2GARA

A ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
188
Chain Sequence
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRALIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
publication title A pH-dependent stabilization of an active site loop observed from low and high pH crystal structures of mutant monomeric glycinamide ribonucleotide transformylase at 1.8 to 1.9 A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Purine biosynthesis
total genus 60
structure length 188
sequence length 209
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1998-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 2garA00
1RBZA 3AV3A 2FMTA 1RBMA 5CJJA 4YFVA 3P9XA 5J63A 4ZYXA 1RBQA 4EW2A 1C2TA 2GARA 4QPCA 2BLNA 3LOUA 3TQRA 3DCJA 4ZYZA 1RBYA 5J9FA 3DA8A 1C3EA 1CDDA 4EW3A 1YRWA 3W7BA 1CDEA 4ZYWA 4R8VA 1MENA 1RC1A 2BW0A 3AUFA 4S1NA 4ZZ1A 3NRBA 3Q0IA 1GRCA 3KCQA 1NJSA 4QPDA 4ZYYA 3O1LA 4EW1A 4NV1A 1ZLYA 3GARA 4PZUA 3R8XA 3N0VA 4ZZ0A 1ZGHA 1RC0A 4ZZ2A 4ZYTA 1ZLXA 4TT8A 4Q12A 1JKXA 1FMTA 3OBIA 2CFIA 1GARA 3TQQA 4ZYUA 4TTSA 1MEJA 4YFYA 1S3IA 4ZZ3A 4ZYVA 4TS4A 4IQFA 2YWRA 4DS3A 1MEOA
chains in the Genus database with same CATH superfamily
3BQMB 4GL4A 3VYWA 3MJCA 1SURA 5HMLA 2IZ5A 4YFVA 1PTJA 1TVKA 3HY3A 3LBAA 4HAUA 4HGYA 4C04A 1VPWA 4DEXA 3E35A 3UBMA 3GLFA 1CE8B 2ZANA 3BH0A 4Y6OA 4RO0A 5DCUA 5HE8A 1VXRA 1PJ3A 2V9PA 4DLAA 3T5BA 3BGIA 3H4MA 5B1YA 3M6IA 5C5DA 2Q2VA 3FF1A 2OOSA 1XTSA 3NYQA 1M1YB 4IIXA 2MCFA 3IR6A 2A94A 1IWBB 4NBSA 4PN3A 4DUYB 4I08A 3KXIA 3LIIA 4DNOA 4OSPA 3THRA 5HUJA 4AKEA 1V0JA 3ZV6A 5FV7A 5JQGB 3WGJA 4D42A 1XDBA 1CUCA 3LZCA 1SPBS 2HA4A 2Y1XA 2RD2A 4K86A 1AVTA 3ZCVA 5KOIA 1N34B 3NPAA 1ZJJA 2FJ0A 4COKA 3U19A 2RI0A 4UXJA 2R97A 4L4XA 4KNVA 1BEUB 1GV1A 2VPTA 4F06A 4KQJA 2XX3A 5CCDA 1NYRA 1CQXA 4E2XA 4PSUA 1EG7A 1ULUA 4LHZA 5K45A 4H1TA 2C0QA 3T94A 1LPOA 2EFGA 3HJCA 3VSDA 5CD9A 3HKCB 5THXA 2FFJA 1F2DA 3B60A 2CFCA 4DAEA 1KMCA 4KLAA 4YA6A 2VBFA 2GTIA 2VPWA 4CUKA 4ABTA 1S96A 1X1EA 1TMYA 1TQ6A 3G0CA 4O2LA 3DDUA 4JB8A 5JADA 1VJGA 2XUOA 1YT5A 2YCBA 3DKPA 1QIEA 2Q6TA 1S4QA 4FTWA 4KUEA 1SUFA 1ZZGA 4XB1A 3WGZA 1AO3A 1LNSA 3B36A 4XVRA 1BE0A 4F38A 4HQRA 5D87A 1DO2A 2LZ0A 4QXAA 4OQNA 2C54A 4MV6A 5HBGA 4XIYA 2PR2A 3N1UA 1SRQA 4M55A 2CDRA 4DMKA 2QT0A 3DE4X 2QE7D 3VJKA 4OLJA 5ISMA 5EXPA 5DK6A 3ETLA 1Z6ZA 5GOZA 4FDVA 2W2TA 1UKAA 3F4KA 3R9WA 1EQ2A 1P5ZB 4L8VA 4FXPA 4YCJA 3OOSA 1L6RA 2I5PO 5CEEA 1OFTA 2J4CA 3JZFA 2Q5EA 3FSJX 4YDQA 2WP8J 4BFYA 1I33A 4A2CA 1EJ0A 1TU0A 4MGHA 4C6HA 1Z5NA 3LPLA 4C7OB 3AKZA 4NDZA 1H3FA 2CK3A 1KIMA 1H5NA 1TCAA 3DCNA 3C5HA 1A77A 2RG1A 5EXTA 5LYJF 2ZKIA 4B33A 4LQCA 1A9YA 1OIVA 4YO8A 4E21A 1SK9A 3VSBA 4GDFA 3WNVA 3SVLA 3PDWA 4ROTA 5HIKA 1JHUA 4KAXA 1BH6A 2PMKA 3DJYA 2R44A 1ULHA 5L3SB 2XUGA 3E7DA 2QSZA 2WIGA 3E9DA 2JFNA 4JLKA 4LA4A 4YN3A 4TRRA 5H82A 6CHYA 3PD0A 1GU0A 4OP1A 1K7SN 1TUIA 4KLRA 4ZOQI 4E1BA 3QJYA 3F73A 2WTEA 1RJDA 4RADA 1KZHA 2ZI3A 3ZWPA 3N76A 4DFDA 1Z7BA 4TLDA 2HQ1A 2V58A 5KI6A 4BNGA 3T3MB 1L5OA 2QL5A 4WNCA 1EFTA 3K9QO 4QPCA 4UDYX 1Z0ZA 2VKQA 2YTZA 3K8ZA 5CXXA 5FKJA 2IUUA 4GXNA 4IS3A 5LLDA 4MO9A 4S24A 3USZA 3VKHA 4GBMA 2VRCD 1MB3A 4LBZA 2J5KA 1AV6A 2XD9A 3EGDA 2FJPA 1EQUA 2WD7A 2P0EA 2V5VA 3NPMA 1PS8A 1M8KA 2XUHA 2VP5A 1D0VA 3NWEA 2PMDA 3P5BA 3SR4A 2CLOB 2AFIA 4HAVA 1MX3A 3OPMA 3OJOA 4FGSA 1RC8A 3NTQA 1WW3A 4M76B 1XK6A 1RZRA 4M88A 3RAGA 4ZXPA 5CRIA 3R5JA 3RVDA 1Z2CA 4HN9A 1DGQA 1E1RD 4JB0A 4X91A 4CLEA 4DQKA 4H35A 1ISPA 2AFHA 2EG9A 1FDWA 3RBAA 4N0DA 3OCXA 4B6GA 3E0XA 1CNEA 2R4UA 4UD2A 2A59A 2XVXA 3LCUA 3NCTA 4FHGA 1M6YA 4RQTA 2ZS9A 2XECA 2AG8A 2PR7A 2QRJA 2C5SA 2DWCA 1Q6ZA 4A2PA 4FX2A 2KJQA 1MPXA 3B9RA 4XYMA 4AQDA 2C2BA 1VGQA 1A5ZA 1YZGA 1JPVA 4ZYYA 4UQOA 3K73O 3MB5A 2SHKA 3N0XA 3KVOA 4ZDKA 1U6IA 2L42A 4CM6A 4FK8A 1L4MA 2FW0A 3AEUB 5CK4A 3T3GA 3VM6A 1V1RB 4BFXA 1GNPA 2H4ZA 2ZUDA 2H0QA 3KD3A 4MW1A 2OBYA 3A2NA 1JALA 3FWYA 3PHGA 1QFJA 3RFFA 1N2IA 3C4VA 1XTVA 4OMFG 3OEYA 2QNIA 1DO0A 4G1UC 4GOKA 2AI1A 3AUSA 3JZAA 1CRQA 4KRXA 1QSGA 3T9CA 1DAHA 1E7QA 2E2WA 3FKJA 4MUYA 3SYLA 3A10A 3H75A 4QSMA 4I55B 2AFHE 2BKXA 4OUDB 3ZU5A 1CYDA 2HIAA 2GMWA 2JFHA 1DWPA 4FMBB 4MYCA 3WNZA 1E6UA 1OI3A 1UF9A 2MR6A 3L1KA 1K7XB 4BX3A 5A5DA 1HL3A 2PNFA 4QNMA 4MRAA 2PPLA 4RLQA 2V9ZA 2OFPA 3ZHBA 2QTZA 2FSUA 2NU8A 1T5DX 2JFQA 3NM6B 4FNAA 1B8PA 1XEWY 1M3SA 1EA5A 1JXAA 1PR0A 1S8OA 4OGGA 4RNDB 3G3EA 4B83A 3DULA 3ZZUA 4ALLA 4YRNA 4OBXA 3PVCA 4XA8A 3E5MA 3D59A 4REQB 1YI0A 1T3TA 1UC9A 2E4AA 3G2LA 4OI2A 5JARA 3SBOA 4AJ9A 4YLEA 4FOTA 1DS6A 1TAQA 4BO9A 3PGMA 1LH0A 1BHQ1 4P3PA 2OV6A 3K2BA 4EI9A 3OG9A 3TLGB 4X3OA 3TB6A 1Y63A 4WD3A 1XD2A 1D2NA 4ED9A 3KCNA 3IP3A 3KWLA 4BNIA 2J0EA 2A9OA 2XJ9A 1KDPA 3DEJA 3K5HA 4QBIA 5EUQB 5AT1A 3C8HA 5AXAA 3V3KA 4ND7A 4XXHA 5K20A 4PC3A 4B8ZA 2ZUTA 2YHUA 1KHHA 1X7YB 2WSSA 3OZXA 3RNLA 4BMXA 2OAQ1 3NHSA 3HV0A 2NOAA 4J3JA 4RQAA 3TAHA 4F5WA 2H18A 2VAPA 3G9TA 3X1YA 1UXKA 3D3WA 1LW7A 4CEJB 2Y3IA 4ZDIA 3AHFA 3INTA 1PK8A 2AHRA 2CNOA 1YQTA 2MINA 2P4QA 1B73A 2P2YA 3DM9B 1MC5A 4ZOBA 5KX5B 1M33A 1USVA 1XA0A 3CS3A 3NBFA 4PLPA 1MZVA 4U7FA 4I4TF 