2GAHC

Heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
TPLRHSPAEHLDTVMDAASVAGRVELREIAFTTQISLRCAPGTQAHAALAAATGAGLPAKVGEVAGEAQGTAVLWLAPDEFLATSAENTELGGVLSAALGDAPGQVVDLSANRSVLELTGPDAPLVLRKSCPADLHPRAFAVNQAIVTSVANIPVLLWRTGEQAWRIMPRASFTEHTVHWLVDAMSEFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution.
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Oxidoreductase
molecule keywords heterotetrameric sarcosine oxidase alpha-subunit
total genus 43
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 2gahC02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 2gahC01
1WSVA 3GEHA 1YX2A 3TTGA 3GEIA 1WOPA 4PABA 3A8IA 4P9SA 2GAHC 3AD7C 1PJ6A 1VRQC 3ADAC 1XZPB 3GEEA 3TFHA 1PJ5A 3GIRA 1X31C 1WOOA 1XZQB 3AD8C 1WSRA 1V5VA 1WORA 3A8KA 2GAGC 1VLOA 4PAAA 5L46A 3TFJA 1PJ7A 1XZQA 3AD9C 3A8JA 3GSIA 3TFIA 1WOSA 1XZPA
chains in the Genus database with same CATH superfamily
2V8VA 1JWWA 3OSPA 1YNNA 4ILDA 4G1IA 4E8UA 2NSBA 2HS0A 4WILA 1N34J 3G71S 4A8QA 5AXMA 4R8UB 2ALYB 3D3CJ 4NXNF 4AT1B 1ICEB 4JOUA 2HS3A 2LXIA 3BGOP 3S1NK 4RW6B 1NHUA 3MTJA 3HOUK 1DTQB 4Y28C 4H4KA 2W7OA 5AT1B 1KN6A 1HHTP 1NK4A 2W24A 4J9NA 1DLOA 3NL0A 3IWLA 1IBCB 2AX1A 3U1MA 2XSFA 5L1KA 5IM0A 4X62F 3HZEA 5C44C 4Y0FA 3UDCA 3W5XA 5B0FA 2ZOGA 1U2CA 3AA9A 4O0IA 1RHQB 2GAHC 4BWJA 2BJ7A 3HOVC 3BKUA 2RJZA 3G8TA 2NUUG 3FBFA 1RTIA 3PO3C 2WBRA 1I3QC 4OYPA 4PR6A 2HHHJ 4NYOA 1ISEA 3PO4A 1BWVA 2RNEA 4DR6J 4DR5J 2YKNA 4GT9A 2DB1A 4C8KA 5L39A 5LXRA 3RZDK 3LGNA 1W26A 3ISZA 2QIFA 3U1NA 2DIUA 4K59A 1TWAC 2A1BA 1ZETA 1IKYB 4R8UA 2E2IC 1IBLF 2HQGA 4ELUA 1RTJA 1FVQA 2AYEA 2ZH2A 4KN4A 4FYWB 1KQFB 3PYDA 1B3TA 3PYGA 5DS7A 1SIWB 4LFCJ 2B4OA 4WTYA 3T1YF 1RSCA 3GFHA 1LWEA 4UTGA 2PDAA 2HYIB 4DV4F 1BUXA 1YBTA 2ILZA 1T03B 3LW5C 5KFXA 3C16B 1W25A 2YQ1A 3BM7A 4A3JC 4ES3A 2QYCA 1XXCA 4A3BK 2DYAA 3AY0A 3M8QA 1NCLA 3G87A 1HW9A 2LDYA 2DGUA 1WQFA 4QYZK 1RTIB 1RWNB 1SQGA 2KT2A 5HP1A 4UY85 4RMFA 4C3HK 1MLAA 2CNKB 4OZ1A 4Z7YA 4IG3B 3ENWA 1AB8A 3GLJA 4RUAA 4KC6A 2ZBQA 4L75A 4GO7X 4CLTA 2DNQA 1JXEA 1SC3B 1WC6A 3N0CA 1USMA 2HHHF 3BQ1A 5EGHA 4Q45A 2FQTA 2VB6A 1VC5A 1G6BA 4ZMMA 4ZVOB 2XCRB 5TJ3A 3DN9A 3EDRB 5F8IA 1XN9A 1TELA 3R5CA 2A6MA 4GMKA 1YZ7A 1UA1A 2RDDA 1RBLA 4URSA 2MY8A 2G4BA 2E2JC 1N52B 2QFIA 3VQTA 1SKSA 2LU1A 4JI6J 2RRAA 2R93C 5DDOC 2UXCJ 1LWEB 1XMBA 1CQNA 3HFKA 3MD3A 1NXIA 1S4FA 3RB6A 2V34A 1UW4A 1SL1A 1J6XA 2ZOFA 3ULHA 1VFJA 2D74B 2WVCA 3AD7C 4R0EA 2MLZA 2EPIA 4KB2A 5FJ8K 2HBQB 5E3PA 4LSNA 3BB5A 2WVBA 2HLTA 4EEYA 3D9BA 4CDIA 1FRIA 1FO1A 5LT5A 1VQKS 3M3YC 2DY1A 4J9KA 4KPYA 2B4UA 2J7KA 4OHZA 4DSLA 4BCAA 1BD6A 1U0HA 2N82B 1DJ0A 3KJVA 2CFAB 2J8AA 4PXCA 4KN7A 2R9LA 4TY9A 3HOXC 1R8HA 5SZTA 1Q0NA 1RWWB 4X66F 2R7TA 1WC4A 7AT1B 1FI4A 3T9NA 3VZHA 3RR8A 2HHWA 2AGPA 2E44A 3KHHA 3DHXA 5FIIA 2YH1A 4CT8A 4C2MC 2HGNA 4ECZA 4URGA 3NS6A 3FUYA 2GW8A 3H59A 1IWAA 3JSMB 2AGQA 3T3FA 4KHRA 3BBFA 1EQMA 2P9GA 2HRTA 1JOEA 5KFHA 1P6TA 3MEDB 4PG5A 3W2WA 1KS2A 2GIRA 3UCZP 2JWNA 4LR7A 1TK5A 2AU0A 1HQEA 2CPEA 3VAHA 4KB4A 2ZH8A 3OVSA 4LF1A 5J2QB 4PG6A 2FPHX 1IQZA 5LJ5Y 2PFDA 2R7ZA 2W2QP 5K8MA 3SSQA 2DH9A 2UUAF 2VH7A 2HKEA 3ZZTA 1JNRB 4MK9A 2GO8A 3VAGA 1ZTTA 1JJHA 4JI2J 4UZCA 4I2PB 5KG6A 2RDJA 4P75A 2HFZA 4X4PA 1X9MA 2AYBA 4B9LA 1RAJA 5DDPC 2XY7A 3IC1A 3KJVB 2CFAA 1Q16B 4F0KA 3VGVA 3AOAA 3G6ES 3MFHA 1S9FA 1ZA1B 4NXMF 1L3VA 3T6JA 5IWAF 3MPDA 1CJVA 2FHJD 4P5AA 4IUFA 4IO9Q 5IYCK 2HWTA 3HOVK 2MQPA 1WG1A 1S9EA 4EBDA 4WP9A 3H0GC 3HX9A 1J6VA 1EP4A 1LEOA 3GJRB 2UZAA 3LPEA 3VAFA 1XEZA 1IE0A 2VJUA 3N0BA 4EYIB 2M88A 3EPGA 1KC8T 3QGGA 3V4IA 1Q7LB 4WYWA 2KTQA 3CJ3A 1VIOA 2XZDB 2KU7A 4BLBA 2MKIA 2IVYA 3PJ9A 3NBPB 2WW4A 3AFGA 2QL5B 3HVTA 5LXYA 5J2QA 1X9WA 4N47A 1R9TA 4JI4J 2DGQA 1NK8A 5ETTA 4OZJA 3C46A 4N56A 4JI5J 2I9SA 2R92K 1KONA 4DU7A 2FVPA 4OV6A 4ZVQB 2BMBA 2J9EA 4LREA 4ATNA 1RJJA 2MB0B 2COLA 2HVHA 4LJMA 3MECA 3CIMA 5GAHI 4K7QA 4WK1A 3DOKB 2DGXA 3WX4A 4G7HA 4ES1A 2BKPA 1GMVA 1RLDA 4B3MF 2B8QA 5SUHA 2N7CA 3RW6A 2XS2A 1K83A 1CJVB 2VONA 2KDOA 4KMDA 4DR4F 3K7AK 3OTCA 4G1QB 2UVUA 3R2CJ 1UJ5A 1KWMA 1IM6A 1YJUA 4ELVA 1RAEB 2APOA 2B63K 4ZITA 3ISNC 4ZS6A 4URQU 2NVXK 1ZBSA 2QLJB 2MZ1A 4IR9A 4CM2A 2GIQA 1GX5A 2HFSA 1BDFA 2RHQB 3R5BA 4X4SA 1O51A 4PKDB 3QZ8A 4B9UA 3RJMB 4E0DA 2KHDA 3NBPA 4L72B 5IP9C 1PC4A 1SC6A 2X3GA 3TOQA 2IRXA 4MH8A 3HVTB 3VGTA 3O3LA 3ZZ0A 1CSJA 1MG7A 3FZ2A 3VGUA 1OY9A 2RRNA 1FXDA 3F0NA 2V8DA 3ZFVA 3MDFA 3LH2S 2XCPA 1QSLA 1YGYA 4DV7J 4B3SJ 1FFSB 3D7SB 2NREA 2D3O1 5HLFA 1V5VA 4ELTA 4IOCQ 4DFKA 3JQMA 1QLNA 2BOPA 4WFBQ 1N54B 4C45A 1YHQS 2BKNA 2FZKB 3EMTA 1RWOB 5HL7Q 2K7KA 2MLXA 5H9EK 3RAQA 3VGSA 1OYEA 3RBZA 4DSJA 5CYMA 3AQOA 1C0AA 1P9QC 3LAJA 2VG6A 4B9TA 3CSKA 5EN1A 2KXNB 1HR0F 4QR1A 1HWUA 5E2QA 4Y52K 3P5TL 1UFWA 4NE9C 4K0KJ 1GXTA 1HKAA 3CXCR 2V6AA 1U26A 4EBEA 2CJ9A 4X64J 2F9DA 5DM7Q 2KO1A 1SV5B 1NPPA 1K1SA 3HKZL 3M2UA 3GCWP 4OI2A 3OTOJ 1TWHC 2C22A 3OEPA 4A93C 4ZIWA 3CJRA 1KOHA 4ED5A 2QMUB 3QWPA 2OKQA 5EX0A 4IH7A 2A0FB 1NDLA 1TQLA 3ETMA 3D66A 1RT2A 4MEXA 3HSDA 3G86A 5EWGA 4DL4A 1VRUA 2OPPA 1ZA2B 4EZ6A 1ITPA 3S16K 3N79A 2YVSA 1WG5A 2FQOA 3RGIA 5HVHA 1GAOA 2ZKTA 2DXFA 1FK9B 2Y3YA 3M1VA 1JQGA 1RK8A 2ZBPA 4CO3A 1QUPA 4NL5A 5C25A 2H5JB 1PBUA 5CQGA 2VQEF 2V4JA 3R7BB 4LFAJ 1U45A 2VG6B 3PTWA 1B4BA 1NEEA 3HOWK 2CJXB 4C97A 2QC3A 2RKIB 1FWLA 3GTLK 5C4XC 1RAAB 5CAAA 3GTMC 5DM6Q 2R2RA 2CPDA 3DRYA 3KJQB 5KT3A 3OUYB 4XK8C 3CCWA 4DSFA 1HW8A 1HIYA 1HWIA 1FKPB 2VD3A 3TNVA 3QT8A 2GZOA 3PNIA 4EYHB 4HACB 2DXEA 4ED0A 2Q1LA 1L0WA 2F63A 2R2UA 3W8PA 2V63A 2NXCA 3DGPA 3LAMA 5E3AA 4MAKA 2E5JA 1T02A 5IFMA 2BE2B 4I0WA 1WTBA 3PW4A 4FVCA 2ADBA 3A8EA 4Q0BB 4LVNP 1XC9A 1IJEB 1REVB 3VQSA 3ENAA 3K2YA 4A8SA 2OO4A 2XO6A 5DQGA 2W2PP 4MK8A 2F8HA 2Y1IA 1YJ9S 3IS9B 3B78A 2IAJA 1AZSA 8RUCA 3IBFB 2MZTA 4YB5A 1M90T 1SC1B 3DLHA 3G9CA 3DI6A 3KLIA 1I94F 4LF9J 3BPSP 3OR1B 1NSKL 1RZMA 1J5OB 3SFUA 2DHGA 2C2MB 4QU6A 1UKUA 2RKIA 2FJXA 4OIQA 2DR6A 1M5HA 1IS1A 4QR2A 2R7ZC 1CBKA 1S1WB 4USTA 1SIZA 3TUPA 2GQ2A 4HT5A 3Q0AA 1S1UA 4IRDA 2XMVA 2BBEA 4M5MA 3B4DA 3OXFA 2E5IA 1R0BG 5HATA 3DDNA 2W9AA 3KXDA 1NPKA 1X4DA 5C5JA 2EI5A 5BJRA 4CNYA 5KT6A 4C3JC 3AD9C 4X65J 1X4AA 3OR2B 5GAEU 1TL5A 3PO2K 2LECA 4DR7F 3DLLQ 2J0XA 4RW8A 4TQRA 1VR6A 1W7WA 1XZQA 4LQ9A 3S1QC 1NZAA 2E7XA 3K5MA 2Q6CA 1GMWD 4Q43A 5B0GA 3NOGA 3J7Z5 5ETQA 3DLKA 1AZSB 4B02A 1QTNB 2DH8A 4W92B 4FBUA 2OPSA 3R7SB 2H51B 2DO0A 3VTIA 3LTOA 1RT6A 2D69A 1HMVB 5DQIA 4LFCF 3FDSA 2XCQA 1FWKA 2XMTA 3CJTA 5AE2A 4DL0C 3ZZOA 4CTAA 2GVDB 2R7QA 3DGVA 3QX3A 3UN2A 4ZVHA 1R3NA 3AT1B 1XNRJ 4B9MA 3MUVP 2C3OA 4IQMA 2JEGA 1ROFA 3ZXWA 3EQLA 2JA7A 4A4JA 4DFMA 3SCIE 4ECWA 4C98A 2W4DA 2AT1B 3GR1A 1NK6A 2CPZA 1C1CB 1JLBB 2QLBB 3Q2TC 5KG4A 3HJVA 5MAOA 1QAIA 1TU0B 3EGVA 4FNIA 2DD8S 3D0HE 1V9OA 3CCUS 2ACYA 1I6JA 2Z56B 5CZXA 1T9YA 3CJSA 4YR3A 1O24A 2XYPB 2Q43A 2EG1A 3DDIA 2PMZD 3C19A 1IXKA 2HFOA 1G2EA 5KFUA 4DG1A 2YWKA 2CZ4A 4YQWA 4M5IA 4I56A 4MYUA 1S0OA 2RSQA 1RT6B 4HTIA 2ASLA 2ZH3A 4KGZB 3L7OA 4KO0B 2R7UA 2KZMA 1Y1VK 1BHNA 5E5NA 4AQYF 3EXCX 4FYYB 4CTAB 2GVDA 4RW6A 1N88A 4V1Ak 1DTQA 3I56S 2I2YA 2EBBA 2KVQE 4QIWL 1CEZA 3K17A 5IT9Y 2XWXA 2B9XA 2JSXA 5G4DA 2RIJA 5IT9U 3N6MA 5A0YA 1R43A 3EDQB 3HKZD 4IDKA 2CDRB 5E41A 2QA4S 2XC9A 3T5JA 5D4PA 1JLBA 1H2TZ 5B0AA 1U2RA 3OTDA 1Q86T 5RUBA 1MMNA 3I4PA 3UDVA 2MQQA 3R2DJ 3KMSA 4ED1A 3HM9A 4YEAA 2VBXA 1TZ0A 3FRZA 3NG8A 4JYAF 3H5SA 5CYQA 2CZ9A 2MJNA 3B4MA 3CW2C 5F9NA 2LQ5A 1OWXA 4I64A 3BYPA 2L48A 4CLLA 4QWEA 1NDCA 5IP9K 1P9YA 4DG1B 1I6HC 4X4VA 3MGJA 1IKYA 4DI6A 5FDLB 3PJWA 4I69A 3EVOA 1YJRA 2RS2A 2M8DB 3L9ZA 4KO0A 1I94J 3P8BB 2PC6A 5KFTA 5D78A 1Z1ZA 1IW7A 4H4MA 1FEEA 4HDGA 1CJTB 1RDRA 2E9TA 2J0SD 4KKOB 1WOSA 1WF2A 4DX5A 3PYFA 1VK3A 4GZYA 1Y7PA 4QPTA 3J7YI 5LM7E 1T03A 5EWEA 5A0YB 3I4NC 1RA6A 4YR0A 3RRGA 2HVDA 3C16A 3H4DA 1RKIA 1CVJA 1VC0A 5CZVA 4EBCA 1F0XA 3IFEA 1UP1A 1T9VA 4PCQA 3FFIA 1EIYB 3M8QB 1M1HA 4KHMA 3BO4A 1NJXA 3RRHA 5HJXA 2DNGA 2MSTA 5HP1B 4DPUA 1B4AA 4X65F 2ZITA 4DL7A 1T9UA 1WTFA 2OP5A 1V3RA 5FLXY 3EPIA 2OTJS 1O2BA 3L7UA 2LQ9A 1RB0A 5CYQB 2WB1L 1IR1A 2QX0A 4A8YA 4C3LA 4NXMJ 1NJIT 3BQ2A 3GTKC 3S15K 4A93K 3QAEA 1TL1B 4P73A 2YKOA 4OYWA 4XDCA 4WTOB 5FDLA 4IKAA 1S72S 1NKBA 2H1YA 1VOMA 1HARA 2ACMA 3SFGA 2KXHA 2VFRA 4U95A 1SQFA 2FVQA 4DZ6A 4Y3CA 4H4MB 4NEYA 1CJTA 5BYRA 3S16C 1FXRA 1RWMB 2YNHB 4K2JA 4N5SA 1N5YA 3D6HB 3IBWA 3JSYA 2XCAA 2KFZA 2FVSA 4MKYA 1RU2A 2OIHA 1MN7A 2QN6B 4LSNB 1NK9A 1VGYA 3DLEB 3CCRS 2O5DA 3W5ZA 2LQJA 4F3OA 5KFSA 3OVBA 3K59A 2I38A 1RT1A 2ATCB 3DLJA 2KYZA 1NO8A 3R7NB 5LMUJ 1WCMK 2IBKA 2XHWA 2JVOA 1TKTA 2FHOB 1WDTA 5GMKa 5LJ3Y 3BDEA 2HFUA 2XWYA 1DCOA 3ZTOA 3I4MC 3CDAA 1U0HB 1RYRA 1I3QK 2MMYA 2PEHA 5LSLA 1TL1A 4OYIA 5IYCC 4NOIA 3M6UA 1PILA 4CZCA 1UVNA 1A0OB 2K2PA 2O01C 2R7XA 3S01A 2F7VA 2WVFA 5L9XA 2IMOA 2UXDJ 1UVMA 4ZPWR 5E3RA 1WQGA 2QMWA 2KT3A 1ZAWA 2J0QD 3UDLA 1TWGK 3M05A 4B3OA 4Q8FA 1LV5A 5K8OA 1PYOB 1V6HA 3TZYA 3KLGA 4BBSC 4XTTA 4OZ0A 5I3UB 5CA5A 2B5JB 3RZOC 2BW7A 3JYTB 1KEKA 1RU1A 2J7WA 2MZJA 5DZ6A 3MPYA 4WIQA 1LW2B 1WD6A 1RI7A 4WJ3M 2C28A 4KC5A 5F9LA 4I6WA 3TA1A 3CDUA 2IA6A 4OX8A 3AQPA 1YJNS 3VAJA 1VQNS 2B9EA 3DLEA 3QMQA 2WAQD 3BKFA 4J9MA 1F9FA 2KRBA 2VC0A 2W25A 2JDJA 4WFZA 4TU7A 1OS5A 1RT1B 4P71A 3BYRA 2ATLA 4IYQA 2GMHA 5IYBC 4DN9A 1X4EA 2WZ1A 1NKCA 3TVKA 4NMXA 5F8GA 5HL8A 1NDPA 5K8PA 1EK8A 4K4YA 2ROEA 2KN4A 4USUA 3EWGA 4DJBA 1IWGA 4U7UD 2B0GA 3SQOP 9ATCB 4L76A 3LA0A 4DQSA 1RACB 5AXKA 4KPCA 4DV5J 4J9RA 4RL1A 2H4WB 3OLBA 3UCUP 2CQBA 3PW0A 2FD2A 1WACA 3CDEA 4YS2A 1VC6A 1A6LA 1WHYA 3V4IB 1FRXA 2DHAA 1VK8A 5I3UA 1RWKB 2OGUA 4CWBA 2VQFJ 3PX6A 1ZOTA 3KG4A 5C3EK 1TMJA 3JYTA 3BBCA 4EGLA 2R92C 4NLVA 2LXFA 6FDRA 3C14A 5K20B 2KB2A 5HN0A 2B9YA 4DV1F 1VJWA 2ZWOA 2R8KA 1BC6A 4DU8A 4LRDA 2DNLA 1YCLA 3M3YK 2G0JA 3BREA 1DCHA 2E1MC 3MM6A 4FYDA 4C3KA 4PXBA 1T7PA 1HNIA 4A3FK 3DOKA 4A48A 4LRBA 2ZNYA 5HI7A 4DV2J 4NLXA 2CPJA 1MWZA 3D6MB 3HKWA 3OFEA 3MAHA 4BC9A 3SSRA 3KUHA 2Z0GA 2VU5A 4ZVRB 1KTVA 2XEXA 1WCMA 4ECYA 4G1QA 4ZCLA 1TWGA 1VLYA 4DEZA 4J91A 1JJCB 4BXXK 2M9KA 1RWXB 5J2PB 1FD2A 2CPHA 3Q8QB 2OMOA 1BWEA 4PABA 3I87A 2C2OB 3GTJA 4ZP8A 2GIFA 2L3MA 4KMHA 2MYFA 3PX0A 2EK6A 2LKZA 3I4HX 1C4AA 4ZLLA 1UL3A 3NS5A 1REGX 1UJ6A 2MQ8A 2E29A 4J5OA 2OD4A 3KWMA 4KGXB 3C14B 4B17A 5IWAJ 2H9ZA 2HQDA 2MKKA 4QQBA 3NGKA 1G4CA 3T00A 2LA6A 4J9VA 3GTYX 4K4UA 2ZFHA 3A3NB 2KH9A 3MM6B 5KFPA 5HLFB 4CI0B 5C42A 1KLNA 4DL3A 1Y9OA 3IWNC 2KL8A 3AD8C 1N34F 2M0GB 4L74A 3BZQA 3JB9k 4LSLB 3HHLD 4RBVA 1JXVA 1QE1A 3RW7A 1B0TA 4DV2F 1XR7A 3AB2B 3GTGC 3OTBA 1FX2A 1YK9A 3KUEA 5LSOA 4EUVA 1IBAA 2CNNB 3PJXA 2WB1D 3TZZA 5L8RC 3ET6A 4USMA 1USOA 5E3QA 2K7JA 2JZ5A 5J2PA 4WJ4A 2V6TA 4KV8A 2PFFB 4F4WA 1F7VA 2RB7A 3M7VA 2VKZG 2DR8A 2KT5A 3M2UB 3I5CA 2MKHA 2VF3A 1FDDA 2IDEA 3DRSB 3KLVA 2NVQK 2IC3A 1NK0A 2Z4PA 3VAIA 1UFKA 4NWBA 5KFAA 4OZLA 2JC1A 4Y2AA 2XBPA 4K4ZA 4JI1J 3GTOC 2OD6A 2B7BB 2P9EA 5KG5A 3FNNA 4IRKA 1AFIA 1RT2B 3G6XA 3GTPC 1WF0A 1APSA 2ROGA 2ZZMA 3IO1A 4GTEA 3C66A 4EI2A 2AYGA 3GR0A 2PPBA 2W9BA 1TTHB 2OFGX 3KNGA 1UZHA 3A4TA 4IRCA 3PW2A 3MPWA 3HXMA 2MQLA 4EO6A 1HFEL 4QWCA 3H0GA 3DNCA 2GO9A 1KBRA 2CQHA 5F8HA 1FJCA 5KFEA 1K73T 1YBUA 3M1VB 2GX8A 2YWWA 2LCWA 4WZMA 