2GARA

A ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
188
Chain Sequence
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRALIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pH-dependent stabilization of an active site loop observed from low and high pH crystal structures of mutant monomeric glycinamide ribonucleotide transformylase at 1.8 to 1.9 A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Purine biosynthesis
molecule keywords GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
total genus 60
structure length 188
sequence length 209
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1998-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 2garA00
1GARA 4EW2A 5J9FA 2GARA 1MENA 4QPDA 1RC0A 4R8VA 1RBYA 4EW3A 4ZYZA 3DA8A 2CFIA 4ZZ2A 5J63A 4EW1A 2BW0A 1CDDA 1GRCA 1NJSA 1RC1A 1RBZA 1S3IA 4ZYTA 4ZYUA 1FMTA 3P9XA 1C2TA 3DCJA 4PZUA 3W7BA 3O1LA 4NV1A 4ZYXA 3LOUA 1MEOA 3Q0IA 4Q12A 3AV3A 4ZYYA 4ZZ3A 3KCQA 4QPCA 2BLNA 2YWRA 1JKXA 3TQRA 3OBIA 4ZYVA 4DS3A 3R8XA 1CDEA 3GARA 4YFYA 1ZGHA 4ZYWA 3NRBA 3TQQA 4TT8A 4TS4A 4YFVA 1C3EA 1ZLYA 3N0VA 5CJJA 1RBQA 1RBMA 1YRWA 4S1NA 3AUFA 2FMTA 4TTSA 4ZZ1A 1ZLXA 4IQFA 1MEJA 4ZZ0A
chains in the Genus database with same CATH superfamily
2JAWA 1YSCA 3NTRA 4OHVA 3GFQA 4W1QA 3M4ZA 5JXHA 3D8TA 5AW7A 1KA9H 3DOUA 4K6OA 3GRYA 3N05A 5EYPB 5BWLA 2Q45A 3T7AA 1NLZA 1SUDA 2HOQA 2QU7A 3EGIA 2BM0A 3PTAA 2I66A 4Z51A 2IYNA 3F4BA 4OM8A 1AT1A 1QH1B 1URPA 3BE8A 4XQEA 4CKZA 1I6WA 3ELDA 1DAOA 3KOOA 4CMKA 4RVUA 5F7ZA 3KVRA 4AZ0A 2XKJE 2K4MA 2ZWIA 3R5FA 4J29A 3WKEA 3E35A 1DRKA 1YQEA 4X3CA 5ICSA 1GAEO 4BE4A 3M1IA 1L5ZA 2C95A 1OXTA 1T5IA 3DPIA 1P7YA 1UJ5A 4HBZA 5JAQA 3WV5A 4CI9A 4TYQA 4XCXA 1SCJA 1HMPA 3DG9A 1IBSA 4ZZ0A 4QLBA 1LZKA 3VFDA 3ZU5A 1F0NA 4FDLA 4ZT7A 4U39A 4TSFD 2ZYRA 4MA4A 1HNNA 4EGJA 5JROA 2WKWA 3EZ9A 3QLTA 4X3OA 3L5KA 4JOBA 4Y2GA 1X1DA 1TLLA 1VGRA 2PX8A 3OAAA 4WCFA 3SEZA 3PX7A 5CNJA 1MPTA 5BW4A 4IDBA 2Q2QA 2VDKB 4JBGA 4XGRA 3T7SA 2JI9A 4IDPA 1XMJA 1KJ9A 5IJ9B 3NWOA 1W4CA 4R5MA 4UU7A 2E4UA 1Z2EA 2VUHB 3A1EA 3NV7A 3QXJA 1NDHA 3QKRA 2A5DA 1EX1A 3T5CA 1DXOA 2DJIA 1LK7A 1TFRA 2MSWA 2QTHA 4ZAYA 2XCQA 3OM1A 4X0EA 3ET4A 1FP7A 1B16A 2H65A 1F3LA 1FOEB 1VLVA 3RR2A 3LBFA 3VYVA 1O89A 3JYQA 2NZ2A 4CDMA 4Y7CA 2CE2X 5BYKA 1C9JA 5IC5A 5I48A 1AVTA 3I0MA 3FLEA 4K9KA 3T41A 3GMIA 1NUSA 2RB4A 2WLSA 1ORHA 5FPSA 4DGQA 3PDCA 2I7VA 4K6FA 5JC8A 4B35A 3VSBA 4CEHB 5JV5A 3TRJA 2GLTA 1V48A 4OHXA 4PZ0A 4IIGA 2R5NA 1YGYA 5I7UA 1YQQA 2RKOA 1EJ0A 1OC4A 2DG2A 3VVCA 5K8IA 2B5OA 3VU0A 2FUCA 3Q3HA 1USKA 4MIYA 3ZU6A 1CRZA 1U2DC 3O93A 4QZVA 2B5VA 5L3ZA 2VKQA 2BE9A 2ZVPX 1G8AA 3OCJA 3KEQA 3SP1A 2O8CA 3IQIX 1MIOA 1YU6A 2W8ZA 3RVBA 1F12A 2HA5A 1PZNA 2E2WA 4D99A 3ED1A 4K87A 1EVQA 1W8IA 1NFRA 2VNIA 3JZDA 2R8XA 1OMOA 2GJ4A 2EOAA 3OJXA 3TQIA 1HZZC 1VPDA 4Y2QA 1M8PA 2WILA 5TQ2A 2SHKA 3UGTA 5IJZA 3CF4A 4ID3A 4JJ4A 5KC9A 2AZDA 3K0CA 1FNMA 4WZBB 3F67A 4RXMA 4QOIA 4KXVA 2FRDC 4QPPA 5GQSA 4AO8A 1DKMA 4C7OB 1QX4A 4KO8A 5JDIC 1RCTE 3OX3A 3G2JA 2WEKA 2XNCA 1NA5A 4PGFA 3VNVA 3ZJ4A 1OWOA 2B94A 1R27A 5FL3A 4D3DA 5AVRA 3JZAA 4U02A 1HFKA 3DZDA 1G5QA 1SXJA 3FX2A 4FC6A 2GLUA 4C0AC 3DO6A 3IO3A 5EWLB 4YX9A 5HJ7A 4MCIA 3GRUA 3Q10A 1OBVA 3Q7TA 4IIFA 3D2AA 4D4LA 4HTFB 2JI7A 4K0RA 3ZHTA 1GRQA 1NIPA 4QBKA 3OLQA 1VP3A 2WQ6A 2VHZA 4MV9A 2MINB 1UC8A 1A9TA 2Z8YM 4CBVA 4B71A 4XUCA 3F6YA 4NBWA 1ZK0A 1IEXA 2R25B 4JJZA 3MGGA 5LLSA 4MWTA 4Y18A 4H7FA 3VMMA 5K3SA 3EQ7A 2BC9A 2P9ZA 2E21A 3DLCA 5FLYA 3TLYA 4BASA 2HI0A 2IGBA 1QYWA 4ITVA 4BKPA 4YCSA 1EK0A 3BWDD 4M0DA 3SHFA 1GPUA 5G2OA 3K70D 1X7WB 2DP4E 3I2IA 4HV4A 2YN0A 1FXWF 4OH1A 1MHTA 2B6NA 3IBTA 4QNNA 1N3LA 4NS1A 3ZXIA 3S6JA 2DT5A 3H9QA 1E96A 2XA9A 1JG2A 2YV3A 3EIHA 4INZA 4JLMA 4M9CA 3SC3A 4C5CA 5LQUA 4I2VA 1K3TA 1TD1A 3NBQA 4YGYA 5DH9A 1A0OA 4NEHB 5JJ5A 4C7JA 2X0KA 3LY5A 2C97A 2X6TA 3WDKA 4C0QC 3IILA 4Q19A 1M5TA 3AL2A 4G0VA 1P9WA 4DLLA 2RMKA 3VU1A 2JHCA 3GNQA 2YBEA 4HB4A 1Y42X 2J5RA 2QRVB 2VWPA 4DREA 2H5IA 3VO8A 3ITNA 1ZIYA 1P9NA 2ST1A 4PRKA 3GJRA 1KOJA 3IC5A 4DS3A 3KQOA 5CYGA 3DBOB 4FGSA 1XDDA 2R6HA 4M2LA 4LOIA 3NYIA 1E2BA 2VHJA 3BXFA 5DNCA 1ONBA 1ZKMA 2R6CA 3C7DB 1ZM3A 1PT6A 3GT0A 3TJRA 3I9KA 4UEWA 2HH9A 4BO6A 2GK3A 4QARA 2C92A 3FPJA 4FTWA 1UXIA 1LI5A 3A06A 3FIJA 4FBMA 4DCOA 3HN6A 1TIKA 5L3SB 4MGHA 3WWZA 2I8AA 2PJUA 3EXHA 1G8YA 4PHFA 1WP9A 2ZTUA 4HFRA 4L22A 2CNBA 4PO3X 4V0MA 4GQAA 1HL7A 1G6HA 3X1KA 1NJ1A 2WA1A 5LQMA 4YRJA 1EDDA 2H9AA 2F9FA 2PG3A 5CM9C 1PO7A 1EU1A 2PZKA 3B89A 3EGOA 4LE2A 5CK5A 4CKBB 3ASZA 4EVRA 3CEHA 4YBRA 1JHPA 1PRYA 4Q01A 4Q1DA 1QU2A 4CU2A 2EJWA 2ID7A 3PXGA 3TYXA 3WL6A 1OWLA 3J81k 4FMBB 4Q1BA 4B83A 2R8OA 5IT9A 1KR5A 4HB2A 3HRKA 3VZSA 2RHRA 2CLSA 4Q9NA 3WNDA 5IPFA 4KR2A 2O0LA 2VDWA 3N2IA 5TVGA 3ETCA 5HGJA 3DMRA 4LXUA 3VA7A 4UTNA 1DKUA 4HGZA 3P9CA 3F6SA 1W49A 2HCRA 2AH5A 3BYZA 1JILA 4YGXB 3WGHA 4ZN6A 4P36A 3VPHA 4QQKA 4JBYA 5ESRA 1BH6A 3A1VA 4WOBA 2OCIA 3W34A 4YONB 1L7MA 1SXJC 1S2NA 3BD8A 1QB8A 4BJ5A 4D9CA 2NQ2C 5ALWA 1Z6GA 3TF5A 3GD5A 3MCWA 4MKIA 2GXUA 3K16A 5ALVA 3IEVA 2D5IA 2LD4A 3AI1A 4JI7B 2VS1A 4JFAA 1NXTA 4RD1A 