4ZV7A 3WP1B 3UWMA 2YWCA 1XMOB 1ZAKA 4IFEA 1P33A 1RPJA 5GIOE 2FUKA 2VQSA 5LWHA 3HE3A 3GFRA 4C0WA 4RU1A 3ZVMA 4P7FA 2QL7A 2G76A 4XSGA 1AKYA 1RWKA 4OO3A 3PL5A 4B7UA 3WADA 2R6AA 4V03A 4ZOLF 2YY6A 3HDTA 1W35A 2OD9A 4FONA 4HTFB 3IURA 2VN8A 3PRYA 4LY9A 1RRGA 2AJLI 3GWGA 3PF8A 5REQB 4PC7A 4NEQA 3V7YA 1N0WA 1CHNA 3UY4A 1KC3A 1YQQA 4FFWA 4DAOA 2WUGA 1FNNA 4DVJA 2YS7A 3JD1A 3MG9A 2ZI6A 5CVJA 1HE1C 1EUCB 3O6VA 4PYJA 3CF2A 3ZV7A 3CM0A 3GJ5A 4MWZA 4IBOA 4CN8A 3G2KA 1OT5A 1AM4D 3DZBA 5A1TA 4KN8A 1CDOA 3CNOA 1UDXA 3ROZA 1U8XX 2PK3A 3E8XA 1M1NB 3S7ZA 5KNLA 3THWB 3OOHA 5IDQA 5K3BA 1Q11A 2IW3A 1NXWA 2B30A 1E7MA 2G40A 3MPUA 3MOIA 4MOWA 3BQNB 2XNKA 4UHFA 5C9ZA 2QRMA 3GJYA 4GKVA 5DXJA 4BQQA 1BDMA 2Q3FA 4HYYA 4JVSB 4DC1A 1E3LA 1F0YA 3D81A 2D1FA 2OCIA 2UZ0A 3GCXA 4QPZA 5CNMA 5EN4A 4OLFA 1RYYA 2YH2A 3HDVA 3SHVA 2PYDA 1KFCB 4JDPA 2OO3A 1DADA 4FE4A 3MC1A 1A7AA 1X1TA 2P0AA 4P38A 4RD0A 4ROSA 4XX1A 1NXTA 3T5PA 1IBLB 2JCXA 3EGXA 3C3BA 3JVEA 4G65A 1X8LA 5D3QA 1PJ8A 2DQ4A 3GJ3A 4O25A 4LJ6A 3PHJA 4JJ6A 3C14C 1GZ3A 2OV4A 3WB0A 1NW7A 3LKZA 1N92A 4EW6A 2JIPA 4IVRA 1N9GA 3GGCA 2AV6A 2GZAA 4JH0A 2WICA 4J1TA 4DLZA 2HQBA 2QMUA 3IULA 4HDSA 3A4NA 1DB3A 3G0BA 5IVDA 1XNRB 1BHJA 1I7PA 1PGOA 1G7SA 2W98A 2GR9A 3CV3A 3BIFA 2AQIA 3D02A 1MV5A 1FTYA 1KYYA 4OJKA 4B2YA 1N5DA 4FW8A 2ZT7A 3B9PA 1REQB 3OX4A 1DWQA 4LS3A 4Q9LA 3S6JA 4MCAA 3ROTA 4DRZA 1PP4A 4RTOA 2M32A 2K87A 1K8QA 1DTSA 3L6UA 1T6ZA 3IMCA 1K27A 2VAWA 1VCOA 1MORA 1Y81A 3IXQA 3N0TA 2BGGA 3IVMA 4Q0MA 4ZZ3A 3WNBA 1WSAA 1II0A 1MFPA 2IPNA 4B84A 5BT8A 1MDBA 3CQ9A 4BZZA 2D5CA 2NTVA 3N8DA 5K8LA 2ZXUA 1AZSC 1R6XA 3OLVA 4FYYA 3JASB 1YIOA 1YOVB 2QIOA 3PFGA 5DJ5A 4CQLA 4D99A 4K0RA 5LBIA 4IIEA 3ZGVA 4RXTA 2WB2A 2HJ9A 3KHKA 3M6AA 4HH0A 2RH4A 1ZUIA 3UICA 4H7HA 2X2FA 1OHHD 4Q18A 1QHEA 4GSLA 4PGAA 4PRZA 1JKJA 1HY3A 5LD2B 3ZU2A 4MRPA 1PX2A 2XUIA 1E63A 1F1JA 3ESCA 5C52B 2AG1A 1Y0BA 4Y2SA 2Z6AA 3Q40A 3CKLA 4NMXB 3MD9A 4LNUB 4UMFA 4XH9B 1MJGM 5EP3A 2RHLA 1UT5A 1VSVA 1NBWB 4Q37A 1YWGO 3ZOZA 2LR0A 1C29B 2CD9A 1ZJ5A 3AJRA 1NONA 2DUMA 5FBKA 4D4KA 1YIAA 1SCUA 2VKTA 3RADC 5HW0A 4ZI7F 1WNTA 2CJYA 3HHEA 4S1PA 2RGDA 1T6BY 4B3GA 1LTQA 4MW5A 4TTPA 2ZAIA 3GCDA 1U7TA 1IOLA 2HU8A 3ZKWA 1U9JA 1AZTA 5FA8A 2GESA 3EVAA 2OWEA 3ZGXA 3M2PA 2O0JA 2ST1A 3BE4A 3CSDA 4G23A 4NECA 4NS4A 4R8RA 4BO1A 1SKMA 5FTJA 3BH7A 3D5QA 4JUAA 1HZZC 1E1DA 4WACA 5DBOA 4IOJA 2P68A 2WM2A 1M1YE 3ACDA 4YP1A 1PWHA 4GX1A 5BSEA 1N4DA 4YUYA 1Q17A 3W2TA 4QOIA 3S2IA 3HWRA 2FEXA 2JF0A 4PLCA 1S0UA 1IVSA 4GPAA 2W2OA 4MB2A 1RI2A 3I4CA 1KR5A 1X3LA 4BO2A 4BASA 4S1VA 1PGNA 3V8VA 1TQDA 1VIYA 3GJSA 3HCCA 1R8QA 4P31A 1CRZA 1XQXA 1A9PA 3Q11A 4F9FA 4P32A 2PEZA 3LGXA 4URUR 3U56A 1J8DA 4BXOA 3JATB 3UJHA 1KEUA 1GNSA 1FW6A 1Y7TA 2EJCA 2Q1WA 4D97A 4HDNA 4J1QA 4NZMA 3U4QA 2N47A 4LY3A 3OKPA 4D4MA 1LZLA 3ZIUA 2RAPA 3I6MA 4Q9HA 1YO6A 4CN9A 1BWSA 2ACKA 3CURA 3DBOB 3EEFA 1CRLA 2P91A 1OH7A 4ZN6A 1YB4A 6LDHA 5I6DA 2GTPA 1VPTA 1SKAA 3MBIA 1BS9A 2IFTA 1Y9JA 3KZOA 3OQJA 4PIVA 4R1PA 3UXEA 1L7DA 5KQRA 2Q3CA 1PTKA 1MX5A 5CFQA 3I2YX 2Z5FA 4JYCA 1JPUA 2HGZA 2QT9A 3V9AA 3E4DA 2JD1A 4BIIA 3EF0A 1XTIA 2I78A 2LPMA 4NV0A 1P6XA 5FTNA 3BRWD 3H2IA 4LXHA 3FR7A 4B8YA 3IBYA 3TW4A 2HL6A 3FFXA 4G25A 3TQSA 1JFSA 1TM5E 2DT5A 3GEIA 3DNMA 5AH0A 3ZCSA 4WK0B 1OOEA 2WF8A 1NM5C 3C3AA 4PWZA 2PUBA 4QT4A 1E62A 4OHYA 2ZSFA 3RDPA 3F6YA 4YJGB 2QTTA 1WDMA 4UHCA 4XTRA 4AJ4A 5AESA 1C1YA 2JJ1D 4NLLA 2A1UA 3QHPA 1SQSA 2RI6A 3BGSA 2C3YA 1LVHA 1H5UA 1T15A 1T3ZA 2G07A 2BZGA 3C6MA 3PHIA 1QHNA 4OVKA 2ZIAA 4C07A 3V8MA 1M7BA 2B4AA 3OFVA 5DN6D 1LXCA 3KQPA 4QATA 4IKEA 3KV3O 2PVCA 1V1MA 2O0KA 3AL2A 3D7MA 3JWPA 5BSRA 2P8SA 3RUCA 1SUEA 2PH3A 3KELA 1KEZA 1D8TA 1VIAA 2HLDA 1POXA 3L0DA 1ZGBA 3BDIA 2I9KA 3WIEA 4YGYA 1VL1A 1CPYA 4BQRA 1P91A 5CUQA 3G8BA 5DI3B 3TLYA 5DVZA 1XN1A 2P3LA 2QY9A 4L9AA 3VR6H 2GKGA 4O4HA 3ZG6A 4FEEA 4BC0A 5KWSA 1AGRA 2HWWA 2Q7XA 2XI4A 2Y93A 5D3MB 1PV2A 4HNAA 4F6LA 1P0MA 1ILWA 3BF8A 3PEEA 5CJPA 1KU6A 2IYNA 3E9CA 2IYAA 3EZGA 1ZGJA 3NT5A 5FI1B 2Y0DA 4FZRA 4BBAA 3ZVNA 5AXCA 4WLEA 1M2JA 4NNPA 4YBRA 3AH8A 5EJEA 5JJ5A 1NRIA 5B64A 3HBFA 2DJIA 1TEHA 4N54A 5JECA 3R4CA 1JEYA 1ISIA 4E4TA 3LPMA 5ENZA 5JCOA 2XOKA 4H3KB 3EPKA 3REOA 2GVDC 3ZWVA 1RLJA 2VNHA 4OHUA 1W5SA 1AKQA 2HO4A 1HYEA 2VYQA 4I1RA 4PXYA 3RVNA 3V8NA 3KOWA 4D02A 2YUIA 3QV2A 4TWJA 3NM4A 2J30A 2X9LA 3VPDA 2BKUA 3FDZB 2VAMA 2ZCVA 1OWLA 3KK0A 1KH3A 2CMGA 3FCEA 3AEYA 5CNKA 2Q4EA 3L02A 2IZ7A 3WIDA 2ZI4A 1R5BA 2H1CA 2EFJA 3FUUA 3KFVA 4OHWA 1CIJA 2CUTA 4JBLA 2QR2A 3ES9A 1JFFA 2DUJA 2LV8A 2Z8ZA 2ZJOA 3KJNA 4OLHA 3CUUA 2W6CX 4L72A 4WWHA 4CMHA 1QRDA 2OL4A 3FPBA 1PJ2A 3BXPA 2DP4E 3M7IA 4HH1A 5AKZA 4ESOA 4L22A 2C97A 3LYAA 4QXMA 3RROA 1Y7IA 3DMYA 2HSDA 1LJUA 2P6PA 1RABA 5JS2A 1DQRA 3G0OA 1LRJA 2XXJA 5GZ1A 3EWSA 3AR4A 3RB8A 4X3CA 3RVJA 3TAUA 1Z6YA 4BGEA 1DT5A 2PZLA 1JKMA 2RK4A 3C7TA 1KAEA 3FWNA 3IJ5A 4FFOA 5ECGC 3EUEA 3IP8A 2CKDA 3M9XA 5J58A 3PJDA 4BNVA 5AOAA 3NTRA 4EKNB 1DV2A 1S4MA 2OBBA 3I6ZA 3QEJA 4ZKEA 4WZ6A 2GB4A 1GARA 4HEA1 3S99A 1AB6A 4TV8F 1KQNA 3TQQA 4KQCA 8OHMA 3KEOA 3HM2A 4HEHA 2ZR8A 4NENA 4FSHA 3HU1A 1GP2A 2P62A 1O8BA 