2C2NA 1QE1B 1JJ2R 5C25B 4XCHA 2VPZB 1P27B 3JTOA 3N3YA 5KFLA 3W7BA 1XMQF 2IYGA 3QPIA 1F7UA 1SVDA 2IVMA 1URRA 2BJ8A 3GTLA 3H2VE 4DV6J 1U02A 2DGOA 3FVYA 1EQ0A 4OHWA 1RT5A 5ETMA 4KV8B 3CD6S 3BF4A 3H5XA 3TJ9A 5T7LB 1AB4A 5LMNJ 3DRSA 1XERA 2RS8A 2HGLA 3ZTQA 4CH0S 1H3DA 4PXEA 1TMMA 3O5TB 5FLXU 4LF5F 2Q3PA 2P8IA 2JA7C 4OX7A 4FS2A 1CC8A 3WBZA 1ZQ1C 1PJ6A 1EKSA 2PT0A 3S1NC 4F2RA 5AXLA 2UVWA 1WIHA 2GA7A 4K4TA 2HHQA 4Q0BA 1GFWB 4NZ0A 1S0MA 3HK2A 2FLNA 1VGXA 4C0HA 4F4KA 3C2PA 3MURP 4HKQA 3DHWC 2JL9A 4DFJA 3OFGA 3PYEA 2HGMA 3KMQA 4UOCA 2FIUA 1FDBA 2IAJB 1LNQA 5D6GA 1XWLA 3OR1A 3IXQA 2KHCA 5FJ4A 4IO1A 2AMCB 1R8BA 4C7QA 1U1QA 1F2GA 3TEHB 3HVAA 4O2DA 1F5CA 2J8SA 2RQ4A 1T3OA 1KP6A 5T14A 1RT5B 3WC0A 2Z30B 4PXDA 4Q5SA 1FDAA 1RBAA 5A2QU 3ADAC 2CZVC 3N28A 2R8JA 2O66A 4JB8B 2FHMA 2ROPA 2OPQA 3LP2A 2D9PA 1MMDA 2XNRA 2F1FA 3C15B 3O6QA 3BGRB 3H5YA 3FEXB 4WF9Q 1NM2A 3IMQJ 2XLIA 4RW4B 4ZK7M 1WHVA 2X1GA 3BKTA 1I51B 3M9NB 3OR2A 4JI8J 1FJ7A 1KNZA 2HS4A 1BGWA 2AHOB 4CO1A 2VFVA 1NJWA 1W2IA 2ZJQQ 2AGOA 1XZQB 3I9V9 2CJAA 3DLKB 4USHA 2WK4A 2OPSB 3LO3A 1VIXA 4QIGA 4K4VA 1HMVA 1SKRA 4ECRA 4YG2A 1RE1B 4RNHA 4O3QA 5IT0A 5HMXA 1K83K 2W7VA 2JEIA 5GADU 1O2FB 3U27A 1DY3A 4H4OA 4NLSA 4PWWA 1H98A 2WBMA 1LXNA 2F8EX 3DU5A 3GTPA 1MU2A 2ZDPA 3L4BC 5HO4A 1YX2A 2OPQB 1FWPA 4DR4J 1JK9B 2JA5C 3HMJG 4G65A 1NK5A 2FJEB 4DR3J 2QLXA 5DDRC 4C11A 5KFIA 3H3VD 3W5YA 4RBUA 5IV4A 2HAIA 2JA5A 2VJVA 1R8PA 4RW4A 3TYTA 2E9ZA 2VUMA 4KIAA 4P9SA 5LOQA 3CE8A 4KHPJ 1B99A 4UT4A 1WI6A 2H65B 1DURA 3NGTA 3MFIA 3DC2A 3TARA 4AFFA 2RMLA 5F0WA 4KJIA 2HMIA 1HBNB 2CQ1A 4AD6A 3U1LA 3GFXA 3D3BJ 5L1LA 4Q4ZA 4O3RA 4OMFG 1ZAXA 1RUSA 2NVYC 3CAGA 3DRXA 3SXLA 5KFDA 4P6QA 2ILYA 4ZPTR 3OFFA 1LW0B 1TFYA 2YNIB 2BJDA 2F8MA 2NZCA 3VF0B 1HNWJ 4ILRA 3CB4A 1N32F 3KLFB 2N4CA 3R97A 1OPZA 4H4OB 1T8EA 1RWPB 2B63C 3UFCX 1KQKA 4DL2A 3CCES 4ZVPB 3R9LA 4XSZA 1UAWA 4BY7K 4F4AA 1MU2B 1N5SA 3BGLA 1N36J 2W8KA 4OI3A 4CRJA 2IM1A 4Y00A 1WEXA 3QT5A 4O3OA 5HMWA 1OQ3A 2NVXA 4ANEA 1FNMA 1M5VC 2BDPA 4C3JK 3QIDA 4IDKB 4GC7A 4C11B 4QWAA 4RWXA 4WXOA 3NOCA 1EETA 5IOQA 3HSGA 4AE5A 1VHIA 4YFNA 3RB4A 4ENOA 1E6YA 1OJ4A 3V4GA 3IN5A 3GTJC 3PO2C 4ECTA 1VQLS 2VC1A 3ITHA 5C24A 3OTOF 1VS3A 3QQCD 2ERRA 1VI7A 2EVZA 4IH6A 4RUCA 2HMIB 2PE8A 3CQZK 4RU9A 2B4VA 2WONA 1SH2A 1FD8A 5KFFA 2BA9A 2DR7A 4NOHA 2GSOA 1FRJA 3AOBA 3J81j 4ED8A 4FPIA 3KJFB 3KJNB 1MWYA 5M2RA 1RISA 5KFJA 2YNIA 1G7CB 4LR8A 3WDOA 4Y2KA 4GTBA 5KT5A 3CMES 2R7SA 2NYHA 8ATCB 1R8CA 4A8MP 2LYVA 3H0PA 5JMNA 2J6UA 2GQQA 3UD5A 5LL6d 4KKOA 3GQCA 4C0BA 4K5SA 3NLCA 5KG3A 4B3SF 4TQSA 2N7YA 2HHSA 1Y3KA 3KG0A 2DO4A 2DGVA 2QT7A 2HNZB 3Q8SB 3HT3A 3FJ2A 3FFIB 1PAUB 3CO9A 3H0GK 4HR2A 5TMFA 2CKWA 2JVRA 1E6YB 1Z2ZA 2QSFA 1U25A 3BO2A 2M2BA 3MR5A 4WP3A 5AE1A 4LF8F 2NVTK 3O2IA 3D4JA 1DD5A 2QFJA 4V19J 5JVOA 4QYZJ 2HWHA 3G4CA 3K8VA 4NLPA 1IQ0A 4YHHF 3VCDA 2L41A 2WONB 3D6FB 5IQ6A 3W65A 1M0SA 2CUYA 2RU9A 1HWLA 2IHR1 3V6KA 4XLNA 4BLGA 5IV3A 1TWCK 2YNGB 1TL4A 5L46A 2BQUA 2NSCA 2DNKA 4Q5VA 2AYMA 2ZM6J 2NXEA 3ILOA 5G0RB 5C44K 1RA7A 5DETA 5IQQA 4G0WA 5IZHA 2XULA 3FKBA 3PXGa 2YTCA 2RDIA 4CIOA 2Z58B 2YNHA 3PO3K 1GMWA 1N5YB 3OBIA 1T9WA 5D4OA 4PEOA 2X7IA 5EHHA 4OIXA 2BUNA 5ETOA 1JIHA 2JEJA 4GTDA 5KT4A 4PG8A 3S0XA 3SDEA 2HNZA 1WCMC 4KQZA 1KVJA 1CLFA 1T95A 4ZHRA 1F2HA 2VFSA 2JA8K 3GSDA 3BGFA 1S6PA 3HDSA 4HHJA 1HI0P 2XSJB 2NUHA 4USJC 1TWHK 3M4XA 1TKTB 2OUGA 3OQ2A 4J9UE 3LGHA 2HEKA 4NLGA 2K06A 2V0NA 1S6UA 5HMZA 2IM2A 1SH3A 2M3DA 2E2HA 1YI2S 5D8HB 4I68A 5JVHQ 4ECUA 1U6BA 2V6SA 5GAGI 1UEUA 5JXSA 3GG1A 4A47A 4NLYA 1H6KX 2NLWA 4A8KA 1KQSR 5KFRA 2UXBJ 2YNGA 2HQFA 2F3JA 3BH6B 3K5OA 4BDPA 4S0MA 1GTHA 3G82B 2LU2A 4PUOA 1SJ4P 2DY9A 1JB0C 1P8GA 4PPZA 4R5PA 4OJ1A 1U0SA 2PI4A 4C2MA 2JRSA 1ZYQA 4B3OB 3KK1B 1IKWA 2M7SA 2RAQA 1B0VA 3ZTRA 3R3TA 4MKBA 1D9FA 4P10A 2G13A 1X7VA 2EKYA 3KLGB 4JV1A 1JLFA 1N5VA 2B5JA 3ILLA 2VPXB 1MN9A 4QW9A 1UEKA 2YWFA 4Z2XA 4MTPA 2IMWP 2HHVA 1LW2A 3DLGB 4I1TA 3N9UC 2MPUA 2KYXA 1PC5A 4WE1A 1BQNA 1R9TK 3SDEB 1RAHB 5F8NA 3KHGA 1VYAA 2CG8A 1NLKL 2UUCJ 1FKOA 4P2MA 2OSQA 2QZ8A 3CCLS 4G6VB 1S6PB 4K4XA 2FHJA 5KG2A 3M8WA 1SQEA 2YX1A 3MR3A 4GKKJ 4ZJLA 2D3ZA 1PYSB 2EXUA 2DVIA 2MTLA 3WZ0A 5IP7K 3CJ8A 2E2IA 3TRGA 2NPIA 4MIBA 4B3TF 1XR6A 2XCOA 4HHUA 2XG8A 4PYAA 1QSSA 1UV7A 2YPYA 2LQBA 2YBVA 2XHCA 3AHPA 2R93A 4PUOB 1OPIA 2HG4A 5KFZA 5DLGA 2CQ2A 1UVLA 4ZPVR 3GTOK 4RKUC 1KRPA 3H2LA 4O44A 3TX8A 3W8GA 4CLWA 3P45B 1JLFB 3HP6A 4FDFA 2HQCA 3DLGA 3GP9A 4KAIA 4WE1B 2UV8G 2VQFF 2E5GA 5CD4A 1BS2A 5FLMC 1BQMA 2L9DA 1KFSA 1O2AA 4KB7A 5FD1A 4JI4F 1FKOB 4DV0F 1R31A 2NR0A 4JI5F 2NYIA 1BGXT 1Y5LB 1JLGB 2UUCF 3IPJA 2R7WA 3LPXA 1Y00A 1R7IA 4YB7A 3UCGA 3QO9A 4F4YA 2BJEA 3JSRA 1HNIB 3HHLC 2A6OA 1KHWA 3J80U 2HNYA 4YP3A 3R27A 3EVWA 4ZPDA 2YPZA 3THVA 4AYBL 3HOXK 1RHKB 4DR3F 3K5NA 3MMJA 2POKA 4QOTA 2V69A 1HNZJ 2V2ZA 3BR9A 1D9AA 3HOYK 3S2DC 2Z2MA 1F5AA 4OL8A 4QBUA 4M5LA 1OIAA 3TQ1A 4KGVB 2GJIA 2G2ZA 3M8PB 3GEHA 4NEZA 1SC4B 5HQLA 4ZJOA 4OYOA 1UWAA 1O26A 4DR1J 4TLRA 2DKOB 1M5SA 3LANA 4LRFA 4DHVA 1U24A 1Q78A 2P8TA 2NVYA 3QBCA 5M5YK 2B4PA 4JI3J 3IR7B 3OL8A 3BGUA 3ZO7A 2DR9A 4ZOSA 3M2RA 2W1BA 2AIRB 1T05B 1Q82T 1XXBA 1WKKA 5LSRA 1V5IB 2WSCC 5D0RA 2GJ2A 2B63A 1T0TV 1N0VC 2Q66A 1DZ5A 2YWHA 2UXBF 4X84A 2EEYA 1N33J 4RLEA 1VQ6S 4DS4A 1JLGA 2HHXA 3CD7A 1RU0A 3QO9B 1HQ2A 4P7VA 1FNOA 5C42B 1S9GA 5HROA 4KGKA 2HNYB 2V4RA 5HQ8A 3HVWA 4GFQA 4P2SA 1F9NA 3A3PB 4YFKA 1SFOC 3RBDA 3DRRA 4LSLA 4EMDA 1J2VA 1SJ1A 4MIAA 2HIQA 4KT0C 3GMGA 1D9DA 2P9CA 3MTKA 3ET6B 1LK7A 1RT3B 5KFGA 4KBIA 3QYYA 7FD1A 4UF4A 1LKZA 3PKMA 3HCXA 2CADA 3P3DA 2CAJA 1WOPA 4DSEA 1VRQC 2GHPA 2DNZA 2MZRA 3BSNA 2DGWA 3M2RB 4DUYF 3RB0A 4XPCA 3EJMA 3K58A 2IC3B 4JI3F 1ZYRA 3R5GA 3W63A 5E0OA 4UQGA 2JA6C 3GYGA 2VODA 3PG9A 4HI1A 5HQMA 5D4NA 3AXKA 1FTCA 1ZM9A 2QO3A 1NJYA 2VBZA 1S7IA 3FHZA 3D1HA 5K14B 2J9DE 2W9BB 2HVEA 3FCHA 4OYBA 1Y1WA 3AOCA 2DPJA 1VBKA 3BSOA 2EFQA 3CVKA 2VASA 2E7VA 5KFQA 1FXLA 4X4NA 3MMLB 3QGHA 2XLJA 2E1AA 2JC0A 2ZKUA 4FKXA 2OEKA 4WFAQ 4GKKF 2IBOA 4OIPA 4C3IK 2F4VF 3DRRB 5BXIA 4DR2F 3W61A 1X5OA 1YIJS 4K4SA 2B6AA 1Q53A 4QIEA 4QU7A 1UVJA 1U1MA 1UPPA 3HFZB 1RAGB 4DLGA 2UV8A 1N36F 3NCQA 1HNXF 4LQYA 2E2HK 2GQCA 3LQVA 3TA0A 1XNQF 5AE3A 4AL5A 4DV6F 2KG0A 1NHVA 2YWGA 2RU3A 5T7LA 4J9LA 4KFBB 2BE7D 4PG7A 2LDIA 5FLMK 1FRLA 1GX6A 2MEWA 4OINA 4DUYJ 4EU0A 1KFDA 1X4GA 3QWUA 1XPPA 2BZ2A 3M30A 1SH0A 3FKIK 3LP0A 3PHEA 3CCZA 4C8ZA 2OPRB 2AJQA 1GNKA 5K14A 3J7AN 2HHPA 5F3TA 3ZZPA 4IOAQ 1Z4UA 1S79A 3MR6A 3QSIA 4DR1F 2AV5A 1NB7A 3HOWC 1PBAA 5HSPA 3HOZK 3QFWA 4TKTA 2IYIA 4QW8A 1VQ8S 1S99A 4I6YA 4F8RA 3O8WA 2E1CA 1X31C 5JJBA 4G3IA 4JI1F 1B7YB 3FK4A 2C1EB 2LXUA 2CJQA 1C4CA 4RZRA 1INNA 4DX8H 4PPDA 1BJTA 2EBEA 1ZM2A 3GV8B 5F8JA 3IG1A 3HD2A 3OL6A 5ETLA 5CD4H 3TAPA 3TAQA 3AJDA 1YITS 2UU9F 2R92A 2DHXA 5DLFA 3LUYA 3CD5A 4P7TA 3SCJE 2YH0A 4BXXC 2P6SA 4BWMA 2VDHA 4MEYA 3LP2B 3PO5A 3J81Y 2R7VA 1MWQA 2V8GA 4OLPA 3C15A 4GVBA 3BGRA 3M30B 5EDWA 2V2VA 4JI2F 1AFJA 3HOUC 1Y3JA 3W9JA 3LP0B 2XQCA 1F93A 2Z57B 4U7CA 4Q8EA 2OPRA 1N5TA 1WC3A 1R0AA 1FRKA 2W7AA 3S8SA 2ZD1B 3MM5A 1TK0A 4ZA1A 2RH6A 3OV7A 2EFVA 1I50K 4KARA 5IC6B 3K0JA 1XIQA 1SJRA 2MZQA 2XMJA 3S1RC 2YU9C 2J6SA 1HBUA 2R7OA 4NA1A 1WUUA 4A3CK 5CCMA 4EZ9A 3M6XA 4MJKA 2YU9K 1R89A 2B3TB 5ADZA 2F65A 3PX4A 4YUDA 2IVFB 4DBQA 4WU3A 4PQAA 4DOZA 3SEOA 3KK3B 4DV1J 3MEGA 2BM1A 5L38A 3I5BA 2LEPA 1HBMB 4QIVA 3CULA 3IG1B 3EXYA 4DLEA 2VICA 1OMSA 2V2QA 1KVIA 3QJJA 1JLCB 4BBYA 4QCLA 3WC2A 5KOXA 4LF6F 2PIIA 4YY3J 2WCXA 2X1FA 2Y0SD 1X0PA 3SQGA 2VOPA 3RR7A 3K7RA 3V6HA 4GVBB 1XBWA 1SMYA 1NDKA 1RHMB 4FF3A 5KOWA 2Y1JA 1S49A 2H48B 2BYCA 2FZCB 3OXLA 1R0AB 3ISND 4LF2A 2ZD1A 4GVLA 3P49B 2M8HA 4WFXA 2C2EA 3WIVA 3J7A1 5K5MA 1K44A 2D6FC 1HBNA 1RHRB 3ELHA 4HVZA 2FJDB 1QAJA 3MCMA 4J7CA 5C4JC 1JQWA 3A1YG 3CJ5A 5HVGA 1I3QA 2VKRA 2QJ3A 4J9PA 3KK3A 3QT6A 3NP5A 3MEGB 1HYSB 4M1XA 4Y34A 3R5JB 1LW0A 5DGBA 1AUSL 2FB0A 1HBMA 4J3NA 3UD4P 2M52A 3BSAA 2VZ9A 2AX0A 4ZKAA 3AA8A 2NXJA 2KWAA 4X62J 3KLFA 3ERED 2CIMA 2XNQA 5KT7A 3US5A 4DR2J 4HH0A 4IR1A 1IL2A 3OL7A 3H2UB 2OLWA 5CH7B 1D8YA 3KDOA 2BW2A 3PIOQ 1SCJB 2FC9A 5IT4A 3AODA 2HBZB 3GFYA 3O44A 4U6PA 2QLFB 3SQGB 4OI0A 4NI2A 3GYNA 1RHUB 2HFVA 1AUDA 3D2WA 5HBMB 4QYRA 4PWDB 3I4MK 3TANA 1TL7A 1EETB 2GHVC 2Y0SL 4X6AK 1ELOA 4LMZA 2AW0A 1O28A 1IJFB 4B3TJ 3QGPA 1BE4A 4KDDA 3G2XA 3ITHB 5C24B 1U09A 1L3TA 4F02A 1FRHA 1N4LA 2YU9A 3RZAA 4NLQA 1VMBA 1DQAA 4C8YA 2FUG9 1YJWS 4M63A 1DRZA 2H54B 2BJ3A 4K8RA 4ALZA 2LQ8A 2X1AA 4RUBA 4KMUA 3DKDA 3FOEA 2GS8A 3R5DA 2BE5A 1WKLA 2B7CB 3L95X 1SPBP 3CMAS 1U1LA 1N0UA 3NWRA 2GFFA 2AF6A 1O8BA 4XAKA 4BC7A 2R2TA 1WORA 1T94A 2RE1A 1SFOA 1HHQA 2R8GA 3DXSX 2PO4A 2ZHBA 2KM8B 2YQ0A 3QRRA 4C9DA 3POTA 1EJ7L 2QRRA 3HJFA 2P6TA 1WDDA 1XMQJ 4NI2B 3K5LA 1Z2LA 3TZXA 1YRTA 5IS2A 2PMWA 2RF2A 1LK5A 1I6HK 5HBMA 4J9QA 1HPZA 2ABYA 3WQPA 4PWDA 2BOAA 1RKJA 5F0UA 2J9DA 2G2YA 1TL7B 4CYUA 1O0PA 1K0TA 2JNJA 5T41A 5EX3A 4DPYA 1S1TA 4FXVA 3S1RK 3TJ8A 3J7ZT 2ZC3A 4OYXA 4WWSA 4ED4A 4FXDA 4CLZA 5DGAA 3HHNB 3VR1A 2XZWA 1GXLA 2JHEA 3T5KA 2K3IA 3GILA 2N3LA 4UUXA 4OHYA 1BY9A 2V9KA 4HDHA 3PR5B 4ETXA 4ZPCA 2BRKA 1DFDA 3CT9A 3N5BA 3S7RA 1RAOA 5HANA 1U6ZA 3HI9A 2B8PA 3UR3C 1ZM4A 4Q7AA 2M5YA 2HHUA 1KVKA 3FMWA 5G0RA 3BDPA 3KTQA 4NASA 4USVA 3EYZA 5C2CA 3CIZA 3BSCA 3IR5B 3KHLA 5EGEA 3TVZA 1VJEA 1X4CA 2W9CA 4ECXA 3M8ZA 1NMEB 4OZ2A 3CPWR 1K83C 4Y6IA 3KLHA 4LT6A 3DXJA 3J80Y 2ZH1A 1N33F 3TX0A 1IBKJ 2JA8C 4BY7C 4WK3A 2ZDOA 2EW9A 1TWGC 2DPIA 2FJAB 3AH5A 1PCAA 2PN6A 1HPZB 3JTPA 4CLKA 1K0VA 2OELA 5DRKA 4ZHRB 3MPUB 1DTTB 1JLEA 2ZH5A 4ZVSB 4NYPA 3PW7A 2O67A 3E8OA 5KFNA 1S1TB 3HOYC 1N56A 2RVJA 2JX2A 4KH0B 1F60B 4I2QB 2XSJA 4P74A 3W2VA 3PKYA 3CCMS 1FRMA 3C6UA 4U96A 1TVRA 2F4FA 5ETSA 4LF9F 1K47A 3L09A 2FY1A 1FNXH 3BH7B 2B51A 3A3OB 4CLPA 1WQHA 5ETVA 4DS5A 2FDNA 1FKAF 1S1XA 2DNMA 1K9MT 3NEKA 1YQHA 1TWFA 1S57A 4GKJJ 5F8MA 2XI3A 3BQ0A 5J1EB 1S0VA 1TKXB 3CCTA 4G7ZA 2ZZNA 1OY6A 4BBRC 2F40A 3G82A 1TWFC 1S12A 4RR5A 2WTFA 4R5PB 3FCVA 3KK1A 1IKWB 3MMBB 5B0CA 2VDIA 3FKIA 2AKWB 3J7YU 5F8LA 4WKYA 1VHFA 2PSZA 2HRUA 3OJUA 3SCLE 5KG1A 3TQEA 3GONA 3NGSA 2UUBJ 3SSSA 4X4TA 4F25A 1JNZB 3TO8A 4Y65A 2AEMA 4OJ3A 4DV3F 1BQNB 1XR5A 2QE5A 1IBKF 4U67Q 4WCEQ 1WKJA 3AXMA 1DTTA 2XY6A 4U9RA 4ZLJA 2JLEA 1RAIB 1QUVA 1CJKB 4ZP7A 1DHMA 1YSJA 4R0JA 4LVOP 1FFGB 5JFEA 3W2VB 4ZCMA 2U2FA 3QATA 3KOAA 3KK2B 2I0XA 1DAXA 2Y3PA 4O0NA 2FQQB 3KKFA 3U02A 3CDBA 2PMHA 2RHSB 2ZJPQ 1N6QA 1X0FA 1FE0A 2UVRA 4F0HA 4NPOA 3T5LA 4NLWA 2CJYB 3ICLA 4C0OC 1PO6A 3G4AA 3GZ7A 1TKXA 4LF7F 1B7FA 2DT9A 2VUMC 3RZDC 1D0EA 2BQRA 1JLQB 2DR5A 3NWGA 4L73A 4O44B 4Z7CA 3S2HK 3MMBA 2E2IK 3R1LA 3BN7A 3SCKE 1HWKA 1A9NB 4A46A 4USWA 1SI9A 1TL3A 2RRBA 1U49A 4HT7A 1L3KA 4LRCA 4NCBA 3ZZZA 1U7LA 4RUHA 2E66A 3OFHA 3I0RB 1BQMB 1YKWA 2CQDA 5A6PA 3GIRA 4ECQA 1MSWD 4EFAC 3LWMA 1F5BA 2BXJA 1C1BB 1DARA 1CJKA 3T01A 1FFWB 4K4WA 4WZQA 2Y9HA 4YY3F 1EX8A 1X4BA 4BS2A 1X9SA 4XIUA 1IKVB 1J5EF 3LP1A 3WIUA 5KTQA 3D1QA 5IYDK 2L08A 1EARA 1I50A 3V6DB 3BPDA 1IKXB 4MFBB 3UE2A 1UW9A 2NVXC 5M2UA 1TUVA 1SKWA 5IYDC 1DQ8A 2RQKA 2PD1A 3F56A 4Q2LA 3N5FA 1NRKA 3UWTA 3MI7X 1Q1KA 4CLUA 3M8PA 2AJFE 4UOFA 2CWXA 2MXYA 4ID8A 4K0KF 5KFWA 