4F5WA 2QQFA 2G9ZA 4R8VA 3TW6A 2C54A 4G8CA 4QG3A 2QIPA 2V7QA 5EXDA 2VBFA 4K9OA 3FCOA 4DHEA 1X14A 3GZNA 4P4SB 5LOVF 5JEDA 3FZNA 5HMLA 4NPCA 3IUMA 1XKQA 1EE1A 5I51A 5SV2A 4NJMB 1DV1A 4FD3A 4W7HA 4XQ0A 4LVCA 1KEWA 4ZC8A 1FE8A 2QTZA 3P0IA 3KELA 4RMIA 3WNQA 5D5QA 5KHAA 4I3GA 4M89A 3FYTA 5ALGA 1ENPA 3V33A 4ZAGA 1BXZA 4Z1OA 1ZGAA 4LISA 1WW3A 3K70B 1AQLA 1H6BA 2PGJA 2XMBA 4YB8A 2IBTA 1H6CA 5JNTA 3LXRA 5FWXB 5AVZA 3ZKWA 3DR5A 5E1DA 2EG9A 1SHLA 3G82C 1A04A 3DD1A 3HCEA 4DADA 5I7OA 4NNOA 2VXOA 2R0QC 4Y1FA 3R74A 4IJQA 4M55A 1XD8A 4FCTA 1B73A 5AUOB 1JFTA 5T41A 3RC7A 4WK4B 3TLKA 3C70A 1CY6A 2AFHA 4PF1A 3U3RA 3L4BA 3C45A 3HCOA 3FMFA 4H1HA 2ODAA 5D7NA 4EB3A 3QX9A 2XADA 1QG4A 2YZKA 4HQRA 3TOZA 2VXBA 2YS6A 2W42A 1THZA 2BJWA 3EH2A 4URFA 1RZRA 1J1UA 2R6R1 3IVRA 2B8EA 3GJ4A 3P0EA 3AB8A 3ZWVA 4YRTA 5BMVF 4BO2A 4QE3A 1CLEA 2A0KA 1UPBA 4D4IA 3HDYA 2C98A 3A1CA 2A94A 1H2EA 2IYAA 3DBHB 3DDUA 3L4SO 4MARA 2X7HA 3H8SA 3S1SA 5FTMA 1DO0A 2JJ8A 3QF7A 3H6KA 4O4HB 4EBFA 3TL6A 4M38A 2WWXA 3CIOA 1ZX1A 1EM8B 2ZI7A 2PWZA 2VNSA 3DP9A 3MOSA 4FVTA 4JUCA 4U9HS 3UN1A 5ALYA 1ONPA 4ZO6A 1CUAA 1YR8A 2ZUVA 4RE6A 5BWNA 5CM2Z 1WF6A 2AQ8A 2HTFA 3EULA 4Q1EA 5AMXA 4BMSA 1ZVVA 2NSHA 1JI0A 1IIRA 3T0FA 3A25A 5DRYA 4F86A 1M67A 2RHTA 4FI3F 2PMWB 2C4UA 1PL0A 2ONYA 1FFAA 4F93B 1M2NA 1TA4A 4Q9HA 4DLAA 4DSTA 2YJ6A 2EEPA 3G8AA 1HA3A 1B8UA 3HJUA 1D0SA 2M6RA 1MQSA 5FI0B 4F72A 1A69A 5CDGA 2AFIE 4U00A 1GITA 1LQUA 1M2OB 4IDCA 1U7DA 3A2LA 4WBXC 4AJNA 3A6GA 2AIRA 3K6JA 3LPCA 2OLJA 1STOA 4PM4A 4BAZA 3LT2A 5JJLA 4NENA 4OJMX 4PHCA 4URVR 4DNFA 2JJMA 4B6GA 2AC7A 1T6NA 1H6AA 1XQVA 2ZOSA 5JEEA 1NX6A 3V8RA 5L95A 1F2UB 1K9SA 3THWB 2G4VA 3HQ4O 4IV8A 4PC1A 5DZSA 1C50A 5DSXA 3O3MB 4TKLA 2COEA 3SMQA 1TZCA 4K3VA 3L41A 3UJ9A 5EJ7A 4Q3DA 3F6CA 5DMXA 1Z0FA 3B2EA 3Q88A 4FDVA 2WJ6A 4YWJA 3SZGA 3Q9NA 3TW8B 1OLOA 1QV6A 2YMLA 1ORTA 2KSQA 2W00A 3G3EA 2AQKA 4YP5A 4WDQA 3WFJA 2IHKA 4DMRA 1RM3A 2R4UA 1XPRA 1ZVMA 1TOAA 2O1EA 1YE5A 5TVKA 1VMDA 2HA7A 4X8OA 3R7FA 5DE3A 3VR6H 3MTGA 2QW8A 2M1XA 1CULC 3GVIA 3ODGA 4BP9A 1T9CA 2XUPA 1ORIA 4MK4A 2PH3A 2X5OA 3TQFA 2EZTA 2CMGA 4KAXA 2VQSA 3EQ6A 3GGGA 1BWSA 3H1EA 4V0LA 5AI6A 1OLSB 5A1JA 1NW8A 3RF6A 1WEKA 1EKXA 3K05A 4MWOA 4LZWA 3F3SA 5IWCA 3TPCA 4KFUA 3HJCA 2GJKA 4W5QA 3WRVA 3DQQA 4UUMA 1DCMA 1T2EA 3KYCB 3PA6A 5FAKA 1UZNA 3BWEA 2ACWA 1XEWY 5L3RA 5A5DA 3JY6A 1JHZA 2Q7DA 1QK5A 3PQDA 2WDPA 4A10A 2VP3A 2FR0A 2HWYA 2IUSA 3FPBA 3LHFA 1HTBA 2HCJB 3PT5A 4KNVA 1TE2A 1ZC3A 2ZBGA 1DQSA 4O8CA 4F85A 3E3LA 2LPMA 4TL8A 1KQOA 1RM0A 2BBSA 2Y68A 4QOJA 5EJ2A 4L72A 3KXPA 1DHTA 1TEXA 2EF0A 2OCXA 4XJTA 5CG2A 1HE2A 1UC5B 1V6AA 2ROQA 3MJFA 4B73A 1QC5A 1QE0A 4V0SA 1JEAA 4A36A 1YE8A 5HKOA 3D7MA 3OQIA 4RABA 2H1SA 2B83A 2ID9A 1QGYA 4K6KA 4BO8A 3EPLA 2DEUA 1SUAA 3MJDA 1K8RA 1MRNA 1JJVA 2OK7A 3LFUA 4B3GA 3P4UA 2GBIA 1G2QA 1KY3A 1UCFA 2R85A 3D5EA 1RJFA 3DZCA 3QIVA 4JFRA 4UU8A 3MMNA 3SEFA 1JQKA 4OGLA 4ROSA 1C3OB 1H65A 1PDVA 2AUNA 2JGFA 1EFHA 3MUOA 5IFLA 1G59A 2G67A 1JLHA 1OXMA 3HUFA 5EIWA 4AKGA 4FKMA 3TGWA 4A2WA 1XPOA 2BFFB 2HZBA 1I3LA 5B3JC 4ZJYA 5KWSA 3H9BA 2QLTA 3DXYA 2FP4B 5K3DA 2XGOA 4IR7A 1W36C 4M1SA 4EJSC 4ESHA 1QHNA 3UATA 5FPKA 1FRFS 2A9PA 1FTYA 1GUBA 2OL4A 2UDPA 1JDVA 3DDZX 1BE1A 2I55A 2Q3DA 1HYHA 3VZPA 4UATA 4O3FA 3IEIA 4JSTA 1YCHA 4HDKB 5EERA 5HF9A 4G01B 1CERA 3KQYA 2QHXA 5KQGA 4DBLE 4R1QA 3SLRA 3TL3A 1CRQA 2H54A 3HI4A 3U3KA 4YAKA 5JT1A 1FSZA 1JJFA 5HUHA 5I45A 1UMCA 1YJXA 2IHZA 2R79A 2X0RA 2XTZA 4J4HA 4LJ7A 4Q00A 1JSLA 4QECA 3WLNA 5BV2P 4B87A 1OX4A 1VJCA 2ADFA 3KUKA 2FG7C 3BFJA 3KOZA 4MYCA 4EHBA 2YKGA 2DBZA 2OO5A 3KBBA 1AGRA 4J0EA 4IOJA 2QI9C 1SBYA 4M1MA 3UHOA 1QP7A 4CM4A 4P81A 1BWPA 3JZMA 4A82A 4RY9A 4E2FA 1M34A 5J2TA 1G3MA 2CXOA 2G83A 4WEOA 3AJEA 1THGA 3L1UA 1KO1A 5T4BA 5K4HA 4E2XA 1FFHA 1P7CA 1Z56C 1XOIA 2CDCA 4UOZA 2FPLA 3WK4A 1LZLA 3GFBA 3H3FA 3PLNA 3A6KA 2WM9B 3GPDG 3HCBA 3H97A 4NBSA 3SY8A 3JWJA 4G81A 4RQTA 4DV5B 1PJTA 3E58A 3H8WA 3OCCA 4G5SA 5FBHA 4JDUA 3C43A 4EW2A 1Y6GA 4NBUA 3IXMA 2P6RA 3J7TA 1E2QA 5I9NA 4LHWA 3C8MA 2IXFA 4AAYA 5EJEA 1RZUA 1X1BA 4J49A 4NECA 3WLRA 4Q3NA 4UW9A 4Q4CA 4QBHA 4JB8A 5EE5B 1RBZA 1BFDA 1TEZA 1Y80A 3DE7X 1GU0A 4BJ6A 2B36A 2Z3VA 3V2HA 2OWDA 3TZHA 3DUWA 1NW7A 1NI5A 1PNOA 1QH8A 2HFKA 3G0CA 3PUJA 4N3NA 4L5AA 3RJZA 1V35A 2PLNA 5FUMA 3LA8A 4G41A 5DYGA 4IPTA 1J90A 4UZSA 2I2BA 3HLYA 1N5JA 3K5HA 4YFYA 3GXOA 1Q21A 3SM3A 3B9RA 1E62A 3LUCA 4OFWA 5JMOA 3SD7A 4KREA 4AY2A 1PR5A 2VSNA 4V1CA 4OQLA 1RWBA 2R2GA 3COVA 1E7MA 3B78A 1FQWA 4JCOA 4RK4A 5HGXA 2QLMA 3MELA 3DDNA 4FGJA 2JS7A 2JZCA 1Q12A 4MRNA 1OHHD 3GQVA 4ZKEA 1PNVA 4IHAA 4JUBA 1GPNA 4QUBA 2PX2A 3ND8A 5KQLA 5AHRA 3W9SA 2HWXA 4W6ZA 5TSDA 3RLFA 1TAHA 3W2TA 5I7FA 4QQRA 3ZZMA 3UBTA 3OG9A 3DOCA 2AF3C 4QXOA 2OQIA 4CPDA 3FYSA 3WWDA 3L0SA 4FYXA 2FMUA 1K3UB 4KWTA 3GT3A 16PKA 3DPUA 3BH6A 1R16A 1CQJA 3E7DA 4WQMA 5DYTA 3VR5A 1IN6A 2MYTA 1AZTA 3A32A 1RRFA 3MCZA 1JIUA 2XAAA 2VPTA 5HQJA 3L0OA 2G9VA 1KSJA 3DZ8A 3B1FA 1KTVA 1ORVA 2D4AA 2TECE 3LP6A 3PRYA 3UEOA 3V8QA 4AY3A 5L40A 2E0IA 2CKDA 2Q4DA 4EB6A 1VHLA 1MB3A 3FNGA 3O8CA 2A1TS 5E7IA 1E2FA 1KEUA 1RYEA 1KAGA 2XGSA 5TPWB 