4LRQA 1E0SA 1LJ8A 4JYMA 3R6GA 4XR4A 4FEAA 3FTFA 1E2BA 3ZYZA 2HCBA 2HBYA 3UOGA 2OPHA 4DNFA 2Q6LA 2B4RO 2E37A 2AB0A 1G1AA 4GP7A 4P83A 4KR7A 3CZCA 2O3TA 5TGDA 1U0OC 2CLMB 4C5AA 4E5DA 5EYPB 1Z5UA 5BWMA 2GA8A 2WJJA 2WTMA 3NG1A 4PV7A 2CLHB 3WLFA 1KK2A 1L1EA 4DEVA 3HDYA 3QGMA 2O19A 2X19A 3A0RB 2FPIB 3W9YA 1SBCA 2Q4DA 3COPA 3CWQA 1GNTA 4F6RA 2WNIA 3WQQA 2HD4A 4F96A 2VJAA 4JODA 4OFWA 3RT7A 4OG2A 4DIDA 2FPSA 1PBTA 3LYUA 4BMCA 2JRLA 4XX0A 2HMVA 4HJRA 3JY6A 4A7PA 2JI9A 3HCDA 5BVGB 3Q5DA 2KPOA 3GRKA 4HDKB 1ADYA 1SBQA 1W4CA 2LKDA 4PYNA 5AOVA 4DMUB 1O77A 2IUFA 3MGKA 4O4JA 2FR8C 3O47A 5GZ6A 8MHTA 1VHJA 4UQLA 1YCDA 1GGJA 5HSGA 5GJCA 4GPD1 1L1QA 4JLDA 1GKKA 2HMWA 3OE5A 4QYTA 3TECE 3Q2OA 5B2FA 5F5XA 3WS7A 2NP7A 5IU6A 1XB2A 5EWJB 1O8CA 2GEBA 4LE2A 2JCGA 2R6R1 1C9NA 3AETB 1X7XB 1BEEA 2DJ5A 3N2EA 3KOZA 3ZWCA 3OTHA 1PGQA 3OA0A 1OCEA 4IIGA 3FLAA 5TJ9A 4BHTA 4Q1VA 3O74A 5LZ2A 2MYTA 1E79D 1VYVA 2GRUA 3KTOA 4ESEA 1Y5IA 1E89A 5AVSA 5ICMA 2G9UA 1H2BA 1YH3A 5KNBH 1KDVA 1QVVA 3JD4A 4V3BA 5IJ0B 4S04A 3ORFA 5I47A 1L4UA 4WQMA 1IATA 1Z34A 5K1ZA 1CFJA 2NPFA 5CB6A 4LHSA 3G82C 1PNVA 4OYHA 4CG0A 1M2OA 3UT5B 3K2QA 1E9BA 2DG2A 5LLSA 1J1ZA 3AYXB 5BT9A 1F6DA 2GXAA 1BVYF 3NIFB 1WSWA 3K9CA 4PGGA 1MABB 4R1SA 3FUVA 3BZBA 1WUHS 4I7EA 4AKTA 4F5EA 2PLAA 2E4UA 3GN1A 1QHHA 1Y80A 4QOGA 3OM8A 4EG8A 5KQMA 4Q4HB 2PRSA 2XYPA 2PPVA 2SECE 2AJDA 3I58A 4TS1A 4F91B 1JZTA 3K0FA 1O58A 1YKSA 1I94B 4E70A 3VKWA 2IQIA 4CKWB 3I9V6 3HN6A 2BDUA 4GE0A 2ZE6A 1OXMA 1I4DD 2CGEA 2A7QA 3E8SA 3DT9A 4C21A 2WWXA 2QGZA 4M1SA 5ALXA 5IT9A 4LV6A 4OSEA 5DP1A 1EGVB 1P7YA 2G7MC 4KO3S 4DA4A 1BYIA 4W5NA 4A0RA 1VE5A 1F17A 2FX5A 3GVCA 4G9EA 4HDRA 3OICA 2GK7A 1FVOA 3NONA 4G56A 1UXHA 4PY2A 1U7HA 4JR1A 4M8IA 2EIHA 4CIDA 4EG6A 2KI5A 3PGA1 2G5PA 2HX1A 3L1HA 2BFCB 1QOZA 2PANA 4K5QA 3ETNA 3O91A 4Z6KA 4B87A 1YXMA 2B83A 1VYUA 3IDQA 1HX7A 3ZZNA 2GPTA 1BO6A 4HQOA 5DGXA 2OC9A 3BXFA 3RTEA 1F4LA 2HRDA 1OTXA 1I01A 2FP3A 4P4TA 4WTOA 4WN9A 3ZE1B 3TF5A 4IDHA 3C97A 1EHIA 2FX2A 4V1CI 1MXFA 1Y1PA 3CKKA 1DQYA 5EE0A 1JIQA 4E51A 4DDMA 4GWLA 1W88A 2XDYA 2QRKA 5CFMA 2KE5A 1X13A 1YMUA 1B16A 4ON9A 4KIWA 1YC2A 3CXUA 4DLUA 1O89A 4DLRA 3MS4A 3P1JA 2QUHA 3W0LB 4BP1A 2OP1A 1DZIA 3EK2A 3KQLA 3PNKA 3EY9A 4G3XA 1Y7LA 1ZBQA 2Y2UA 1LPAB 1W5BA 3IHLA 2ZB3A 1ACLA 1N5MA 4H4DA 5LMCA 5IN5A 3AFGA 3E6AA 4WOPA 1TK3A 2JLAA 1TF2A 1VL2A 2XUFA 5DYGA 3KTFA 3HUUA 1Z5WA 1BHSA 1KI6B 3M6MD 4OJTA 3Q9UA 1IE3A 3DE6X 2D59A 4Q4JA 1U1IA 4E32A 2HK7A 4EZBA 2DFNA 1RLOA 2H2WA 2ZLBA 1BKSB 1F48A 3O7MA 4LOAA 4RL4A 1FDSA 1Z9BA 2H31A 1AS2A 2WF7A 1L5KA 3RIXA 3ZXYA 4BN4A 4YR7A 1OFUX 1Y3CE 3I72A 2JFBA 3IAM1 5T67A 5CCBA 1ZIXA 2DYKA 4HS4A 4JC4A 5AW4A 1Q74A 3AHCA 3H5IA 4A6EA 2HU2A 3I2KA 5ARCA 4MYSA 2X0NA 3T95A 1UBRS 2QQ5A 5E7IA 4FX5A 5F3RA 1SHLA 1E8MA 1BXGB 4IJ5A 3ASUA 4Z8XA 1EE2A 1XGKA 2P67A 4Z9FA 2C9MA 3SHQA 3JYPA 2QE7A 4CF5A 2JHFA 2PGJA 4IYJA 3MT9A 5JC8A 1PUIA 1ZK1A 2J07A 2Q6KA 3C1OA 3I76A 4FFVA 4PFKA 5JAIA 1H94A 1U8UA 4MRMB 5JVDA 3PLAE 1QR6A 1LVGA 3ZY3A 1KY3A 4RUKA 1VG0B 3UV6A 2ADOA 2CWDA 4F4CA 2ZYWX 2P9TA 5BWBA 2VHWA 3IRUA 3ILVA 2Q50A 8ABPA 3GJXC 3KRTA 1O95C 3RHSA 1TUBA 2H11A 4RYLA 2N9UA 5AUQA 4EMTA 1M5UA 2ZETA 1GLVA 1N0VC 1UBNA 1NTOA 1HYGA 1XCPA 1JLLA 2VEOA 4L2IB 3WIUA 5BW8A 4G0PA 4Z5XA 1DV1A 5FL7D 3U4AA 1ZC3A 3ZD6A 1NMZA 2C4WA 3W6PA 4HX9A 4DT1A 2G4LA 3FWKA 4YCBA 3CISA 2P90A 3NHPA 4D4LA 5C8YB 4OKSA 3R3JA 4J7CA 4Z7JA 2JS7A 1QH8A 1IJKA 1QVZA 2EKQA 3KT8A 3SS9X 3WNDA 1YONA 2Y0PA 4RBNA 5DGCA 3M3DA 5GJBA 4LK2A 4O0LA 1NASA 3H42B 1L3IA 1SC1A 4FFLA 2XQJA 4HNVA 3GO4A 4IIJA 5A0VA 3C43A 4J2OA 3OJXA 4C76A 3ICQB 3LNCA 2XMDA 4DIBA 5F7ZA 1E8NA 1NI4A 4FCWA 1E3SA 1GEGA 2YUTA 1PFVA 1LF0A 1LLDA 1T8RA 4DLLA 4MZDA 3SG0A 1DLIA 3GT3A 4BB6A 2C98A 2XB4A 4BQOA 2HSJA 5HZHA 2VF4X 1P1KA 1K8XB 5AM5A 3M4YA 1M6WA 1R7RA 3LX8A 3RC2A 5C1DA 4N18A 4K1XA 4Q24A 5JS6A 3PHHA 3NEJA 1NZFA 1VB5A 4PZ9A 3LXMA 2P6RA 1ZD8A 1U0FA 4GM1A 3NWJA 5JSUA 1WZNA 2EATA 2I6UA 3OIFA 4I5EA 3WWOA 1G8MA 1M1ZA 5DTJA 3Q3VA 4G63A 3PPYA 4G89A 1A9TA 2C58A 4Q66C 4BWVA 1U3FA 4WZBA 4O2AF 4FSDA 1BCSB 1PNTA 1ZQ1A 3D4LA 4H16A 2BEVA 3TX2A 2X8AA 3O4HA 5FI0B 3DHYA 2BI7A 4LMAA 3GD5A 2E85A 1N7GA 1U1FA 3OP1A 3MTQA 4M86A 2QPTA 3WGOA 3INRA 2QROA 1UZAA 2BMDA 1BFKA 3M6FA 3CG4A 1HURA 3JVVA 2J7PA 5J2TF 2C7PA 1U2RA 3JQDA 1SZCA 4B85A 2QTFA 1NR1A 1KQGA 4LPKA 3LP5A 4AJOA 2NO9A 3PNBA 3AG6A 4C6SA 3ZDDA 1MD9A 4OHFA 5JOQA 2BM1A 2CYAA 4FGWA 3M3PA 4B31A 1Z7GA 5ITVA 4KHPB 1XTTA 2GJ8A 2XZOA 3L1VA 2R6HA 3CT6A 1GAJA 4IS2A 1ULAA 3ROQA 2HV8A 4KVFA 2FZGA 4WHMA 4LFAB 1NQXA 1Y34E 2R1VB 1X92A 2PMWB 5KOHB 3RRJA 3TE7A 1KSFX 3LLSA 4IJVA 4UTPA 3TZBA 2WD9A 1T9AA 1EVKA 3U3RA 5KTOA 3Q0IA 1IONA 4F12A 3IMGA 3O8OB 5JAPA 1M2NA 1SZDA 2A30A 4ZQEA 2CB9A 3S55A 1XLUA 5GM2A 5A7FA 2F3QA 6NULA 5DHAA 1KL7A 2R47A 1IPHA 1ZHOA 1V2GA 2AKYA 2PKWA 3L0OA 5EKXA 4X7BA 1U0RA 2FNAA 4WZBE 1SKQA 4IQ0A 1FFCA 4ETIA 3SIXA 4A9AA 3AJ9A 4WY8A 4CM4B 3Q1LA 1BXZA 2E4ZA 2XUZA 1R66A 5CH5A 1WXXA 3K1AA 1Q2XA 2I34A 4H4CA 1J7KA 1UOQA 5BN4B 4H15A 4PLVA 2Z4SA 2NYVA 4ZOCA 4CBVA 2C8LA 2H4HA 3JAWB 1XVLA 2NO7A 5JZOA 1H2ZA 1RLTA 2JEZA 3DQPA 2C96A 4O4LF 1GGEA 