4A3JK 3UR0A 5JUMA 1AXQA 4X2BA 1T05A 3TFIA 1WJ9A 3E51A 2P5MA 2XY5A 4Z37A 1KDNA 3L3CA 4PYDA 3QRPA 2D41A 3B8HA 1CQMA 1G1XA 5MLCV 1YDLA 1NUEA 2UVVA 4DX6A 4F26A 2E2HC 3I0RA 1QM9A 4XSXA 2CQPA 2GSUA 1ZBTA 2UP1A 5A2QY 2ZC4A 3IRXA 2E1RA 1HR0J 2GCFA 1VQ4S 3Q8RB 3MD1A 1Q7YT 5A6WA 2HPUA 4A3IC 1S9GB 4ZLPA 1IKVA 5HROB 4N8OA 4FKYA 2P5VA 2CVEA 1B64A 1WELA 1IKXA 4MFBA 2EC0A 4IFYB 2OFHX 1W2BR 2O5JA 4R25A 5IXUA 1VDHA 4ITSA 2WAQL 1Y1WC 3ZZRA 1CS4B 4TYBA 4A3EK 5ETNA 2GSNA 4Y2CA 1RT3A 3OVAA 3ILIA 2MSSA 2CNOB 5I42B 4DPXA 3GTMK 2HAFA 4ER8A 1HHSA 4X4RA 2J6TA 1VRTB 3VVTA 2E5HA 2V5HG 4F4XA 1X60A 2NPFA 2E1PA 4DSKA 3QRQA 2WHOA 3Q3QA 2DRBA 2G0IA 3T9ZA 3R1HA 2IY5B 1NKEA 1HNZF 3I55S 4ZCKA 4P52A 3NXZA 3BP3A 1R8AA 3M9OB 2RD5C 3DMJB 5J1NA 2KXFA 3HPOA 1ZPWX 4C8OA 1UZDA 3CCQS 3GTGK 2LVWA 1L5UA 1F3FA 4P2FA 4M5DB 4FF2A 4D3HA 3SYZA 1NK7A 3GTMA 2FYXA 3FEYB 1OY8A 3UO0A 4DDQA 3UNGC 2SXLA 3RU0A 2WSFC 1UA0A 3OXGA 3B54A 5ETRA 3UPFA 5BR8J 3MCNA 2FGOA 2BJ9A 3BR8A 3CO0P 3IAM9 1WHWA 1X8DA 5I3PA 2C2DA 1CS4A 3MAAA 4TVAB 2B6AB 2WOMA 2MGZB 3T1HF 2HFNA 3GJQB 1PG5B 1GMUA 5BYSA 4CT9A 2XYGB 3NAHA 2ZHOA 4F0MA 3L4KA 1LXJA 2QG9B 3T5HA 1VRTA 2MZSA 1SJFA 3TUIC 1J5EJ 1IR2A 2YX4A 2QTWA 4NX9A 4KFBA 1YRXA 2E5LF 3FRYA 2AZ1A 4K50A 3CWJA 3E01B 2E9RX 3KNAA 3S14K 1TP7A 3CNQP 1VISA 3V4MA 3OW2R 4TXSA 3HZGA 2C42A 1EZZB 2DHHA 3S14C 2PA8D 3DMJA 3F41A 3HHLB 1VJQA 4ZLNA 2QEXS 3A13A 4OJGA 3C6TA 5H9FJ 3NMRA 1Y11A 3O1LA 2JEFA 1RCXB 3DXBA 2JFKA 2XMMA 4QR0A 4ICLB 3MPVA 4RW9B 3PRBA 2AZ3A 1Q81T 4J9OA 4CP5A 5M3MK 3A8KA 4PAAA 1F1BB 3HT0A 2BJ1A 2AJ1A 1H7WA 3MAAB 4JBCA 2DBBA 2Q79A 3NCPA 3BUEA 1IM4A 2VOOA 2I8EA 3IR6B 1C0TA 1AT1B 3GTQK 4LK1A 2YNFA 3MMCB 3EZOA 3I9ZA 3LOUA 1ZS6A 2K1RB 4MT1A 3GV7B 5E33A 1Q8IA 3S6EA 3OLAA 3GTOA 3AJ2A 1ZAVA 4DR7J 3KLEB 2A69A 2HIYA 4RBTA 2IPOB 5KFMA 3N6LA 1QD1A 1WI8A 2MLYA 5A8RB 2YKAA 4NZ7A 2R42A 4L6V3 4RNOA 3S2HC 2Z2ZA 2A10A 3HHLA 3M32A 2DNYA 4DDFA 5KG0A 4FXWA 3NMAA 1M1KT 3MM5B 4ANCA 4GTCA 4J90A 2DNPA 4JI8F 5L1JA 3MZIA 4WBFA 1JXLA 1CC7A 1Q8KA 1HBUB 4ERDA 1B0PA 4Y2MA 1XNRF 1WNEA 2OSRA 3EM1A 2A6EA 4FNHA 4OJHA 3S1MC 1BQXA 2CPFA 3K7AC 3PDNA 1FJGF 2MY7A 2XO7A 3NGRA 4NLRA 4CLSA 1C0TB 2W2OP 2R8HA 2UUTA 2V67A 3F73A 3R6GB 1U2FA 1VQ7S 4J37A 2YNFB 1JLCA 1H73A 1YZ6A 2CA9A 1RCOB 2RILA 3JS9A 5AJ3J 2R7RA 2FJVA 3KDNA 3Q89A 4PG4A 3A8IA 2D9OA 1CPZA 1D8ZA 4TYAA 3DOMA 4ILLA 3KLEA 2DNOA 4LF7J 3CJ0A 5A8RA 4X4UA 4DX7A 3GTQC 2ALZA 2DRAA 1RWVB 4O3SA 3IRWP 3M32B 3I31A 4LUBA 3Q22A 4AL7A 3TW0A 3GDZA 4WPAA 4NYZA 2GMLA 2EFPA 2HVIA 2WW8A 4AQYJ 4QWBA 1TAQA 1UFLA 2CQCA 3RB3A 4L3KA 5AXNA 4LJZA 2NXUA 2A18A 4ANDA 4LR9A 5GAHU 3OT9A 1K8AT 1S0NA 2LLZA 1ZH5A 2YKQA 1HYSA 2EFOA 4PWUA 4ZVUB 9RUBA 3UN5A 5L9NA 2UUBF 1SJ3P 3ZNJ1 1PJ7A 2E2JK 2RGRA 3MEEB 4DV3J 4NMLA 1SL0A 1U6FA 5CABA 1VBXA 4DPTA 3GB0A 2R4FA 3RBXA 2LA4A 1FEHA 3DU6A 3GU0A 4JV2A 3PEHA 2A3JA 4CO2A 3P4UB 3MM7B 2E5LJ 1FERA 3T19A 3PY8A 2FVRA 5CHCB 1ZTWA 1HQUA 4PRFA 1EHWA 4Y7NC 3G8QA 4IOBA 1R6VA 5D77A 2W8LA 4A3MC 1JX4A 1CJUA 4FF4A 4A8XA 1O29A 4NLUA 2CDQA 2ADCA 3HSZA 4OI4A 4OIOA 2FGCA 2KFNA 5DJBA 4AUKA 3Q24A 1S48A 3H90A 3ENVA 5E3CA 4A3FC 4WFYA 1LWFB 5EGYA 2FTRA 2LEBA 1ZPVA 1FE4A 2XGPA 4OZNA 3G6YA 5D0EA 3CCJS 3A12A 2R8IA 3MEEA 1KQGB 4YN3B 1YLXA 3DFEA 3BEGB 1X4FA 3H5UA 1RBOB 4HHHA 1SB6A 1S76D 4U8VA 2OAUA 2OMLA 3NAIA 3JAMY 3POTB 1Y1VA 2JH3A 3X1LB 4JI0F 2KRRA 3PRVA 4A3LK 2LFVA 4ZIVA 2CQIA 3LWLA 2RF2B 1WOOA 1Q79A 3NCRA 1IN0A 4JI7F 1Q4RA 4B9NA 1HNXJ 1GEHA 4DF4A 4X4QA 1O25A 1XZPA 4CYUB 2CJKA 1N5QA 2EC2A 2XGQA 3FQLA 3KYLA 2QL7B 2CQGA 2NZ4A 2PA8L 1PKUA 4M8LA 1CJUB 3MCSA 1C0UB 4ZCIA 2V68A 3VA7A 4RJVA 3TUZC 3TR5A 1F9HA 2IJRA 2EK1A 2ZNZA 3GJTB 4G7OA 4YHHJ 1TKZB 1U1PA 4H54A 3QGIA 1URNA 3RAXA 4A3KC 4M5GA 2XMKA 3MAQA 1TWHA 2ZM6F 1DBDA 1JLAB 1NBEB 2XYHB 4OHVA 2PA3A 4OI6A 4OYAA 4LR2A 2W9CB 4YB6A 4BBSK 3CDWA 1TWAA 2ZH9A 3FEZA 2NVTC 3KLHB 1D09B 4DQIA 3TFHA 4FP9A 3TI0A 4LSZB 3G96A 1UMJA 2JA7K 4OHXA 4N41A 1TKDA 3R8YA 4TNOA 2R2SA 4O4GA 2EFNA 3QSYB 3IGVA 4JI0J 1ZZFA 3NUHA 2KG1A 4MYTA 3I96A 4NLTA 4CO0A 3Q8VA 1NH7A 1XZPB 1JLEB 4CH1A 3GFZA 1JJ4A 4Q44A 3HD1A 5D4LA 3VAKA 1TWCC 2C3PA 4F3QA 1XMOJ 4I2QA 4P5BA 2W2MP 5GMEA 1KLMB 3IBCB 3C6UB 4ZH4A 4RNMA 2C3YA 2VL1A 5IYBK 1TVRB 3JQJA 3FOFA 2PEBA 4M5JA 3D28A 3I6PA 2DEIA 3BV8A 1YJTA 4JP8A 4GTFA 1HBOA 3I5AA 1S1XB 8AT1B 3RUBL 4DCPB 3I82A 2IM0A 4C6AA 5IORA 1KR4A 2GNKA 3Q2SC 2WVDA 5J1EA 2A68A 3HHEA 3TP2A 3OSNA 4M5NA 5F3ZA 2ZVSA 4DF8A 1MMLA 2G1HA 4EO8A 3TEGA 1YJVA 2PMZL 5E7OB 4WP8A 5GADI 3I32A 3W64A 2W01A 1FA0A 4TLQA 4LLGA 4O4GB 3MF5A 4ZN3A 4KATA 3D6TB 6AT1B 5EWFA 1H38A 2ZH7A 3V6JA 1RAFB 3DCAA 3ZTSA 3L7PA 2DGSA 1I1GA 1OQ6A 4AH6A 2V6UA 4EK2A 4WFNQ 2V9WA 2MDAA 4DR5F 3FSIA 1WWHA 3OREA 5M3FK 1RP5A 1KLMA 3RZOK 4A3DC 3KK2A 1XMOF 3V2UC 4LQ3A 4HI2A 4IFVA 3NKYA 2B56A 1YVFA 3NGUA 2CQ0A 3NGDA 1N6QB 3MUMP 4MK7A 2OTLS 4NCAA 1FVSA 3PFEA 2Z2YB 2VA2A 2NXNA 5GAGU 4C3HC 3CJQA 3H25A 4W4MA 3DYAA 1JLQA 3ONQA 2JLGA 4N7TA 1S10A 2AJ2A 1KKHA 3EUNA 4GO5X 3PCOB 3OHBA 4F7VA 2ZUAA 3MOZA 4FVMA 3GTPK 4BKWA 4DCJB 5DG9A 2DCUB 5IOSA 4RPFA 2OEJA 1FJEB 1EI6A 4NXNJ 5EUHA 1TL3B 5B09A 1X4HA 2OH2A 2I5JB 2V94A 4ZPAA 1V3ZA 1VLOA 3VALA 2Z8QA 1UVKA 2WB4A 1XTZA 4OV1A 1C1BA 1TWAK 3CMQA 3IWXA 4Y7NK 2BABA 3IP0A 3LP1B 4IFVB 2YWEA 4YOEA 2VG7A 3V6DA 4B3RF 3SV4A 1HNWF 3UDEA 5D3GB 2BANB 2ZJRQ 1GK8A 3Q8YA 3T1HJ 1NPRA 4CM0A 2JOQA 1VH2A 1O5JA 3JXOA 2W7PA 1B4SA 4FM9A 4LF6J 3UVJB 4I7FA 2XI2A 2YX7A 3DYAB 1B70B 3NY0A 5A8WB 1MNEA 2U1AA 2YY3A 3EZ5A 4UQTA 1I5OB 2Y0BB 1VBZA 2UXCF 1GTEA 2R7ZK 3K57A 2DCLA 3GTGA 1VQSA 2HQIA 3FKIC 4P72A 1QAXA 4DXLA 1UWBB 3OPFA 2A2DA 3RBEA 5J2NB 3MR2A 1M5OC 1NAQA 3I0SB 2HURA 2FLLA 4F50A 1TR0A 2I5JA 4CNZA 2ZEJA 1TUWA 2H5IB 1S5ZA 5IP7C 4CO5A 3MMAA 4CH7A 2LEAA 4Y52C 3PM9A 3S1QK 1NHKL 1VQYA 2VQEJ 4F3MA 4LFAF 4CLFA 3IRXB 1IUJA 4HYKA 3TAMB 2VPWB 2H5EA 3ETOA 4LBIA 3GTKK 1FJGJ 3QJLA 3UI3A 2JA6A 4KY3A 3EGNA 2BACA 2Q6BA 2VV5A 2VG7B 2HWIA 2M70A 1OSDA 4IFYA 1S6QB 1HI1A 2BR0A 1FCAA 2KVIA 4OLOA 5BYQA 1WSVA 5D3GA 1WF1A 5J1PA 4NA3A 4CLYA 4K2XA 2BRLA 4CCHA 1IQTA 3CC2S 3EZUA 5ITHA 4HEA9 3UVJA 3F44A 4I7FB 2CFXA 5A8WA 5H1SV 4QIFA 4UZBA 1F3VA 4DUTA 5I42A 2HW3A 1RT4B 2AEJA 4W98A 3FMBA 1NH8A 4D3GA 3GEEA 4FPRA 4A3KK 4C8LA 2WRMA 3SI8A 2QMXA 3CQZC 1WSRA 3CD0A 3FBCA 1EQRA 4K5RA 2GV1A 2QA1A 2NQPA 3BJYA 3PEJA 3MM8A 4WKRA 3AH6A 2PI5A 1OO0B 3CC4S 4YDDB 4LF8J 1WC0A 2HVZA 4LIRA 2ZWPA 2HBRB 3CJKB 1RT7B 1HI9A 4Y2IA 1FDNA 4A3DK 2KFYA 3I4NK 4QWDA 3IAS9 4LBPA 4ZP6A 3TZWA 3QJPA 5HJYA 2RQMA 3B6BA 4M5DA 3MOJB 1RTHA 4RNFA 2Y8WA 3TAMA 3G6VA 1YBAA 4NCGA 4KH1B 2IM3A 3WX8A 1TAUA 1H72C 4X6AC 4C8NA 2AP6A 4OZ5A 1YRUA 1U1RA 3TA2A 4C2MK 3H42A 2D1CA 4LF4F 2DIVA 1S6QA 2IIHA 5KG7A 3NNHA 5L1IA 2UXDF 2F4VJ 1HD1A 1ACMB 2ZUFA 5K8NA 3HSJA 4F36A 2Y1RI 5ETPA 2WOMB 4ED2A 5BR8F 2MGZA 2X51A 3NNAA 4USIA 2QSWA 1UEVA 4N76A 1U1KA 3FSYA 4YFUA 2F5GA 2DK2A 4AYBD 2GMJA 1ZM3A 2CVIA 4F04B 4P2XA 2C2RA 4IG0A 4C4WA 5I3QA 2CPXA 3M4OK 3TTGA 5A8KB 3NRBA 3H3VL 4DR6F 3E01A 3JTNA 4DUZF 4QJVA 2W4CA 3MM8B 1O6XA 4B08A 2GVZA 3P6YC 3ILJA 4OYMA 3AAWB 4KSEB 4AXJA 4OZ3A 2IJFA 4NA2A 3IM8A 3PFOA 3CJKA 1SKUB 1RT7A 2R3VA 2W2NP 1AA1B 4DMZA 3C6TB 1RTHB 3T41A 4O3NA 1JMTA 2W4PA 1TFWA 4NZ6A 3GSIA 4ICLA 5KFVA 4RW9A 1SFOK 1T3NA 3D54A 4JV0A 1V3SA 3CJ2A 2GGPA 4OFZA 4OX6A 3HLUA 4C8MA 3Q8PB 2Y8YA 3V5RA 1BMQB 1YNJA 4LF4J 4A8FA 4MMOA 3BBBA 1ULRA 1QVFR 3UNYA 2JA6K 1KD1T 3D67A 4DSIA 4DWIA 3H40A 1RWUA 1ZVUA 1RTDB 3S17K 3MMCA 3EX7B 1S59A 2BEFA 3BP8C 4PZVA 5E68A 1O27A 2K1RA 2C2ZB 5IOLA 5DDQC 5HAOA 3GTJK 5A8KA 2V50A 1G3OA 3TFJA 3GTLC 1KTQA 5DO2A 2P2CB 3L4JA 3N6NA 4RW7B 2JFDA 2GVZB 4JUZA 2EWHA 3BS9A 4FZVA 4HLBA 3FSXA 5DZ7A 4E98A 2CWKA 2MKSA 3NNCA 3TVYA 3GJSB 3D0IE 3W3SA 1H2UX 4DPOA 3H98A 5D0GA 2FHKA 4KHPF 4U8YA 5CCLA 3MR7A 5H9EJ 3PR4A 2V8PA 2QGFB 1CULA 2XS5A 1UVIA 2DHSA 1ZXOA 2BV3A 1KOOA 2X3DA 5C7PA 3T1AA 4KRWA 1S7HA 3S15C 2AEFA 2ZH6A 2YKPA 1DLOB 4ED3A 3M8YA 2H3EB 2JLFA 3DLBA 2HZVA 3UN3A 5M5WK 1UCNA 1WHXA 3FBEA 1S97A 4IQXA 4M95A 3D68A 4YDXA 2N3OA 5J2MA 4C48A 3W9HA 4PQUB 3RRKA 1RTDA 1S1VA 3CGIA 5JVGQ 4DN0A 4N77A 2ASYA 3QIPB 3OPKA 3W1YC 4YFXA 4A3GK 1NSPA 1XXAA 3DOMB 2KJWA 3PV8A 2J5AA 4FYVB 4DV0J 2ZFZA 3Q83A 3W9IA 1WC1A 4M5HA 2ZVIA 4RW7A 4A3CC 3G8SA 1JVIA 4EWTA 3M6VA 2HZAA 2YXLA 1TWFK 1P1TA 2A6HA 2CQ3A 1QDUB 4UOHA 1ZZNA 2VA3A 4A3MK 2C2KB 3DRPA 4UY8T 1HA1A 2IA0A 3T02A 1N32J 2J0WA 1RTJB 1MW7A 5B08A 1CULB 1L3SA 1EH1A 5DQHA 2FC8A 2CW0A 4MKVA 4FN5A 3N4WA 1RLCL 1R27B 3GIKA 3UQSA 1RGVA 2J9CA 4DV7F 4DQPA 4DUZJ 4HH1A 2RUGA 1LQ9A 3EVMA 3DM2B 4ED7A 2HNDA 3GIJA 1R0CB 4JK1A 3GG0A 4KR0B 2CPIA 3UW1A 3JSTA 2ZHAA 5M2PA 4I6AA 4NRTA 5J2MB 4PQUA 3MWBA 1S1VB 2VUGA 3QIPA 2XLKA 3KHRA 4DFPA 2M4MA 2KZZA 4LFBJ 4G0VA 2RUSA 1WC5A 2XM3A 4J9SA 4A3BC 2DNRA 4M1KA 3THPA 4IG3A 4FYXB 4ZP9A 1EFWA 3MXHP 2CG4A 3MM7A 1BLUA 3E3XA 1HL6A 3CTRA 4BBRK 3M8SA 5B0BA 1S6OA 5CJ9A 4ECSA 1HQUB 1UJ4A 3GIIA 3TWZA 3DRPB 2QA2A 2EKNA 3THTA 2XS7A 2AD9A 4GRSA 2ZBIA 1NZ8A 2UUAJ 3HO1A 4GC6A 3MHYA 1U1OA 1Y5NB 4QIWD 1NJZA 5AJ3F 5B0DA 1GT8A 2FJBB 1TWCA 3MM9B 5DG7A 1LWCA 1JKHB 3W66A 1X5TA 4RU2A 5KFOA 1LWFA 1VBYA 1QVGR 3DM2A 1M1GA 5KFYA 2IDLA 2HNDB 1U4BA 3MUTP 3W60A 1UPMB 3KUGA 2QLWA 4ETZA 5IOTA 1HNVA 2MKCA 4GTLA 3J81U 2VBYA 1KSPA 2CPYA 2JJ4D 2AQ4A 5C2GA 3HHDA 4ZVTB 2I1RA 3TUJC 2DISA 3IM9A 2I6WA 2AJ0A 5LMUF 3K8WA 2RH3A 1NSQA 3TJAA 2LMIA 2FLOA 3IGNA 4WYLA 1AYEA 3M4OC 2WVEA 1PGZA 5C4JK 4WIIA 4KGMA 1GH8A 2GJFA 3EICA 1IBMF 2PHCB 2C3MA 4XO0A 2NVQC 3GV5B 2DXDA 4B3RJ 5DG8A 4JI7J 5D15A 1U47A 1TV6B 2HQ3A 3HF5A 4ZN1A 3ZNUA 2QYGA 1C0UA 1YTYA 3K5PA 5ETKA 2G9OA 3ZZYA 3OTEA 2VFTA 1YWXA 1Q5YA 5KFKA 3MM9A 4NRUA 1LWCB 1JKHA 2VFUA 3JSMA 1TKZA 4RO0A 3OD2A 3Q8UA 5CXTA 1PJ5A 3MEDA 1H2VZ 3W2WB 3LPYA 3X3UA 5M5XK 1XNQJ 2CRLA 3HXAA 4B3MJ 4V19X 3OL9A 1HQEB 1M5PC 4DL5A 4YMEA 1QTMA 2XMAA 3BO3A 1HNVB 3S1MK 1M5KC 1N8RT 2DGTA 1JLAA 2D3UA 2ZUEA 1S4EA 3ZTPA 1FT8A 1Y5IB 4NLDA 1HD0A 1QAYA 2X1BA 2ZUGA 1A7GE 4I2PA 3QT7A 1BXNA 4I67A 3CJ4A 1RTZA 2H4YB 2MHNA 1X5PA 4N8NA 3IA0A 2YKMB 3OHAA 3D1OA 2ASDA 4F2SA 4CO4A 4OI1A 4QZVB 2YQ3A 4LIWA 2KKHA 2L9WA 1NU4A 3KG1A 1VQPS 2JA5K 1SL2A 1AW0A 2Y1LB 4WXWA 5GMDA 4DV5F 1TV6A 3VV2B 2MQMA 4OX9F 1NNDA 2BM0A 2OJ3A 1GXUA 3PHTA 2ZE2A 1S9EB 1LFWA 1YG0A 1EP4B 3SV3A 1Q5VA 1HBOB 2CJBA 4ZVEA 4XLPA 2HBYB 2AWZA 1VQ9S 2V8HA 5D0HA 4AXIA 2MJUA 4GKJF 1Q8LA 1KHVA 1K1QA 1CG2A 2ZBCA 5A76A 5K9FA 4MIWA 3GWCA 2HRYA 1IVZA 1T9TA 2B9WA 7FDRA 2DRDA 2HSEB 2BKOA 3N01A 3GTQA 1DQ9A 1U8WA 1HI8A 5B7WA 3MECB 4OYZA 3NS7B 2NS1B 2V4QA 2J76E 3QLHA 2YKMA 2A2CA 4I4BA 3W62A 3CF5Q 3GCXP 3LAKA 1X5SA 2CQ4A 2IRUA 2DEJA 3CUNA 4L3NA 5B0EA 2OHDA 4KYZA 1G51A 4UW2A 1L3UA 1TUGB 4A3GC 1Y1WK 1QJHA 1SUQB 1T9XA 2HK3A 2ZE2B 4CQ1A 4X66J 3GIMA 4W90B 2EBGA 2NCKL 2DH7A 1R9TC 1S77D 2GHWA 4OX9J 3FGVA 1FTRA 4G1PA 1I3OB 3RTVA 3HOZC 2MQOA 2EG2A 4OQJA 2VG5A 2L9NA 1OSCA 5GAEI 4BLAA 3SIPB 3FQKA 1WEZA 1IBMJ 2IFXA 3H4BA 2HK2A 1DCPA 4OIRA 1NSAA 4BY1K 1LFPA 3P96A 4JI6F 3SZZA 1SBRA 3VHQA 2XTJP 1RABB 2ZBRA 2E7WA 1UETA 1H0HB 4B9VA 1F6TA 2RT3A 2VHGA 3EGZA 3VVUA 1IBLJ 3MCOA 1GE9A 2IRYA 4LRAA 5KT2A 1FESA 3HHKA 3C3LA 3M9MB 3CQZA 3DOLA 2MHEA 3QLHB 2D7SA 2BQ3A 2XZTB 1KQ4A 3JQKA 4KE5A 3B82A 4TU8A 1EAYC 2VUMK 4KAWX 4A3LC 4RX6A 4O3PA 4M5KA 5CYMB 