3WJ1A 4A3SA 3NHYA 5DTRA 1AQ6A 4TYWA 5IM5A 5JAIA 2VHUA 5C32A 2HWWA 4YLGA 1QP4A 4JEMA 4O1HA 5E3IA 1YZFA 1P8JA 2A9JA 1NVKA 3PVSA 2OZLA 3Q3VA 3UQYS 1NTOA 2ZUDA 4ZAXA 2AMLA 3OQMA 3C6BA 1CUDA 1QBGA 1P9OA 1VSTA 1U04A 3CE9A 1NBHA 3PFFA 4LMAA 1P4AA 4OSEA 3UJ6A 1E4OA 5ILOA 2FMTA 4Q4DA 1GYPA 3IH5A 1W87A 5M5BA 1GGVA 2I80A 1O6BA 2O8DA 1YF3A 4ZCQA 1JG4A 2E89A 1RS0A 2BISA 2I1LA 1ZU4A 3FAKA 3SE7A 4DM7A 3WNCA 5JISA 3U7QA 1G3UA 2P2NA 2BGKA 2VBCA 4AK9A 2OUKA 1R0KA 5IFKA 1WZCA 5A1TA 3M6MD 1X70A 4OHOA 2HLHA 3HBJA 1D4AA 2PWBA 2HSDA 1KU0A 3L4BC 1ABFA 3NM5A 4IXNA 4MW1A 2P2YA 4RNDB 4Z8XA 2HK9A 1TMOA 3JASA 1SVLA 4FW9A 5B53A 3HPRA 2IHTA 1IJBA 3R3SA 1XU7A 2WJHA 1DMRA 1SWVA 1XAGA 1EH5A 1V1RB 2FFJA 2JW5A 5DB4A 3PI6A 4CGYA 5KVAA 4BRZA 4WJLA 3NB0A 2PX0A 4HFNA 3H5RA 1PJ3A 2OFFA 2GQ0A 5IDXA 2WE8A 3GBSA 3P9SA 3I01M 1GXSA 2FKNA 2XKBA 5BVGB 5FTLA 4RACA 3VSAA 3BE4A 1QO7A 3ZQJA 3TRDA 4NU8X 2C31A 4ND3A 5IK2D 5COBA 4DWVA 1O6GA 1R6DA 2WYOA 3WG9A 4P7JA 2PUJA 1Y6RA 5EKSA 1U90A 4A2PA 4FWTA 3UWSA 1LBSA 1XVLA 1L0BA 3U1TA 1XTBA 4WNIA 1KS9A 2PKCA 2Y2VA 2EIHA 2ES4A 4R2KA 3IIKA 3L9XA 5IKPA 2QNBA 5ALDA 2B99A 3NGMA 3QG1A 1NUAA 1S8NA 3GN1A 5K05A 4NPHA 5FFMA 3DXFA 1IB0A 2I78A 4PPNA 3NHLA 3QPBA 1D9ZA 4OFXA 5IXYA 5EESA 3K0CC 4RV4A 1FJHA 5DW0A 3REQB 5LNK6 2HA3A 3ON5A 4OV6B 4DIDA 4MR7B 4OYLA 4FHZA 3WICA 4JYBA 3SQXA 1SHJA 1DIBA 1R8QA 2Y1LA 2EL9A 4K28A 4NOJA 4UARA 4R41A 4KJZA 3RYHB 5CW2A 1CZOA 1SVUA 1OY1A 3ZCTA 1CVRA 4CNQA 1OU0A 3DGEC 3KETA 1U2DA 2IXAA 2G0TA 3UJ8A 2HNBA 2GKOA 5JW6A 1ZDMA 2GDJA 5WRFA 1NXQA 3CLTD 4DMLA 2OPBA 3O8LA 3RABA 1H2FA 5K3FB 1QOZA 1ZZEA 2ZYWX 2VYND 3KYIB 4Y0NA 3RSHA 3TS1A 1WW8A 3I5YA 2A9OA 1UOQA 4JJEA 3QUAA 2AKYA 2D4HA 4M9RA 1CEQA 2FR1A 3VHRA 4KFTA 1P31A 5HG0A 3SYTA 2EZ8A 3JPWA 4BV8A 5JANA 4K6HA 2ZZNA 1K92A 2WSSD 1W5TA 4UFNA 5BVHB 5A03A 1A88A 1L3CA 5K4AA 4DMUB 4QDKA 1LEHA 4YRRA 1QNFA 5C5CA 1KFJB 3CB4A 1Z6PA 2QM3A 3CSUA 3NYWA 3OQIB 2PRJA 3NALA 4JVLA 3ZGVA 4ECEA 4LKOA 1Y82A 1B93A 2Z1NA 1F1BA 3RW9A 2QF7A 3WLQA 1PZXA 1NL3A 4FYHA 2GESA 2GM5A 3I9MA 4N0MA 4QOFA 2O8CB 2CLCX 4IIJF 2HT1A 1ATZA 4ZQBA 1QVAA 4A8PA 4ERNA 5FL7A 5CTAA 3OU7A 3RVMA 1QWOA 2DHEA 5EQJB 1WABA 2KMLA 1L5HA 1BVRA 3L49A 4R0VA 4F0JA 2C2KA 3P20A 1L7PA 4RPIA 3ADCA 2GZHA 4Q7LA 4QQ8A 2ZWVA 5F5LA 1G5FA 5AKLA 5EJAA 2CWWA 3TW4A 2IE8A 3OZXA 1ZW6A 2RDMA 1WLSA 3HB7A 3P9KA 1IE3A 1SKMA 1NRIA 1CK4A 3HUDA 3IRUA 3NETA 3RWMB 1JPJA 4KP7A 4TTQA 2BGJA 3KLNA 3HI6A 2IOYA 10MHA 1XA0A 3ADOA 3AF4A 4DAOA 1C2TA 5IT5A 4TT3D 5BV8A 4HNAA 5K3AA 1T5DX 1BU8A 1GPLA 4QXAA 1X7YA 3E9ZA 5CR9A 1QIGA 4XE5A 2PFSA 4S0XA 4X71A 1IZ0A 1J21A 2BHSA 3HYCA 3UOAB 2I1QA 3EIUA 5MN6A 5HK8A 3IV7A 1M2JA 3AKEA 1RZRD 1JXQA 1PKEA 1W6RA 4AJHA 4DCJA 3QVMA 3WNBA 2H1IA 1TTPB 8ATCA 5A4AA 2QLBA 5JLAA 1P45A 1QO0D 5ELMA 2N3ZA 1NGSA 2Q8PA 4KQJA 1WBDA 2BFEA 3FNHA 1C30A 1QSGA 5IM4A 4QYWA 5IAEA 2X40A 2YBDA 2XCSB 3AI7A 1YRLA 3PHJA 3AO0B 1WDLA 4OQYA 3ABSB 4MB6A 1JSRA 3SFZA 4F96A 1DX4A 1R12A 3ZOZA 5AP9A 2OGTA 4Y2PA 3HXTA 1WUTA 3QYPA 5E4JA 3N3AC 4J0IA 3EZ7A 3C24A 3QM1A 1R3UA 2VJBA 1M2GA 1WZNA 3F98A 1MAAA 2VXYA 3HUEA 3SAJA 2F1RA 4J3FA 3MGAA 5IKXA 1M2HA 5J4LA 1W34A 4P3PA 4RANA 3BN3A 3T0IA 3TBHA 1U3UA 4J0CA 3VPXA 2HXYA 3T3OA 1SQ0A 3IJ5A 2PKQP 2R1TA 1U7PA 2HCTA 2ZJZA 3R6LA 4MUEA 5ANRB 3UA3A 1E79A 2CHEA 2F48A 1VHJA 2V6JA 3OESA 1KXJA 1JKMA 2VQ6A 3JARB 1JTVA 2POCA 3T1QA 2AEFA 4RA9B 5ISMA 1XTVA 1I2ZA 3U3JA 2JDIA 2CCGA 2YRFA 3JWEA 1IUNA 3U37A 2ZU6A 4Q3CA 1JYFA 2VTBA 1AKVA 1ODKA 2ZCJA 2F3QA 1F4LA 3O38A 1M2FA 2QG4A 3FSGD 3PQ6A 4FFWA 3B8EA 4MPTA 3QXXA 4V1CB 3EFOB 3KJZA 2WD7A 5GMOA 1SXIA 1K7EB 3G88A 1BDJA 4G0XA 4KTTE 2J3DA 3B6ZA 4UBIA 4UJ3A 2F1JA 5EVCA 1ZK3A 5FPQA 4EBBA 1AKYA 1Y3CE 1UM9A 1VG0B 2A84A 2QUKA 2NXNA 4LUCA 1Y8ZA 2AK3A 3SGLA 2ZB4A 1C1XB 3RDPA 3BH0A 2I3DA 1XJWA 4G4GA 1XLTC 1Q3KA 1YR1A 2JGLA 1XEAA 1XN1A 1UXKA 3MWFA 4PIVA 2C9YA 2CCJA 1JS1X 2COKA 2X6RA 1HNZB 1GG9A 4BAGA 3S4YA 1R2QA 3BK1A 1U3DA 4FFVA 4A0HA 1NMZA 1FRVA 3TNFA 2X13A 1A2OA 3RBVA 3WV4A 1EGVB 2H07A 3QRWA 3AU8A 4GGMX 4X8MA 3K1AA 1GPBA 3ES9A 4MUFA 4QU0A 2B3TA 2QZJA 5EZQA 4IINA 3AV3A 4ZXFA 1KMNA 4F2DA 5AVXA 1J0AA 1W4LA 2XYRA 5SZIA 1JLKA 3IT3A 3LT1A 2OORA 3IOMA 1L5MA 2XUOA 5A7FA 1T0IA 1J2EA 1DMSA 1RQLA 3QVOA 1LBEA 4K0KB 1I6KA 4JU8A 3DE6X 3W5AA 3QEAZ 2NTNA 1GRVA 2JKVA 2ZYVX 4BO5A 3EC2A 3LCUA 4CEHA 4RKWA 3Q15C 3U1VA 1LK5A 2HDNB 1RQ2A 2XMDA 4F3KA 5K8CA 3CX6A 2FPXA 5IHPA 2V6BA 2QQ0A 2YNMA 2AN5A 2IOHA 1WEHA 2RGBA 2CJYA 3FDZA 3U4IA 1E77A 2CHQA 5D86A 3U48A 4XWAA 3ZJ5A 2CNNA 1VP9A 3SSOA 4EY7A 3MSCA 5AOVA 2LTAA 1P2DA 1QXSA 4MV4A 5LB4A 1NPYA 2A33A 2BOVA 1WMAA 3H3JA 2WR8A 3HKBB 1GLNA 1Z8NA 2C9DA 3K09C 3OF3A 4GWKA 1IONA 1YRAA 5DVZA 1H85A 3K8QA 2A59A 1M75A 3VVMA 3RSSA 1EUQA 4GUDA 4AO7A 5JXGA 5CB6A 4UE6A 4FZ3A 1Q20A 2YCBA 1G17A 5D5PA 3LJKA 2ET6A 2FW6A 1IHUA 5IBRA 5EQDA 4ICIA 2VATA 2Y66A 2GEDA 5ALPA 2UZIR 4D3XA 3GCGA 3FNQA 2VDRB 5JAMA 2J3QA 2JGNA 2XSZD 4Q7EA 4EI8A 3P2JA 4PR3A 4TRMA 5HRCA 1KTIA 4DZTA 1QDLB 4NZZA 2G40A 4GF5A 3I12A 3WR5A 1TF5A 2PT7A 3RIGA 4YPOA 1TVKB 5ITWA 1X7ZB 2PKRA 2D54A 4U7GA 5E95A 5FBRB 2QZ4A 3FI9A 2XGJA 1NJGA 1YRHA 1IH8A 5SY9A 3IHLA 4YT4A 2ZRCA 