5TGZA 3ORYA 1GRVA 3BK2A 4LQDA 3PYMA 3OPNA 2NPIA 3VISA 4CLXA 4D0LB 1YDGA 2MSLA 2WJVA 4NU6A 4TMFA 3QX9A 1SCNE 2FE1A 4ISBA 2EFEB 1BOOA 3R9IA 1D3AA 2FZWA 3R9KA 1J5EB 4BB5A 4FE7A 3R3ZA 5LA6F 2FCAA 2HWKA 4TT3D 1W1UA 1CETA 2YCLA 3FDXA 4Z8YA 1XAIA 3GLFB 1ZVVA 3G2PA 5GGYA 3EGIA 1RYHA 3GMDA 3PQ5A 5I9BA 3K9BA 2GCNA 3QELA 4PBTA 5G0UA 2OYRA 1OT3A 3B3QA 3DEHA 1PEKE 1NW4A 1PSDA 2F3PA 5AVWA 4WEOA 1ZD1A 2G04A 2WABA 1L5LA 3JTMA 1WETA 1PT5A 1G8GA 1X7WB 1YFJA 1SXJD 1NLUA 1CUSA 4F4JA 5IJ9A 2OO5C 2FW6A 2I2XB 2PFSA 5FLYA 1STOA 3GHHA 3QZUA 4DSOA 2PAAA 3F7OA 5DGTA 3I05A 5BSMA 4BZXA 1OA0A 4NMHA 4ZEVA 4BMVA 1OXVA 1Q95A 4J6FA 1GG9A 2ZIXA 3KYDB 4MUNA 5E8JA 2W2KA 3RRBA 1XEAA 4DQVA 5CDTA 4KQHA 4OGWA 1JJFA 4M7OA 3WRVA 4HMPA 1H8HA 1WDKA 3O8DA 2FRDA 4YI5A 4AKSA 4D3XA 4W1SA 2AHOA 1PDOA 1NSYA 5LP6F 2XAAA 1CULC 2FE4A 2PQ0A 3DHVA 3IXMA 4UMVA 5CD1A 3TEJA 1TPYA 2QYTA 3FOCA 1PT7A 2OLKA 2IYQA 5LKRA 4M8NE 3DMRA 5K4AA 3FGPA 5GONA 4NXMB 4BS9A 4D80A 1P77A 1W5EA 3L8DA 3MOGA 1YU9A 3R3XA 4JJKA 1CF4A 1O94C 3LQFA 4AROA 4FYMA 4MWCA 3UMGA 1BXKA 3W9SA 1RTTA 3QEMB 3R0QA 1AQLA 2ZPUA 1DDIA 2P9FA 4TVKA 1OI4A 4YB8A 4N65A 5G0WA 5KTNA 1I2AA 3B1XA 4L8YA 1VPVA 4X8HA 5HHTA 4IKOA 4J0QA 3T1VA 3U9TA 1T0PA 1WO8A 3NKFA 5EHXA 1NXXA 3U5ZB 3UPUA 1D1PA 2HJRA 3JVUA 1BFDA 1CF9A 1PZGA 4FYKA 2AF3C 5ALFA 3PD1A 1G3IA 2IKSA 1FMFA 3LL7A 1DBSA 1MRZA 3RG2A 4V2IA 3TUJC 1NBMD 1S6YA 1ITZA 3EQZA 4L07A 1RACA 1XVAA 2ZSDA 3QVOA 4R7GA 4EIWA 2WD8A 1V25A 1OXUA 4MUHA 2JGIA 3MIIA 5CX4A 2B4YA 3ZK8A 3MRXA 4BO7A 1ODFA 4CVNA 1EINA 1ULTA 1U9CA 3IXLA 1EGMB 4LYYA 3EPRA 1MA0A 3MS2A 1D2EA 3T1TA 4HHEA 4ZVMA 3HWSA 2E55A 2XRMA 4XM2A 1MX9A 3Q88A 4LCBA 5HNKA 2I4OA 2WSBA 2QQ0A 3QM1A 3Q3CA 3GARA 4MP8A 5CXUA 2BR3A 1EEHA 2H7VA 3TTSA 1JDTA 5KKCA 5HQJA 1Y5NA 4WK2B 1NW9B 4UZEA 4ND4A 3O8QA 3C7CB 1LBHA 1KTIA 1V11A 3DTTA 3PIDA 5I7HA 3U5TA 4KBYA 4D2IA 3PFHA 1VHLA 1RWMA 2AW5A 1M2VA 5IFKA 2GXQA 2H2FA 3GC6A 1P75A 1E1CA 3PZRA 1C3VA 3PCXA 2GF2A 2BFNA 5E4YA 4NTZA 5I5EA 4Q12A 4IDEA 2IZ0A 2R7LA 3C5WP 3U44A 5FPHA 1QFMA 2V5AA 3A11A 3FE2A 3E3LA 4PXSA 3CKYA 3HVJA 3I1IA 4LSMA 4IIUA 2AXEA 1E5QA 1VI6A 1DG9A 4RY0A 2IT1A 1Z35A 3L18A 4ZYUA 1PG5A 1UMBB 4FBGA 4Q00A 5JV5A 5AJTA 4N48A 3DO6A 2VVTA 3MRVA 2X9VA 4IILA 4NZPA 3AFHA 3ZS8A 5A2QA 2XNDA 2B8EA 1WXFA 1X7HA 4QG3A 3VZCA 3EARA 3IV7A 5DXAA 4E09A 3FZNA 1BGWA 1W9HA 2B37A 3QVGB 3DVAB 4KP7A 1ORTA 5CVUA 3SBEA 5JASA 1EP2B 4A2QA 4OYRA 1XAGA 4TV9F 5F23A 3QXJA 3IUYA 3C48A 2AFIB 4HS9A 4LE0A 4KR0A 4X8OA 3WYFA 5IH7A 4KAJA 2I7VA 3AG5A 4G0ZA 5IJZA 2M6LA 1OGIA 2WWWA 2Y71A 2QY6A 2G70A 3ORRA 3GA0A 3MTJA 1GCAA 1HBJA 4BGUA 1DFGA 3JW8A 3P9XA 4YWJA 4JWTA 1YNOA 5FIUA 2OORA 4IXTA 2JEOA 1D09A 4KEAA 5ALYA 2IV2X 4DCSA 2C3MA 5EESA 1OV6A 1Z45A 1J0AA 1R0RE 3L3BA 4C3UA 4DZRA 3I2FA 3IIIA 1IN4A 1VL5A 4FHDA 3SLGA 2O8DA 1A98A 3AEKB 4ZQHA 1RYEA 1RRPA 4EVRA 4X84A 2D0PB 5CDYA 2E18A 4C2TA 2PX3A 2IWRA 3G2HA 3N2IA 4MV9A 3T5GA 5A4FS 3AR5A 3X1ZA 5IH3A 1ID1A 2IVZA 3O9MA 4IOLA 5EFZA 2GSWA 1AUQA 3ZC3A 1U5AA 3RR2A 3FTEA 2V7UA 2QQFA 5BQ5A 1T25A 3A6FA 3C8DA 3O90A 2Z1NA 4KQKA 3E1SA 2G4CA 5LDGA 5SYAA 4KO1S 3A0UA 5ES3A 2FY8A 1VBNA 4PTZA 3RVLA 4YLGA 3W1VA 3WXMA 1G0NA 3FN4A 4I9UA 1PVOA 5EOVA 2YL2A 5EI5A 2QRZA 1JHOA 3FUWA 3JU3A 4ZT5A 2H17A 4AIRA 5GVSA 1QTNA 2QB5A 1XVUA 3IEVA 1RT9A 3I9MA 1Z17A 4RHCA 3TW8B 2WUWE 2UZ1B 3H6GA 3FAZA 3EW7A 3PITA 4OF4A 2Q2NA 1JIJA 3FNBA 1E98A 3KG2A 1MGPA 1II8A 1ENPA 1YV9A 2AXNA 421PA 3E9RA 4QNRA 4BNZA 3D6FA 1W0KD 4O5OA 5E1DA 3SX2A 3IEKA 1GLNA 1UPXA 4B47A 2BCEA 2QR5A 4IGKA 4J4BA 2BFBA 1E2FA 3G02A 3HJFA 4TKUB 2JGKA 5CNIA 1PR6A 4EVQA 2IGBA 4K3VA 2C7RA 4HVAA 5JD3A 2C3PA 1W76A 2DY0A 5K3SA 1UKEA 3H04A 3FCUB 5DRTA 4ZEXA 1FYWA 2C94A 3FNHA 3DFUA 1GSOA 1KY2A 1MTOA 1TLTA 4RD1A 3NFRA 3TIGA 4AWBA 5F7XA 4ALJA 2V6BA 4RV9A 1LWOA 1ZO8A 1EK5A 3T06B 3SHFA 4KQ9A 3HEMA 3ASVA 2ABWA 5DISB 1YAHA 2WSLA 4AJJA 1OSNA 4D9JA 1F9AA 1XQWA 4ARVA 5DNUA 1JEJA 1QVRA 4ZO9A 4YNBA 4Q4CA 1QHIA 2YIJA 3H9UA 3QKIA 2MSWA 4PONA 4UVEA 4D9BA 3HO1A 1ADCA 1GA4A 4XGNA 3RQSA 2X9GA 3LX6A 4O5AA 3IELA 1RM5A 3MMNA 2YZGA 3QMMA 1FUEA 1QGUB 4DNXA 3MPOA 4DQDA 2UXCB 1WUYA 2XMGA 3D54D 2FMIA 1TO1E 4FLEA 2B6NA 3T5TA 3TRIA 4J94A 4DR7B 4Q1FA 5C7IO 1L4FA 4ITRC 3P9QA 3CLSD 2V74B 1KF0A 1DJNA 3GOQA 4KKXB 4KQMA 3H5LA 4BFLA 3IQFA 4KMRA 1G21B 2ZSHA 5CFZA 1JQ5A 2D3TA 1I10A 2QRGA 1FJ2A 3PHLA 4JLOA 2AWOA 5JNVA 3KSAC 1WX1A 3DBRB 1IXKA 1JHMA 2ORIA 1KZ9A 4N6GA 1LKZA 2W70A 1W25A 3CZPA 3VPGA 1U1DA 3OJ0A 3WNQA 1IJBA 2QX8A 3DE7X 3VR4H 2DEUA 1KFJB 4OXIA 5COBA 2FYTA 3DW1X 5FPKA 1QDUA 3FTDA 2EW8A 2XMQA 4YMWA 3FNFA 3C6YA 1XIVA 3MOSA 2P2NA 1PFYA 3D8UA 3UK6A 1WV0A 4GGMX 4LZJA 2J7KA 3UB3A 2A5LA 2PKQO 3EXFA 5JDIA 4TWZA 2JLRA 2QK4A 3LHIA 2ZJ3A 4PR3A 1SQ6A 1KTVA 4DRYA 4V02A 1NVGA 2VPYA 1HDXA 5TPZA 2R62A 1G7TA 2F1IA 4DR6B 4HH4A 4NZYA 4F8EA 3MWDA 2NV2B 3K2EA 1NYQA 2G17A 2A86A 1QIKA 2Y67A 2YNMC 2YYAA 3A37A 4X1OA 2I2AA 1MO4A 2NG1A 2O8BB 3HCOA 4QTZA 1RXEA 3ZLBA 1SC4A 2AOTA 1N0HA 2GYVA 1N1GA 2PWZA 4E2FA 2B36A 2CLLB 4MLPA 4ZQBA 2PA3A 2HPZA 3ZY6A 1Z2NX 2IHYA 3WZLA 3LSTA 2DFPA 4PG7A 4UD6A 5EWMA 2WJHA 3C4QA 4YMSA 1AHNA 2DQZA 3H8JA 4JLNA 1X2EA 4Y0AA 3JYHA 