1VQOS 4F67A 1NB2A 2MKJA 3JAMU 3QFHA 1SUQA 1RADB 1FF2A 3RG6A 2UUWA 2O5IA 2V2KA 4AL6A 3HVRA 4F4ZA 1I50C 1U48A 3VWSA 3BN4A 3R5AA 3T6BA 3R6LB 2BANA 1SV5A 2VG5B 3MEKA 5D4DA 4FF1A 2N4DA 1P1LA 5TMCA 3M8RA 1VQMS 1R6YA 2FZGB 2NVYK 1RQ0A 2KM8C 1J98A 3SZYA 3GYXB 4C3MA 1PIEA 4C3IC 4WU2A 4USKA 5HK4A 3CCSS 3LALA 3CEDA 3S1TA 4GTAA 3WODA 3CCVS 4XDDA 3FC9A 4ECVA 2C3UA 4ES2A 3M6WA 1UWBA 3S2DK 3ENQA 2R93K 5THWA 1VRUB 5J2NA 3V81A 2VBWA 2OPPB 5IC4B 1PSDA 4O23A 3I0SA 1HWJA 3K89A 2FY8A 3DOLB 2VIHA 1PYTA 4BY1C 1RHJB 2MKYA 2WSEC 3H8YA 3FZBA 4A8OA 4UOGA 1FK9A 3RAMA 3MMAB 4KASA 3H20A 4UUWA 2J7UA 2QL9B 2V4JB 2KJVA 1D1UA 4DCOB 3SMZA 2FVCA 2DITA 4ID5B 1F9EB 5HMYA 1QSYA 4ZPBA 3SBMA 1N48A 2G2OA 2DJWA 5KAKA 2PGCA 2LP4A 4TN2A 3HFVA 3RYLA 4ZJQA 3GE9A 5I4MA 5LMNF 2DTJA 4DQRA 3OUYA 2CNLB 4HL9A 1FKPA 2OEMA 3E2EA 4KTQA 1Y0HA 3GTKA 4DQQA 4NLOA 4HACA 3EGWB 2AJ4A 4LF5J 2XMUA 3ZZUA 6FD1A 3G4SS 1RT4A 1HLWA 4H4KC 3GPAA 3PW5A 3DGPB 4A3IK 4B9SA 3PRDA 4KM8A 1Y10A 2G0CA 2HHTA 2BE2A 4ILMA 1SXLA 3V81B 1AROP 4LOWA 1REVA 4M94A 2DNNA 2FLPA 3ZC4A 3QAUA 3OJSA 4WJBA 4BHQA 2Z2LA 3Q86A 4XPEA 1Y4ZB 3PACA 4KMAA 3LGMA 3IS9A 3S17C 3M2VA 3JSBA 4G0UA 1YJ7A 3DDKA 1VQ5S 3HULA 1U1NA 3DI6B 3KLIB 5F41A 3VZIA 1XJWB 3KFWX 1J5OA 2B43A 3WHIA 1H7XA 2O1PA 4LK0A 4NCGB 1LWXA 1MROA 4YB1P 1T11A 3N0VA 1Q95G 4FZBA 5KFCA 4ID5A 3Q23A 1H74A 3T1YJ 4Q2MA 2FJWA 4RNNA 3P5BP 1SJQA 2KI2A 3AB4B 5HVFA 1S1WA 4DV4J 1Y1VC 5C3EC 1LOUA 3VAMA 1XK8A 2O3DA 1S1UB 4LBHA 1E6VB 3U7JA 4MQ9A 4QPXA 1UTAA 3EE3A 3LAPA 1D3WA 3PVXA 2OI2A 2VPYB 1EKRA 3FBBA 2RQCA 2ZH4A 1Q8BA 4E2FB 2EFGA 4ZVFA 3H7HB 2ZOMA 2UU9J 1QY7A 4IG0B 4JYAJ 4JV5J 2MQNA 4FBTA 5CHPA 3C8YA 4A8WA 4TU9A 4DPWA 1RXOB 5KFBA 4RW8B 2CXEA 4QJVB 1EB0A 4IH5A 2ZZTA 5C4XK 2K8GA 4TY8B 3AJ1A 2QV6A 3QNWB 1J6WA 1GQEA 4RWWA 3M2VB 4DZDA 1PAEX 1FHTA 4A3EC 4ZVGA 1I6VA 3PZPA 1MROB 5H9FK 4O4RA 1IR0A 2QA4G 3FCWA 3UD3P 2HLUA 2G1DA 1WEYA 2GGPB 3CC7S 4X4OA 5GVQA 3QZ7A 2K3KA 4U7UK 1E6VA 2ASJA 2F9JA 4FS1A 3SZ2A 2CYYA 1OYDA 4KM9A 1C2PA 3GEIA 2HZCA 4YR2A 4ED6A 5IM0B 1TK8A 3D5MA 2BE9B 4X64F 2IJNA 1C1CA 2GC8A 1U8SA 2BX6A 5CYJA 4LFBF 2XB2D 1XQIA 4DL6A 3LF0A 3A8JA 4HTJA 1WG4A 3D0GE 2BVZA 1RYSA 2D3OR 2XMWA 1J27A 3PIPQ 1VCTA 5U47A 2DNHA 4JV5F 1HQMA 2GAGC 1FX4A 4ZDNA 4TY8A 4MKAA 2YKNB
chains in the Genus database with same CATH topology
1WSVA 3GEHA 1YX2A 3TTGA 3GEIA 1WOPA 4PABA 3A8IA 4P9SA 2GAHC 3AD7C 1PJ6A 1VRQC 3ADAC 1XZPB 3GEEA 3TFHA 1PJ5A 3GIRA 1X31C 1WOOA 1XZQB 3AD8C 1WSRA 1V5VA 1WORA 3A8KA 2GAGC 1VLOA 4PAAA 5L46A 3TFJA 1PJ7A 1XZQA 3AD9C 3A8JA 3GSIA 3TFIA 1WOSA 1XZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSV A;  3GEH A;  1YX2 A;  3TTG A;  3GEI A;  1WOP A;  4PAB A;  3A8I A;  4P9S A;  2GAH C;  3AD7 C;  1PJ6 A;  1VRQ C;  3ADA C;  1XZP B;  3GEE A;  3TFH A;  1PJ5 A;  3GIR A;  1X31 C;  1WOO A;  1XZQ B;  3AD8 C;  1WSR A;  1V5V A;  1WOR A;  3A8K A;  2GAG C;  1VLO A;  4PAA A;  5L46 A;  3TFJ A;  1PJ7 A;  1XZQ A;  3AD9 C;  3A8J A;  3GSI A;  3TFI A;  1WOS A;  1XZP A; 
#chains in the Genus database with same CATH topology
 2V8V A;  1JWW A;  3OSP A;  1YNN A;  4ILD A;  4G1I A;  4E8U A;  2NSB A;  2HS0 A;  4WIL A;  1N34 J;  3G71 S;  4A8Q A;  5AXM A;  4R8U B;  2ALY B;  3D3C J;  4NXN F;  4AT1 B;  1ICE B;  4JOU A;  2HS3 A;  2LXI A;  3BGO P;  3S1N K;  4RW6 B;  1NHU A;  3MTJ A;  3HOU K;  1DTQ B;  4Y28 C;  4H4K A;  2W7O A;  5AT1 B;  1KN6 A;  1HHT P;  1NK4 A;  2W24 A;  4J9N A;  1DLO A;  3NL0 A;  3IWL A;  1IBC B;  2AX1 A;  3U1M A;  2XSF A;  5L1K A;  5IM0 A;  4X62 F;  3HZE A;  5C44 C;  4Y0F A;  3UDC A;  3W5X A;  5B0F A;  2ZOG A;  1U2C A;  3AA9 A;  4O0I A;  1RHQ B;  2GAH C;  4BWJ A;  2BJ7 A;  3HOV C;  3BKU A;  2RJZ A;  3G8T A;  2NUU G;  3FBF A;  1RTI A;  3PO3 C;  2WBR A;  1I3Q C;  4OYP A;  4PR6 A;  2HHH J;  4NYO A;  1ISE A;  3PO4 A;  1BWV A;  2RNE A;  4DR6 J;  4DR5 J;  2YKN A;  4GT9 A;  2DB1 A;  4C8K A;  5L39 A;  5LXR A;  3RZD K;  3LGN A;  1W26 A;  3ISZ A;  2QIF A;  3U1N A;  2DIU A;  4K59 A;  1TWA C;  2A1B A;  1ZET A;  1IKY B;  4R8U A;  2E2I C;  1IBL F;  2HQG A;  4ELU A;  1RTJ A;  1FVQ A;  2AYE A;  2ZH2 A;  4KN4 A;  4FYW B;  1KQF B;  3PYD A;  1B3T A;  3PYG A;  5DS7 A;  1SIW B;  4LFC J;  2B4O A;  4WTY A;  3T1Y F;  1RSC A;  3GFH A;  1LWE A;  4UTG A;  2PDA A;  2HYI B;  4DV4 F;  1BUX A;  1YBT A;  2ILZ A;  1T03 B;  3LW5 C;  5KFX A;  3C16 B;  1W25 A;  2YQ1 A;  3BM7 A;  4A3J C;  4ES3 A;  2QYC A;  1XXC A;  4A3B K;  2DYA A;  3AY0 A;  3M8Q A;  1NCL A;  3G87 A;  1HW9 A;  2LDY A;  2DGU A;  1WQF A;  4QYZ K;  1RTI B;  1RWN B;  1SQG A;  2KT2 A;  5HP1 A;  4UY8 5;  4RMF A;  4C3H K;  1MLA A;  2CNK B;  4OZ1 A;  4Z7Y A;  4IG3 B;  3ENW A;  1AB8 A;  3GLJ A;  4RUA A;  4KC6 A;  2ZBQ A;  4L75 A;  4GO7 X;  4CLT A;  2DNQ A;  1JXE A;  1SC3 B;  1WC6 A;  3N0C A;  1USM A;  2HHH F;  3BQ1 A;  5EGH A;  4Q45 A;  2FQT A;  2VB6 A;  1VC5 A;  1G6B A;  4ZMM A;  4ZVO B;  2XCR B;  5TJ3 A;  3DN9 A;  3EDR B;  5F8I A;  1XN9 A;  1TEL A;  3R5C A;  2A6M A;  4GMK A;  1YZ7 A;  1UA1 A;  2RDD A;  1RBL A;  4URS A;  2MY8 A;  2G4B A;  2E2J C;  1N52 B;  2QFI A;  3VQT A;  1SKS A;  2LU1 A;  4JI6 J;  2RRA A;  2R93 C;  5DDO C;  2UXC J;  1LWE B;  1XMB A;  1CQN A;  3HFK A;  3MD3 A;  1NXI A;  1S4F A;  3RB6 A;  2V34 A;  1UW4 A;  1SL1 A;  1J6X A;  2ZOF A;  3ULH A;  1VFJ A;  2D74 B;  2WVC A;  3AD7 C;  4R0E A;  2MLZ A;  2EPI A;  4KB2 A;  5FJ8 K;  2HBQ B;  5E3P A;  4LSN A;  3BB5 A;  2WVB A;  2HLT A;  4EEY A;  3D9B A;  4CDI A;  1FRI A;  1FO1 A;  5LT5 A;  1VQK S;  3M3Y C;  2DY1 A;  4J9K A;  4KPY A;  2B4U A;  2J7K A;  4OHZ A;  4DSL A;  4BCA A;  1BD6 A;  1U0H A;  2N82 B;  1DJ0 A;  3KJV A;  2CFA B;  2J8A A;  4PXC A;  4KN7 A;  2R9L A;  4TY9 A;  3HOX C;  1R8H A;  5SZT A;  1Q0N A;  1RWW B;  4X66 F;  2R7T A;  1WC4 A;  7AT1 B;  1FI4 A;  3T9N A;  3VZH A;  3RR8 A;  2HHW A;  2AGP A;  2E44 A;  3KHH A;  3DHX A;  5FII A;  2YH1 A;  4CT8 A;  4C2M C;  2HGN A;  4ECZ A;  4URG A;  3NS6 A;  3FUY A;  2GW8 A;  3H59 A;  1IWA A;  3JSM B;  2AGQ A;  3T3F A;  4KHR A;  3BBF A;  1EQM A;  2P9G A;  2HRT A;  1JOE A;  5KFH A;  1P6T A;  3MED B;  4PG5 A;  3W2W A;  1KS2 A;  2GIR A;  3UCZ P;  2JWN A;  4LR7 A;  1TK5 A;  2AU0 A;  1HQE A;  2CPE A;  3VAH A;  4KB4 A;  2ZH8 A;  3OVS A;  4LF1 A;  5J2Q B;  4PG6 A;  2FPH X;  1IQZ A;  5LJ5 Y;  2PFD A;  2R7Z A;  2W2Q P;  5K8M A;  3SSQ A;  2DH9 A;  2UUA F;  2VH7 A;  2HKE A;  3ZZT A;  1JNR B;  4MK9 A;  2GO8 A;  3VAG A;  1ZTT A;  1JJH A;  4JI2 J;  4UZC A;  4I2P B;  5KG6 A;  2RDJ A;  4P75 A;  2HFZ A;  4X4P A;  1X9M A;  2AYB A;  4B9L A;  1RAJ A;  5DDP C;  2XY7 A;  3IC1 A;  3KJV B;  2CFA A;  1Q16 B;  4F0K A;  3VGV A;  3AOA A;  3G6E S;  3MFH A;  1S9F A;  1ZA1 B;  4NXM F;  1L3V A;  3T6J A;  5IWA F;  3MPD A;  1CJV A;  2FHJ D;  4P5A A;  4IUF A;  4IO9 Q;  5IYC K;  2HWT A;  3HOV K;  2MQP A;  1WG1 A;  1S9E A;  4EBD A;  4WP9 A;  3H0G C;  3HX9 A;  1J6V A;  1EP4 A;  1LEO A;  3GJR B;  2UZA A;  3LPE A;  3VAF A;  1XEZ A;  1IE0 A;  2VJU A;  3N0B A;  4EYI B;  2M88 A;  3EPG A;  1KC8 T;  3QGG A;  3V4I A;  1Q7L B;  4WYW A;  2KTQ A;  3CJ3 A;  1VIO A;  2XZD B;  2KU7 A;  4BLB A;  2MKI A;  2IVY A;  3PJ9 A;  3NBP B;  2WW4 A;  3AFG A;  2QL5 B;  3HVT A;  5LXY A;  5J2Q A;  1X9W A;  4N47 A;  1R9T A;  4JI4 J;  2DGQ A;  1NK8 A;  5ETT A;  4OZJ A;  3C46 A;  4N56 A;  4JI5 J;  2I9S A;  2R92 K;  1KON A;  4DU7 A;  2FVP A;  4OV6 A;  4ZVQ B;  2BMB A;  2J9E A;  4LRE A;  4ATN A;  1RJJ A;  2MB0 B;  2COL A;  2HVH A;  4LJM A;  3MEC A;  3CIM A;  5GAH I;  4K7Q A;  4WK1 A;  3DOK B;  2DGX A;  3WX4 A;  4G7H A;  4ES1 A;  2BKP A;  1GMV A;  1RLD A;  4B3M F;  2B8Q A;  5SUH A;  2N7C A;  3RW6 A;  2XS2 A;  1K83 A;  1CJV B;  2VON A;  2KDO A;  4KMD A;  4DR4 F;  3K7A K;  3OTC A;  4G1Q B;  2UVU A;  3R2C J;  1UJ5 A;  1KWM A;  1IM6 A;  1YJU A;  4ELV A;  1RAE B;  2APO A;  2B63 K;  4ZIT A;  3ISN C;  4ZS6 A;  4URQ U;  2NVX K;  1ZBS A;  2QLJ B;  2MZ1 A;  4IR9 A;  4CM2 A;  2GIQ A;  1GX5 A;  2HFS A;  1BDF A;  2RHQ B;  3R5B A;  4X4S A;  1O51 A;  4PKD B;  3QZ8 A;  4B9U A;  3RJM B;  4E0D A;  2KHD A;  3NBP A;  4L72 B;  5IP9 C;  1PC4 A;  1SC6 A;  2X3G A;  3TOQ A;  2IRX A;  4MH8 A;  3HVT B;  3VGT A;  3O3L A;  3ZZ0 A;  1CSJ A;  1MG7 A;  3FZ2 A;  3VGU A;  1OY9 A;  2RRN A;  1FXD A;  3F0N A;  2V8D A;  3ZFV A;  3MDF A;  3LH2 S;  2XCP A;  1QSL A;  1YGY A;  4DV7 J;  4B3S J;  1FFS B;  3D7S B;  2NRE A;  2D3O 1;  5HLF A;  1V5V A;  4ELT A;  4IOC Q;  4DFK A;  3JQM A;  1QLN A;  2BOP A;  4WFB Q;  1N54 B;  4C45 A;  1YHQ S;  2BKN A;  2FZK B;  3EMT A;  1RWO B;  5HL7 Q;  2K7K A;  2MLX A;  5H9E K;  3RAQ A;  3VGS A;  1OYE A;  3RBZ A;  4DSJ A;  5CYM A;  3AQO A;  1C0A A;  1P9Q C;  3LAJ A;  2VG6 A;  4B9T A;  3CSK A;  5EN1 A;  2KXN B;  1HR0 F;  4QR1 A;  1HWU A;  5E2Q A;  4Y52 K;  3P5T L;  1UFW A;  4NE9 C;  4K0K J;  1GXT A;  1HKA A;  3CXC R;  2V6A A;  1U26 A;  4EBE A;  2CJ9 A;  4X64 J;  2F9D A;  5DM7 Q;  2KO1 A;  1SV5 B;  1NPP A;  1K1S A;  3HKZ L;  3M2U A;  3GCW P;  4OI2 A;  3OTO J;  1TWH C;  2C22 A;  3OEP A;  4A93 C;  4ZIW A;  3CJR A;  1KOH A;  4ED5 A;  2QMU B;  3QWP A;  2OKQ A;  5EX0 A;  4IH7 A;  2A0F B;  1NDL A;  1TQL A;  3ETM A;  3D66 A;  1RT2 A;  4MEX A;  3HSD A;  3G86 A;  5EWG A;  4DL4 A;  1VRU A;  2OPP A;  1ZA2 B;  4EZ6 A;  1ITP A;  3S16 K;  3N79 A;  2YVS A;  1WG5 A;  2FQO A;  3RGI A;  5HVH A;  1GAO A;  2ZKT A;  2DXF A;  1FK9 B;  2Y3Y A;  3M1V A;  1JQG A;  1RK8 A;  2ZBP A;  4CO3 A;  1QUP A;  4NL5 A;  5C25 A;  2H5J B;  1PBU A;  5CQG A;  2VQE F;  2V4J A;  3R7B B;  4LFA J;  1U45 A;  2VG6 B;  3PTW A;  1B4B A;  1NEE A;  3HOW K;  2CJX B;  4C97 A;  2QC3 A;  2RKI B;  1FWL A;  3GTL K;  5C4X C;  1RAA B;  5CAA A;  3GTM C;  5DM6 Q;  2R2R A;  2CPD A;  3DRY A;  3KJQ B;  5KT3 A;  3OUY B;  4XK8 C;  3CCW A;  4DSF A;  1HW8 A;  1HIY A;  1HWI A;  1FKP B;  2VD3 A;  3TNV A;  3QT8 A;  2GZO A;  3PNI A;  4EYH B;  4HAC B;  2DXE A;  4ED0 A;  2Q1L A;  1L0W A;  2F63 A;  2R2U A;  3W8P A;  2V63 A;  2NXC A;  3DGP A;  3LAM A;  5E3A A;  4MAK A;  2E5J A;  1T02 A;  5IFM A;  2BE2 B;  4I0W A;  1WTB A;  3PW4 A;  4FVC A;  2ADB A;  3A8E A;  4Q0B B;  4LVN P;  1XC9 A;  1IJE B;  1REV B;  3VQS A;  3ENA A;  3K2Y A;  4A8S A;  2OO4 A;  2XO6 A;  5DQG A;  2W2P P;  4MK8 A;  2F8H A;  2Y1I A;  1YJ9 S;  3IS9 B;  3B78 A;  2IAJ A;  1AZS A;  8RUC A;  3IBF B;  2MZT A;  4YB5 A;  1M90 T;  1SC1 B;  3DLH A;  3G9C A;  3DI6 A;  3KLI A;  1I94 F;  4LF9 J;  3BPS P;  3OR1 B;  1NSK L;  1RZM A;  1J5O B;  3SFU A;  2DHG A;  2C2M B;  4QU6 A;  1UKU A;  2RKI A;  2FJX A;  4OIQ A;  2DR6 A;  1M5H A;  1IS1 A;  4QR2 A;  2R7Z C;  1CBK A;  1S1W B;  4UST A;  1SIZ A;  3TUP A;  2GQ2 A;  4HT5 A;  3Q0A A;  1S1U A;  4IRD A;  2XMV A;  2BBE A;  4M5M A;  3B4D A;  3OXF A;  2E5I A;  1R0B G;  5HAT A;  3DDN A;  2W9A A;  3KXD A;  1NPK A;  1X4D A;  5C5J A;  2EI5 A;  5BJR A;  4CNY A;  5KT6 A;  4C3J C;  3AD9 C;  4X65 J;  1X4A A;  3OR2 B;  5GAE U;  1TL5 A;  3PO2 K;  2LEC A;  4DR7 F;  3DLL Q;  2J0X A;  4RW8 A;  4TQR A;  1VR6 A;  1W7W A;  1XZQ A;  4LQ9 A;  3S1Q C;  1NZA A;  2E7X A;  3K5M A;  2Q6C A;  1GMW D;  4Q43 A;  5B0G A;  3NOG A;  3J7Z 5;  5ETQ A;  3DLK