2GB1A

A novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title A novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein G.
pubmed rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immunoglobulin binding protein
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2gb1A00
2PLPA 2ONQA 1IBXA 2ZW1A 2IGGA 2ZW0A 1HZ6A 2N7JA 2KACA 2KN4A 1MHHE 4KGRA 1IGCA 2LUMA 2PW9A 1EM7A 1K51A 3UI3A 1ZXHA 2JWUA 1PGAA 5HG2A 4IKGA 2K0PA 1D4BA 1P7FA 1K53A 3V3XA 2JU6X 2I2YA 1MVKA 5BMIA 1MHXA 1C9FA 1KH0A 1YMHE 1FCCC 1XF5L 1YNTE 5HFYA 2J53A 4OZCA 2IGHA 1GB1A 1K52A 1FCLA 1MPEA 2KWDA 1Q10A 2QSDA 2J52A 2KDMA 4KGSA 5BMGA 3GB1A 2JSVX 1HZ5A 5BMHA 2PTLA 3FILB 5HI1A 1IBXB 1K50A 4GLSC 4OZBA 1XCTL 1PGXA 2JZPA 2JXTA 1UWXA 2NMQA 4WH4A 2I38A 5HHDG 2OEDA 3MP9A 2RPVA 4KGTA 3FILA 4HKZE 4IOIE 1GB4A 2IGDA 2LHEA 2EELA 2N9LA 2ON8A 1P7EA 4HJGE 4D2KA 1JMLA 1XCQL 2KQ4X 2N9KA 2QMTA 2RMMA 2GI9A 1PGBA 5JXVA 2GB1A 1MI0A 1QKZA 1IGDA 1F2RC 1FD6A 2LHDA 4MACA 4OZAA 1F2RI 1HEZE 2LGIA
chains in the Genus database with same CATH superfamily
2W3SA 1L6UA 2IDYA 3E56A 4NAWA 1P9DU 1FXTB 5EE1A 3MFGA 4W9IA 3QQ8B 1MFWA 3I63C 3N1ZC 4BBNC 2D2QA 3GS2A 3SEBA 3L10B 4NQKE 4DDGD 2WX1A 3BVGA 1QOBA 3AE9B 3BVMA 4YSYB 4MT5A 3ZO5B 3M95A 3EHVA 4HCNB 4NJCA 1TYGB 3O13A 4KIKA 1OFFA 2K3UA 4L1BA 2K25A 2X38A 1WX7A 3ZTCA 1WJNA 2K6DB 3W1SC 2OHFA 3IT4B 1XF5L 5HFYA 4EUTA 1SBBB 2FIFA 5G2NA 4B0MA 1V5TA 3LJ3A 2QSDA 4M0WB 2BT6A 4GDKB 2DNFA 3UQAA 3W9CB 2WGSA 3DPDA 1EO6A 4A6QA 3PHXB 4C7ZA 4S17A 4E74A 3NVWA 4LDTD 2L1AA 2BS4B 5JH5C 1YX5B 1YQ3B 4OVUA 2XK5A 3PVLA 2KMAA 4WH4A 5E6PA 1B1ZA 5HHDG 1T3QA 2O2VA 3A9KA 1VZ7A 2BGFA 2ZCCA 3TIXA 2ON8A 4PS3A 4CYEA 3JW0X 4A3OA 2BYVE 3AM9A 2KKCA 2DYBA 3KUZA 4MGZE 4JQWC 1SEBD 2VZKD 5IP4D 2KX0A 2J0JA 2NPTA 4OZAA 3ENEA 2L0TA 2OOBB 2C60A 2D07B 3DBSA 2KACA 3NVYA 1KLUD 1UZXB 4IC7B 