4YTEA 5SZHB 3JARA 5HILA 5JO9A 4IDNA 3HCRA 2FDXA 1Y8RA 1DC4A 3DHWC 4QGAA 3DLHA 2J0QA 1DEKA 3AFIA 3BRCA 4TQAA 2IUEA 1WLYA 3O3NB 3IOCA 1BDJA 1N9GB 2HN9A 3LUJA 4US1R 3VXKA 4IX1A 3HZHA 4QJIA 1S8AA 1ZNZA 1P0QA 2ZBGA 3CNLA 3PUKA 1RDFA 4G0NA 3RTCA 2LBPA 3ESDA 3I01A 2BELA 4G67A 3ROMA 3UVEA 3WLQA 3CLKA 2O8CB 1CZKA 3KBBA 4EYSA 4OHMA 1JKFA 1WSBA 1Q2UA 2GRAA 3ANSA 4MGEA 3ZJ4A 4CTKA 4RS4A 5DHTA 5KREA 1XYYA 1B0PA 4FC7A 2AJ8A 4UEQA 1RMYA 1G3QA 3HTXA 2Q0QA 1FRNA 3RRFA 1U5BB 5JTTA 1KO5A 1TJYA 2I3GA 1C3OB 2JA2A 3EUFA 4LBVA 2XRYA 5IKPA 2YHSA 4LDAA 3OT5A 1WQ1R 1NKSA 4HLDA 1A8PA 2EEPA 3RS4A 3I42A 4MDEA 3DKIA 4FGLA 4KH0A 2W22A 5BWCA 4NX2A 4NBVA 2OSBA 4LGCA 4OJQA 2ETXA 3BBLA 1OBFO 3QVKA 3RFTA 4E5SA 3VZRA 2VJPA 1H2RS 3IILA 4WZAA 1U8FO 5LQCA 1V3UA 4XYEA 5FWXA 3V46A 4EGCB 5A0TA 5DM60 1ZRHA 4WCFB 2B2XA 1WXEA 4MXDA 1W85A 5FJIA 5TVKA 4LHVA 1LLCA 1NBEA 1NQVA 1XZCA 3FF4A 2GM3A 5HZMA 2IH2A 2AEEA 4BE7B 3HKBB 1QF9A 4HDOB 2IEBA 1M7HA 4OGLA 5EFOA 4JQOA 2JLVA 3T38A 1J24A 1EWYA 3V1YA 1UKZA 2XDWA 3E7PA 1WTCA 3B51X 3LKBA 1RBZA 1F2UB 1KK0A 2PXCA 3IPRA 3ON5A 3HZZA 1N2HA 3EAQA 4IWXA 3RWMB 1LWNA 4QVGA 4RJKA 3W4IA 5JI2E 2IHJA 3EHEA 2JGMA 3FHTA 1VKRA 3EBOA 1C30A 2GTHA 3C0KA 3ZZ1A 1E3EA 3PDUA 4O1IA 4BPRA 2V8BA 3NQ41 1U0LA 2JNWA 4YAOA 1BW9B 3K4QA 1WJGA 3FOEC 5AVOA 4I9GA 4JP5A 3GA7A 4MV8A 4BFWA 4P33A 4JLPA 3A9SA 1CEXA 3CUSA 3U37A 4R0NA 3SJUA 4G24A 2QQEA 5JWRA 3N2GA 2BHRA 5BSUA 1PFQA 3R7WA 3NUZA 2NUAA 4WZAE 1RE0A 1X39A 4O02B 1ODCA 1HDGO 4I6EA 3F67A 3DBHB 5EIFA 3GQVA 4CCSA 2R68A 4PPNA 5F21A 2RH9B 2GJAA 2ZTHA 3AUXA 5FPQA 5L3RA 3MQFA 4H7DA 4OQDA 1G1MA 2DLNA 2HJVA 3A05A 4NEHB 1JEQB 3IUBA 4EEKA 4HL6A 2A14A 4MS1A 4DBLE 3U48A 3WK4A 4TL8A 1JSLA 2J9FB 1M34B 3DS8A 2WR8A 1JFTA 1OXTA 1ZMOA 1DFIA 3SHTA 3TR0A 4AZTA 4CKBA 1EJBA 3NBZC 4TYYA 1PDWA 1RXUA 3OZDA 4K6GA 4ZI5A 4ILKA 4FYPA 2PX0A 2ASEA 3SQXA 3LT5A 2J3JA 2OUIA 4NNJA 2A0FA 2QLFA 3CUVA 4LOIA 4DSNA 3S5JA 1EE9A 2WKSA 3BK1A 4LDZA 3OC0A 4S35A 4BLRA 3DF7A 4CI9A 1KY5A 4WADA 3U62A 2WB4A 2BMFA 1VMKA 3W1EA 4KVGA 1YZTA 3A9UA 4BNFA 2RC5A 3K7EA 3SIRA 2AIRA 3PXCX 3BWDD 1FUYB 4LSWA 4WZZA 3FYHA 4LK3A 4DJDC 3SIPA 1G16A 4XEHA 4BQIA 5A9SB 3HUFA 5JAHA 2DM6A 2DSTA 3I34X 4PX3A 1JLHA 2VNIA 3L7KA 1WPQA 3BMOB 5EE9A 4BU0A 1Q92A 4F85A 5H59A 1SCJA 1OLSA 1ZCJA 3WBFA 5FWYA 5HOEA 1UMDA 4FGZA 4YREA 4ZGBA 4W1RA 4X7RA 4ND2A 2DLDA 3G23A 3I6IA 2EFYA 5AK5A 2IP2A 3CRMA 3VU9A 1W36D 2ACVA 1E96A 4UASA 1ISMA 1S3FA 3ZCPA 3ADPA 9GPBA 3R9XA 3AF2A 1A7UA 2EV9A 5FWDA 4FKBA 1E3DA 1LPNA 3BDVA 1E7RA 1T8TA 2CDBA 3DDNA 2H3EA 3ABIA 2XCUA 3PFIA 3QUQA 2B34A 5DCLA 1GVNB 4C1NA 1IEQA 1LV7A 3BVPA 2W6ID 4RD4A 3QXHA 1ID8A 2R5WA 2OZEA 3ICVA 1BVUA 1KZYC 4G4JA 3VX4A 3BMQB 1Y6JA 4YRZA 1OWMA 2NMVA 1G5FA 4MDHA 2DFTA 4L9RA 3LLMA 4ML3A 4X90A 4NCBA 2Z0MA 1ZK2A 1J2TA 3D0QA 5AOBA 5FB3A 5BV0A 1SXPA 3CH5A 1JEAA 4HX5A 5E0OA 4LQLA 5FORA 1ZM2A 2JZCA 3GROA 4RKYA 3OFNA 2AI3A 3DL0A 4ZRDA 3CFYA 4HLUC 2I3AA 3OQHA 3SE7A 4RGBA 4DS3A 1CRWG 1V3TA 1JR3D 1KKUA 4HUQB 3O84A 5LXTA 4GP9A 4TWIA 2OMKA 1Q16A 1V4NA 3ZQJA 4W5RA 1D6SA 3Q0TA 1E5DA 2W58A 3KZVA 3OI7A 3D3KA 1EAYA 2V54A 1GZSA 2C03A 1F2VA 4RPKA 3RHZA 4QUEA 5BMVA 5BSHA 2JCBA 2VPIA 5EVCA 4DANA 1FP6A 1GUFA 2QNBA 4YJHA 4D96A 5TF4A 3NVMB 4O4HF 3PDIB 1YR9A 4MICA 4EUHA 2FR0A 4DWVA 3HJNA 5BN1A 1Q0HA 5AQEA 3DC7A 1VHWA 4NBRA 4EABA 1PTJC 3DAHA 3WAGA 2F7SA 5TC4A 3DFMA 3FHLA 3P2OA 3LBYA 4P7GA 3WL8A 1XF9A 2LNDA 5EUCA 2ZZKA 4ZVLA 2ID9A 2UAGA 3KD2A 3C1TA 5AI6A 3K2IA 1A1VA 4Q5IA 2IOFK 2Y1FA 1T8PA 4N82A 3FFTA 4KMOA 3ENWA 2Z2IA 1XE3A 2OCBA 4RVUA 4WVLA 3RSQA 1AN9A 1KXZA 5IN4A 4ZMRA 4BRUA 3OJFA 3S40A 1F9EA 1CY0A 2ES4A 4UU0A 1EWVA 3O4IA 3ZQ6A 2ZRFA 2Z1MA 5AVRA 1B41A 1ZH0A 1D4ZA 3QVMA 2OVFA 2B2NA 2Q3EA 3ONFA 4IUBS 3C3YA 4GRDA 4DOMA 5IKXA 2BFFA 3K4HA 4IO0A 1N2EA 3S2GA 3ZVRA 2ODAA 4RK4A 5KSWB 3HCBA 3BKWA 4NYMQ 4UBLA 2VPPA 1XLWA 1JG3A 4I55F 4IL5A 1XELA 5E7MA 1JTEA 3PNLA 4WSOA 3VHXB 3K9GA 2YXNA 2ZB4A 4BMOB 2G67A 3IJRA 3PPWA 3CX7A 1F0PA 3RF7A 1AF7A 1RWOA 1VBKA 2Q2OA 3EXEA 5FPTA 3WGLA 3ZPXA 4C4YA 4W5QA 2QW0X 3V97A 4IGAA 1NT2A 2DU8A 1HDCA 4AJEA 3J80A 5B4TA 4BNDA 2Q6OA 1ONBA 4DPLA 4URYR 2X41A 2C07A 3ZQUA 3WMEA 5FUWA 3U7GA 2FMKA 5EP4A 4DXDA 2IH5A 5KYNA 2HBRA 3THXA 3C4JA 3CLUD 4A16A 2NSJA 2ILVA 5A4MS 1RVV1 1MB2A 3AIMA 3ZEIA 1MT0A 2XLCA 5EIXA 1WKBA 2OUKA 2JI8A 1L6IA 2J45A 5ALSA 3RRNA 5DM0A 5I9IA 2FSHA 4B81A 3G89A 1LSOA 1KVRA 4PG8A 3E84A 4ZZ0A 3ZDAA 2QI9F 2DETA 4E1VA 2JH3A 1F14A 4C4XA 1EHYA 1GQFA 1U3VA 5E2BA 2R5NA 3KEGA 4F60A 3NKLA 3F49S 1JNYA 3O5AA 1N5OX 4L0QA 1AA6A 2FZKA 1WHTA 2V4MA 4RS3A 4C4SA 5J1SB 2Q9UA 4OAQA 2C00A 2VI5A 3OBIA 2GPWA 3A27A 1YQ9A 2EZ9A 1QUEA 1Z5OA 2QM7A 1X8JA 2HA6A 2YN0A 1DP4A 3E1KA 4PFSA 2ATVA 2COKA 1B8UA 5ALRA 1JAYA 3PA8A 5JNLA 1TQ8A 1U0NA 1V48A 2IPAB 2OOKA 3ZLUA 2Y2VA 3DMDA 1E3JA 3L6CA 3KEFA 1JXOA 1X8KA 4BNMA 3AINA 5HGJA 4D79A 4HRAA 2FG6C 3DTVD 1Z6GA 3REQB 2IXBA 2E48A 4DC0A 3D2BA 5CLJA 3GDWA 1KAQA 3U3JA 4ALIA 1CVIA 1VYHA 3OZWA 4FUTA 1XLTA 1C41A 1N8KA 3EF3A 3ZLVA 4CMIA 4OX9B 1E2PA 1AUPA 4II3A 3TNDA 4YMTA 1MH1A 4B3CA 5IEJA 4PHCA 4QICA 1X0VA 1XZJA 3UCEA 3ENVA 4PQFA 2RHBA 2XH8A 4O4JF 3KZMA 4QGBA 4QDZA 