A;  1AZS B;  4B02 A;  1QTN B;  2DH8 A;  4W92 B;  4FBU A;  2OPS A;  3R7S B;  2H51 B;  2DO0 A;  3VTI A;  3LTO A;  1RT6 A;  2D69 A;  1HMV B;  5DQI A;  4LFC F;  3FDS A;  2XCQ A;  1FWK A;  2XMT A;  3CJT A;  5AE2 A;  4DL0 C;  3ZZO A;  4CTA A;  2GVD B;  2R7Q A;  3DGV A;  3QX3 A;  3UN2 A;  4ZVH A;  1R3N A;  3AT1 B;  1XNR J;  4B9M A;  3MUV P;  2C3O A;  4IQM A;  2JEG A;  1ROF A;  3ZXW A;  3EQL A;  2JA7 A;  4A4J A;  4DFM A;  3SCI E;  4ECW A;  4C98 A;  2W4D A;  2AT1 B;  3GR1 A;  1NK6 A;  2CPZ A;  1C1C B;  1JLB B;  2QLB B;  3Q2T C;  5KG4 A;  3HJV A;  5MAO A;  1QAI A;  1TU0 B;  3EGV A;  4FNI A;  2DD8 S;  3D0H E;  1V9O A;  3CCU S;  2ACY A;  1I6J A;  2Z56 B;  5CZX A;  1T9Y A;  3CJS A;  4YR3 A;  1O24 A;  2XYP B;  2Q43 A;  2EG1 A;  3DDI A;  2PMZ D;  3C19 A;  1IXK A;  2HFO A;  1G2E A;  5KFU A;  4DG1 A;  2YWK A;  2CZ4 A;  4YQW A;  4M5I A;  4I56 A;  4MYU A;  1S0O A;  2RSQ A;  1RT6 B;  4HTI A;  2ASL A;  2ZH3 A;  4KGZ B;  3L7O A;  4KO0 B;  2R7U A;  2KZM A;  1Y1V K;  1BHN A;  5E5N A;  4AQY F;  3EXC X;  4FYY B;  4CTA B;  2GVD A;  4RW6 A;  1N88 A;  4V1A k;  1DTQ A;  3I56 S;  2I2Y A;  2EBB A;  2KVQ E;  4QIW L;  1CEZ A;  3K17 A;  5IT9 Y;  2XWX A;  2B9X A;  2JSX A;  5G4D A;  2RIJ A;  5IT9 U;  3N6M A;  5A0Y A;  1R43 A;  3EDQ B;  3HKZ D;  4IDK A;  2CDR B;  5E41 A;  2QA4 S;  2XC9 A;  3T5J A;  5D4P A;  1JLB A;  1H2T Z;  5B0A A;  1U2R A;  3OTD A;  1Q86 T;  5RUB A;  1MMN A;  3I4P A;  3UDV A;  2MQQ A;  3R2D J;  3KMS A;  4ED1 A;  3HM9 A;  4YEA A;  2VBX A;  1TZ0 A;  3FRZ A;  3NG8 A;  4JYA F;  3H5S A;  5CYQ A;  2CZ9 A;  2MJN A;  3B4M A;  3CW2 C;  5F9N A;  2LQ5 A;  1OWX A;  4I64 A;  3BYP A;  2L48 A;  4CLL A;  4QWE A;  1NDC A;  5IP9 K;  1P9Y A;  4DG1 B;  1I6H C;  4X4V A;  3MGJ A;  1IKY A;  4DI6 A;  5FDL B;  3PJW A;  4I69 A;  3EVO A;  1YJR A;  2RS2 A;  2M8D B;  3L9Z A;  4KO0 A;  1I94 J;  3P8B B;  2PC6 A;  5KFT A;  5D78 A;  1Z1Z A;  1IW7 A;  4H4M A;  1FEE A;  4HDG A;  1CJT B;  1RDR A;  2E9T A;  2J0S D;  4KKO B;  1WOS A;  1WF2 A;  4DX5 A;  3PYF A;  1VK3 A;  4GZY A;  1Y7P A;  4QPT A;  3J7Y I;  5LM7 E;  1T03 A;  5EWE A;  5A0Y B;  3I4N C;  1RA6 A;  4YR0 A;  3RRG A;  2HVD A;  3C16 A;  3H4D A;  1RKI A;  1CVJ A;  1VC0 A;  5CZV A;  4EBC A;  1F0X A;  3IFE A;  1UP1 A;  1T9V A;  4PCQ A;  3FFI A;  1EIY B;  3M8Q B;  1M1H A;  4KHM A;  3BO4 A;  1NJX A;  3RRH A;  5HJX A;  2DNG A;  2MST A;  5HP1 B;  4DPU A;  1B4A A;  4X65 F;  2ZIT A;  4DL7 A;  1T9U A;  1WTF A;  2OP5 A;  1V3R A;  5FLX Y;  3EPI A;  2OTJ S;  1O2B A;  3L7U A;  2LQ9 A;  1RB0 A;  5CYQ B;  2WB1 L;  1IR1 A;  2QX0 A;  4A8Y A;  4C3L A;  4NXM J;  1NJI T;  3BQ2 A;  3GTK C;  3S15 K;  4A93 K;  3QAE A;  1TL1 B;  4P73 A;  2YKO A;  4OYW A;  4XDC A;  4WTO B;  5FDL A;  4IKA A;  1S72 S;  1NKB A;  2H1Y A;  1VOM A;  1HAR A;  2ACM A;  3SFG A;  2KXH A;  2VFR A;  4U95 A;  1SQF A;  2FVQ A;  4DZ6 A;  4Y3C A;  4H4M B;  4NEY A;  1CJT A;  5BYR A;  3S16 C;  1FXR A;  1RWM B;  2YNH B;  4K2J A;  4N5S A;  1N5Y A;  3D6H B;  3IBW A;  3JSY A;  2XCA A;  2KFZ A;  2FVS A;  4MKY A;  1RU2 A;  2OIH A;  1MN7 A;  2QN6 B;  4LSN B;  1NK9 A;  1VGY A;  3DLE B;  3CCR S;  2O5D A;  3W5Z A;  2LQJ A;  4F3O A;  5KFS A;  3OVB A;  3K59 A;  2I38 A;  1RT1 A;  2ATC B;  3DLJ A;  2KYZ A;  1NO8 A;  3R7N B;  5LMU J;  1WCM K;  2IBK A;  2XHW A;  2JVO A;  1TKT A;  2FHO B;  1WDT A;  5GMK a;  5LJ3 Y;  3BDE A;  2HFU A;  2XWY A;  1DCO A;  3ZTO A;  3I4M C;  3CDA A;  1U0H B;  1RYR A;  1I3Q K;  2MMY A;  2PEH A;  5LSL A;  1TL1 A;  4OYI A;  5IYC C;  4NOI A;  3M6U A;  1PIL A;  4CZC A;  1UVN A;  1A0O B;  2K2P A;  2O01 C;  2R7X A;  3S01 A;  2F7V A;  2WVF A;  5L9X A;  2IMO A;  2UXD J;  1UVM A;  4ZPW R;  5E3R A;  1WQG A;  2QMW A;  2KT3 A;  1ZAW A;  2J0Q D;  3UDL A;  1TWG K;  3M05 A;  4B3O A;  4Q8F A;  1LV5 A;  5K8O A;  1PYO B;  1V6H A;  3TZY A;  3KLG A;  4BBS C;  4XTT A;  4OZ0 A;  5I3U B;  5CA5 A;  2B5J B;  3RZO C;  2BW7 A;  3JYT B;  1KEK A;  1RU1 A;  2J7W A;  2MZJ A;  5DZ6 A;  3MPY A;  4WIQ A;  1LW2 B;  1WD6 A;  1RI7 A;  4WJ3 M;  2C28 A;  4KC5 A;  5F9L A;  4I6W A;  3TA1 A;  3CDU A;  2IA6 A;  4OX8 A;  3AQP A;  1YJN S;  3VAJ A;  1VQN S;  2B9E A;  3DLE A;  3QMQ A;  2WAQ D;  3BKF A;  4J9M A;  1F9F A;  2KRB A;  2VC0 A;  2W25 A;  2JDJ A;  4WFZ A;  4TU7 A;  1OS5 A;  1RT1 B;  4P71 A;  3BYR A;  2ATL A;  4IYQ A;  2GMH A;  5IYB C;  4DN9 A;  1X4E A;  2WZ1 A;  1NKC A;  3TVK A;  4NMX A;  5F8G A;  5HL8 A;  1NDP A;  5K8P A;  1EK8 A;  4K4Y A;  2ROE A;  2KN4 A;  4USU A;  3EWG A;  4DJB A;  1IWG A;  4U7U D;  2B0G A;  3SQO P;  9ATC B;  4L76 A;  3LA0 A;  4DQS A;  1RAC B;  5AXK A;  4KPC A;  4DV5 J;  4J9R A;  4RL1 A;  2H4W B;  3OLB A;  3UCU P;  2CQB A;  3PW0 A;  2FD2 A;  1WAC A;  3CDE A;  4YS2 A;  1VC6 A;  1A6L A;  1WHY A;  3V4I B;  1FRX A;  2DHA A;  1VK8 A;  5I3U A;  1RWK B;  2OGU A;  4CWB A;  2VQF J;  3PX6 A;  1ZOT A;  3KG4 A;  5C3E K;  1TMJ A;  3JYT A;  3BBC A;  4EGL A;  2R92 C;  4NLV A;  2LXF A;  6FDR A;  3C14 A;  5K20 B;  2KB2 A;  5HN0 A;  2B9Y A;  4DV1 F;  1VJW A;  2ZWO A;  2R8K A;  1BC6 A;  4DU8 A;  4LRD A;  2DNL A;  1YCL A;  3M3Y K;  2G0J A;  3BRE A;  1DCH A;  2E1M C;  3MM6 A;  4FYD A;  4C3K A;  4PXB A;  1T7P A;  1HNI A;  4A3F K;  3DOK A;  4A48 A;  4LRB A;  2ZNY A;  5HI7 A;  4DV2 J;  4NLX A;  2CPJ A;  1MWZ A;  3D6M B;  3HKW A;  3OFE A;  3MAH A;  4BC9 A;  3SSR A;  3KUH A;  2Z0G A;  2VU5 A;  4ZVR B;  1KTV A;  2XEX A;  1WCM A;  4ECY A;  4G1Q A;  4ZCL A;  1TWG A;  1VLY A;  4DEZ A;  4J91 A;  1JJC B;  4BXX K;  2M9K A;  1RWX B;  5J2P B;  1FD2 A;  2CPH A;  3Q8Q B;  2OMO A;  1BWE A;  4PAB A;  3I87 A;  2C2O B;  3GTJ A;  4ZP8 A;  2GIF A;  2L3M A;  4KMH A;  2MYF A;  3PX0 A;  2EK6 A;  2LKZ A;  3I4H X;  1C4A A;  4ZLL A;  1UL3 A;  3NS5 A;  1REG X;  1UJ6 A;  2MQ8 A;  2E29 A;  4J5O A;  2OD4 A;  3KWM A;  4KGX B;  3C14 B;  4B17 A;  5IWA J;  2H9Z A;  2HQD A;  2MKK A;  4QQB A;  3NGK A;  1G4C A;  3T00 A;  2LA6 A;  4J9V A;  3GTY X;  4K4U A;  2ZFH A;  3A3N B;  2KH9 A;  3MM6 B;  5KFP A;  5HLF B;  4CI0 B;  5C42 A;  1KLN A;  4DL3 A;  1Y9O A;  3IWN C;  2KL8 A;  3AD8 C;  1N34 F;  2M0G B;  4L74 A;  3BZQ A;  3JB9 k;  4LSL B;  3HHL D;  4RBV A;  1JXV A;  1QE1 A;  3RW7 A;  1B0T A;  4DV2 F;  1XR7 A;  3AB2 B;  3GTG C;  3OTB A;  1FX2 A;  1YK9 A;  3KUE A;  5LSO A;  4EUV A;  1IBA A;  2CNN B;  3PJX A;  2WB1 D;  3TZZ A;  5L8R C;  3ET6 A;  4USM A;  1USO A;  5E3Q A;  2K7J A;  2JZ5 A;  5J2P A;  4WJ4 A;  2V6T A;  4KV8 A;  2PFF B;  4F4W A;  1F7V A;  2RB7 A;  3M7V A;  2VKZ G;  2DR8 A;  2KT5 A;  3M2U B;  3I5C A;  2MKH A;  2VF3 A;  1FDD A;  2IDE A;  3DRS B;  3KLV A;  2NVQ K;  2IC3 A;  1NK0 A;  2Z4P A;  3VAI A;  1UFK A;  4NWB A;  5KFA A;  4OZL A;  2JC1 A;  4Y2A A;  2XBP A;  4K4Z A;  4JI1 J;  3GTO C;  2OD6 A;  2B7B B;  2P9E A;  5KG5 A;  3FNN A;  4IRK A;  1AFI A;  1RT2 B;  3G6X A;  3GTP C;  1WF0 A;  1APS A;  2ROG A;  2ZZM A;  3IO1 A;  4GTE A;  3C66 A;  4EI2 A;  2AYG A;  3GR0 A;  2PPB A;  2W9B A;  1TTH B;  2OFG X;  3KNG A;  1UZH A;  3A4T A;  4IRC A;  3PW2 A;  3MPW A;  3HXM A;  2MQL A;  4EO6 A;  1HFE L;  4QWC A;  3H0G A;  3DNC A;  2GO9 A;  1KBR A;  2CQH A;  5F8H A;  1FJC A;  5KFE A;  1K73 T;  1YBU A;  3M1V B;  2GX8 A;  2YWW A;  2LCW A;  4WZM A;  2C2N A;  1QE1 B;  1JJ2 R;  5C25 B;  4XCH A;  2VPZ B;  1P27 B;  3JTO A;  3N3Y A;  5KFL A;  3W7B A;  1XMQ F;  2IYG A;  3QPI A;  1F7U A;  1SVD A;  2IVM A;  1URR A;  2BJ8 A;  3GTL A;  3H2V E;  4DV6 J;  1U02 A;  2DGO A;  3FVY A;  1EQ0 A;  4OHW A;  1RT5 A;  5ETM A;  4KV8 B;  3CD6 S;  3BF4 A;  3H5X A;  3TJ9 A;  5T7L B;  1AB4 A;  5LMN J;  3DRS A;  1XER A;  2RS8 A;  2HGL A;  3ZTQ A;  4CH0 S;  1H3D A;  4PXE A;  1TMM A;  3O5T B;  5FLX U;  4LF5 F;  2Q3P A;  2P8I A;  2JA7 C;  4OX7 A;  4FS2 A;  1CC8 A;  3WBZ A;  1ZQ1 C;  1PJ6 A;  1EKS A;  2PT0 A;  3S1N C;  4F2R A;  5AXL A;  2UVW A;  1WIH A;  2GA7 A;  4K4T A;  2HHQ A;  4Q0B A;  1GFW B;  4NZ0 A;  1S0M A;  3HK2 A;  2FLN A;  1VGX A;  4C0H A;  4F4K A;  3C2P A;  3MUR P;  4HKQ A;  3DHW C;  2JL9 A;  4DFJ A;  3OFG A;  3PYE A;  2HGM A;  3KMQ A;  4UOC A;  2FIU A;  1FDB A;  2IAJ B;  1LNQ A;  5D6G A;  1XWL A;  3OR1 A;  3IXQ A;  2KHC A;  5FJ4 A;  4IO1 A;  2AMC B;  1R8B A;  4C7Q A;  1U1Q A;  1F2G A;  3TEH B;  3HVA A;  4O2D A;  1F5C A;  2J8S A;  2RQ4 A;  1T3O A;  1KP6 A;  5T14 A;  1RT5 B;  3WC0 A;  2Z30 B;  4PXD A;  4Q5S A;  1FDA A;  1RBA A;  5A2Q U;  3ADA C;  2CZV C;  3N28 A;  2R8J A;  2O66 A;  4JB8 B;  2FHM A;  2ROP A;  2OPQ A;  3LP2 A;  2D9P A;  1MMD A;  2XNR A;  2F1F A;  3C15 B;  3O6Q A;  3BGR B;  3H5Y A;  3FEX B;  4WF9 Q;  1NM2 A;  3IMQ J;  2XLI A;  4RW4 B;  4ZK7 M;  1WHV A;  2X1G A;  3BKT A;  1I51 B;  3M9N B;  3OR2 A;  4JI8 J;  1FJ7 A;  1KNZ A;  2HS4 A;  1BGW A;  2AHO B;  4CO1 A;  2VFV A;  1NJW A;  1W2I A;  2ZJQ Q;  2AGO A;  1XZQ B;  3I9V 9;  2CJA A;  3DLK B;  4USH A;  2WK4 A;  2OPS B;  3LO3 A;  1VIX A;  4QIG A;  4K4V A;  1HMV A;  1SKR A;  4ECR A;  4YG2 A;  1RE1 B;  4RNH A;  4O3Q A;  5IT0 A;  5HMX A;  1K83 K;  2W7V A;  2JEI A;  5GAD U;  1O2F B;  3U27 A;  1DY3 A;  4H4O A;  4NLS A;  4PWW A;  1H98 A;  2WBM A;  1LXN A;  2F8E X;  3DU5 A;  3GTP A;  1MU2 A;  2ZDP A;  3L4B C;  5HO4 A;  1YX2 A;  2OPQ B;  1FWP A;  4DR4 J;  1JK9 B;  2JA5 C;  3HMJ G;  4G65 A;  1NK5 A;  2FJE B;  4DR3 J;  2QLX A;  5DDR C;  4C11 A;  5KFI A;  3H3V D;  3W5Y A;  4RBU A;  5IV4 A;  2HAI A;  2JA5 A;  2VJV A;  1R8P A;  4RW4 A;  3TYT A;  2E9Z A;  2VUM A;  4KIA A;  4P9S A;  5LOQ A;  3CE8 A;  4KHP J;  1B99 A;  4UT4 A;  1WI6 A;  2H65 B;  1DUR A;  3NGT A;  3MFI A;  3DC2 A;  3TAR A;  4AFF A;  2RML A;  5F0W A;  4KJI A;  2HMI A;  1HBN B;  2CQ1 A;  4AD6 A;  3U1L A;  3GFX A;  3D3B J;  5L1L A;  4Q4Z A;  4O3R A;  4OMF G;  1ZAX A;  1RUS A;  2NVY C;  3CAG A;  3DRX A;  3SXL A;  5KFD A;  4P6Q A;  2ILY A;  4ZPT R;  3OFF A;  1LW0 B;  1TFY A;  2YNI B;  2BJD A;  2F8M A;  2NZC A;  3VF0 B;  1HNW J;  4ILR A;  3CB4 A;  1N32 F;  3KLF B;  2N4C A;  3R97 A;  1OPZ A;  4H4O B;  1T8E A;  1RWP B;  2B63 C;  3UFC X;  1KQK A;  4DL2 A;  3CCE S;  4ZVP B;  3R9L A;  4XSZ A;  1UAW A;  4BY7 K;  4F4A A;  1MU2 B;  1N5S A;  3BGL A;  1N36 J;  2W8K A;  4OI3 A;  4CRJ A;  2IM1 A;  4Y00 A;  1WEX A;  3QT5 A;  4O3O A;  5HMW A;  1OQ3 A;  2NVX A;  4ANE A;  1FNM A;  1M5V C;  2BDP A;  4C3J K;  3QID A;  4IDK B;  4GC7 A;  4C11 B;  4QWA A;  4RWX A;  4WXO A;  3NOC A;  1EET A;  5IOQ A;  3HSG A;  4AE5 A;  1VHI A;  4YFN A;  3RB4 A;  4ENO A;  1E6Y A;  1OJ4 A;  3V4G A;  3IN5 A;  3GTJ C;  3PO2 C;  4ECT A;  1VQL S;  2VC1 A;  3ITH A;  5C24 A;  3OTO F;  1VS3 A;  3QQC D;  2ERR A;  1VI7 A;  2EVZ A;  4IH6 A;  4RUC A;  2HMI B;  2PE8 A;  3CQZ K;  4RU9 A;  2B4V A;  2WON A;  1SH2 A;  1FD8 A;  5KFF A;  2BA9 A;  2DR7 A;  4NOH A;  2GSO A;  1FRJ A;  3AOB A;  3J81 j;  4ED8 A;  4FPI A;  3KJF B;  3KJN B;  1MWY A;  5M2R A;  1RIS A;  5KFJ A;  2YNI A;  1G7C B;  4LR8 A;  3WDO A;  4Y2K A;  4GTB A;  5KT5 A;  3CME S;  2R7S A;  2NYH A;  8ATC B;  1R8C A;  4A8M P;  2LYV A;  3H0P A;  5JMN A;  2J6U A;  2GQQ A;  3UD5 A;  5LL6 d;  4KKO A;  3GQC A;  4C0B A;  4K5S A;  3NLC A;  5KG3 A;  4B3S F;  4TQS A;  2N7Y A;  