2GJ9A 3GYBA 4ZXPA 5P8WA 4C29A 2CXNA 5A4MS 1FBNA 4IMJB 2PQ0A 3THSA 4EJ2A 2JFWA 2P7IA 4JR2A 2GXAA 3PGLA 1GOTA 1N8TA 1L5SA 3C4VA 4UPDA 4DLKA 3DW1X 3F71A 3IBSA 4PGHA 3MG9A 4EFMA 2SECE 1CTQA 3IAM6 2DECA 7GPBA 4BLTA 1FFCA 4EW1A 4B8WA 3OQ1A 4DG8A 1Y3FE 3NEPX 2D7DA 1RWKA 2UZ1B 1UXHA 2HU7A 4C2BA 3FWZA 2EATA 2D3WA 4WN3A 3E1SA 4LJ4A 5I6DA 2XQFA 1EFPA 2IF0A 4PX9A 1W47A 1B3RA 2VJMA 3UT5B 4US0R 4O2AA 5IVDA 2RSLA 3OJCA 4I4TF 5JZ9A 4R8RA 1D03A 4TRJA 4R1LA 3RK0A 2MSDB 3IBFA 3M70A 4IQGA 2A0YA 4IGKA 4QUHA 3FCCA 3UG6A 2A1TR 2XZDA 2A5JA 4RLHA 5CK4A 1J8QA 4GRIA 1D0VA 3GJ8A 2R8RA 3B36A 4UE2A 4R0MA 2FVXA 1R0ZA 1HZJA 3E15A 5D3ZA 5EKXA 1VL2A 4Z7QB 3EQ2A 4EGQA 1OX4B 1BKYA 1CFZA 4DC0A 1SFRA 2F59A 3I42A 4G8BA 2CK3A 3T4XA 1W52X 1UJMA 9LDTA 5JHHB 4G4JA 4KUGA 3WKAA 1IEQA 1P3Y1 4MRRA 3CEJA 4OI1A 3ZDZB 4MVYA 1AQYA 5BNFA 3CRNA 3CH7A 3BC1A 1RTKA 2ZJFA 3A3NA 5ER6A 5CITA 1EXWA 3RRXA 3LLCA 5CPFA 2OT3B 5FOTA 2FZEA 3GP8A 1K2VN 3F3KA 1J8FA 1YFJA 2ASEA 3Q7IA 3IPYA 3UHAA 3CUSA 4PAWA 5EJ4A 5BVHA 5BOVA 3LKBA 1BHSA 1OBOA 2YV5A 1CDOA 3UUEA 4H27A 1S2IA 2XDAA 3L7YA 2ZB2A 3RSCA 5IJAA 4E33A 5ILGA 3H04A 3SX0A 1FFSA 2I6SA 2WIAA 3BCHA 2MSNA 4RF5A 3G8BA 4IDGA 3CUUA 3G17A 2PU7A 4UHHA 3V3KA 4YIHA 3ESCA 4PLYA 1J56A 2CFIA 2MHCA 2YXBA 2XQIA 4WFQA 2ZJYA 4AZ0B 1XRSB 3REGA 2Y1EA 2AG0A 5C4MA 5B6JA 2VSOA 3C1TA 2MDTA 3BRWD 1OKKA 3FIUA 2FSGA 3L8DA 4KGZA 1Z4KA 1DGQA 5HNKA 4DMMA 5ALZA 5IXSA 2Z9BA 3ZLVA 4J2HA 4GYKA 1Q50A 4WMLA 3VR5D 2HHHB 2JLSA 4RIIA 1SD1A 2PO5A 2IXTA 4JJKA 3TMKA 1Q0LA 3N9IA 4MB0A 2Q5CA 2VF5X 1E3QA 4NKRA 1N57A 1R6TA 3L7DA 1ISSA 1VGVA 1E2EA 4LJSA 1Q3TA 1U8XX 1Y8AA 2QX4A 3RYTC 3LUBA 1FF9A 2ZS8A 5LQJA 5BSMA 4DLXA 1UBJS 2BMFA 2G5CA 3D3NA 3G02A 4NMLA 4M6WB 4NFSA 4C0HA 3CURA 4KXXA 5BSRA 4YV7A 1NF8A 4ZV9A 1KAOA 3KYDA 1HEIA 2CFSA 3IKVA 1J5EB 1ZM2A 1IJFA 1MORA 2GK6A 4CQLA 1WBBA 3WYAA 1L4BA 3P2YA 3M4YA 1ZUNB 2YJ4A 3UQZA 4JMPA 5BRJA 1DVRA 2CMFA 2W11A 3B12A 4G1BA 5EAIA 3K4QA 4LHEA 4QTYA 2QP9X 1A96A 2R8YA 3LKZA 5IJXA 2IOQA 4FQ5A 3W2EA 2A0FA 4F5DA 4MOWA 4TOIA 3CVYA 1EG7A 1I4LD 1Z0AA 3CRMA 3HG7A 1DBVO 3DXXA 2GNOA 1Y1RA 4MVJI 3LHDA 4Q47A 3M3DA 4B4KA 3D0RA 1X3LA 3N8NA 3PFKA 1W4AA 2BY4A 1UDWA 2JD1A 5K5EA 5LP6B 3VHXB 1TCAA 4X6UA 1CUUA 4IJ5A 3CRW1 3N53A 4BLUA 1MB0A 4BU0A 1I01A 3HMQA 3PD0A 1SC9A 2IPOA 2ZWAA 4YACA 1J1ZA 1KZ6A 1TYZA 3I04A 5JH7F 4RVCA 2WTXA 3A58B 1C9YA 1SMKA 4C9BA 2P35A 1R6UA 4JT4A 4Y67A 1E3WA 2GRUA 3GAMA 3OOWA 1DPFA 5AVQA 5DI3A 3CKMA 1DRVA 1OFTA 5CDSA 1V8BA 2DBQA 4D42A 4M88A 2C1XA 5IARA 1TW3A 5E1BA 2NYAA 3GFVA 4DR6B 2PDAA 1P5HA 2PLFA 1RIFA 2C2ZA 3IULA 3QKSB 5EP3A 1LF5A 4CFSA 4CMIB 4NCBA 2RFLA 4EH1A 5FBZA 1DE0A 2C0CA 3ZZTA 2B1JA 2GWRA 3AR5A 4GMKA 5EXSA 5AESA 5I7SA 2D2VA 4OB6A 5JQGA 1GL7A 1Q74A 1UT8A 2BEWB 1ZD2P 3AW8A 3PQ7A 4IKEA 2WJ3A 4HYQA 1RNLA 4AW9A 1V8FA 3T12A 3WYBA 2PFGA 2XA1A 5F4BA 2XBLA 3MJSA 3Q7PA 4TMWA 1RFLA 3ABQB 3E84A 5G41A 3PPYA 4QULA 1KYVA 3S70A 3BZUA 4P54A 4LBZA 4LYFA 1GZUA 2E87A 2R8EA 3A14A 3RFFA 1VOTA 3TBFA 1ZY2A 3KEGA 3VKWA 2C78A 2FSPA 2P1DA 3ZDCA 1M83A 1N3BA 1Z6QA 2Q6LA 3PDJA 1FDOA 2ZT7A 1O8BA 3JQGA 3G2KA 3JARA 1N9GB 3CKKA 4IQFA 4BNDB 3JYPA 4FFBA 1UDRA 3V8PA 3TCXB 4EB8A 3K1AB 5AI5A 4RCYA 4UTOA 4WX2B 2PMDA 4FZVA 4L16A 3RRMA 2WB2A 1Y4AE 1YBAA 3QPDA 1GA1A 3PXUA 4JZKA 4LY6A 1J09A 1SG9A 3SDBA 1X2EA 4DPMA 5FR1A 2FFQA 1JDPA 2P1RA 2ZRJA 5IT0A 2Z2IA 4NNJA 3BGDA 3NAGA 5DNYB 3RS2A 4JC4A 3WP1B 1KZ9A 4LRSB 4JWTA 1LNZA 4WA8A 1ZUIA 2J30A 4LJ9A 1NYQA 1EX9A 4QIHA 3NDRA 1T5SA 1N1GA 4P86A 3VR0A 2D1FA 5D8DA 5J2TF 1CF4A 1IN1A 4ZP1A 4J0JA 2OHGA 3VTAA 1WUIS 2NSYA 2Q4TA 4HWOA 1EBUA 2OXCA 2QUHA 3GFTA 3NBZC 3CNOA 3D0QA 1T34A 4GGPA 4UUAA 5FTJA 4AUNA 1OXVA 1P77A 3OKCA 5IN4A 4BVHA 3IKJA 2VUIB 3D1JA 3KJHA 5B1YA 5C2JB 4K86A 3K0SA 1Y1KE 3SR4A 1OXUA 4R1OA 5JMWA 2B7BA 5A4JA 4LA4A 5AO9A 2AEEA 4IH1A 2AB0A 2NXEA 5A3JA 3T5DA 5BN3A 2E5WA 4U8HA 3WJAA 2WU8A 1QGUB 3RUCA 1HDIA 4H16A 5ITSA 3PGVA 3I01A 4R9NA 3DQZA 3M9WA 2B4KA 1TYAE 2OBNA 5U9CA 3L3BA 5EJ8A 1JA9A 1VJ0A 4B6EA 1LSJA 3DV9A 1I6LA 4YMSA 2BRUC 5EWLA 2GPNA 1BNCA 2F43B 1X7XA 4GZ5A 1NF3A 4M60A 4K26A 2IUUA 1YZGA 4UM9B 2OK8A 2O07A 3PLAE 2I2FA 3TVDA 4IDQA 4XIFA 3I5AA 3LT5A 5JRDS 5IH3A 1ZH0A 2WIGA 3FRHA 4OBBA 1DAMA 2DM6A 4W4TA 3DOJA 1GPH1 1L7RA 4TX1A 1OH5A 1JG1A 2PGDA 2WJGA 3ZJUA 1RJ9A 3OECA 4P5PA 3AR9A 5C5DA 1JEYB 4FN5A 3AIOA 3QBEA 4QPZA 3UENA 3WYGA 1S8OA 1NQTA 1W4ZA 4JC8A 1VZ2A 2I4RA 1K68A 4D8UA 5KJ1A 2IXDA 1QJ4A 2R6FA 3MS7A 3DDWA 3ZU3A 2XLCA 1JLLB 4O59O 1UOOA 1FBTA 2I67A 5CPBA 4A6EA 1CQZA 1ND6A 1JV2B 3K2BA 2ODTX 1CY2A 1ZMBA 1YVRA 3GNSA 4Q6BA 3PZRA 1M33A 4OMFG 2QEQA 4S1VA 5KNDH 2WKSA 4GXRA 1D2GA 3FTEA 1F6BA 1TVKA 3EE6A 5EJGA 1KI1A 2O3QA 1JKJA 2BZGA 4M0PA 3WXMA 5I4BA 2P9JA 1PGQA 1C41A 1M9NA 3FYCA 3K6KA 4J7XA 3V1LA 4E46A 1DJPA 2Y1XA 3JVVA 2YY5A 1R5BA 2WSYB 4ZQHA 1AV6A 2ZRDA 2R96A 5TY0A 2WUGA 1ZOLA 2OCBA 1DTWB 3ZD6A 1RAIA 4N0QA 6NULA 1L5YA 2PGIA 5C1DA 1IBKB 4Q66C 3G8CA 1GZ4A 3RT9A 1CS4C 3ESXA 2PR7A 4PZ9A 4YT8A 3D31A 1NONA 5JBNA 4AG3A 2JI8A 1HORA 1AF4A 2OHVA 1NMYA 1N2IA 1PWHA 3HVIA 1T5HX 3KOUA 2FDXA 1ODJA 4WADA 3ZN2A 2Z9DA 3C14C 3T9BA 1Z7YA 2NTVA 4L0CA 3KKEA 1E2DA 3RYCA 3ANTA 2YHAA 