5T4BA 4XQCA 4ISCA 2CT8A 3MWKA 3P5SA 4PG4A 3IX7A 4G0QA 4QECA 1Q1ZA 4BKQA 4PIPA 1K66A 4QAQA 1OYVA 4ZU1X 4WKPA 2P5UA 3FMVA 4MO2A 4BQEA 5B7QA 4Z86A 4CV2A 5KOJA 1Z39A 3A3OA 1EBUA 1SQ5A 3EBLA 2X8WA 4LEIA 2ODQA 5KC9A 2WG2A 4PSVA 4ZI3A 2YOHA 3L8ZA 3B9BA 1RKQA 2CB0A 4GKBA 1OUMA 1U3GA 5B5SA 1BIFA 3OESA 3GBSA 1PR2A 1J2YA 1QYIA 1M2OB 3NHBA 4C7BA 1DZ3A 1HE2A 2GZ2A 1UT8A 2HTEA 3BMNB 3DWEX 3JALA 3QI7A 2ALJA 2CL5A 2W6MA 3GGJA 4JLMA 5DCYA 1OTYA 1FJHA 3M4JA 3IALA 4DDHA 1Z63A 1UP6A 2HUNA 2GAAA 2BEWA 4E5NA 3THYA 1VHQA 1ENOA 4NZ9A 4ER6A 5JATA 1UZUA 4JL6A 5C18A 4I5DA 3PHBE 2H6EA 3A1UA 5GP1A 5DV9A 4B6RA 2UUOA 4MYRA 3NV9A 3W6UA 2ISCA 2ZVPX 1Z8FA 2YRXA 4IJUA 1O6BA 1C2YA 4HXFB 5TDHA 1ZINA 2I4TA 4BEJA 1R16A 3FCSB 3X2SA 1ANKA 2WWGA 1CKEA 5TGTA 2O57A 4NBUA 4QYIA 4DLYA 2VDQB 4FIDA 3SZ3A 1GAWA 2AOXA 2GCOA 1F8GA 4EYOA 4NICA 4EYEA 1OD6A 5EY5B 4W5TA 5F9HA 1DAOA 2HA0A 2AOUA 1ZMRA 3IR5A 3T3HA 5EQJB 5A5GA 3ASZA 3VX3A 4EL5A 2O0HA 2ZAYA 3QVVA 5JWOA 3SF8A 3VU3A 3NIDB 3GZNA 1G3UA 4C2BA 2ZWAA 4Y9DA 4EKYA 2C5GA 1RPTA 3OQBA 4LDRA 4LVCA 1DARA 1P0PA 1TJ4A 4Z1MD 4LX8A 1WXIA 3KPYA 1W59A 1CLEA 1UT6A 1B00A 2ZB2A 4WN3A 2GDJA 4B79A 4K87A 3S3TA 3U80A 4XWGA 1US8A 2R84A 3V1KA 3Q15C 4IXMA 1O5TA 5JPIA 2GEFA 5JLAA 5EQFA 2I6GA 2O6LA 4LOJA 4QPPA 4ZDWA 5P8WA 3GNQA 3U17A 2PT9A 5CMLA 5EJ7A 1K86A 2C61A 4TUYA 4GLOA 5FQOA 4EQ6B 3T9BA 4F5YA 2DCMA 1ICIA 4UDXX 2JLXA 3QV1A 5G0VA 1QH9A 3L7CA 1P1JA 4Q9IA 1T1EA 2HJSA 2HFJA 3CRW1 2XVZA 1PFUA 3E48A 3S29A 2KMLA 5E9QA 5B30A 5HJEA 3TG2A 3MMSA 2R79A 2ZBDA 3ZXSA 3CIOA 1FBNA 1PHRA 1L5HA 1K75A 1FTSA 3DV0B 5CDUA 3FHOA 4GRAA 1E9SA 3L6RA 4FMDB 3MJEA 5CH8A 5BUCA 4QU5A 3HLYA 1GL7A 2NVUB 4HAWA 3S1AA 1DQPA 1M6HA 1P4HA 1E2KA 2XA1A 5JMTA 3ZDEA 4K9LA 2TMKA 4DZTA 5BW4A 2Z58A 1IQRA 3H3FA 1XCGB 1Y4SA 1AS0A 4ZDJA 4Y6SA 2FPKA 2OEPA 2OAGA 4JMPA 2BZSA 3MXTA 1ZL0A 1NW5A 5C2JB 1VJ1A 4RZ2A 1WBBA 1CR4A 1KAMA 4Q6BA 3BRQA 3FR8A 4A8PA 1U8ZA 1JAIA 1EFDN 3BRSA 1IHYA 3IBCA 1JL3A 3DMGA 3ND9A 2XMCA 4WINA 2ANCA 1I32A 3FMIA 3UWDA 2CXPA 1DTEA 2KQUA 4KIGA 4RPLA 2FV8A 2WHRA 4HQNA 5G02A 1B6GA 4EB6A 4IMJB 1SXJE 4BKPA 4GE3A 1JI3A 1Y4AE 2CLSA 621PA 1WZEA 1FVXA 3NATA 1U6JA 3T54A 2L2QA 4HQFA 4BNJA 1QQTA 2CXTA 2IC5A 3CLTC 5H1YA 5K3DA 2AYYA 2A4MA 3BXZA 1UADA 2BMWA 2PAFA 4IFBA 2ZBEA 3ELDA 2PU7A 4KH1A 5TQ2A 1QQ5A 1GZVA 2H57A 2EFCB 3QVWA 3C8UA 4MVJP 4TTQA 4FP9A 4U0JA 4R83A 3OD5A 1NLMA 2C4MA 2GS9A 3MGCA 4GI1A 5JVDF 1EUYA 2VJLA 2P9QA 3AESB 3SZOA 1DPGA 2XUJA 3W2EA 3R8CA 3TTUA 3X1WA 1O5OA 1BWRA 1XP5A 3QEOA 3VR3D 1KIFA 1KZ4A 3P2JA 3UATA 4NYIR 4R3NA 1Z6AA 4FEGA 4IIFA 3FB1A 4RM3A 2VUTA 1AK9A 4XARA 5EINA 3SDSA 5IJWA 1VLQA 1VFPA 3ZEAA 4QFMA 5DHFA 1XRSB 3CN7A 2C1ZA 4BNKA 1U31A 2NNLD 4AS1A 3F4BA 3P71T 3EXAA 3QF4A 1I0LA 5G1OA 4E1AA 1ZA2A 1HQKA 2G4VA 2NVWA 4YDHB 1JYSA 1BGXT 3OEHD 5D7NA 1NJ6A 3ZTWA 4GGOA 1NQ5A 1N0IA 3DEFA 2AG5A 3MELA 1I80A 1EESA 1M34E 3L7BA 2B5VA 2V5UA 3I0MA 1PFKA 4Y9RA 4IWYA 4RELA 2SCUA 4XWTA 1PJTA 2XCTB 2PTGA 4QQKA 3RU9A 5TT1A 2JCVA 4TRNA 2FMUA 3GT4A 5C53B 4RH3A 3ZUPA 4J49A 4LJ7A 1KH1A 5ELLA 4ABYA 3L7LA 1Z6XA 3O8BA 1FFXA 4TRMA 4RGVA 2QP3A 2XSZD 1T4GA 4NC9A 3AB8A 3R5FA 1K4MA 5DXFA 1BE8A 1JE1A 2RI1A 1NBME 1UFVA 1ZAYA 1C1DB 2Q5OA 5DNDA 3WGMA 4TWBA 3MAAC 3G5MA 1A97A 5HBRA 2R4QA 3KQQA 1Q0RA 3T5CA 3HO6A 1YR2A 1DKMA 3CINA 4GF5A 1ES9A 2QD2A 4HAIA 5ALPA 3V34A 3L4BA 4LDJA 2EKPA 1A2QA 3ILXA 5ALUA 5EZQA 4BX9A 2BJWA 2YHAA 4EG4A 2HHAA 1EFVB 1CQIA 4D0SA 5CB8A 5HYVA 3RYCA 1CBUA 3PYLA 1LY1A 1UBKS 4AS2A 2DHRA 4CDRA 3G5TA 2W90A 4WCDA 1Z26A 2RONA 4UEWA 2C5LA 4DQXA 1A3CA 1TNDA 1KPIA 2GPSA 1QGZA 4GOXA 3T4PA 3MILA 1QCYA 1UBOS 1OLXA 4I50A 4MP3A 5FBRB 3U31A 4DSTA 4JNCA 1JG4A 2J5XA 2QLLA 2QTCA 4HDQB 3WB9A 1N2CA 3EUWA 4AZVA 2RH8A 4QULA 3TNFA 1A27A 3HDGA 3A6JA 1CZLA 1LX7A 2YVLA 1PSWA 1AKWA 1NPYA 3G2IA 1BD4A 1ZD3A 4U1RA 4ZU3A 3ZGZA 3MNFA 3WYEA 4OPMA 4BO8A 4G5SA 1TXGA 4GIBA 4TXLA 1I2MA 2WFAA 4OK6A 3GRRA 1I6WA 5CPBA 3VI4B 2D2FA 1I2ZA 1Q0ZA 4L3OA 4D3ZA 4BV3A 3E15A 1YSCA 3H8WA 1FFBA 3BN3A 1OB2A 2OHOA 2ZAOA 1R00A 3ZCXA 5KJ1A 3JQCA 3JWGA 3IBSA 3UV3A 1QG0A 3ZWDA 2G1AA 4JXKA 3Q0EA 2I7TA 4QUBA 4R40A 3PPIA 1TO2E 4BZWA 3DAPA 3OZRA 1OI2A 1FDVA 1IBCA 5FA6A 1YE3A 3ZJTA 3U39A 3D2CA 2O3SA 4ARZA 1XTKA 2O7VA 1SKYE 4DEYA 4RORA 3TW0A 2V45A 4FQ5A 1BRTA 1J2JA 1CW2B 3G8YA 1NHGA 5L3VA 3GYBA 2UZIR 5LR6A 1P2SA 1QIIA 5CB4B 4GI5A 4MQ4A 1LDGA 4WCFC 4CM8A 1T8WA 3WXBA 3OTWA 4JYBA 4LVUA 4PHTA 4Q7MB 4IJQA 1F7VA 4L5AA 3M6VA 5CM9C 5E1OA 3VR2D 4D9KA 1JR6A 1M7GA 3IA2A 4JASB 3M5PA 4J90A 1TM7E 3VYSB 2AC2A 1AH2A 3UPDA 1IB6A 1N2CE 3WYGA 4CU2A 1SBHA 1NVMB 4GVPA 5HF8A 3ZE0B 2WKQA 5K3OA 1NJ5A 3T9DA 3UTDA 2WG0A 2FEWB 3R0VA 2ZTVA 4F4UA 4NJEB 1YGPA 5T64A 1FYDA 2O1SA 3B13B 4ND5A 2QPOA 4QDOA 3WRXA 1RHKA 2X1LA 3JX9A 4JK3A 3WYBA 2ZE5A 1P2FA 4N7MA 1O57A 5BR1A 5BYKA 2AE1A 2Y1GA 2QTLA 2ZBRA 1BCRA 3A06A 1XRPA 1R0LA 1NJSA 3BJEA 3TBHA 3GUCA 3VU8A 2ODPA 2KW5A 3QVJA 1QP0A 5BSTA 2OM6A 3IUMA 4I6GA 4P98A 1WUJS 2ASVA 3V00A 2I1VB 1MKYA 4DA8A 2BV3A 1NXSA 1T6XA 3HS3A 3ME5A 4LF8B 4IW3B 4N1AA 3FTQA 4MPTA 3CUWA 4E5MA 1BMFA 1R10A 1X15A 1P8JA 5IPFA 1I7LA 3W6NA 3BGDA 4LV8B 4O2BB 3ZBUA 3N7TA 3VTKA 5K0BA 1WU7A 