;  4DR1 F;  3RB0 A;  2UXD F;  2QYC A;  4BBR C;  2M3D A;  2AJ2 A;  2HFZ A;  2OJ3 A;  2Z2Z A;  2NZC A;  3QAE A;  4RWW A;  2W2Q P;  3GTQ A;  1XNR J;  4FVC A;  4MKY A;  1JQG A;  1FCA A;  1QUV A;  2ZOM A;  3QFH A;  2DEJ A;  4KHP J;  2NVT C;  4N41 A;  2FHM A;  5FJ4 A;  5AE1 A;  2RGR A;  2ZWP A;  3Q0A A;  4IG0 B;  1K0V A;  4MKB A;  3C16 B;  1UMJ A;  4G7H A;  2XI2 A;  1Z2Z A;  3M8W A;  3M4O C;  1N32 F;  2LQJ A;  5ETT A;  1OY8 A;  3LAM A;  5M2P A;  3UN3 A;  5IV3 A;  2WVB A;  2KM8 C;  3OXF A;  2NVY K;  3EGV A;  1C4A A;  2AP6 A;  2MQQ A;  3W60 A;  1J98 A;  5B09 A;  4O44 A;  3I0R B;  1KON A;  2DO0 A;  2V4Q A;  2J6U A;  3MEK A;  1CVJ A;  1Y1V K;  5MAO A;  4TQS A;  1T7P A;  3ILO A;  4KAS A;  2VG7 A;  4Q8F A;  5GAE U;  4NCA A;  2ZDO A;  3BP8 C;  4N8N A;  5IYB C;  3HOX C;  1F9F A;  2YKP A;  4PWD A;  3VGV A;  1H72 C;  3GG1 A;  3R5G A;  4CI0 B;  2X3D A;  3FKI C;  2XSF A;  1Y5I B;  1TR0 A;  5MLC V;  4BWM A;  3H0G K;  4TLQ A;  3AFG A;  2FJD B;  2XZW A;  4C8L A;  4ZJL A;  1JB0 C;  3H5U A;  4EUV A;  4JV1 A;  1LWC A;  1O2A A;  1WEZ A;  1H2V Z;  3VGU A;  1NH7 A;  4WFN Q;  1VMB A;  2MST A;  3GTM K;  1PBU A;  3ET6 B;  2MZJ A;  1OY6 A;  3EGN A;  2W7A A;  3A8K A;  2HFO A;  3E8O A;  3AT1 B;  2U2F A;  2KT2 A;  2M4M A;  1UVI A;  3K5L A;  3UVJ B;  2BRL A;  4EU0 A;  5KFY A;  2GQ2 A;  3H2U B;  5D4L A;  1CC8 A;  1FF2 A;  1DCP A;  3TZZ A;  2FVC A;  1RT5 B;  2GMJ A;  4KT0 C;  2E29 A;  3ZNU A;  3CD6 S;  1K8A T;  1HBU B;  4QYR A;  2VA2 A;  1QVG R;  2HQD A;  2LU1 A;  5IWA F;  1RTJ A;  1K47 A;  1XPP A;  1JXV A;  1IUJ A;  2CQH A;  4Y52 K;  2DHS A;  4MK9 A;  4K4T A;  5FD1 A;  5HVH A;  4OYX A;  2KTQ A;  2U1A A;  4OYA A;  3VHQ A;  1GXT A;  2HQI A;  3M8P B;  3R5A A;  4ECS A;  5TMC A;  2GVZ B;  3K89 A;  3KJV B;  2SXL A;  3CME S;  1IKW B;  1IWG A;  1G7C B;  3TEG A;  3BQ1 A;  1LWE A;  2XY5 A;  2G0C A;  1C0U A;  2DT9 A;  5B0C A;  4LK0 A;  3OVS A;  4MMO A;  6FD1 A;  1S9G A;  5JJB A;  5BR8 F;  1TU0 B;  1DTT A;  4FKY A;  2C42 A;  4WE1 B;  1UW9 A;  4A8X A;  4Y65 A;  1YLX A;  3CJR A;  2AJ0 A;  2XG8 A;  3S1R C;  1NAQ A;  3S2H K;  1EFW A;  2W25 A;  1K73 T;  3MEC B;  3JSB A;  5GAG I;  2YNI B;  3VZH A;  3DXB A;  1M0S A;  1ZM3 A;  1KHW A;  4J9V A;  5DZ6 A;  5H9F K;  3HJF A;  2MKJ A;  2VZ9 A;  1HAR A;  3DRS B;  5FLM C;  4CT8 A;  4DQS A;  2CFA A;  3VZI A;  2QLF B;  3A3N B;  4BS2 A;  3ILJ A;  3RTV A;  2ZFH A;  1VLO A;  3M9M B;  1QY7 A;  3LAJ A;  4A3K K;  4C4W A;  1PIE A;  2VC1 A;  1X5O A;  2V8V A;  3CVK A;  3NS6 A;  3LO3 A;  3HHN B;  4QW8 A;  4HI1 A;  3NNC A;  4N47 A;  2WB4 A;  2RS8 A;  2Y0S L;  5J1P A;  4OI1 A;  3OR2 A;  2V2Q A;  2XZD B;  2YKQ A;  3RR7 A;  4UF4 A;  2HEK A;  4XCH A;  5CZV A;  3A8I A;  3BBF A;  1FD8 A;  2IRU A;  3GP9 A;  2JA8 C;  2HK3 A;  1NPK A;  1CJV B;  3WC2 A;  1ZAX A;  5KFI A;  4ZCI A;  4A8Q A;  3G8T A;  1I6V A;  2IM1 A;  2CWK A;  4M5D A;  1U25 A;  4ZVH A;  3ELH A;  3KG0 A;  4USM A;  4A3B C;  1EP4 A;  2QG9 B;  5EGY A;  4P7T A;  2D6F C;  3BRE A;  3GTG A;  3L9Z A;  3CCU S;  2Y1I A;  3MM6 A;  2X1F A;  1D0E A;  2XLK A;  4OI2 A;  3MCO A;  2F7V A;  1HW9 A;  2DTJ A;  5KT2 A;  2OO4 A;  3IR7 B;  2HBY B;  1SPB P;  5L1J A;  3OL8 A;  4O44 B;  2WB1 L;  3VAK A;  2EWH A;  1U2F A;  2HW3 A;  2JL9 A;  5FDL A;  2DHA A;  3EXY A;  2ILZ A;  1NK0 A;  3R2D J; 
#chains in the Genus database with same CATH homology
 3GSI A;  3ADA C;  1WOP A;  4PAA A;  3A8I A;  2GAH C;  5L46 A;  3GEI A;  1WSV A;  3GEE A;  3GEH A;  3AD9 C;  3A8J A;  4PAB A;  4P9S A;  1WSR A;  1XZQ B;  3TTG A;  1PJ6 A;  1YX2 A;  1XZP A;  1PJ5 A;  3TFJ A;  1WOS A;  1X31 C;  1WOR A;  3TFH A;  1VRQ C;  1XZQ A;  3A8K A;  1V5V A;  1VLO A;  3TFI A;  3AD7 C;  1WOO A;  3AD8 C;  3GIR A;  1PJ7 A;  1XZP B;  2GAG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...