1YJJA 4P6VF 2W9NA 3HM6X 3N30A 3BK2A 2K6QA 2MCNB 1VDVA 3VHTC 3UQBA 1UGJA 3EECA 4AS1A 1PDXA 3PT2B 3Q69A 2M0AA 4KKJA 2AQ1B 4AP4C 3KQ4A 3A33B 2KFKB 3V61A 3KLSX 1EF1A 3NZSA 2BB5A 4USAA 1TY2A 1C76A 1D5XC 2JYEA 3Q2AC 2IGHA 4GDLB 1JCKB 4CO7A 3M63B 1V49A 4FXCA 5GMVA 3AE2B 1WXVA 5FR6A 2WX0A 3AEDB 4KGSA 3EA6A 3KH0A 2VH1A 2D10A 1DYQA 3IG3A 1C77A 2B3AA 2WXNA 1K50A 3NOBA 2MH7A 1TIFA 3V6EB 3B08A 4IW0A 1U4AA 3ECIA 4KGTA 4HKZE 4MGYE 1EUVB 2ZZPB 2L3ZA 3WALA 4YWGG 5LXHA 4DHJD 3R8BA 2LZ6A 3LYYA 4RM8A 1V86A 1GOZA 2RMMA 2JT4B 2NBVB 1B9RA 2DX5B 3K9OB 2ACZB 2LGDA 4R3DA 2MJEA 1UWMA 2BKRB 3DOWA 1J0GA 2CU1A 3PLVA 3VAWA 2KK8A 2BS2B 2KN4A 1GC7A 5E6JA 2KJ6A 3AE6B 2PW9A 2JUOA 3RNAC 2KOXA 2WXJA 2BF8B 2Z8LA 2V0GA 3N32A 4RMAA 4HK2A 1GUAB 4E3CA 2PE9A 3VQIA 4K7WA 4W9CA 1JWMD 5C3JB 4JWSC 1R4NI 3DBLB 3WCQA 2IO0B 3AE7B 2K8HA 3U2SC 1TS2A 1TBEA 3AH7A 4A55A 1WGRA 1UBIA 2LI5A 4WURA 4L23A 4N59A 1L0YB 4E71A 3QIJA 4GN1A 1VRAB 5L95C 3WAOA 4URKA 3N9YC 4EKUA 3U7DA 3NG0A 1TKYA 1UH6A 2KTFA 4A20A 2WXQA 3A4SC 1K8RB 5BYRA 4WWMA 1Y56A 2PEAA 2JXXA 3DQVA 4HROA 4JWUC 4MEMA 4W9LA 2M19A 3BZDB 2BW2A 3IVFA 4WAAA 3I9V1 1PGXA 2JXTA 5FK9C 3AEAB 3MHZA 1E90A 1JWBD 2LD9A 4UDUC 1L7YA 1AWDA 2YLMA 2V4IB 4BKTA 2KQ4X 3ZQ4A 1JW9D 2QMTA 2ZVNA 4RM9A 2LASA 4DQOC 4KDIC 4HCPB 4AWJA 2BTEA 1QQRA 2GB1A 1ZUD2 4GXBA 3Q8EA 2FCMA 4NJ6A 1F2RI 2M1MA 3L54A 3VFKA 4LJPB 3NHEB 4ARCA 3R66C 2IGGA 4A9AA 2YEPF 2WXKA 1SIFA 3VTVA 1IGCA 4IM2A 3HM3A 4PYUA 1I4GA 3UI3A 3OG5A 2KTRB 1BUIC 4C00A 1C78A 1WGGA 2CS4A 2ZEQA 1YIWA 4C4VA 2J42A 4IWPA 1P7FA 3VUXA 1F52A 4Q2JA 2SAKA 2WXOA 2JU6X 4FHKA 2LXCA 1FO4A 3NZUA 1LGRA 3TEZA 5GXGB 1HE8A 1WFYA 1C4CA 2FAZA 2LVPA 2PPHA 1XLPA 3AE1B 3H6NA 3NY5A 4A90A 3EFUA 2RDBC 3DDCB 1YNTE 3TCAA 4OHJA 4LLGM 1TTNA 2PE6B 2KC1A 2Z0DB 4ANXA 2G45B 1Q10A 2MP2B 5TR5A 3VR9B 2N9PC 2D11A 1I42A 2MQJA 4M01A 4IUMB 3V60A 