1E6MA 1MTOA 2FHPA 3PXCX 5CYPA 4URXR 4X8HA 3KU4A 1DSSG 5CBKA 2BPOA 1YB6A 2C77A 4EKYA 4OHUA 1ZCBA 3AOGA 5JG7A 3QFHA 3NH6A 3MINB 3QEKA 3STWA 5CBPB 5FX2A 1TLTA 5MDHA 2ZJ0A 4L0MA 4UJ5A 4AUMA 5CAEA 3UJAA 2DPGA 4H4CA 1N75A 1Z28A 2IEDA 3VPGA 3VQTA 3OJOA 1E9DA 3N8DA 3TR0A 2HMUA 1Y4ZA 1GPYA 2AC4A 2C2MA 1DEOA 4UUPA 1BEUB 2PXHA 3LQ1A 3T9FA 1JTEA 3VV2A 3ZUGA 1ZD8A 3BXXA 3OE7A 1UKBA 4OSOA 4KGXA 2YY7A 4O4JF 3U7RA 4CIBA 4BE7B 1A4XA 4JBIA 4FDAA 1X86B 2RAVA 5AVJA 1JQ5A 3SC2A 2ORED 3W5SA 3FJ1A 1EJ6A 1V9LA 2WFMA 6GPBA 1JA1A 4PG7A 3VR4H 2ODEA 1Y7IA 1E1QA 4FEYA 4GHWA 4ZU6X 1KQNA 2Y0DA 3SXUB 4B5LA 4EO9A 3INGA 3NIDB 3HCFA 3NUZA 3L77A 4H0FA 3IRVA 2DTEA 4REOA 3FH0A 1X80A 3ZY3A 4DWOA 4DCGA 1YRWA 1HF3A 4XLLA 3BSSA 1JQEA 3WBFA 1UWLA 3HBNA 3KYDB 3F0TA 2VBGA 3FYHA 4NF2A 3NHWA 3VH2A 1S2GA 2XCLA 3MJCA 2V54A 2X15A 3LW7A 4KLNA 2HJRA 5DDIP 4US1R 3TWOA 4CKCB 5J63A 4Z1MD 5E1OA 4ZGWA 1AB5A 1M34E 4ZO7A 1E7RA 2ZE6A 3CF0A 4Q34A 2W6CX 1UWVA 2Q62A 5FWDA 5TB5A 2DUMA 3UKJA 5IANA 2X9VA 3N7AA 1YJCA 4UTXA 1EZZA 2QX7A 2X4DA 3GRRA 5JH7A 4X95A 4A6DA 3P2EA 1OH7A 1NHGA 2PJRA 2PXAA 3B9BA 4MRMB 3PE4A 4YCCA 2Z8YA 1FLDA 1AY0A 2XD9A 3F74A 3PNVA 4GUAA 4G5QA 4I1RA 1Z22A 5DNEA 3R77A 1DIGA 1QONA 1KARA 3FVVA 3GFPA 3UWPA 3INNA 4U7PB 1IG3A 5BORA 3N39C 1RRKA 3OZRA 3AXTA 1BEEA 2O2DA 4N18A 1DAKA 4LYHA 1QYVA 2GUWA 1T35A 3I28A 1WX1A 1ESDA 1Q0TA 1JHXA 1LI7A 5J4VA 5CEJA 3UB2A 1A9QA 1I14A 1V5EA 3SE0A 3WOVA 4E22A 4ZZ2A 2PL9A 3E9NA 5H59A 2VQDA 3WA7A 1F8XA 1FRNA 1MB9A 3IPRA 4LV5B 3PQ2A 5HRAA 3C87A 3RAFC 3EASA 3OY7A 3OF5A 4Y30A 2CDRA 1PF7E 5C9ZA 4GX2A 1P6XA 3CUVA 5LNK1 1GO2A 4JA0A 1FNCA 4TVKA 3B6EA 2W2LD 1CIVA 2VZLA 3AF2A 3AUKA 5J23A 3GA5A 1ZRHA 3UUGA 1IY0A 1XZHA 2W6JD 2C2WA 2Z5FA 2VSFA 2WF7A 2FJUA 4S2UA 2RBEA 4GKJB 4R1PA 2JGDB 2FPWA 1EESA 4ZOAA 1E1CA 3NJ8A 5LN1A 2FN3A 1LTKA 2PVCA 4OXQA 4A03A 1T9DA 4W8OA 5ALTA 2OCPA 5DYWA 3VZCA 3HZRA 5HSGA 3CRVA 5LZ2A 2OM2A 1BWQA 2ZI3A 3LK6A 3QKTA 1H1DA 1SBTA 1GRCA 1Q22A 2GFHA 4H17A 3NXKA 1MDBA 3GU3A 4A5OA 1HNXB 3ZJTA 3D8HA 3WMRA 2JLVA 3TAHA 1DUSA 3E7WA 3DMGA 1U5AA 5E3JA 3DO5A 2PQ2A 3U0VA 5JR3A 5KJEA 5J40A 4C6RA 2QG9A 1JEQB 4Z7NB 3KOXA 4UM7A 3JCZA 2OFOA 1FP4A 4LRTB 1U5BA 4YMHA 4MJLA 4EFLA 1PIWA 2OYCA 3MQ4A 1A71A 3D7KA 4PU0A 4TTSA 1ISHA 2Y2UA 4K81B 4LBWA 4GBGA 2QRMA 5KX5A 5K4GA 1E0AA 1ZPDA 3KQSA 1O6CA 2ZIEA 2H52A 1SXJB 2YVQA 3IB6A 3AUSA 3RIMA 3N8IA 1M1YB 4PYRA 2ATVA 3GVXA 4RD0A 4B7UA 4QRHA 3VPAA 1I7LA 2EW1A 3S1AA 1XHFA 3AG5A 2A3NA 3RC1A 4XQ9A 4NVRA 4MVJE 2Q9AA 1SG6A 1TKAA 2BEUA 4GOND 4XJSA 1KSHA 2FWPA 3BDVA 2VA9A 2BF4A 4IRUB 4XGIA 3W6NA 4D96A 2ZITA 1IQ0A 3EGDB 2R4TA 3GEHA 3LL7A 3V2GA 4B2LA 4BUJA 1Q1QA 1F2UA 3THWA 3NOXA 3U3XA 2GEVA 3IP1A 3LHKA 4TGLA 1K9VF 4Q9LA 3CCCA 2PVPA 2VHQA 3FZEA 3QXCA 1CJVC 1M6WA 3RVJA 1GEEA 1KORA 1Q44A 4MR8A 2C00A 1KO8A 1LGYA 3N2KB 2A9VA 3EXFA 1V8OA 4WW0A 3C48A 5CLQA 4KPFC 4BQOA 1N7IA 1WDMA 2B61A 4NZPA 1CUYA 4W5NA 4CLOA 3OO0A 4G0WA 4BMOB 1J20A 3UAZA 3JQ8B 5CFPA 1YK0A 1YS7A 5FOSA 3QELA 1A1SA 3JAKB 3UA4A 5ESXA 4KHPB 4ENQA 5DTIA 3WADA 3R9XB 3R44A 4L74A 1FFXB 1M5UA 4KQXA 1KRWA 4XVUA 3TUJC 1WNTA 2C20A 2X76A 5TS2A 4BMZA 5LKRA 3H2SA 1N7GA 1VL5A 3PL1A 2HPZA 1NSYA 3MB8A 3FPKA 4V0OA 1VI2A 4HRVA 2CHGA 2JAXA 3G2PA 3UGQA 1YOBA 3I9JA 5E4FA 2EKLA 3DWEX 3HJBA 1XNHA 1YJ8A 2C4WA 2O7QA 2IYFA 1DX6A 5D3MB 9LDBA 4KITB 2MR6A 3OEED 1FSFA 2FU5C 2Q27A 4J1TC 3UTDA 1VDMA 1ZNYA 2QG6A 4BVGA 1IWOA 4EVIA 5KTPA 4FGLA 4B17A 1RWXA 4KB5A 4BRUA 2PE5A 4D9FA 1EUDB 2KQUA 2JVJA 1N2HA 3LAWA 4NCXA 4NV1A 1P60A 2BE7A 3UPUA 2RD2A 2RONA 4HQFA 3HO6A 3BMCB 2PT5A 1QDUA 3PNKA 3V6MA 4AZSA 2JCSA 4D4JA 2BI8A 3R8CA 2IHJA 4QEKA 2ZW9A 1H0RA 3VR1A 5EE3A 4RMHA 1MABB 1QC5B 2CBZA 2ZJ3A 2RHBA 2VWQA 3QZUA 2BM1A 4CKYA 5G0TA 1I13A 3BEDA 1Q91A 4H7JA 3AVOA 4REMA 2JCVA 4A6PA 5TC4A 3A6JA 4IJUA 4E13A 2QL6A 3QF4A 1ZNZA 3FW1A 4BJHB 7AT1A 5H81A 5ALJA 3EQ8A 2QB5A 1SUEA 3CNQS 4MA5A 4ND2A 2G04A 1H23A 3LRTA 3NWPA 3BXPA 3TNYA 3TG2A 2IS2A 3QLEA 2X2FA 1HSOA 3AF0A 3BMQB 1Q0RA 2AVNA 4WOPA 1V9SA 4LF8B 1C7RA 2IYPA 3PIDA 3FHCB 1CJKC 2H6EA 3Q0EA 1IHPA 3VJMA 4J07A 4EPRA 4F6RA 1E92A 3ZI7A 2C3OA 3PNQA 4CYMA 4EENA 2FV8A 1U63A 1JAZA 2IBSA 5DHSA 5E6SA 5A3RA 1RRVA 3DMTC 3ANNA 4Q3LA 4HLNA 1MQ9A 2PIAA 1M6NA 1PX2A 4OI4A 3KKQA 1GD1O 4B84A 4R1MA 4XLZA 2NZ8A 4NZMA 2M6LA 2V9ZA 2WG0A 1AMUA 1O0CA 1GTG1 3KHKA 4UULA 1TTTA 3AP1A 4TV8B 4DLBA 3MT9A 1HR0B 1KYQA 3HXQA 4YRFA 4IYRA 1BH2A 1VGQA 4BIIA 5F2NA 5JY6A 1QG6A 3EB9A 1G5RA 5IDVA 1Q11A 1NKTA 4L4ZA 2Y6UA 4KDCA 4QGBA 1LJLA 3U3DA 3X1JA 2O2SA 1CUVA 4EAAA 4E94A 3BMNA 4RD2A 1P3JA 4ZVMA 5AI4A 2ZRHA 1J2UA 1X87A 1I10A 1L7QA 2VP2A 4XIJA 1XFDA 1R4ZA 1MO6A 3KJNA 2PUGA 2GZMA 3RROA 2JLWA 1LC3A 3NTVA 1ZRNA 5AM4A 3UJCA 4BXOB 4EEXA 2GNAA 3OX2A 3QG5A 5DKFA 4QYXA 5HKLA 1CDDA 1TC2A 1IRIA 1LUAA 1YUBA 4BVBA 3RS7A 2ZI9A 5FWYB 1XO1A 3B1WA 2ILTA 1EP3B 4C0KA 1RVDA 2A7QA 1XCPA 4V03A 1I3KA 2DFDA 2NZXA 5BV7A 1EVJA 2A4KA 3D2CA 1FL9A 5CAEB 2XT9A 2YFQA 4RFVA 4HXYA 2ZXEA 1BCRB 5FJIA 3VXKA 4B9AA 3HJHA 1WMDA 2PUEA 1PJBA 2BR4A 4JL6A 3TTWA 4OXKA 3IAAA 2CZGA 5AKHA 3V46A 4X94A 1MQAA 1XVVA 3B3FA 4A73A 3X44A 1WETA 1WUHS 1V2HE 4JJGA 1KYIA 1CRLA 4MRMA 2FW1A 3NP9A 