2FW8A 4LNAA 2NM0A 4BKOA 4BV9A 4PE5B 1G5RA 2F1HA 3WRYC 3GQBA 4HB2A 3ISTA 4OMDA 4R2IA 1CUXA 1QVWA 2B0CA 2I33A 3W8DA 2FP4A 1GGMA 3F3KA 2F1JA 4IHKA 1GADO 1T43A 1X70A 4R98A 5D00A 5BN5B 1OV4A 3VNBA 4Y2YA 2IYLD 3W79A 3OM9A 2CWWA 3NASA 4EY8A 2WIKA 3HYTA 3MMXA 3UN1A 4DA9A 2WAOA 4RPJA 2VXBA 3TKAA 1LJLA 4OIMA 4O3MA 1Z62A 2W2LD 1PJSA 3U49A 2PUEA 4MVCA 2F43B 4KXUA 2AWNA 1Z8HA 4MLZA 5DF1A 4FFBB 1NIPA 1C9YA 1GNRA 3SAJA 4YV2A 4ZFNA 4YI3A 3RGGA 3G8AA 3K15A 3B12A 2EBUA 4MWTA 3PA6A 1QS0B 1U3DA 3HLTA 1G5PA 2Y0BA 3HWX1 3IAHA 3DTVB 5CDGA 1BDHA 1K2VN 3TCKA 2VUHB 2NO0A 5IAOA 5L6LB 1NRWA 2HT1A 2B1GA 3HKDA 3SLKA 3GLUA 4CIBA 3C7AA 1IPFA 1S3GA 4MS3B 5JJIA 4IGEA 2P9HA 3COJA 1GDTA 3IUSA 4JVOA 1ECFA 1VPEA 2I3BA 4L28A 2R1TA 3L2OB 2AS0A 2EEZA 3AFOA 3H2ZA 1IQUA 1RWQA 4TLAA 4YALA 5ECDA 3HMQA 5KQLA 1JA9A 5B7NA 3DGEC 2B4KA 4EY7A 3TZQA 4EJ6A 2CNKA 3HA7A 2D00A 4FGUA 1DRUA 3VZQA 4D6YA 1VZ2A 4R51A 4PC6A 3EDRA 5AQ1A 2PXHA 3IODA 4AXXA 4IKPA 4UUPA 4F45A 4ZV9A 1J56A 3NNSA 3Q85A 4FMCB 2PX4A 2P3QA 1E3QA 3O95A 1A2OA 2I62A 4OGFA 3S68A 1E20A 3QTBA 1SQGA 3O9VA 5FBVB 1NNUA 2ZJ5A 1INLA 1P61B 1TYAE 5AJZA 3K6RA 4L5JA 2C9ZA 1BA3A 4LXIA 3MEQA 3Q6MA 4WK6A 4Z4FA 3DLAA 3W8FA 2QD5A 4CKBB 3V7UA 1PYOA 3ZK9A 3TDKA 1PJLA 4KFTA 3WMWA 4I1UA 4I4LA 4U7TB 2PEYA 3RU2A 3KJXA 3VVLA 4CIVA 3ETJA 1VYTA 5JTUA 3A4MA 5JFOA 4ND1A 2EBFX 4PYKA 2VBIA 1W75A 3DAFA 4U7HA 1UK8A 5DGIA 1DEXA 1FYVA 1UBHS 1NUAA 3BYZA 3CT4A 3WSWA 1A95A 4XFKA 1QVAA 3LI2A 5BVHB 3EB9A 1SCQA 1ZM4A 1N7IA 2K2WA 3JSAA 4HFJA 4LZOA 2KHZA 2QZ4A 1ZJ4A 4Y1RB 5AHWA 1GJRA 4RZIA 5TSDA 3RSFA 1M0EA 3AR8A 1NIJA 3K5IA 3OO0A 5DYTA 1G9TA 3ZNPA 1M5RA 1FTQA 2ZSKA 2A84A 3H2KA 1YB5A 4BNNA 4MWEA 2HW8A 4MK4A 1YMVA 3L7AA 4LGYA 3IQZA 4LHEA 4MJLA 4FLMA 3NHMA 4C5BA 1VJCA 1IN5A 1AQIA 1U8AA 2OXEA 1G63A 2TS1A 3L8MA 5H3LA 3BFKA 4JB3A 4AAYA 4CCWA 3HZRA 3KOYA 3LY5A 4D3YA 1QU2A 1KORA 3F8SA 1EA7A 5ADWA 3CNQS 2XUQA 5ICGA 2W2XA 1KO1A 5J5CA 3L7YA 1TW3A 4AQ7A 4LWQA 3EPLA 1DC3A 3AI2A 3N5KA 1ETUA 2X1HA 3IKVA 3N75A 1G5IA 4X1KA 4HB4A 4Z9AA 1XJCA 1KMIY 2DR0A 3O73A 3OTOB 4AY6A 3SDBA 2QAGB 1PS9A 2FN8A 4LZPA 2YFYA 1T36B 2H06A 4HYEA 4Y9SA 3OZUA 2DFLA 4YAUA 1GY8A 4EG7A 4UMDA 4MVYA 3LC7O 3FZGA 1C9KA 4AT1A 3V80A 4K28A 1Z0DA 1DOZA 1UINA 3B3JA 3GAAA 3NBKA 4LMRA 1K6IA 2VZ8A 2IYZA 1ZQ9A 2Q0SA 3LPAA 3O8LA 3BX1A 5DNCA 3EWIA 5DPMA 3IQHX 4DCMA 5JAZA 3W5BA 4YUVA 5CBKA 1A71A 3GJZA 2ZR0A 5IYZA 5KWEA 4BBPA 4QAJA 2JAUA 3OIGA 4Y6RA 1TO6A 2BZ0A 1RI4A 1FXSA 1PF7E 1H4TA 1V6SA 2E89A 4CIYA 1SD5A 2PKYX 5CA0B 5JW6A 4IUYA 2JLUA 1WWKA 4P7KA 3OQIA 1A9QA 4KJZA 2B7BA 1B3RA 4RSGA 4N39A 4RTSA 3JSXA 1Z75A 3E22A 3WIBA 4NZNA 1GWNA 3FNIA 1JHPA 1ILEA 1R4AA 5F1OA 1SXHA 1E92A 4H1VA 1IY1A 2VT2A 1D6MA 1G6Q1 1HC7A 3G2OA 4ZVRA 5I9MA 2Q4TA 3IIEA 1OGJA 2XLBA 3L05A 5C51B 4S05A 1OKKD 3ZDCA 5DLYA 2EP8A 1BS1A 2QXTA 1QDEA 4L5CA 4Y2PA 2B78A 2IYUA 2YN2A 1VB3A 2NUPB 3D6UA 2W8BA 3IERA 3MMPA 3HXMA 2P4EA 1K63A 2HA7A 1P9OA 2L0XA 1QGYA 1RW4A 2WJ3A 4J03A 5JZVA 1JQDA 4MEBA 4UREA 4H27A 2WTAA 1Q22A 1JU4A 1QG6A 1Q0QA 3HVUA 2ECPA 2C3OA 4OQYA 5ESWA 5JSKA 1FNMA 3ZD8A 2Z9BA 1ISGA 1IXZA 2ZJ8A 2QVCA 3ER6A 3MJRA 3P0JA 4UUQA 1UC8A 3E2PA 2GBLA 2R8XA 1YKFA 2XOEA 5B2ZA 5DT2A 3B48A 4N8SA 2OENG 4O1HA 4RQBA 2PU5A 1II8B 1I2DA 5ERXA 2FWAA 1QJ4A 5EUBA 5L51A 5FBZA 1OH5A 4XD7D 3L4EA 3T99A 2VJYA 1SY7A 4G1CA 4DE5A 3CLSC 3GJRA 3IQEA 1GR0A 1QAMA 3IVRA 4JAVC 4KACA 2PBLA 4F4FA 2FG5A 4PZZA 3U13A 3CNBA 4MAFA 4NG4A 3ZHCA 2QLJA 5EJGA 5A3JA 4A15A 4YPVA 1Q7TA 1Y6ZA 4DLVA 4RMJA 4IMPA 2AMVA 5KC8A 1X1SA 4LZAA 4QQNA 3MXOA 4UZFA 4HNRA 3FDIA 1N2SA 3TB4A 4EO7A 2JLZA 3EXIA 1P7WA 1Q0PA 4H7FA 3TXYA 2H4XA 4R2MA 4UTVA 3CH6A 1L7PA 1V5EA 4W63A 5E38A 3DLTA 2V96A 3BDAA 3HP1A 3Q5EA 1D6JA 1W2WB 3LWNA 4S2UA 3WV5A 1TJ3A 4F86A 1SHKA 4TLCA 5DGDA 4LJRA 4BKMA 2D0OB 5K6AA 1MRNA 3G7NA 4U7PB 3K0SA 3C5CA 1M6NA 1CR1A 1TQHA 3G5LA 1DIHA 2O50A 1C7JA 3CF0A 4YP9A 3VC3A 3G0HA 3QKSA 3WO0A 3MWLA 3GUUA 4PNPA 3RRXA 2VDNB 3ZBPA 5LWQA 2NO5A 2UXBB 4RPGA 1CERA 5A7GA 2H63A 3IKLA 2QMHA 1RVDA 4IVNA 4HYQA 3WWEA 4BTLA 4M60A 3ETDA 1CUAA 2ZRGA 4A5OA 1XPRA 1J21A 2BUBA 2XB6A 3L7IA 1TGYA 3NOXA 3KUXA 3WJ1A 2HXSA 2N42A 5JNTA 2NU9A 1TKRA 1XFDA 1W5AA 2A9VA 2AZTA 3H1BA 3I09A 4I9FA 4MVJA 2ATEA 3V4SA 3J81k 1Y8ZA 3RM3A 5ED0A 2QW1A 3WZMA 1N2XA 2FUCA 4PFJA 5P21A 5C8ZA 3NAQA 4YRAA 4CM7A 5EIOA 4ZJZA 3FPSA 3GZ4A 2Z6QA 4B2LA 1QH1B 2W2QA 4RULA 5JZBA 3VJLA 2VJKA 1XMPA 3DVSX 2H54A 4KO2S 4C88A 1H2XA 2R2AA 1Z16A 3VDMA 2NU6B 5A03A 3OPYA 1ADGA 2BR4A 2NQ8A 5BRJA 3WFJA 2XYHA 2FOIA 3D8HA 5GY7A 1RLUA 1Z6PA 1F8XA 1MA3A 3NVAA 4JGGA 2PT6A 2YQZA 2X15A 3CUKA 3CTPA 3EXFB 1ECPA 1EDBA 5EJ8A 4OOEA 4INJA 4Y2QA 5AXBA 1KK1A 2ZIUB 4RX1A 1TM3E 4RE6A 4TKLA 4DB2A 1A0OA 4MB6A 3MFQA 4WBNF 1KJWA 1PSZA 3KQTA 1QBKC 2UUPA 4WGGA 5AI5A 1U2GA 3I9KA 3KJGA 3NV7A 4MQFB 2IE8A 4OFXA 1ZH8A 5CM2Z 3PEYA 4A0SA 4U2KA 1DWUA 2G77B 4HDAA 3PGJA 1OFVA 4JJFA 1IOWA 4BLQA 4MVJE 3ZHVA 1KMHB 2JB9A 2X1VA 1N1DA 2DULA 4J9UE 5BSWA 2DMRA 2CBXA 3ND7A 4GC5A 3IDAA 2VH1A 3NH9A 4X94A 5HKOA 3MHTA 1ZVKA 2YHBA 1RRMA 3D7LA 3A28A 2VDRB 3CEJA 5MN6A 3PWSA 2QSUA 4YBZA 3KU1A 4U4AA 2JBAA 4RXMA 3CVOA 4Y2VA 1J0XO 3BF7A 4R6XA 2ZJ7A 