2HHS A;  1Y3K A;  3KG0 A;  2DO4 A;  2DGV A;  2QT7 A;  2HNZ B;  3Q8S B;  3HT3 A;  3FJ2 A;  3FFI B;  1PAU B;  3CO9 A;  3H0G K;  4HR2 A;  5TMF A;  2CKW A;  2JVR A;  1E6Y B;  1Z2Z A;  2QSF A;  1U25 A;  3BO2 A;  2M2B A;  3MR5 A;  4WP3 A;  5AE1 A;  4LF8 F;  2NVT K;  3O2I A;  3D4J A;  1DD5 A;  2QFJ A;  4V19 J;  5JVO A;  4QYZ J;  2HWH A;  3G4C A;  3K8V A;  4NLP A;  1IQ0 A;  4YHH F;  3VCD A;  2L41 A;  2WON B;  3D6F B;  5IQ6 A;  3W65 A;  1M0S A;  2CUY A;  2RU9 A;  1HWL A;  2IHR 1;  3V6K A;  4XLN A;  4BLG A;  5IV3 A;  1TWC K;  2YNG B;  1TL4 A;  5L46 A;  2BQU A;  2NSC A;  2DNK A;  4Q5V A;  2AYM A;  2ZM6 J;  2NXE A;  3ILO A;  5G0R B;  5C44 K;  1RA7 A;  5DET A;  5IQQ A;  4G0W A;  5IZH A;  2XUL A;  3FKB A;  3PXG a;  2YTC A;  2RDI A;  4CIO A;  2Z58 B;  2YNH A;  3PO3 K;  1GMW A;  1N5Y B;  3OBI A;  1T9W A;  5D4O A;  4PEO A;  2X7I A;  5EHH A;  4OIX A;  2BUN A;  5ETO A;  1JIH A;  2JEJ A;  4GTD A;  5KT4 A;  4PG8 A;  3S0X A;  3SDE A;  2HNZ A;  1WCM C;  4KQZ A;  1KVJ A;  1CLF A;  1T95 A;  4ZHR A;  1F2H A;  2VFS A;  2JA8 K;  3GSD A;  3BGF A;  1S6P A;  3HDS A;  4HHJ A;  1HI0 P;  2XSJ B;  2NUH A;  4USJ C;  1TWH K;  3M4X A;  1TKT B;  2OUG A;  3OQ2 A;  4J9U E;  3LGH A;  2HEK A;  4NLG A;  2K06 A;  2V0N A;  1S6U A;  5HMZ A;  2IM2 A;  1SH3 A;  2M3D A;  2E2H A;  1YI2 S;  5D8H B;  4I68 A;  5JVH Q;  4ECU A;  1U6B A;  2V6S A;  5GAG I;  1UEU A;  5JXS A;  3GG1 A;  4A47 A;  4NLY A;  1H6K X;  2NLW A;  4A8K A;  1KQS R;  5KFR A;  2UXB J;  2YNG A;  2HQF A;  2F3J A;  3BH6 B;  3K5O A;  4BDP A;  4S0M A;  1GTH A;  3G82 B;  2LU2 A;  4PUO A;  1SJ4 P;  2DY9 A;  1JB0 C;  1P8G A;  4PPZ A;  4R5P A;  4OJ1 A;  1U0S A;  2PI4 A;  4C2M A;  2JRS A;  1ZYQ A;  4B3O B;  3KK1 B;  1IKW A;  2M7S A;  2RAQ A;  1B0V A;  3ZTR A;  3R3T A;  4MKB A;  1D9F A;  4P10 A;  2G13 A;  1X7V A;  2EKY A;  3KLG B;  4JV1 A;  1JLF A;  1N5V A;  2B5J A;  3ILL A;  2VPX B;  1MN9 A;  4QW9 A;  1UEK A;  2YWF A;  4Z2X A;  4MTP A;  2IMW P;  2HHV A;  1LW2 A;  3DLG B;  4I1T A;  3N9U C;  2MPU A;  2KYX A;  1PC5 A;  4WE1 A;  1BQN A;  1R9T K;  3SDE B;  1RAH B;  5F8N A;  3KHG A;  1VYA A;  2CG8 A;  1NLK L;  2UUC J;  1FKO A;  4P2M A;  2OSQ A;  2QZ8 A;  3CCL S;  4G6V B;  1S6P B;  4K4X A;  2FHJ A;  5KG2 A;  3M8W A;  1SQE A;  2YX1 A;  3MR3 A;  4GKK J;  4ZJL A;  2D3Z A;  1PYS B;  2EXU A;  2DVI A;  2MTL A;  3WZ0 A;  5IP7 K;  3CJ8 A;  2E2I A;  3TRG A;  2NPI A;  4MIB A;  4B3T F;  1XR6 A;  2XCO A;  4HHU A;  2XG8 A;  4PYA A;  1QSS A;  1UV7 A;  2YPY A;  2LQB A;  2YBV A;  2XHC A;  3AHP A;  2R93 A;  4PUO B;  1OPI A;  2HG4 A;  5KFZ A;  5DLG A;  2CQ2 A;  1UVL A;  4ZPV R;  3GTO K;  4RKU C;  1KRP A;  3H2L A;  4O44 A;  3TX8 A;  3W8G A;  4CLW A;  3P45 B;  1JLF B;  3HP6 A;  4FDF A;  2HQC A;  3DLG A;  3GP9 A;  4KAI A;  4WE1 B;  2UV8 G;  2VQF F;  2E5G A;  5CD4 A;  1BS2 A;  5FLM C;  1BQM A;  2L9D A;  1KFS A;  1O2A A;  4KB7 A;  5FD1 A;  4JI4 F;  1FKO B;  4DV0 F;  1R31 A;  2NR0 A;  4JI5 F;  2NYI A;  1BGX T;  1Y5L B;  1JLG B;  2UUC F;  3IPJ A;  2R7W A;  3LPX A;  1Y00 A;  1R7I A;  4YB7 A;  3UCG A;  3QO9 A;  4F4Y A;  2BJE A;  3JSR A;  1HNI B;  3HHL C;  2A6O A;  1KHW A;  3J80 U;  2HNY A;  4YP3 A;  3R27 A;  3EVW A;  4ZPD A;  2YPZ A;  3THV A;  4AYB L;  3HOX K;  1RHK B;  4DR3 F;  3K5N A;  3MMJ A;  2POK A;  4QOT A;  2V69 A;  1HNZ J;  2V2Z A;  3BR9 A;  1D9A A;  3HOY K;  3S2D C;  2Z2M A;  1F5A A;  4OL8 A;  4QBU A;  4M5L A;  1OIA A;  3TQ1 A;  4KGV B;  2GJI A;  2G2Z A;  3M8P B;  3GEH A;  4NEZ A;  1SC4 B;  5HQL A;  4ZJO A;  4OYO A;  1UWA A;  1O26 A;  4DR1 J;  4TLR A;  2DKO B;  1M5S A;  3LAN A;  4LRF A;  4DHV A;  1U24 A;  1Q78 A;  2P8T A;  2NVY A;  3QBC A;  5M5Y K;  2B4P A;  4JI3 J;  3IR7 B;  3OL8 A;  3BGU A;  3ZO7 A;  2DR9 A;  4ZOS A;  3M2R A;  2W1B A;  2AIR B;  1T05 B;  1Q82 T;  1XXB A;  1WKK A;  5LSR A;  1V5I B;  2WSC C;  5D0R A;  2GJ2 A;  2B63 A;  1T0T V;  1N0V C;  2Q66 A;  1DZ5 A;  2YWH A;  2UXB F;  4X84 A;  2EEY A;  1N33 J;  4RLE A;  1VQ6 S;  4DS4 A;  1JLG A;  2HHX A;  3CD7 A;  1RU0 A;  3QO9 B;  1HQ2 A;  4P7V A;  1FNO A;  5C42 B;  1S9G A;  5HRO A;  4KGK A;  2HNY B;  2V4R A;  5HQ8 A;  3HVW A;  4GFQ A;  4P2S A;  1F9N A;  3A3P B;  4YFK A;  1SFO C;  3RBD A;  3DRR A;  4LSL A;  4EMD A;  1J2V A;  1SJ1 A;  4MIA A;  2HIQ A;  4KT0 C;  3GMG A;  1D9D A;  2P9C A;  3MTK A;  3ET6 B;  1LK7 A;  1RT3 B;  5KFG A;  4KBI A;  3QYY A;  7FD1 A;  4UF4 A;  1LKZ A;  3PKM A;  3HCX A;  2CAD A;  3P3D A;  2CAJ A;  1WOP A;  4DSE A;  1VRQ C;  2GHP A;  2DNZ A;  2MZR A;  3BSN A;  2DGW A;  3M2R B;  4DUY F;  3RB0 A;  4XPC A;  3EJM A;  3K58 A;  2IC3 B;  4JI3 F;  1ZYR A;  3R5G A;  3W63 A;  5E0O A;  4UQG A;  2JA6 C;  3GYG A;  2VOD A;  3PG9 A;  4HI1 A;  5HQM A;  5D4N A;  3AXK A;  1FTC A;  1ZM9 A;  2QO3 A;  1NJY A;  2VBZ A;  1S7I A;  3FHZ A;  3D1H A;  5K14 B;  2J9D E;  2W9B B;  2HVE A;  3FCH A;  4OYB A;  1Y1W A;  3AOC A;  2DPJ A;  1VBK A;  3BSO A;  2EFQ A;  3CVK A;  2VAS A;  2E7V A;  5KFQ A;  1FXL A;  4X4N A;  3MML B;  3QGH A;  2XLJ A;  2E1A A;  2JC0 A;  2ZKU A;  4FKX A;  2OEK A;  4WFA Q;  4GKK F;  2IBO A;  4OIP A;  4C3I K;  2F4V F;  3DRR B;  5BXI A;  4DR2 F;  3W61 A;  1X5O A;  1YIJ S;  4K4S A;  2B6A A;  1Q53 A;  4QIE A;  4QU7 A;  1UVJ A;  1U1M A;  1UPP A;  3HFZ B;  1RAG B;  4DLG A;  2UV8 A;  1N36 F;  3NCQ A;  1HNX F;  4LQY A;  2E2H K;  2GQC A;  3LQV A;  3TA0 A;  1XNQ F;  5AE3 A;  4AL5 A;  4DV6 F;  2KG0 A;  1NHV A;  2YWG A;  2RU3 A;  5T7L A;  4J9L A;  4KFB B;  2BE7 D;  4PG7 A;  2LDI A;  5FLM K;  1FRL A;  1GX6 A;  2MEW A;  4OIN A;  4DUY J;  4EU0 A;  1KFD A;  1X4G A;  3QWU A;  1XPP A;  2BZ2 A;  3M30 A;  1SH0 A;  3FKI K;  3LP0 A;  3PHE A;  3CCZ A;  4C8Z A;  2OPR B;  2AJQ A;  1GNK A;  5K14 A;  3J7A N;  2HHP A;  5F3T A;  3ZZP A;  4IOA Q;  1Z4U A;  1S79 A;  3MR6 A;  3QSI A;  4DR1 F;  2AV5 A;  1NB7 A;  3HOW C;  1PBA A;  5HSP A;  3HOZ K;  3QFW A;  4TKT A;  2IYI A;  4QW8 A;  1VQ8 S;  1S99 A;  4I6Y A;  4F8R A;  3O8W A;  2E1C A;  1X31 C;  5JJB A;  4G3I A;  4JI1 F;  1B7Y B;  3FK4 A;  2C1E B;  2LXU A;  2CJQ A;  1C4C A;  4RZR A;  1INN A;  4DX8 H;  4PPD A;  1BJT A;  2EBE A;  1ZM2 A;  3GV8 B;  5F8J A;  3IG1 A;  3HD2 A;  3OL6 A;  5ETL A;  5CD4 H;  3TAP A;  3TAQ A;  3AJD A;  1YIT S;  2UU9 F;  2R92 A;  2DHX A;  5DLF A;  3LUY A;  3CD5 A;  4P7T A;  3SCJ E;  2YH0 A;  4BXX C;  2P6S A;  4BWM A;  2VDH A;  4MEY A;  3LP2 B;  3PO5 A;  3J81 Y;  2R7V A;  1MWQ A;  2V8G A;  4OLP A;  3C15 A;  4GVB A;  3BGR A;  3M30 B;  5EDW A;  2V2V A;  4JI2 F;  1AFJ A;  3HOU C;  1Y3J A;  3W9J A;  3LP0 B;  2XQC A;  1F93 A;  2Z57 B;  4U7C A;  4Q8E A;  2OPR A;  1N5T A;  1WC3 A;  1R0A A;  1FRK A;  2W7A A;  3S8S A;  2ZD1 B;  3MM5 A;  1TK0 A;  4ZA1 A;  2RH6 A;  3OV7 A;  2EFV A;  1I50 K;  4KAR A;  5IC6 B;  3K0J A;  1XIQ A;  1SJR A;  2MZQ A;  2XMJ A;  3S1R C;  2YU9 C;  2J6S A;  1HBU A;  2R7O A;  4NA1 A;  1WUU A;  4A3C K;  5CCM A;  4EZ9 A;  3M6X A;  4MJK A;  2YU9 K;  1R89 A;  2B3T B;  5ADZ A;  2F65 A;  3PX4 A;  4YUD A;  2IVF B;  4DBQ A;  4WU3 A;  4PQA A;  4DOZ A;  3SEO A;  3KK3 B;  4DV1 J;  3MEG A;  2BM1 A;  5L38 A;  3I5B A;  2LEP A;  1HBM B;  4QIV A;  3CUL A;  3IG1 B;  3EXY A;  4DLE A;  2VIC A;  1OMS A;  2V2Q A;  1KVI A;  3QJJ A;  1JLC B;  4BBY A;  4QCL A;  3WC2 A;  5KOX A;  4LF6 F;  2PII A;  4YY3 J;  2WCX A;  2X1F A;  2Y0S D;  1X0P A;  3SQG A;  2VOP A;  3RR7 A;  3K7R A;  3V6H A;  4GVB B;  1XBW A;  1SMY A;  1NDK A;  1RHM B;  4FF3 A;  5KOW A;  2Y1J A;  1S49 A;  2H48 B;  2BYC A;  2FZC B;  3OXL A;  1R0A B;  3ISN D;  4LF2 A;  2ZD1 A;  4GVL A;  3P49 B;  2M8H A;  4WFX A;  2C2E A;  3WIV A;  3J7A 1;  5K5M A;  1K44 A;  2D6F C;  1HBN A;  1RHR B;  3ELH A;  4HVZ A;  2FJD B;  1QAJ A;  3MCM A;  4J7C A;  5C4J C;  1JQW A;  3A1Y G;  3CJ5 A;  5HVG A;  1I3Q A;  2VKR A;  2QJ3 A;  4J9P A;  3KK3 A;  3QT6 A;  3NP5 A;  3MEG B;  1HYS B;  4M1X A;  4Y34 A;  3R5J B;  1LW0 A;  5DGB A;  1AUS L;  2FB0 A;  1HBM A;  4J3N A;  3UD4 P;  2M52 A;  3BSA A;  2VZ9 A;  2AX0 A;  4ZKA A;  3AA8 A;  2NXJ A;  2KWA A;  4X62 J;  3KLF A;  3ERE D;  2CIM A;  2XNQ A;  5KT7 A;  3US5 A;  4DR2 J;  4HH0 A;  4IR1 A;  1IL2 A;  3OL7 A;  3H2U B;  2OLW A;  5CH7 B;  1D8Y A;  3KDO A;  2BW2 A;  3PIO Q;  1SCJ B;  2FC9 A;  5IT4 A;  3AOD A;  2HBZ B;  3GFY A;  3O44 A;  4U6P A;  2QLF B;  3SQG B;  4OI0 A;  4NI2 A;  3GYN A;  1RHU B;  2HFV A;  1AUD A;  3D2W A;  5HBM B;  4QYR A;  4PWD B;  3I4M K;  3TAN A;  1TL7 A;  1EET B;  2GHV C;  2Y0S L;  4X6A K;  1ELO A;  4LMZ A;  2AW0 A;  1O28 A;  1IJF B;  4B3T J;  3QGP A;  1BE4 A;  4KDD A;  3G2X A;  3ITH B;  5C24 B;  1U09 A;  1L3T A;  4F02 A;  1FRH A;  1N4L A;  2YU9 A;  3RZA A;  4NLQ A;  1VMB A;  1DQA A;  4C8Y A;  2FUG 9;  1YJW S;  4M63 A;  1DRZ A;  2H54 B;  2BJ3 A;  4K8R A;  4ALZ A;  2LQ8 A;  2X1A A;  4RUB A;  4KMU A;  3DKD A;  3FOE A;  2GS8 A;  3R5D A;  2BE5 A;  1WKL A;  2B7C B;  3L95 X;  1SPB P;  3CMA S;  1U1L A;  1N0U A;  3NWR A;  2GFF A;  2AF6 A;  1O8B A;  4XAK A;  4BC7 A;  2R2T A;  1WOR A;  1T94 A;  2RE1 A;  1SFO A;  1HHQ A;  2R8G A;  3DXS X;  2PO4 A;  2ZHB A;  2KM8 B;  2YQ0 A;  3QRR A;  4C9D A;  3POT A;  1EJ7 L;  2QRR A;  3HJF A;  2P6T A;  1WDD A;  1XMQ J;  4NI2 B;  3K5L A;  1Z2L A;  3TZX A;  1YRT A;  5IS2 A;  2PMW A;  2RF2 A;  1LK5 A;  1I6H K;  5HBM A;  4J9Q A;  1HPZ A;  2ABY A;  3WQP A;  4PWD A;  2BOA A;  1RKJ A;  5F0U A;  2J9D A;  2G2Y A;  1TL7 B;  4CYU A;  1O0P A;  1K0T A;  2JNJ A;  5T41 A;  5EX3 A;  4DPY A;  1S1T A;  4FXV A;  3S1R K;  3TJ8 A;  3J7Z T;  2ZC3 A;  4OYX A;  4WWS A;  4ED4 A;  4FXD A;  4CLZ A;  5DGA A;  3HHN B;  3VR1 A;  2XZW A;  1GXL A;  2JHE A;  3T5K A;  2K3I A;  3GIL A;  2N3L A;  4UUX A;  4OHY A;  1BY9 A;  2V9K A;  4HDH A;  3PR5 B;  4ETX A;  4ZPC A;  2BRK A;  1DFD A;  3CT9 A;  3N5B A;  3S7R A;  1RAO A;  5HAN A;  1U6Z A;  3HI9 A;  2B8P A;  3UR3 C;  1ZM4 A;  4Q7A A;  2M5Y A;  2HHU A;  1KVK A;  3FMW A;  5G0R A;  3BDP A;  3KTQ A;  4NAS A;  4USV A;  3EYZ A;  5C2C A;  3CIZ A;  3BSC A;  3IR5 B;  3KHL A;  5EGE A;  3TVZ A;  1VJE A;  1X4C A;  2W9C A;  4ECX A;  3M8Z A;  1NME B;  4OZ2 A;  3CPW R;  1K83 C;  4Y6I A;  3KLH A;  4LT6 A;  3DXJ A;  3J80 Y;  2ZH1 A;  1N33 F;  3TX0 A;  1IBK J;  2JA8 C;  4BY7 C;  4WK3 A;  2ZDO A;  2EW9 A;  1TWG C;  2DPI A;  2FJA B;  3AH5 A;  1PCA A;  2PN6 A;  1HPZ B;  3JTP A;  4CLK A;  1K0V A;  2OEL A;  5DRK A;  4ZHR B;  3MPU B;  1DTT B;  1JLE A;  2ZH5 A;  4ZVS B;  4NYP A;  3PW7 A;  2O67 A;  3E8O A;  5KFN A;  1S1T B;  3HOY C;  1N56 A;  2RVJ A;  2JX2 A;  4KH0 B;  1F60 B;  4I2Q B;  2XSJ A;  4P74 A;  3W2V A;  3PKY A;  3CCM S;  1FRM A;  3C6U A;  4U96 A;  1TVR A;  2F4F A;  5ETS A;  4LF9 F;  1K47 A;  3L09 A;  2FY1 A;  1FNX H;  3BH7 B;  2B51 A;  3A3O B;  4CLP A;  1WQH A;  5ETV A;  4DS5 A;  2FDN A;  1FKA F;  1S1X A;  2DNM A;  1K9M T;  3NEK A;  1YQH A;  1TWF A;  1S57 A;  4GKJ J;  5F8M A;  2XI3 A;  3BQ0 A;  5J1E B;  1S0V A;  1TKX B;  3CCT A;  4G7Z A;  2ZZN A;  1OY6 A;  4BBR C;  2F40 A;  3G82 A;  1TWF C;  1S12 A;  4RR5 A;  2WTF A;  4R5P B;  3FCV A;  3KK1 A;  1IKW B;  3MMB B;  5B0C A;  2VDI A;  3FKI A;  2AKW B;  3J7Y U;  5F8L A;  4WKY A;  1VHF