5D6OA 3ZWDA 3RC2A 4KPEC 1PSWA 2BZ1A 4O4LB 4E70A 4LCBA 3D59A 3AP3A 4U7FA 4KR3A 2P2CA 2QSZA 1J2TA 1G1MA 4QEDA 4AF8A 2J07A 4XEHA 3KVVA 5FWNA 4HZGA 2Z4SA 4J76A 1E32A 3EQ9A 4KVAA 1U0FA 3PUIA 3VKGA 4LY0A 2J0VA 1KRHA 2CJXA 1O54A 4OQ4A 3R9KA 4BS9A 1KNQA 1GKIA 3OICA 3G5UA 2HNAA 1I3MA 3EHDA 4GRAA 3M6IA 4EECA 3HCWA 4WK0B 4L7QA 4NXMB 3ZHRA 1MTZA 2EBFX 3TQHA 3NOVA 4R54A 1EFUA 3EVBA 3GMTA 4LIPD 3IUEA 3PQ8A 4H31A 4RTQA 1E4EB 4ESOA 3PXXA 5IJ9A 3ZQ4A 3BGOS 2I1VB 1II0A 3Q8MA 1PUIA 2NO4A 2Q3HA 3G7SA 1ZAKA 2Q0QA 2MOKA 1Z5ZA 3NEAA 3OZUA 4FYJA 3RK1A 2X58A 4M1EA 1TNDA 1NMEA 5TF0A 3L9WA 1NJ5A 1DAHA 2AN3A 2H0AA 5JZBA 4MWZA 2R7MA 5LBTA 3AJ9A 3T9CA 3TEJA 4DLSA 4LJYA 3R7NA 5HS4A 2QA5A 3K53A 4LFAB 4GOXA 4RXTA 1UDXA 1ZJ6A 3D7NA 1IIBA 2Q2NA 3HWWA 3JALB 4DLYA 3TQRA 2J4CA 3TDMA 3DOHA 2LZ0A 4HGPA 4ND8B 1DFHA 3B9PA 1SHKA 3LUHA 4TL7A 1DQYA 2CFOA 2ZVJA 2MSEB 3S2ZA 1QAQA 1G64A 3L7CA 3KAKA 1N1MA 1ZGCA 2ZPAA 3RUAA 3ZHCA 4FQ7A 4DFDA 3IEKA 3IQZA 3KOMA 1GSIA 3KVNA 1YI1A 4U7HA 3GMSA 4UCWA 1ZG3A 1CUCA 1OBHA 1BQ3A 4UBNA 3CLTC 2O2ZA 2QV7A 1NMSA 4AX4A 5JDCA 2BGLA 1SGWA 1MJFA 3DL4A 4WOCA 1RQGA 3R7WB 2GRAA 4TXLA 1V41E 4MJ7A 1LLQA 5AXAA 3COJA 1VM6A 1ZBQA 2WUFA 1CR4A 3DHNA 3OFNA 1PN3A 1OLXB 2LCIA 5F2KA 3B5JA 3EUAA 3I6QA 5FAXA 3D4LA 2BMEA 2QRLA 3LYAA 4CTOA 5F9FA 1G63A 1V1RA 1NRWA 2HRRA 2QROA 5CHYA 4CM5A 4KRXA 2PFKA 3AFNA 3QU7A 3MIIA 2WMYA 4RVSA 1P0CA 2Q1UA 3VDRA 3G2LA 5GIOE 4C87A 2RAPA 4JVOA 4LKRA 3N2GA 3S8YA 2J0QA 1KDPA 2I76A 4XZ3A 5JVDF 1HK7A 4HNUA 4JENA 4V2UA 5GONF 1UBHS 2YW2A 4F12A 1WCWA 2VPPA 4FT4A 2AWOA 1E2JA 1QORA 4EY5A 1TD9A 4HB0A 2GBLA 4H3VA 4N3BA 4OLHA 1ULTA 1XLVA 1R1DA 5K2OA 2Q9CA 3ZD9A 3CRRA 2GFIA 1YR7A 1JX6A 1N2XA 2H5JA 2W6MA 4GC9A 4GVPA 1MN6A 3UAXA 1ISRA 4BKQA 2B69A 4HYTA 4X91A 1SWWA 2ACVA 1ECLA 1YC5A 2V7QD 1WHSB 2C94A 2IEBA 2ORYA 4HLQB 5AK4A 1ID8A 1EZ4A 1XZMA 4F3RA 3N8KA 4L9WA 1TGVA 2CB9A 2YXPX 2X19A 3GZJA 3PDWA 3QLUC 4LVNA 1BJTA 2FUKA 1RYZA 1PSDA 5DN6A 1GKLA 3EIOA 2O8BA 2QW1A 3FCSB 3NP7A 4O2AB 1GGKA 1E0JA 2W6PA 3BRCA 4PLGA 5T3UA 5F2EA 2I3ZA 1KI9A 1GCIA 5AI0A 1BDHA 4ZVQA 2XWSA 4I6JA 3HB9A 1U8AA 1G291 3JQGB 1O97D 1RKUA 3U44A 4EPVA 1A7JA 1I1OA 5LCXA 2E18A 4KO1S 4NG5A 2ERXA 2VJLA 5B58C 1AURA 2XTNA 4ZIRB 5J4KA 2H4ZA 2VDPB 2BFEB 1GSOA 2TMKA 2B2NA 1E89A 5K7SA 3HA5A 3UMCA 3GLFB 1W2GA 3IE2A 3GH3A 2XOKA 4LF6B 3OTIA 5DASA 5B7PA 4G65A 3I2FA 2YTZA 5G0UA 4IFEA 1XZLA 3P27A 5DBOA 4AJ4A 5I4IA 5CD1A 2WC1A 5G4KA 4ADSG 2HSWA 5DFAA 5C34B 2FF7A 2J1LA 1YZKA 4HEQA 4LJ5A 1U2TA 4Q02A 5LMUB 1PJCA 3M6UA 3QVUA 1QFSA 1PJZA 4MUAA 4NFYA 3MTAA 4AS3A 3LQ2A 2D2XA 3GBPA 4V38A 5LKAA 4KUEA 4MQFA 3RREA 1ZD4A 2Q1XA 3ENQA 1GDHA 4Q6WA 2E3JA 5AH0A 3DTVD 3GPIA 1NPTO 3DFZA 1VRCA 1TM2A 3EZXA 4NJMA 1CG6A 1ZN8A 3NI2A 4UD6A 5CNIA 2FWRA 1JAYA 4S04A 2H00A 3C3DA 1DBIA 1UK9A 1T2CA 2OHJA 3EDRA 4FOSA 3GJYA 4KV7A 4PLZA 4RY2A 2VTBB 2B3DA 2J0UA 3FLMA 4XQCA 3T6KA 4IRXA 4CG3A 2FPUA 4OJTA 3M6VA 2PKYX 2VP4A 3H6GA 1MV5A 1YL6A 3HN2A 4FHGA 3UAYA 3J80A 4RENA 3ZCPA 4JITA 2V65A 1DBWA 1QM5A 4FHFA 4FT2A 1AE1A 1F7UA 3K0BA 2QSUA 2GAFA 3KXLA 4AP6A 4JQSA 3AKZA 4RPCA 4OUDB 1UQUA 2WQ7A 2FWNA 1FSSA 1L5RA 4GBED 2XWBF 3OM8A 3ZDQA 1T91A 3IR5A 4G9GA 4U63A 3RRYA 2HLDD 4KBFA 1SKUA 5JD4A 1A9SA 3DLIA 5EP1A 4B40A 1HLPA 2RC5A 2JH3A 2WIDA 3QBVA 4G5OA 3W2GA 1SBZA 1NQUA 1SU4A 2IH5A 5LZ8A 5CFLA 3UHJA 4LYDA 1R8JA 4MUHA 1KAQA 2D8MA 3GWGA 4DR1B 2HQBA 3G0BA 1RE1A 3IP7A 3S2IA 4RDCA 4GOOD 4QL3A 1FUKA 4IUDS 5IVHA 1YS4A 2CN1A 4GW3A 3RIHA 2O0JA 3KTFA 1FLVA 2IZZA 1Z82A 4B6SA 1TCVA 2QN3A 1XVUA 2C0QA 2FP4A 1Z6ZA 3ZE0B 3HY4A 4LYYA 2D5CA 2JHAA 4FEAA 4XSGA 4EB0A 4F3TA 5EOVA 4ZV4A 2PL3A 4X84A 3TTUA 3WIBA 2R7NA 3FB1A 1SXJE 4HDRA 4EG0A 1G6Q1 1P4HA 1E7WA 3VNUA 3L1VA 4PLTA 5DK6A 2Y77A 3O74A 2O14A 2V9PA 3KPWA 5J2UF 4H7DA 4WNAA 3OEHA 5AK5A 4CFZA 1IATA 2FGJA 3F7NA 3ZH2A 3F5DA 1IK4A 3A70A 1UMCB 2HBRA 5JCOC 4A0SA 4PG6A 1MGPA 1EVZA 2P65A 2GPAA 2O7SA 3W7BA 4TSKA 3HSYA 4O63O 5FO0A 1ZN9A 4BO9A 1C8VB 3TX2A 1SQ5A 2EJTA 3CPEA 4M1OA 1QK4A 1Y0BA 2OGWA 3P52A 4JHXA 2XIQA 4JC5A 5HF6A 3U7EB 2WUDA 3L7BA 1NE2A 1WE2A 1FNBA 1KEKA 1QQ6A 3ZE6A 5CM8B 1XZCA 3VI3B 5KX5B 5DT2A 1YS9A 1ND5A 4JJFA 4BP8A 1SO8A 3HXMA 1FYWA 1IEWA 3C6YA 3HV0A 1GKKA 3MK31 4GC5A 4OI2A 1RYBA 3EYWA 3KB6A 3WDLA 2YFHA 4CUZA 1GQOA 2AJTA 3HGQA 3JSAA 4MJXA 2FOIA 1EE2A 1YMVA 4A8HA 3BRSA 1NNEA 1D6JA 3NFYA 1WOYA 3F7OA 3MT8A 4RU1A 2XHEA 1RWVA 3LM8A 2ZJBA 2RH5A 1XPJA 4FXPA 4NYIQ 3UWMA 4UZFA 1U0BB 3D1VA 5HHTA 1UK6A 2PMBA 3DAPA 1WVIA 4Q9IA 1EYZA 5HUJA 3QMVA 5HZMA 1PWXA 3RS3A 4NMMA 3GZ4A 2P77A 3LIIA 3PB3A 1T36B 1YHYA 1N1DA 2P6MA 1C81A 1OOEA 1WSWA 3F5FA 4CU5A 4B43A 1EVLA 3RTDA 1BWRA 4FFNA 3DBIA 4HC4A 1MOQA 4G26A 2UYYA 2DX7A 3KEOA 3PR3A 5C1PA 4LX0A 4YDQA 5DLPA 2JLXA 1HE8B 4NARA 4P08A 4F6LA 4GQIA 3UOGA 3MLEA 3C3AA 3H8VA 4EPXA 1GPDG 3KPUA 3BSFA 1ENZA 2Z98A 1RC1A 3HL4A 2SKCA 4IIYA 4ZT4A 3DTVA 3JQDA 4DN6A 1JVBA 4PYOA 3SZMA 4RZXA 1F0PA 1HE1C 3DEHA 2IRWA 5JAOA 2BGMA 2CWDA 3COYA 4MV5A 2BGUA 3CZRA 3RKUA 3HLKA 4C76A 5G3ZA 1SCAA 3AC0A 1YMUA 5A0VA 2ZIUB 5JNWA 1U0JA 2H1WA 4FI3C 5FPPA 2MT9A 2ZJ1A 2YXNA 3ACDA 3D0OA 1DEHA 2LR0A 3O2QB 2W0SA 5ALFA 1EB9A 3FNBA 1NOIA 2DFTA 3DZIA 