2JVIA 3KWMA 5KVAA 4IMRA 1O87A 3AUTA 1KFKB 4CG3A 1A82A 5CXQA 1I4LD 3ABQB 3RVSA 3GNLA 1Q0UA 2C2XA 4GKKB 5EIEA 4ZIRA 1GLGA 1CDEA 3SSMA 3VYVA 2XD4A 5G1PA 1IUKA 2LTAA 4MA5A 4DCTA 4KV7A 4MMXB 3UUEA 2H29A 5HTKA 3LD9A 2H1IA 3H4VA 5E8RA 3ZZ0A 4J7XA 1W73A 1GPMA 3NS7A 1QUFA 5KYXB 1H42A 1FRFS 1BG6A 4JLAA 2XMZA 1U0SY 3TMAA 4AS3A 2A0WA 5BNTA 1OWNA 3UAWA 1EUQA 4ZEWA 1FNSA 1XJWA 4EPXA 2PFGA 2PXXA 1PR9A 3DZCA 1M2EA 5TJHA 2BFEB 2JAOA 4Z2YA 1XPUA 2XBUA 5H68A 4EFMA 5HKKD 5DO9A 3RG8A 1TZKA 4UUBA 1U28A 1G20A 2IOHA 3AVYA 1DBQA 2NLOA 1JH9A 4EK9A 1NVBA 1Y48E 2JH9A 2JI7A 1NF9A 1UK9A 4LWZA 5F1PA 4M0UA 5I7OA 1FE8A 3GAZA 2HO5A 4FBLA 3SCZA 2P6UA 1TQ2A 4HVTA 4XDZA 1F20A 4D0RA 1TRKA 2I2DA 3VYTB 2BN4A 5K3FB 3UAOA 3M0EA 3V1LA 4X63A 4ZHQA 2OXCA 4G4IA 1ZI6A 2CLKB 1R0XA 3CWCA 1NXQA 2A9QA 4AZWA 2M6RA 2X1MA 4K2AA 1B0ZA 2JA1A 4JU9A 1S2OA 4YCNA 2FLWA 1P62B 1QZTA 4YJ3A 4XIFA 1EFAA 3ENKA 3A6GA 1JSRA 3ZXIA 1BQ3A 3SF0A 1TYBE 1C8BA 5JHGB 1XU7A 1N6HA 3AL0C 3E9YA 1GG5A 5E4FA 4XLLA 1YZLA 5TR9A 2XVAA 2XUKA 3QPBA 4UBOA 5BUSA 4PRLA 3IS3A 2WHYA 1QLWA 1NRXA 1V7ZA 4CM3A 4D5EA 1UFQA 2BL4A 4FWIB 1NX9A 3O4VA 3UQZA 4OHPA 1SBZA 4B5LA 2BEUB 3ZHRA 5DSXA 3G2JA 2VQ3A 2Z43A 3GBPA 4RQUA 1C0KA 1G20E 1M10A 3QE0A 2F62A 1JZSA 4O4IA 2XQFA 4WIAA 4DMFA 1A5SB 4JT9A 5HQ3A 1EXDA 1G9XA 3DSRA 4LHYA 2AUTA 4ENPA 4L75A 5FNVB 3X2EA 4YXWA 4NRDA 1LV8A 4ATNA 1PI3A 1Z12A 4Q1EA 1D9XA 1UBMS 5T8KC 3FLEA 1KE2A 3FKSD 1JYFA 2VDMB 1LI5A 2NUAB 3R7WB 2ZDHA 1ZOIA 1FRVA 1T4MA 1AHIA 3GMIA 1Z07A 4HUJA 4L6AA 2IOFA 3EG9A 4EPVA 2NZWA 2NX2A 4ZAYA 3C7KA 4R1UA 4U3JA 3INYA 5DLDA 3V4ZA 4F92B 2NYAA 2GN4A 1TTPB 2QUKA 4ZXFA 1XZMA 3WL3A 4FKMA 4YCSA 3LBHA 3WBJA 4X0EA 1L7OA 1XZLA 2XDAA 2RKOA 4N0PA 5T41A 2XADA 3JQ8B 3RYIA 5KYWB 1LVUA 7REQA 3S1SA 5HRUA 2OGZA 1JG7A 3OX1A 4PC2A 1ZITA 5IAKA 3TW6A 2FKAA 5EXDA 4LPSA 4WY5A 4YK7A 5I3ZA 5MGBA 1CP2A 4B3HA 1Q1GA 2QX4A 2BHTA 3I9NA 3WDKA 1RZ3A 1EYZA 3A1VA 4XFDA 4K0KB 4DY4A 2XTMA 2HLHA 5G2OA 3TIVA 1QLJA 4EKGA 3EMBA 4R8SA 1XYGA 1EZ4A 3A3KA 1CLUA 1WP4A 2JRCA 2VCYA 4ZU6X 1Z29A 3BZUA 1ZWKA 4YRIA 1FJGB 3KR1A 3F5SA 1SULA 1YDEA 4YRCA 1GUYA 4D98A 2VNJA 3ZE8A 2BGRA 4UOEA 4E88A 4II7A 3URKA 1OBCA 2ZRMA 3OJLA 2HR1A 5JJBA 3B1JA 1XVIA 3R40A 3U3KA 5HM6A 5AW0A 4GMHA 3DE2X 2QX6A 3K31A 2Z83A 2IYPA 3DP9A 4IIYA 1X9GA 1H3EA 2XWQA 4GI7A 3PB3A 1JQBA 2FPGA 1U94A 2ZUWA 3G5UA 3VU9B 1JLKA 4D8VA 2APJA 2FEMA 2R6ZA 1P1CA 3CLRC 1OREA 2VJOA 2G83A 3R9XB 1SCIA 4G07A 2HV9A 5H83A 3QSGA 2IEZA 1YC5A 3H4TA 4XRRA 2ZIWB 4N12A 5ALOA 1N2OA 5NLLA 2GKOA 3TX6A 5H3HA 2E4YA 4BVBA 1QB7A 3PUVA 1XZPA 1OH6A 4REOA 2W6ZA 1V8OA 3U9LA 5BWOA 1DVRA 2HGSA 4QT0A 2CBGA 3ABZA 4X66B 1AJEA 2VPQA 2V3VA 4P4SB 3UAYA 4RCVA 5TY0A 4IFIA 3NAGA 4GZ6A 5LYJA 2KBEA 1CY8A 4Y2HA 3TS1A 4ETNA 3F5FA 1BJKA 1YRYE 3QMVA 4HYTA 1GL9B 4FCCA 1BE6A 3CRVA 1NNEA 2R66A 1TA4A 2WIFA 4XTCS 3WICA 1YR8A 4I5IA 3COYA 2VBCA 3P0IA 2H65A 5AHOA 2H0AA 3DUFB 5KHAA 4RK0A 1X7ZA 3ESAA 1I1HA 2WJZB 3OTIA 4Q19A 3UJ9A 4F3YA 1H9BA 1R0WA 4HWOA 4N3NA 4MI3A 2CV1A 4Z7NB 4JROA 2IYVA 1QPGA 3OEED 3TLZA 3ZI7A 3NHUA 4BCBA 2YY7A 1HXHA 3BD7A 3FFBA 2AR7A 4AVYA 1JSZA 1MPTA 1XK7A 1NUUA 4ID9A 2BP7B 5C80A 2QA5A 3EEQA 4RM2A 5FBLB 3FNRA 3G8DA 4UE3S 4DA6A 4W1QA 1E4VA 1FFHA 3AY6A 3JD0A 1JFVA 2GHIA 3MCTA 1DOAA 3PS9A 2P11A 3EZ9A 3HB5X 3JZMA 4YMVA 1U2DA 4B44A 3LO5A 3MTAA 4ZEOA 1T4CA 4JCOA 4OQFA 3GL9A 1ATZA 4LI3X 3CPHA 5H5JA 3HXPA 3HB0A 3KSZO 5KHOC 1CCWA 1PL0A 4IR7A 5B1SA 1DJPA 2FOXA 1Z2EA 4GPIB 3UUFA 3WLPA 1U81A 4EH1A 2ZRAA 4YMUA 3VC7A 4E31A 5HM8A 2N46A 5K0ZA 3EQ6A 4F7WA 1E1QA 4HGRA 1RWPA 1AQJA 3HYNA 2XCSB 4YAFA 1QIGA 2BWJA 3A3YA 3QPAA 3U3DA 3VPBA 1M9NA 3Q1KA 2IHNA 2BTQB 3D1VA 1D2HA 1JMVA 3PQ6A 3KOXA 1QE3A 3DE0X 2C9BA 4M7WA 3M4ZA 2XE7A 1UAYA 4DUGD 5KMGB 2D1QA 1AS3A 3R0XA 1NKTA 2I54A 3PJGA 4BNXA 1TDJA 2CDNA 2IZ1A 2Z8XA 4RJIA 2ID8A 4AI6A 1N33B 4BYMA 1I4WA 4CW7A 5CBPB 1LBQA 2F6RA 3EISA 4HAYA 4NAHA 1XQ6A 3O0DA 3N9IA 1OC2A 2I8LA 3ND6A 1NURA 2FHPA 5FOWA 5AVTA 3EULA 1MJ5A 3P9YA 3T9EA 2PJRA 3QA3E 4XYGA 1RFGE 4Q7JB 5BW6B 4BWYA 3TTTA 1U11A 4DIFA 1Z5ZA 2FGJA 4GBGA 4MPPA 3HGTA 1XRRA 3SQNA 5CA1B 1P39A 4JYPA 2YHIB 3EVTA 2FPLA 1HDRA 1YZQA 4I66A 5IAAA 1FS4A 2HDWA 3KLMX 3O4JA 4ZCRA 1IHXA 1EFUA 1SXIA 4ND8A 4PZEA 4L9WA 4NBLA 3WHPA 4JXXA 1L7XA 1T0UA 2EKBA 2X77A 2XSZA 5EIBC 4ZVOA 4GPTA 1EM8B 3ICCA 1EB8A 2NIPA 2OXFA 5JQWA 3OU2A 2JIOA 2R2GA 3QLVA 4HC4A 4M49A 5B58T 3RKSA 3T3IA 3FNEA 4CGYA 2QT1A 2ZU0C 3OPXA 4IAOA 4AFNA 5I48A 2G09A 4P81A 5IZ4A 1YK1A 4C2AA 2ZZMA 4EYQA 3EJWA 4NV1A 3LFHA 1XZIA 2VSOA 3OF3A 3RFCA 4AK9A 3BIWA 5AK6A 3LT0A 4CQMD 1K2WA 3TWOA 1E3WB 1P9RA 1Y3AA 3EZYA 2W6PA 1IM2A 1DHTA 5BOSB 1SUSA 2VTVA 4KXYA 1LBSA 1KP3A 3RNOA 2Q7DA 3SZGA 2VA9A 3C8ZA 4HLNA 2AUMA 3LCVB 4P54A 1CJBA 3BQ9A 4AJPA 1L4HA 3VSAA 3E23A 3V4OA 3KYJB 4L3VA 1COZA 2XZDA 3AT1A 1QHXA 3UB2A 4CM9A 2HHJA 4DSAA 3W2HA 3UFXB 1JG1A 2JK1A 3R23A 3HEBA 3F6SA 2QRLA 2A0XA 5AIBA 3U0BA 3RYFB 5KQGA 1W4RA 4RF2A 2LD4A 5KYUB 3ND5A 4WASA 2QD3A 1X2BA 1NJ2A 3R3SA 4KE7A 3EVCA 4LBWA 2BONA 2ZRIA 4GQAA 2R25B 5TE9A 4RSHA 4UDOA 5HK8A 1B14A 3AONB 1RPNA 4LGVA 4XW2A 4BVJA 3F6PA 2OZKA 5AJXA 4ZYVA 5K03A 4NU5A 3AWIA 1CZOA 1M1UA 1FS6A