A;  2PSZ A;  2HRU A;  3OJU A;  3SCL E;  5KG1 A;  3TQE A;  3GON A;  3NGS A;  2UUB J;  3SSS A;  4X4T A;  4F25 A;  1JNZ B;  3TO8 A;  4Y65 A;  2AEM A;  4OJ3 A;  4DV3 F;  1BQN B;  1XR5 A;  2QE5 A;  1IBK F;  4U67 Q;  4WCE Q;  1WKJ A;  3AXM A;  1DTT A;  2XY6 A;  4U9R A;  4ZLJ A;  2JLE A;  1RAI B;  1QUV A;  1CJK B;  4ZP7 A;  1DHM A;  1YSJ A;  4R0J A;  4LVO P;  1FFG B;  5JFE A;  3W2V B;  4ZCM A;  2U2F A;  3QAT A;  3KOA A;  3KK2 B;  2I0X A;  1DAX A;  2Y3P A;  4O0N A;  2FQQ B;  3KKF A;  3U02 A;  3CDB A;  2PMH A;  2RHS B;  2ZJP Q;  1N6Q A;  1X0F A;  1FE0 A;  2UVR A;  4F0H A;  4NPO A;  3T5L A;  4NLW A;  2CJY B;  3ICL A;  4C0O C;  1PO6 A;  3G4A A;  3GZ7 A;  1TKX A;  4LF7 F;  1B7F A;  2DT9 A;  2VUM C;  3RZD C;  1D0E A;  2BQR A;  1JLQ B;  2DR5 A;  3NWG A;  4L73 A;  4O44 B;  4Z7C A;  3S2H K;  3MMB A;  2E2I K;  3R1L A;  3BN7 A;  3SCK E;  1HWK A;  1A9N B;  4A46 A;  4USW A;  1SI9 A;  1TL3 A;  2RRB A;  1U49 A;  4HT7 A;  1L3K A;  4LRC A;  4NCB A;  3ZZZ A;  1U7L A;  4RUH A;  2E66 A;  3OFH A;  3I0R B;  1BQM B;  1YKW A;  2CQD A;  5A6P A;  3GIR A;  4ECQ A;  1MSW D;  4EFA C;  3LWM A;  1F5B A;  2BXJ A;  1C1B B;  1DAR A;  1CJK A;  3T01 A;  1FFW B;  4K4W A;  4WZQ A;  2Y9H A;  4YY3 F;  1EX8 A;  1X4B A;  4BS2 A;  1X9S A;  4XIU A;  1IKV B;  1J5E F;  3LP1 A;  3WIU A;  5KTQ A;  3D1Q A;  5IYD K;  2L08 A;  1EAR A;  1I50 A;  3V6D B;  3BPD A;  1IKX B;  4MFB B;  3UE2 A;  1UW9 A;  2NVX C;  5M2U A;  1TUV A;  1SKW A;  5IYD C;  1DQ8 A;  2RQK A;  2PD1 A;  3F56 A;  4Q2L A;  3N5F A;  1NRK A;  3UWT A;  3MI7 X;  1Q1K A;  4CLU A;  3M8P A;  2AJF E;  4UOF A;  2CWX A;  2MXY A;  4ID8 A;  4K0K F;  5KFW A;  4A3J K;  3UR0 A;  5JUM A;  1AXQ A;  4X2B A;  1T05 A;  3TFI A;  1WJ9 A;  3E51 A;  2P5M A;  2XY5 A;  4Z37 A;  1KDN A;  3L3C A;  4PYD A;  3QRP A;  2D41 A;  3B8H A;  1CQM A;  1G1X A;  5MLC V;  1YDL A;  1NUE A;  2UVV A;  4DX6 A;  4F26 A;  2E2H C;  3I0R A;  1QM9 A;  4XSX A;  2CQP A;  2GSU A;  1ZBT A;  2UP1 A;  5A2Q Y;  2ZC4 A;  3IRX A;  2E1R A;  1HR0 J;  2GCF A;  1VQ4 S;  3Q8R B;  3MD1 A;  1Q7Y T;  5A6W A;  2HPU A;  4A3I C;  1S9G B;  4ZLP A;  1IKV A;  5HRO B;  4N8O A;  4FKY A;  2P5V A;  2CVE A;  1B64 A;  1WEL A;  1IKX A;  4MFB A;  2EC0 A;  4IFY B;  2OFH X;  1W2B R;  2O5J A;  4R25 A;  5IXU A;  1VDH A;  4ITS A;  2WAQ L;  1Y1W C;  3ZZR A;  1CS4 B;  4TYB A;  4A3E K;  5ETN A;  2GSN A;  4Y2C A;  1RT3 A;  3OVA A;  3ILI A;  2MSS A;  2CNO B;  5I42 B;  4DPX A;  3GTM K;  2HAF A;  4ER8 A;  1HHS A;  4X4R A;  2J6T A;  1VRT B;  3VVT A;  2E5H A;  2V5H G;  4F4X A;  1X60 A;  2NPF A;  2E1P A;  4DSK A;  3QRQ A;  2WHO A;  3Q3Q A;  2DRB A;  2G0I A;  3T9Z A;  3R1H A;  2IY5 B;  1NKE A;  1HNZ F;  3I55 S;  4ZCK A;  4P52 A;  3NXZ A;  3BP3 A;  1R8A A;  3M9O B;  2RD5 C;  3DMJ B;  5J1N A;  2KXF A;  3HPO A;  1ZPW X;  4C8O A;  1UZD A;  3CCQ S;  3GTG K;  2LVW A;  1L5U A;  1F3F A;  4P2F A;  4M5D B;  4FF2 A;  4D3H A;  3SYZ A;  1NK7 A;  3GTM A;  2FYX A;  3FEY B;  1OY8 A;  3UO0 A;  4DDQ A;  3UNG C;  2SXL A;  3RU0 A;  2WSF C;  1UA0 A;  3OXG A;  3B54 A;  5ETR A;  3UPF A;  5BR8 J;  3MCN A;  2FGO A;  2BJ9 A;  3BR8 A;  3CO0 P;  3IAM 9;  1WHW A;  1X8D A;  5I3P A;  2C2D A;  1CS4 A;  3MAA A;  4TVA B;  2B6A B;  2WOM A;  2MGZ B;  3T1H F;  2HFN A;  3GJQ B;  1PG5 B;  1GMU A;  5BYS A;  4CT9 A;  2XYG B;  3NAH A;  2ZHO A;  4F0M A;  3L4K A;  1LXJ A;  2QG9 B;  3T5H A;  1VRT A;  2MZS A;  1SJF A;  3TUI C;  1J5E J;  1IR2 A;  2YX4 A;  2QTW A;  4NX9 A;  4KFB A;  1YRX A;  2E5L F;  3FRY A;  2AZ1 A;  4K50 A;  3CWJ A;  3E01 B;  2E9R X;  3KNA A;  3S14 K;  1TP7 A;  3CNQ P;  1VIS A;  3V4M A;  3OW2 R;  4TXS A;  3HZG A;  2C42 A;  1EZZ B;  2DHH A;  3S14 C;  2PA8 D;  3DMJ A;  3F41 A;  3HHL B;  1VJQ A;  4ZLN A;  2QEX S;  3A13 A;  4OJG A;  3C6T A;  5H9F J;  3NMR A;  1Y11 A;  3O1L A;  2JEF A;  1RCX B;  3DXB A;  2JFK A;  2XMM A;  4QR0 A;  4ICL B;  3MPV A;  4RW9 B;  3PRB A;  2AZ3 A;  1Q81 T;  4J9O A;  4CP5 A;  5M3M K;  3A8K A;  4PAA A;  1F1B B;  3HT0 A;  2BJ1 A;  2AJ1 A;  1H7W A;  3MAA B;  4JBC A;  2DBB A;  2Q79 A;  3NCP A;  3BUE A;  1IM4 A;  2VOO A;  2I8E A;  3IR6 B;  1C0T A;  1AT1 B;  3GTQ K;  4LK1 A;  2YNF A;  3MMC B;  3EZO A;  3I9Z A;  3LOU A;  1ZS6 A;  2K1R B;  4MT1 A;  3GV7 B;  5E33 A;  1Q8I A;  3S6E A;  3OLA A;  3GTO A;  3AJ2 A;  1ZAV A;  4DR7 J;  3KLE B;  2A69 A;  2HIY A;  4RBT A;  2IPO B;  5KFM A;  3N6L A;  1QD1 A;  1WI8 A;  2MLY A;  5A8R B;  2YKA A;  4NZ7 A;  2R42 A;  4L6V 3;  4RNO A;  3S2H C;  2Z2Z A;  2A10 A;  3HHL A;  3M32 A;  2DNY A;  4DDF A;  5KG0 A;  4FXW A;  3NMA A;  1M1K T;  3MM5 B;  4ANC A;  4GTC A;  4J90 A;  2DNP A;  4JI8 F;  5L1J A;  3MZI A;  4WBF A;  1JXL A;  1CC7 A;  1Q8K A;  1HBU B;  4ERD A;  1B0P A;  4Y2M A;  1XNR F;  1WNE A;  2OSR A;  3EM1 A;  2A6E A;  4FNH A;  4OJH A;  3S1M C;  1BQX A;  2CPF A;  3K7A C;  3PDN A;  1FJG F;  2MY7 A;  2XO7 A;  3NGR A;  4NLR A;  4CLS A;  1C0T B;  2W2O P;  2R8H A;  2UUT A;  2V67 A;  3F73 A;  3R6G B;  1U2F A;  1VQ7 S;  4J37 A;  2YNF B;  1JLC A;  1H73 A;  1YZ6 A;  2CA9 A;  1RCO B;  2RIL A;  3JS9 A;  5AJ3 J;  2R7R A;  2FJV A;  3KDN A;  3Q89 A;  4PG4 A;  3A8I A;  2D9O A;  1CPZ A;  1D8Z A;  4TYA A;  3DOM A;  4ILL A;  3KLE A;  2DNO A;  4LF7 J;  3CJ0 A;  5A8R A;  4X4U A;  4DX7 A;  3GTQ C;  2ALZ A;  2DRA A;  1RWV B;  4O3S A;  3IRW P;  3M32 B;  3I31 A;  4LUB A;  3Q22 A;  4AL7 A;  3TW0 A;  3GDZ A;  4WPA A;  4NYZ A;  2GML A;  2EFP A;  2HVI A;  2WW8 A;  4AQY J;  4QWB A;  1TAQ A;  1UFL A;  2CQC A;  3RB3 A;  4L3K A;  5AXN A;  4LJZ A;  2NXU A;  2A18 A;  4AND A;  4LR9 A;  5GAH U;  3OT9 A;  1K8A T;  1S0N A;  2LLZ A;  1ZH5 A;  2YKQ A;  1HYS A;  2EFO A;  4PWU A;  4ZVU B;  9RUB A;  3UN5 A;  5L9N A;  2UUB F;  1SJ3 P;  3ZNJ 1;  1PJ7 A;  2E2J K;  2RGR A;  3MEE B;  4DV3 J;  4NML A;  1SL0 A;  1U6F A;  5CAB A;  1VBX A;  4DPT A;  3GB0 A;  2R4F A;  3RBX A;  2LA4 A;  1FEH A;  3DU6 A;  3GU0 A;  4JV2 A;  3PEH A;  2A3J A;  4CO2 A;  3P4U B;  3MM7 B;  2E5L J;  1FER A;  3T19 A;  3PY8 A;  2FVR A;  5CHC B;  1ZTW A;  1HQU A;  4PRF A;  1EHW A;  4Y7N C;  3G8Q A;  4IOB A;  1R6V A;  5D77 A;  2W8L A;  4A3M C;  1JX4 A;  1CJU A;  4FF4 A;  4A8X A;  1O29 A;  4NLU A;  2CDQ A;  2ADC A;  3HSZ A;  4OI4 A;  4OIO A;  2FGC A;  2KFN A;  5DJB A;  4AUK A;  3Q24 A;  1S48 A;  3H90 A;  3ENV A;  5E3C A;  4A3F C;  4WFY A;  1LWF B;  5EGY A;  2FTR A;  2LEB A;  1ZPV A;  1FE4 A;  2XGP A;  4OZN A;  3G6Y A;  5D0E A;  3CCJ S;  3A12 A;  2R8I A;  3MEE A;  1KQG B;  4YN3 B;  1YLX A;  3DFE A;  3BEG B;  1X4F A;  3H5U A;  1RBO B;  4HHH A;  1SB6 A;  1S76 D;  4U8V A;  2OAU A;  2OML A;  3NAI A;  3JAM Y;  3POT B;  1Y1V A;  2JH3 A;  3X1L B;  4JI0 F;  2KRR A;  3PRV A;  4A3L K;  2LFV A;  4ZIV A;  2CQI A;  3LWL A;  2RF2 B;  1WOO A;  1Q79 A;  3NCR A;  1IN0 A;  4JI7 F;  1Q4R A;  4B9N A;  1HNX J;  1GEH A;  4DF4 A;  4X4Q A;  1O25 A;  1XZP A;  4CYU B;  2CJK A;  1N5Q A;  2EC2 A;  2XGQ A;  3FQL A;  3KYL A;  2QL7 B;  2CQG A;  2NZ4 A;  2PA8 L;  1PKU A;  4M8L A;  1CJU B;  3MCS A;  1C0U B;  4ZCI A;  2V68 A;  3VA7 A;  4RJV A;  3TUZ C;  3TR5 A;  1F9H A;  2IJR A;  2EK1 A;  2ZNZ A;  3GJT B;  4G7O A;  4YHH J;  1TKZ B;  1U1P A;  4H54 A;  3QGI A;  1URN A;  3RAX A;  4A3K C;  4M5G A;  2XMK A;  3MAQ A;  1TWH A;  2ZM6 F;  1DBD A;  1JLA B;  1NBE B;  2XYH B;  4OHV A;  2PA3 A;  4OI6 A;  4OYA A;  4LR2 A;  2W9C B;  4YB6 A;  4BBS K;  3CDW A;  1TWA A;  2ZH9 A;  3FEZ A;  2NVT C;  3KLH B;  1D09 B;  4DQI A;  3TFH A;  4FP9 A;  3TI0 A;  4LSZ B;  3G96 A;  1UMJ A;  2JA7 K;  4OHX A;  4N41 A;  1TKD A;  3R8Y A;  4TNO A;  2R2S A;  4O4G A;  2EFN A;  3QSY B;  3IGV A;  4JI0 J;  1ZZF A;  3NUH A;  2KG1 A;  4MYT A;  3I96 A;  4NLT A;  4CO0 A;  3Q8V A;  1NH7 A;  1XZP B;  1JLE B;  4CH1 A;  3GFZ A;  1JJ4 A;  4Q44 A;  3HD1 A;  5D4L A;  3VAK A;  1TWC C;  2C3P A;  4F3Q A;  1XMO J;  4I2Q A;  4P5B A;  2W2M P;  5GME A;  1KLM B;  3IBC B;  3C6U B;  4ZH4 A;  4RNM A;  2C3Y A;  2VL1 A;  5IYB K;  1TVR B;  3JQJ A;  3FOF A;  2PEB A;  4M5J A;  3D28 A;  3I6P A;  2DEI A;  3BV8 A;  1YJT A;  4JP8 A;  4GTF A;  1HBO A;  3I5A A;  1S1X B;  8AT1 B;  3RUB L;  4DCP B;  3I82 A;  2IM0 A;  4C6A A;  5IOR A;  1KR4 A;  2GNK A;  3Q2S C;  2WVD A;  5J1E A;  2A68 A;  3HHE A;  3TP2 A;  3OSN A;  4M5N A;  5F3Z A;  2ZVS A;  4DF8 A;  1MML A;  2G1H A;  4EO8 A;  3TEG A;  1YJV A;  2PMZ L;  5E7O B;  4WP8 A;  5GAD I;  3I32 A;  3W64 A;  2W01 A;  1FA0 A;  4TLQ A;  4LLG A;  4O4G B;  3MF5 A;  4ZN3 A;  4KAT A;  3D6T B;  6AT1 B;  5EWF A;  1H38 A;  2ZH7 A;  3V6J A;  1RAF B;  3DCA A;  3ZTS A;  3L7P A;  2DGS A;  1I1G A;  1OQ6 A;  4AH6 A;  2V6U A;  4EK2 A;  4WFN Q;  2V9W A;  2MDA A;  4DR5 F;  3FSI A;  1WWH A;  3ORE A;  5M3F K;  1RP5 A;  1KLM A;  3RZO K;  4A3D C;  3KK2 A;  1XMO F;  3V2U C;  4LQ3 A;  4HI2 A;  4IFV A;  3NKY A;  2B56 A;  1YVF A;  3NGU A;  2CQ0 A;  3NGD A;  1N6Q B;  3MUM P;  4MK7 A;  2OTL S;  4NCA A;  1FVS A;  3PFE A;  2Z2Y B;  2VA2 A;  2NXN A;  5GAG U;  4C3H C;  3CJQ A;  3H25 A;  4W4M A;  3DYA A;  1JLQ A;  3ONQ A;  2JLG A;  4N7T A;  1S10 A;  2AJ2 A;  1KKH A;  3EUN A;  4GO5 X;  3PCO B;  3OHB A;  4F7V A;  2ZUA A;  3MOZ A;  4FVM A;  3GTP K;  4BKW A;  4DCJ B;  5DG9 A;  2DCU B;  5IOS A;  4RPF A;  2OEJ A;  1FJE B;  1EI6 A;  4NXN J;  5EUH A;  1TL3 B;  5B09 A;  1X4H A;  2OH2 A;  2I5J B;  2V94 A;  4ZPA A;  1V3Z A;  1VLO A;  3VAL A;  2Z8Q A;  1UVK A;  2WB4 A;  1XTZ A;  4OV1 A;  1C1B A;  1TWA K;  3CMQ A;  3IWX A;  4Y7N K;  2BAB A;  3IP0 A;  3LP1 B;  4IFV B;  2YWE A;  4YOE A;  2VG7 A;  3V6D A;  4B3R F;  3SV4 A;  1HNW F;  3UDE A;  5D3G B;  2BAN B;  2ZJR Q;  1GK8 A;  3Q8Y A;  3T1H J;  1NPR A;  4CM0 A;  2JOQ A;  1VH2 A;  1O5J A;  3JXO A;  2W7P A;  1B4S A;  4FM9 A;  4LF6 J;  3UVJ B;  4I7F A;  2XI2 A;  2YX7 A;  3DYA B;  1B70 B;  3NY0 A;  5A8W B;  1MNE A;  2U1A A;  2YY3 A;  3EZ5 A;  4UQT A;  1I5O B;  2Y0B B;  1VBZ A;  2UXC F;  1GTE A;  2R7Z K;  3K57 A;  2DCL A;  3GTG A;  1VQS A;  2HQI A;  3FKI C;  4P72 A;  1QAX A;  4DXL A;  1UWB B;  3OPF A;  2A2D A;  3RBE A;  5J2N B;  3MR2 A;  1M5O C;  1NAQ A;  3I0S B;  2HUR A;  2FLL A;  4F50 A;  1TR0 A;  2I5J A;  4CNZ A;  2ZEJ A;  1TUW A;  2H5I B;  1S5Z A;  5IP7 C;  4CO5 A;  3MMA A;  4CH7 A;  2LEA A;  4Y52 C;  3PM9 A;  3S1Q K;  1NHK L;  1VQY A;  2VQE J;  4F3M A;  4LFA F;  4CLF A;  3IRX B;  1IUJ A;  4HYK A;  3TAM B;  2VPW B;  2H5E A;  3ETO A;  4LBI A;  3GTK K;  1FJG J;  3QJL A;  3UI3 A;  2JA6 A;  4KY3 A;  3EGN A;  2BAC A;  2Q6B A;  2VV5 A;  2VG7 B;  2HWI A;  2M70 A;  1OSD A;  4IFY A;  1S6Q B;  1HI1 A;  2BR0 A;  1FCA A;  2KVI A;  4OLO A;  5BYQ A;  1WSV A;  5D3G A;  1WF1 A;  5J1P A;  4NA3 A;  4CLY A;  4K2X A;  2BRL A;  4CCH A;  1IQT A;  3CC2 S;  3EZU A;  5ITH A;  4HEA 9;  3UVJ A;  3F44 A;  4I7F B;  2CFX A;  5A8W A;  5H1S V;  4QIF A;  4UZB A;  1F3V A;  4DUT A;  5I42 A;  2HW3 A;  1RT4 B;  2AEJ A;  4W98 A;  3FMB A;  1NH8 A;  4D3G A;  3GEE A;  4FPR A;  4A3K K;  4C8L A;  2WRM A;  3SI8 A;  2QMX A;  3CQZ C;  1WSR A;  3CD0 A;  3FBC A;  1EQR A;  4K5R A;  2GV1 A;  2QA1 A;  2NQP A;  3BJY A;  3PEJ A;  3MM8 A;  4WKR A;  3AH6 A;  2PI5 A;  1OO0 B;  3CC4 S;  