4TXNA 4Z9FA 1PFUA 5DLDA 5DP1A 1F1JA 4OLBA 1MFPA 3AL0C 1QVRA 2BGRA 3EF0A 4D80A 2I4IA 3SVZA 1E79D 3UBMA 2GYYA 1KKLA 1L7OA 2FKAA 4X62B 4RMNA 4PZYA 1W44A 3B5EA 5DHAA 1WXWA 1G6KA 4A1FA 2VZ9A 3EWIA 1L8LA 2JLRA 5J2TB 3D02A 1VPWA 2PKQO 2J4FA 4YI5A 5LYJA 4TTTS 4DMFA 4DEYA 5ALRA 1JKFA 2EBWA 4MV1A 3GGDA 4DWWA 1ODCA 4GE3A 4WA7A 4KN6A 4IUBS 3KFLA 4JLPA 1OLSA 2GKGA 1BQEA 2VR1A 3PV0A 2YICA 4J9VA 5GGYA 2IWHA 1W30A 2XTMA 1P73A 3I1JA 4DJFC 3ZCRA 1YTLA 2DKFA 1VE9A 1VMEA 3BS4A 2F8MA 1XDBA 1RDFA 1PYOA 1GZ7A 1NU8A 2NXCA 1DB3A 3SS7X 1NQXA 3NTQA 5B55A 1KMCA 2GX6A 5KOHB 2FETA 1I6MA 2CY0A 3RC3A 1ITZA 2FXVA 4RKQA 3BF7A 1PNTA 1WD7A 3OBBA 4KOEC 5BW5A 4P5EA 3DMTA 3VU9A 4INJA 3NBYC 2KJQA 4RM2A 2P27A 1J0DA 4HQNA 3IQDB 5F77A 5FQNA 1AXRA 1T8YA 3OA2A 2ODNA 1ACLA 3GT7A 2EV9A 4YH1A 4IMRA 1PK9A 3DJFA 3HWRA 2GTPA 2PXCA 1OI7A 4MA0A 3GPBA 3TB4A 1F20A 3UT5A 1OGJA 1H0HA 1EVEA 2ZYUX 2DJ5A 5FJJA 1DFIA 2HW8A 1W581 1I7SB 3U5ZB 2ZIZA 5BRNA 1BE0A 1DWQA 4XRGA 1GQ2A 1GA6A 1F2TA 5JD5A 1Z4OA 3R09A 4PWZA 3GQBA 3OIDA 5HFNA 2W8BA 3VR5H 1U9IC 3B7WA 3DQPA 3N7UA 3EIQA 4IH4A 1DDIA 3GH1A 3P0HA 1RYFA 4W82A 5M29A 3I32A 4K46A 4M0UA 1OREA 5P21A 4X1KA 1A3CA 1DG9A 1U0LA 3GI1A 1KPIA 1QCCA 4I7EA 5BSTA 3TTXA 5L7TA 4Y7DA 3EMVA 1DXQA 3FYUA 2VJCA 3OU6A 1T0UA 4RGYA 1PK7A 2RI1A 1M10A 1NNI1 2HM7A 2JJ2D 3KBOA 2H2WA 1LXCA 2WF8A 3PGA1 3MYRA 3G5LA 1PWZA 3D3WA 3KEMA 2QP3A 3FDFA 1U0OC 1TMKA 3G2OA 1PS9A 2IIQA 3K92A 1G21A 5HZHA 2ARKA 4OB7A 3X1MA 1SPXA 1Q0ZA 2VUSA 3MPOA 3O7MA 4HEHA 3WZMA 1JBQA 4MHSA 3T1TA 3AVWA 2ZYDA 1ISGA 3IAUA 3DBHA 4LF5B 2CLFB 2DVMA 1JR3E 3N2ZB 4M54A 1LSSA 4CDNA 1QTNA 4DJEC 3F3MA 5HRUA 4DB2A 4DDKA 1GWNA 1ICIA 3LHSA 1I2MA 3Q3IA 4AURA 4YC7A 2E49A 1QOQB 2JFHA 1DV2A 4BTEA 4GIBA 4X20A 1A9XA 1FXSA 4WY5A 4WZBE 1C9NA 1DX9A 1E6EA 1NYTA 3FKSD 3NKVA 5EA2A 5REQA 4E5YA 5JQGB 1AQNA 1M8JA 4L0DA 3JQ7B 4L85A 2JZOA 4MLPA 3LSYA 3W2IA 1IOWA 2FEOA 4ZEXA 2C04A 4I99A 2VPZA 3BWVA 4PPQA 1XJCA 3UWOA 2PR2A 1AUOA 5CVCA 1FLNA 2QTCA 5ILQA 2O0HA 3O31A 3E8SA 2FH5B 3RVNA 3UMVA 2ZRMA 1LWOA 3G49A 4FOLA 3FTFA 2V97A 1T2VA 2A9FA 2G07A 4I50A 3CSSA 4RESA 1V5FA 3L8ZA 4UOQA 4PZEA 1V7CA 4H1VA 5KUTA 1FQOA 3M3PA 2RI0A 4Y2RA 4GGOA 1IXYA 4DJJA 2GEJA 2ZETA 4IICA 4ZU3A 3ZS8A 2Q5IA 2HQRA 1G38A 4CIAA 3EF3A 5ARCA 2IZ6A 3OH8A 1M1XB 4NCNA 1AZLA 4LF4B 1ZK2A 2P62A 3OCZA 3ISVA 4JLNA 2CB0A 4YJ2A 3PSAA 3LWDA 1E8DA 4DLRA 1ORWA 1LLFA 4IZOA 5AKKA 4P32A 1JH8A 1GARA 4LY9A 4YA6A 5C81A 5AW3A 7ABPA 1SK9A 3MB5A 4TKVB 1JBKA 2VDWB 4UPEA 1BFUA 4OU5A 4QRIA 3RRJA 3KQUA 1QYIA 2GCGA 1F4PA 2Y1CA 1MX9A 4CCWA 5M2QA 1A8QA 4RYLA 1DL5A 5B36A 2YYYA 2EL7A 3AIKA 3C5CA 4BFZA 4M53A 1ZJYA 3TRIA 1IPFA 2UUPA 2Y76A 4ZZ3A 1WXGA 5GWXA 4BFSA 4J1SA 1K97A 5DYNA 1WZUA 2P4EA 1KMQA 1X9GA 2NU9A 4JB3A 1RWQA 3B70A 1X7YB 3B48A 5HOEA 1K6IA 2V5AA 3UIEA 1NVDA 3K0EA 2BFWA 2JJ1A 5CW1A 1E9FA 4LI3X 2Q21A 1TEVA 2JGAA 5HIMA 3HKEA 2B35A 1Q2UA 4Y9TA 5A3SA 1WV1A 3E9YA 1U98A 1F2VA 5TGZA 3FHJA 3HDJA 4GWLA 5AOBA 1XZPA 3KHUA 4FYVA 5ELXA 3F8WA 5TPWA 4AN4A 3L0PA 3A9UA 3GNTA 5LVAA 3IIEA 1SQSA 4RSMA 5ICCA 2A92A 3AUUA 4ZCIA 3E5RA 3RFCA 3B9QA 4QDUA 3ANSA 1SAYA 4X44A 2NV0A 1HYEA 3OLVA 4D8VA 2WB4A 5LP1A 1L4FA 2I6QA 1F06A 3OX1A 8ABPA 1P4GA 1SHUX 2G0NA 5G1NA 3R7BA 3TZQA 1RM5A 1V47A 2ICAA 4MUBA 6LDHA 4ITUA 1O87A 1VYUA 1Z6TA 4PAGA 4NE7A 2XW6A 2FN9A 2JVIA 1C5KA 1P9LA 1A97A 2YIMA 3DOOA 4PSCA 4QQFA 4OQEA 4OL9A 3S7ZA 3WLPA 1N77A 2X7JA 2I91A 2ETXA 3ITDA 3ER8A 1IUKA 3WGGA 3SQMA 5GJBA 4X7RA 2RGXA 2VRWA 3ORYA 1WXEA 1OTHA 1Z17A 3P2MA 3TIVA 4NULA 3SHOA 4LOKA 2P67A 5AXDA 4HWSA 2ZQ5A 3LOUA 3NGLA 4GI7A 3BMNB 1HH4A 2HJSA 1NW6A 4NK5A 4DZZA 1U31A 1D1TA 4KQFA 1E69A 3LWBA 3SYRA 4D9EA 3EZFA 3NBFA 3PFWO 3CZCA 4OQZA 2NYRA 3HKCA 5D3KA 3FTNA 4ZT3A 2Z6VA 5K0NA 4G4SO 2HA0A 5K0JA 2XZOA 1C3JA 3OZEA 3D6HA 1BJKA 1U02A 1CHNA 3QI7A 2ZKLA 2WHPA 4OA5A 3JRWA 4RY8A 5KNCA 2B1QA 4M1ZA 4IIXA 4R1SA 2DERA 3KQQA 3LUJA 4HFMA 4PRZA 1Q7RA 3UW3A 3IDSA 3L6RA 4I55F 5L7YA 1C1DB 2KS6A 4FYYA 2MINA 3DVAA 1TM4E 5YASA 5DULA 2EU8A 4EG3A 4YS6A 1N6HA 3P9PA 4PW0A 3RRNA 3D8SA 1C14A 1Y8QB 3RM3A 4BFXA 4WL0A 3F3YA 2C5LA 3R2JA 5K01A 4I4TA 1Y37A 3SXPA 1DJLA 3PJFA 1IZYA 2J48A 1MFZA 1XQ1A 5CD9A 1CVLA 4I4CA 1K86A 4NQZA 1HE5A 3LUPA 2N42A 5DU2A 3O4JA 4KXMA 1XYGA 5IEBA 2L82A 1P18A 1ABBA 1PQYA 1G5TA 2AOTB 4IJMA 4RE5A 2PM8A 2P5UA 1H93A 3UMJA 5AW4A 1R66A 5E2BA 4NONA 1UT5A 3DHEA 4ZCSA 5BSFA 2CLHB 1PZFA 8MHTA 3LS2A 1RXCA 4LPSA 4PLFA 2IPNA 1PKXA 2NWQA 2DUWA 4UQLA 3DVAB 4OP3A 4AIRA 1FPQA 5CJPA 2QTLA 4TM8A 1ODIA 5E6UB 5KOHA 4OO3A 2W90A 1ABEA 4FSDA 1DC8A 1GR0A 1Z5PA 3QU2A 4JYMA 5IAJA 2DQSA 2JDID 5EMKA 3ZDAA 1TCCA 1E2LA 4AS2A 1PG5A 2IUYA 1ZMOA 2ZT6A 2Q3LA 3TINA 4ED9A 2KLHA 1N0UA 1CQWA 1PQPA 2EWVA 3H5WA 2JFGA 1FNDA 1XCGB 3CUTA 2ZKIA 3EVZA 2WFLA 4I6EA 3FDJA 3AI2A 4V0NA 5KMGB 4IDDA 2BGNA 4IW3B 1K1EA 1H0KA 5AJUA 5EZYA 3BFPA 4MGYR 2I03A 1P80A 3P45A 1IHYA 1MXFA 4B48A 1X6VA 1N6NA 3EMDA 4Y98A 4J75A 4G3XA 5I3ZA 5DV9A 1E9SA 1JNXX 1NW5A 4CR6A 4REQB 2M6KA 3ZXUB 4X66B 3SQWA 3R4CA 3HVRA 1C7JA 3ORHA 2FPMA 3GEEA 4FUTA 4IDEA 1QOPB 1NZJA 2VNHA 4TV9F 5J58A 1JFSA 3OIGA 4EJFA 1ULAA 3PUVA 2A1UB 4IRMA 4N5NA 3GOHA 4QTXA 1RXEA 3CW2A 4BFLA 