4YDD B;  4LF8 J;  1WC0 A;  2HVZ A;  4LIR A;  2ZWP A;  2HBR B;  3CJK B;  1RT7 B;  1HI9 A;  4Y2I A;  1FDN A;  4A3D K;  2KFY A;  3I4N K;  4QWD A;  3IAS 9;  4LBP A;  4ZP6 A;  3TZW A;  3QJP A;  5HJY A;  2RQM A;  3B6B A;  4M5D A;  3MOJ B;  1RTH A;  4RNF A;  2Y8W A;  3TAM A;  3G6V A;  1YBA A;  4NCG A;  4KH1 B;  2IM3 A;  3WX8 A;  1TAU A;  1H72 C;  4X6A C;  4C8N A;  2AP6 A;  4OZ5 A;  1YRU A;  1U1R A;  3TA2 A;  4C2M K;  3H42 A;  2D1C A;  4LF4 F;  2DIV A;  1S6Q A;  2IIH A;  5KG7 A;  3NNH A;  5L1I A;  2UXD F;  2F4V J;  1HD1 A;  1ACM B;  2ZUF A;  5K8N A;  3HSJ A;  4F36 A;  2Y1R I;  5ETP A;  2WOM B;  4ED2 A;  5BR8 F;  2MGZ A;  2X51 A;  3NNA A;  4USI A;  2QSW A;  1UEV A;  4N76 A;  1U1K A;  3FSY A;  4YFU A;  2F5G A;  2DK2 A;  4AYB D;  2GMJ A;  1ZM3 A;  2CVI A;  4F04 B;  4P2X A;  2C2R A;  4IG0 A;  4C4W A;  5I3Q A;  2CPX A;  3M4O K;  3TTG A;  5A8K B;  3NRB A;  3H3V L;  4DR6 F;  3E01 A;  3JTN A;  4DUZ F;  4QJV A;  2W4C A;  3MM8 B;  1O6X A;  4B08 A;  2GVZ A;  3P6Y C;  3ILJ A;  4OYM A;  3AAW B;  4KSE B;  4AXJ A;  4OZ3 A;  2IJF A;  4NA2 A;  3IM8 A;  3PFO A;  3CJK A;  1SKU B;  1RT7 A;  2R3V A;  2W2N P;  1AA1 B;  4DMZ A;  3C6T B;  1RTH B;  3T41 A;  4O3N A;  1JMT A;  2W4P A;  1TFW A;  4NZ6 A;  3GSI A;  4ICL A;  5KFV A;  4RW9 A;  1SFO K;  1T3N A;  3D54 A;  4JV0 A;  1V3S A;  3CJ2 A;  2GGP A;  4OFZ A;  4OX6 A;  3HLU A;  4C8M A;  3Q8P B;  2Y8Y A;  3V5R A;  1BMQ B;  1YNJ A;  4LF4 J;  4A8F A;  4MMO A;  3BBB A;  1ULR A;  1QVF R;  3UNY A;  2JA6 K;  1KD1 T;  3D67 A;  4DSI A;  4DWI A;  3H40 A;  1RWU A;  1ZVU A;  1RTD B;  3S17 K;  3MMC A;  3EX7 B;  1S59 A;  2BEF A;  3BP8 C;  4PZV A;  5E68 A;  1O27 A;  2K1R A;  2C2Z B;  5IOL A;  5DDQ C;  5HAO A;  3GTJ K;  5A8K A;  2V50 A;  1G3O A;  3TFJ A;  3GTL C;  1KTQ A;  5DO2 A;  2P2C B;  3L4J A;  3N6N A;  4RW7 B;  2JFD A;  2GVZ B;  4JUZ A;  2EWH A;  3BS9 A;  4FZV A;  4HLB A;  3FSX A;  5DZ7 A;  4E98 A;  2CWK A;  2MKS A;  3NNC A;  3TVY A;  3GJS B;  3D0I E;  3W3S A;  1H2U X;  4DPO A;  3H98 A;  5D0G A;  2FHK A;  4KHP F;  4U8Y A;  5CCL A;  3MR7 A;  5H9E J;  3PR4 A;  2V8P A;  2QGF B;  1CUL A;  2XS5 A;  1UVI A;  2DHS A;  1ZXO A;  2BV3 A;  1KOO A;  2X3D A;  5C7P A;  3T1A A;  4KRW A;  1S7H A;  3S15 C;  2AEF A;  2ZH6 A;  2YKP A;  1DLO B;  4ED3 A;  3M8Y A;  2H3E B;  2JLF A;  3DLB A;  2HZV A;  3UN3 A;  5M5W K;  1UCN A;  1WHX A;  3FBE A;  1S97 A;  4IQX A;  4M95 A;  3D68 A;  4YDX A;  2N3O A;  5J2M A;  4C48 A;  3W9H A;  4PQU B;  3RRK A;  1RTD A;  1S1V A;  3CGI A;  5JVG Q;  4DN0 A;  4N77 A;  2ASY A;  3QIP B;  3OPK A;  3W1Y C;  4YFX A;  4A3G K;  1NSP A;  1XXA A;  3DOM B;  2KJW A;  3PV8 A;  2J5A A;  4FYV B;  4DV0 J;  2ZFZ A;  3Q83 A;  3W9I A;  1WC1 A;  4M5H A;  2ZVI A;  4RW7 A;  4A3C C;  3G8S A;  1JVI A;  4EWT A;  3M6V A;  2HZA A;  2YXL A;  1TWF K;  1P1T A;  2A6H A;  2CQ3 A;  1QDU B;  4UOH A;  1ZZN A;  2VA3 A;  4A3M K;  2C2K B;  3DRP A;  4UY8 T;  1HA1 A;  2IA0 A;  3T02 A;  1N32 J;  2J0W A;  1RTJ B;  1MW7 A;  5B08 A;  1CUL B;  1L3S A;  1EH1 A;  5DQH A;  2FC8 A;  2CW0 A;  4MKV A;  4FN5 A;  3N4W A;  1RLC L;  1R27 B;  3GIK A;  3UQS A;  1RGV A;  2J9C A;  4DV7 F;  4DQP A;  4DUZ J;  4HH1 A;  2RUG A;  1LQ9 A;  3EVM A;  3DM2 B;  4ED7 A;  2HND A;  3GIJ A;  1R0C B;  4JK1 A;  3GG0 A;  4KR0 B;  2CPI A;  3UW1 A;  3JST A;  2ZHA A;  5M2P A;  4I6A A;  4NRT A;  5J2M B;  4PQU A;  3MWB A;  1S1V B;  2VUG A;  3QIP A;  2XLK A;  3KHR A;  4DFP A;  2M4M A;  2KZZ A;  4LFB J;  4G0V A;  2RUS A;  1WC5 A;  2XM3 A;  4J9S A;  4A3B C;  2DNR A;  4M1K A;  3THP A;  4IG3 A;  4FYX B;  4ZP9 A;  1EFW A;  3MXH P;  2CG4 A;  3MM7 A;  1BLU A;  3E3X A;  1HL6 A;  3CTR A;  4BBR K;  3M8S A;  5B0B A;  1S6O A;  5CJ9 A;  4ECS A;  1HQU B;  1UJ4 A;  3GII A;  3TWZ A;  3DRP B;  2QA2 A;  2EKN A;  3THT A;  2XS7 A;  2AD9 A;  4GRS A;  2ZBI A;  1NZ8 A;  2UUA J;  3HO1 A;  4GC6 A;  3MHY A;  1U1O A;  1Y5N B;  4QIW D;  1NJZ A;  5AJ3 F;  5B0D A;  1GT8 A;  2FJB B;  1TWC A;  3MM9 B;  5DG7 A;  1LWC A;  1JKH B;  3W66 A;  1X5T A;  4RU2 A;  5KFO A;  1LWF A;  1VBY A;  1QVG R;  3DM2 A;  1M1G A;  5KFY A;  2IDL A;  2HND B;  1U4B A;  3MUT P;  3W60 A;  1UPM B;  3KUG A;  2QLW A;  4ETZ A;  5IOT A;  1HNV A;  2MKC A;  4GTL A;  3J81 U;  2VBY A;  1KSP A;  2CPY A;  2JJ4 D;  2AQ4 A;  5C2G A;  3HHD A;  4ZVT B;  2I1R A;  3TUJ C;  2DIS A;  3IM9 A;  2I6W A;  2AJ0 A;  5LMU F;  3K8W A;  2RH3 A;  1NSQ A;  3TJA A;  2LMI A;  2FLO A;  3IGN A;  4WYL A;  1AYE A;  3M4O C;  2WVE A;  1PGZ A;  5C4J K;  4WII A;  4KGM A;  1GH8 A;  2GJF A;  3EIC A;  1IBM F;  2PHC B;  2C3M A;  4XO0 A;  2NVQ C;  3GV5 B;  2DXD A;  4B3R J;  5DG8 A;  4JI7 J;  5D15 A;  1U47 A;  1TV6 B;  2HQ3 A;  3HF5 A;  4ZN1 A;  3ZNU A;  2QYG A;  1C0U A;  1YTY A;  3K5P A;  5ETK A;  2G9O A;  3ZZY A;  3OTE A;  2VFT A;  1YWX A;  1Q5Y A;  5KFK A;  3MM9 A;  4NRU A;  1LWC B;  1JKH A;  2VFU A;  3JSM A;  1TKZ A;  4RO0 A;  3OD2 A;  3Q8U A;  5CXT A;  1PJ5 A;  3MED A;  1H2V Z;  3W2W B;  3LPY A;  3X3U A;  5M5X K;  1XNQ J;  2CRL A;  3HXA A;  4B3M J;  4V19 X;  3OL9 A;  1HQE B;  1M5P C;  4DL5 A;  4YME A;  1QTM A;  2XMA A;  3BO3 A;  1HNV B;  3S1M K;  1M5K C;  1N8R T;  2DGT A;  1JLA A;  2D3U A;  2ZUE A;  1S4E A;  3ZTP A;  1FT8 A;  1Y5I B;  4NLD A;  1HD0 A;  1QAY A;  2X1B A;  2ZUG A;  1A7G E;  4I2P A;  3QT7 A;  1BXN A;  4I67 A;  3CJ4 A;  1RTZ A;  2H4Y B;  2MHN A;  1X5P A;  4N8N A;  3IA0 A;  2YKM B;  3OHA A;  3D1O A;  2ASD A;  4F2S A;  4CO4 A;  4OI1 A;  4QZV B;  2YQ3 A;  4LIW A;  2KKH A;  2L9W A;  1NU4 A;  3KG1 A;  1VQP S;  2JA5 K;  1SL2 A;  1AW0 A;  2Y1L B;  4WXW A;  5GMD A;  4DV5 F;  1TV6 A;  3VV2 B;  2MQM A;  4OX9 F;  1NND A;  2BM0 A;  2OJ3 A;  1GXU A;  3PHT A;  2ZE2 A;  1S9E B;  1LFW A;  1YG0 A;  1EP4 B;  3SV3 A;  1Q5V A;  1HBO B;  2CJB A;  4ZVE A;  4XLP A;  2HBY B;  2AWZ A;  1VQ9 S;  2V8H A;  5D0H A;  4AXI A;  2MJU A;  4GKJ F;  1Q8L A;  1KHV A;  1K1Q A;  1CG2 A;  2ZBC A;  5A76 A;  5K9F A;  4MIW A;  3GWC A;  2HRY A;  1IVZ A;  1T9T A;  2B9W A;  7FDR A;  2DRD A;  2HSE B;  2BKO A;  3N01 A;  3GTQ A;  1DQ9 A;  1U8W A;  1HI8 A;  5B7W A;  3MEC B;  4OYZ A;  3NS7 B;  2NS1 B;  2V4Q A;  2J76 E;  3QLH A;  2YKM A;  2A2C A;  4I4B A;  3W62 A;  3CF5 Q;  3GCX P;  3LAK A;  1X5S A;  2CQ4 A;  2IRU A;  2DEJ A;  3CUN A;  4L3N A;  5B0E A;  2OHD A;  4KYZ A;  1G51 A;  4UW2 A;  1L3U A;  1TUG B;  4A3G C;  1Y1W K;  1QJH A;  1SUQ B;  1T9X A;  2HK3 A;  2ZE2 B;  4CQ1 A;  4X66 J;  3GIM A;  4W90 B;  2EBG A;  2NCK L;  2DH7 A;  1R9T C;  1S77 D;  2GHW A;  4OX9 J;  3FGV A;  1FTR A;  4G1P A;  1I3O B;  3RTV A;  3HOZ C;  2MQO A;  2EG2 A;  4OQJ A;  2VG5 A;  2L9N A;  1OSC A;  5GAE I;  4BLA A;  3SIP B;  3FQK A;  1WEZ A;  1IBM J;  2IFX A;  3H4B A;  2HK2 A;  1DCP A;  4OIR A;  1NSA A;  4BY1 K;  1LFP A;  3P96 A;  4JI6 F;  3SZZ A;  1SBR A;  3VHQ A;  2XTJ P;  1RAB B;  2ZBR A;  2E7W A;  1UET A;  1H0H B;  4B9V A;  1F6T A;  2RT3 A;  2VHG A;  3EGZ A;  3VVU A;  1IBL J;  3MCO A;  1GE9 A;  2IRY A;  4LRA A;  5KT2 A;  1FES A;  3HHK A;  3C3L A;  3M9M B;  3CQZ A;  3DOL A;  2MHE A;  3QLH B;  2D7S A;  2BQ3 A;  2XZT B;  1KQ4 A;  3JQK A;  4KE5 A;  3B82 A;  4TU8 A;  1EAY C;  2VUM K;  4KAW X;  4A3L C;  4RX6 A;  4O3P A;  4M5K A;  5CYM B;  1VQO S;  4F67 A;  1NB2 A;  2MKJ A;  3JAM U;  3QFH A;  1SUQ A;  1RAD B;  1FF2 A;  3RG6 A;  2UUW A;  2O5I A;  2V2K A;  4AL6 A;  3HVR A;  4F4Z A;  1I50 C;  1U48 A;  3VWS A;  3BN4 A;  3R5A A;  3T6B A;  3R6L B;  2BAN A;  1SV5 A;  2VG5 B;  3MEK A;  5D4D A;  4FF1 A;  2N4D A;  1P1L A;  5TMC A;  3M8R A;  1VQM S;  1R6Y A;  2FZG B;  2NVY K;  1RQ0 A;  2KM8 C;  1J98 A;  3SZY A;  3GYX B;  4C3M A;  1PIE A;  4C3I C;  4WU2 A;  4USK A;  5HK4 A;  3CCS S;  3LAL A;  3CED A;  3S1T A;  4GTA A;  3WOD A;  3CCV S;  4XDD A;  3FC9 A;  4ECV A;  2C3U A;  4ES2 A;  3M6W A;  1UWB A;  3S2D K;  3ENQ A;  2R93 K;  5THW A;  1VRU B;  5J2N A;  3V81 A;  2VBW A;  2OPP B;  5IC4 B;  1PSD A;  4O23 A;  3I0S A;  1HWJ A;  3K89 A;  2FY8 A;  3DOL B;  2VIH A;  1PYT A;  4BY1 C;  1RHJ B;  2MKY A;  2WSE C;  3H8Y A;  3FZB A;  4A8O A;  4UOG A;  1FK9 A;  3RAM A;  3MMA B;  4KAS A;  3H20 A;  4UUW A;  2J7U A;  2QL9 B;  2V4J B;  2KJV A;  1D1U A;  4DCO B;  3SMZ A;  2FVC A;  2DIT A;  4ID5 B;  1F9E B;  5HMY A;  1QSY A;  4ZPB A;  3SBM A;  1N48 A;  2G2O A;  2DJW A;  5KAK A;  2PGC A;  2LP4 A;  4TN2 A;  3HFV A;  3RYL A;  4ZJQ A;  3GE9 A;  5I4M A;  5LMN F;  2DTJ A;  4DQR A;  3OUY A;  2CNL B;  4HL9 A;  1FKP A;  2OEM A;  3E2E A;  4KTQ A;  1Y0H A;  3GTK A;  4DQQ A;  4NLO A;  4HAC A;  3EGW B;  2AJ4 A;  4LF5 J;  2XMU A;  3ZZU A;  6FD1 A;  3G4S S;  1RT4 A;  1HLW A;  4H4K C;  3GPA A;  3PW5 A;  3DGP B;  4A3I K;  4B9S A;  3PRD A;  4KM8 A;  1Y10 A;  2G0C A;  2HHT A;  2BE2 A;  4ILM A;  1SXL A;  3V81 B;  1ARO P;  4LOW A;  1REV A;  4M94 A;  2DNN A;  2FLP A;  3ZC4 A;  3QAU A;  3OJS A;  4WJB A;  4BHQ A;  2Z2L A;  3Q86 A;  4XPE A;  1Y4Z B;  3PAC A;  4KMA A;  3LGM A;  3IS9 A;  3S17 C;  3M2V A;  3JSB A;  4G0U A;  1YJ7 A;  3DDK A;  1VQ5 S;  3HUL A;  1U1N A;  3DI6 B;  3KLI B;  5F41 A;  3VZI A;  1XJW B;  3KFW X;  1J5O A;  2B43 A;  3WHI A;  1H7X A;  2O1P A;  4LK0 A;  4NCG B;  1LWX A;  1MRO A;  4YB1 P;  1T11 A;  3N0V A;  1Q95 G;  4FZB A;  5KFC A;  4ID5 A;  3Q23 A;  1H74 A;  3T1Y J;  4Q2M A;  2FJW A;  4RNN A;  3P5B P;  1SJQ A;  2KI2 A;  3AB4 B;  5HVF A;  1S1W A;  4DV4 J;  1Y1V C;  5C3E C;  1LOU A;  3VAM A;  1XK8 A;  2O3D A;  1S1U B;  4LBH A;  1E6V B;  3U7J A;  4MQ9 A;  4QPX A;  1UTA A;  3EE3 A;  3LAP A;  1D3W A;  3PVX A;  2OI2 A;  2VPY B;  1EKR A;  3FBB A;  2RQC A;  2ZH4 A;  1Q8B A;  4E2F B;  2EFG A;  4ZVF A;  3H7H B;  2ZOM A;  2UU9 J;  1QY7 A;  4IG0 B;  4JYA J;  4JV5 J;  2MQN A;  4FBT A;  5CHP A;  3C8Y A;  4A8W A;  4TU9 A;  4DPW A;  1RXO B;  5KFB A;  4RW8 B;  2CXE A;  4QJV B;  1EB0 A;  4IH5 A;  2ZZT A;  5C4X K;  2K8G A;  4TY8 B;  3AJ1 A;  2QV6 A;  3QNW B;  1J6W A;  1GQE A;  4RWW A;  3M2V B;  4DZD A;  1PAE X;  1FHT A;  4A3E C;  4ZVG A;  1I6V A;  3PZP A;  1MRO B;  5H9F K;  4O4R A;  1IR0 A;  2QA4 G;  3FCW A;  3UD3 P;  2HLU A;  2G1D A;  1WEY A;  2GGP B;  3CC7 S;  4X4O A;  5GVQ A;  3QZ7 A;  2K3K A;  4U7U K;  1E6V A;  2ASJ A;  2F9J A;  4FS1 A;  3SZ2 A;  2CYY A;  1OYD A;  4KM9 A;  1C2P A;  3GEI A;  2HZC A;  4YR2 A;  4ED6 A;  5IM0 B;  1TK8 A;  3D5M A;  2BE9 B;  4X64 F;  2IJN A;  1C1C A;  2GC8 A;  1U8S A;  2BX6 A;  5CYJ A;  4LFB F;  2XB2 D;  1XQI A;  4DL6 A;  3LF0 A;  3A8J A;  4HTJ A;  1WG4 A;  3D0G E;  2BVZ A;  1RYS A;  2D3O R;  2XMW A;  1J27 A;  3PIP Q;  1VCT A;  5U47 A;  2DNH A;  4JV5 F;  1HQM A;  2GAG C;  1FX4 A;  4ZDN A;  4TY8 A;  4MKA A;  2YKN B; 
#chains in the Genus database with same CATH homology
 1WSV A;  3GEH A;  1YX2 A;  3TTG A;  3GEI A;  1WOP A;  4PAB A;  3A8I A;  4P9S A;  2GAH C;  3AD7 C;  1PJ6 A;  1VRQ C;  3ADA C;  1XZP B;  3GEE A;  3TFH A;  1PJ5 A;  3GIR A;  1X31 C;  1WOO A;  1XZQ B;  3AD8 C;  1WSR A;  1V5V A;  1WOR A;  3A8K A;  2GAG C;  1VLO A;  4PAA A;  5L46 A;  3TFJ A;  1PJ7 A;  1XZQ A;  3AD9 C;  3A8J A;  3GSI A;  3TFI A;  1WOS A;  1XZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...