5BWCA 5HZGA 2ZSAA 2ENUA 2VI5A 1W1UA 3C3EA 2H2FA 2H5LA 4IGIA 4EHIA 4BFWA 3KSBC 2ZE7A 1Z7WA 3KR2A 5DGDA 1ILWA 3C7TA 4IX9A 3F6RA 1OH6A 1M6EX 4LCEA 4KRYA 1Y3IA 5EWJB 3T1OA 2OV2A 3U3MA 1MJHA 3DAHA 4GG1A 4HQKA 4IO1A 4X1OA 3LX8A 3VAZA 1U0HC 3MWDB 4HLCA 4ARIA 4DLWA 5C3UA 1RKVA 4HGRA 2AD5A 4R2IA 8ADHA 2FK7A 3CF4G 1CE8A 2O2GA 3RHTA 4OLFA 4UHDA 4LGYA 4MTLA 3COPA 1YZ3A 4KH1A 4PYJA 3M49A 4E5SA 4ZI5A 1E7YA 3OQ6A 4B7AA 1WPRA 3DVRX 3ZQUA 4HLUC 1S7GA 4PYIA 1ZCAA 4LFBB 1E1MA 1GG5A 2AC2A 2VHEA 2NLOA 3QWAA 2RBGA 4EHLA 4WOJA 3RVOA 1BFKA 1OCEA 1GV1A 4H9GA 3K9QO 2JA2A 2I7XA 4GT1A 4X6LA 1CQIB 3RHSA 3DFIA 1Z26A 4HDNA 3WZLA 3DMFA 2IXGA 2IYOA 4EEKA 4Z3KA 4BBZA 7REQA 3QKWA 4F8YA 5TQJA 4IF4A 2HRDA 4CTJA 4ND6A 4JD5A 4DBVO 2FAXA 3FDXA 2YUTA 2QR2A 3I30X 1NF9A 1JSCA 3W1WA 4D92A 1IBMB 5AJVB 2LXNA 3V42A 3SQLA 3CIFA 4TXJA 4DUGA 3PFIA 2ZI6A 3IR6A 2FFBA 3C3CA 3SLKA 4IILA 3UPDA 5LDHA 2DETA 2BD0A 4NCHA 2DULA 2JAHA 2GYWA 1T5BA 4Z4EA 2GN9A 3WLTA 1XF1A 1X80B 1VL1A 4C03A 1UFVA 2WKPA 3ZNNA 1LTHR 2XMRA 1JR4A 1NVUQ 1ZO8A 2CNDA 3JQPA 3IQGX 1MRSA 3D7LA 4YAIA 1C7FA 3JD3A 4Q37A 3ROXA 4K88A 4NCAA 1CQIA 3VBCA 2KI5A 2QBYA 1D6MA 1PJLA 2H2GA 2QNRA 2GSWA 4MGEA 5CB8A 2BSQA 1FUUA 4HATA 4ZO4A 3IDZA 3ZIUA 3U7HB 1XEFA 1RMQA 2V5UA 1YHZA 3GDHA 5DI9A 3E23A 1PR9A 2UAGA 4JSRA 1H1LA 2QN8A 5F76A 4EG6A 1XCMA 3MUNA 2PGNA 3AETB 4OMDA 3VPBA 4BB5A 4FS8A 1K2WA 1M72A 1ZD1A 3QFRA 3GJ3A 3WIOA 5KMGA 2GF9A 5GTDA 2B78A 3SG0A 3W5UA 1ZNWA 2NZUG 2BFNA 2XEXA 3DXZA 1JJ7A 3IKMB 2BEUB 4D5EA 4JI2B 1E3EA 1U7TA 2ATXA 3QTTA 5E2IA 2WYHA 4TTAA 4BNDA 5T4HA 1MIOB 5KI6A 3EX7C 1ZR2A 3V5NA 2FQXA 1K7XB 5FKJA 3E48A 2NVBA 1AHHA 4LDPA 2CNLA 1C4XA 2PT6A 3WFIA 1YNOA 3AFOA 5CFMA 1QV9A 4M9QA 3RAPR 1GRNA 1W19A 1J9ZA 2I4OA 2P6NA 4Q5IA 1M3SA 3NNDA 1GNQA 3RASA 3WBBA 2XZLA 4DDVA 5C8XA 2JIPA 3OCYA 2XE8A 1A98A 1T3LA 4F97A 3JQ8A 3IP5A 1TVEA 4K9LA 4ZCMA 1A7UA 4Z0NA 2FYTA 2D1QA 2JGIA 3BFVA 2H92A 1KOGA 3I73A 1AUVA 2VK2A 2Z2XA 3C3PA 3IESA 3JW8A 4Y0VA 4Z9BA 1CEXA 4YRNA 2JATA 1KWGA 2BKAA 1KK2A 2GHIA 1APBA 4EF5A 4YJKA 3WK6A 3VJRA 2OAQ1 4Q12A 4EKIA 1DO2A 1U8TA 3SOZA 2D62A 2OVBA 5H83A 3U6BA 3QOYA 3T35A 5GV7A 1RJGA 3D4PA 3G79A 4L6CA 4DUGD 3ZPXA 1OFUA 3PUXA 3ZHZA 3T8YA 4YRAA 4ARZA 5D3MA 1J8MF 3R3UA 3QVKA 3BQNB 4CKWA 4QHYA 1XZNA 5JJCA 5LQCA 2AE1A 5KYTA 4XEUA 3LGSA 2QN6A 1TM1E 4RPLA 4RL4A 5AJYA 5CFQA 1YA6A 1TK9A 2MSLA 3WLHA 3OA0A 5U4QA 3LTEA 2XYPA 4ENSA 1Y98A 1W36D 4W7IA 4TWZA 1T8RA 3EA5A 1ZCZA 1W85B 3UY4A 4KE7A 4TROA 3TDNA 3R7AA 2VDNB 1GZDA 4R3UC 4YMWA 2ZYTX 2G1KA 2H06A 3L92A 3Q72A 4L8VA 4Z1MA 1KE1A 5BN4A 4KGDA 4KZPA 3QE2A 1HLFA 2O59A 1DC7A 1F14A 3V4SA 5ALNA 3KSAC 3W5VA 4B31A 1Q84A 2HLNA 1W35A 1KDRA 4OYRA 1PJSA 1NRJB 1Z5VA 2EG5A 3C3YA 4LC9A 4BAUA 4IH9A 5B4TA 5KVSA 4MDEA 5L7WA 5THXA 2F3PA 4DY4A 3CUKA 3ZD8A 1W59A 3OT5A 2O54A 4YBZA 1VIAA 4ZTUB 1G8MA 2E6KA 4C7MA 4D41A 3NQ41 3GDWA 3OZCA 1H9CA 1KBOA 3GLSA 4AQYB 3DLBA 1UZUA 1UEXC 3D43A 4KPYA 1CZLA 3W06A 1BXGB 3H5AA 2JFUA 4ZYUA 2VHXA 4WLFA 1OXBB 3R20A 2HCFA 5KDLA 2P2ZA 4D8YA 4GPD1 5HCIA 4X41A 5IKMA 3BD6A 4OAOA 4FCCA 4DRXB 4RTRA 1FXUA 1J42A 4XR4A 1SUSA 4FZJA 4P98A 4JELA 2A9RA 1RLJA 3K8YA 3KPJA 1TB4A 4N82A 5AM0A 3FKJA 2FPPA 1NBOA 3CZQA 4W99A 4BGUA 4DIEA 3VYRB 1S9DA 1KEZA 3GLKA 2YQ4A 3MIZA 4LV8B 1QO0A 3K5IA 1R0BA 3N59A 5DTQA 1MIHA 3FMPB 2Q5QA 2H31A 2I34A 4XYGA 1P5FA 4ONEA 1H5QA 4YXWD 4U6SA 1L7DA 4KG7A 4TZ6A 3MJVA 1YQ9A 2BELA 2QLJA 2UV8A 3FXAA 4MP6A 4UE3S 4PLPA 2FRXA 2IYTA 3U4HA 1R64A 2QYTA 1J22A 1RYYA 2PJZA 2NO5A 3NHAA 2V5VA 3KKZA 4MROA 1EJ2A 1MC8A 3IQXA 4KUHA 2KBFA 4XGNA 4PICA 3PK0A 4PY2A 2DTXA 1BD3A 4II7A 4BZQA 2YC4C 5FBQB 1U9YA 4HLDA 3BDAA 4F4FA 1KH2A 5CCXA 4DV3B 5ALUA 1JIQA 1W88B 3BF8A 1KJQA 2D1YA 5B3LA 4IV0A 2R8ZA 4M8KA 3QH4A 4RK5A 3UO8B 1DELA 4HPJB 3LPDA 4AZ3B 1AMNA 2IQ5A 2CNWD 2C9BA 1FP1D 1JG6A 2CVZA 5FNVA 1QUFA 1ESEA 1GQRA 2N47A 3M1YA 4AULA 3KB1A 3C2QA 3NFRA 3HHEA 1QHFA 4J16C 4L9SA 4XIGS 3TLGB 3VPDA 4DG9A 1SBNE 3U6KA 5BR8B 1I9GA 4L75A 1UDBA 1P17A 4TTPA 1E6KA 4Z4HA 5JZOA 2VCHA 3D81A 1VJTA 4EKNB 2DAPA 1MAUA 1MX1A 2IS4A 2C5FA 5J59A 4BMDA 5LMNB 3ROMA 1VE6A 2ZUTA 1SD2A 1AKWA 4P33A 3W3AA 3BWMA 2I62A 3UPTA 1ATIA 3P9RA 4LHXA 3BHMA 2XQGA 4HMOA 2NIPA 2OFPA 1E20A 1F3OA 1JYSA 2W6NA 5DYIA 1OXXK 4GR5A 3SC2B 1E9BA 1H4QA 3OQPA 1HRKA 2FFAA 1YV9A 1FZQA 2FX5A 2RHHA 3F97A 3OT1A 2QQGA 3FZGA 1N8SA 5ESWA 3W1EA 2GBGA 3F1KA 4KEAA 1LJUA 3LT0A 3VVLA 1YONA 2AI1A 3A3PA 3LKVA 4U0KA 2FVYA 4HYYA 2CXPA 2VAMA 4FS3A 5AKIA 4IIBA 5C52B 2SKEA 1SHTX 1WLYA 2A0UA 2VTKA 2X6QA 3GJTA 2YIDA 3E9QA 3MCTA 2WTUA 4YAOA 3CNNA 2PSSA 1P5ZB 1AZWA 1TT5A 3NIWA 4RZ3A 3R3WA 3ZV3A 4JP1A 1GP2A 1ZUNA 3AMVA 2FUNB 2ESRA 3U13A 4J1TA 5KSWB 1B6SA 2ZRAA 1ISFA 1C0EA 2Z8XA 4ETWA 1C3OA 5KVQA 3SICE 4URUR 5GJWC 2CEAA 4CUJA 1AD2A 2J0EA 1T1RA 2O50A 2PUCA 1U1GA 2X9NA 3D6UA 4M0MA 4ENRA 1MDFA 2ZSIA 4UDYX 4AKEA 3MS2A 3UOWA 4XX0A 1FPMA 4HMPA 3LUAA 2AD1A 1AKQA 1WS6A 4KRGA 2HBZA 2IPAB 2C8JA 4GYJA 1CKEA 3WQBA 4MUJA 3AILA 1G5HA 3BA6A 2HGSA 3GGJA 4PGMA 1OBFO 4F4IA 2WKQA 1R8XA 2YHSA 2V7XA 5CBPA 3EVTA 4PQGA 5EKDA 4M22A 3A31A 1BYIA 1D07A 2WU3A 1UMDB 1XALA 3DS8A 1RBMA 1T9HA 1QANA 2UVPA 3OFVA 4AJ1A 3K5WA 3SFVA