3FILB 5HI1A 3EGRA 2RGFA 5LXIB 2WLBA 2KHWB 5BO4B 1P3QU 2NS5A 3VTUA 2PVOD 1WWTA 4IOIE 1DGJA 1R4MI 2IY0B 2EELA 2N9LA 3OAWA 2WXGA 2BYFA 4WWOA 2L00B 4AQ7A 2B76B 2RSUA 3ZXVA 2N9KA 2MJDA 2NTSA 1KM7A 3A9JB 2BPSA 2GI9A 3GZNB 2W55A 5JZEB 1FD6A 5EE0A 2GBJA 3IFWB 1N6ZA 3WA0A 2XBBC 4P7IA 3NS1A 2KLCA 1JRUA 3BYYB 1IBXA 4MM3A 1NYQA 4LCDE 2N7EA 4ZRJA 2JVCA 4RCOA 2MBQA 3RZFA 3KVFB 4CHKA 1WGHA 2MEKA 2WWZA 3Q8AA 3ZNGC 3V6CB 4WJPA 3NRZA 1D4BA 1PFDA 5JHAA 1SJHD 3APCA 2RDHA 4MH8A 3PGEA 2OJWA 3MC9A 1MVKA 1WXAA 5J17A 4W9GA 2LVQA 4KSKC 1SF0A 3H9DA 4HPLB 2KJHB 3ZVVA 4OZCA 5D94A 1TS5A 2KT7A 3C0RB 3OWEB 2MX2A 4FN2A 3JSVA 4ICUA 2KANA 2IO1B 1OQQA 3BK1A 3H8HA 1LXDA 3H7PA 3KUCB 2I1JA 1V1PA 2QJLA 1ACCA 3DBRB 2R2OA 2D3AA 3ZYYX 2IBIB 2GBMA 2KDBA 1CJEA 2OEDA 2G4SA 4HDOA 2C7MB 2FCSA 3KWVA 3DVNV 4P1CC 1P7EA 4YTPB 1V5OA 2BS3B 1WYGA 2X8XX 5IAAC 2CKHB 1D3ZA 4WJQA 4MJSB 5BYSA 2ZVOA 4KVGB 1YJ1A 3M62B 1TGZB 4F7ZA 1E8WA 2HE7A 3QK0A 1F9JA 5BYQA 4ANWA 1MHHE 1WJ6A 1WJUA 1M4VA 1TZ1A 1WJ4A 4WJNA 2NBUA 1FPYA 1WX8A 1QLBB 4AUQC 2IPKD 3A1QA 3PRZA 1ZXIA 4OVVA 4II3B 2L76A 1HA5A 2ZPYA 2WHIA 1V6EA 4TUUA 2V3SA 2DENB 4KSLC 4M8NA 1C4PA 3MTNB 3I3TB 1VCBA 1WGDA 1WR1A 2MSED 1BXTA 3U52E 2IO2B 1S3SG 2LFIA 2GBNA 2WXLA 1ZE3D 2KWDA 2PMVA 4XGAB 3HUIA 3PLUA 4PYZA 2BBCA 3ZIMA 3ZRCA 1E10A 1FFUA 1E6EB 4KV2A 3T3NA 1WH3A 3ZJVA 3QAQA 1FRDA 4PT5A 5AUIA 1DOIA 3APFA 3IAS1 3NZ3A 2V9HA 5E6OA 2YEPB 1NI3A 2I38A 3AU4A 3B0AA 3OLMD 2MBOA 2NVUI 4N58A 2XN9C 2FCQA 1XLNA 2AWTA 5IO9A 1WMHA 1E8YA 3LDZE 4YXDB 3ZNID 5EE9A 3UF8A 3RN9C 1HXYD 1WXSA 3KUDB 3N1XC 4TKNA 3FC4A 4EZKA 1V97A 2LRWA 4DXFA 1ZOYB 1D5ZC 1TKGA 3UIOB 2KVZA 2IJ0A 1L4DB 5D6JB 1JWAD 2D3CA 2LRUA 3VRAB 1L0VB 1WE7A 2N7JA 3RFZB 2KQ7A 3ZRFA 3DHHC 4YTNB 3L17A 3DBHI 3T9LA 3RNEC 2N9XA 2DAJA 1C3TA 2MBEA 4XWWA 2EMSA 1K53A 1YD8U 3PZDA 2M56B 4HKQA 4W9JA 2XK5B 3ZGZA 2M17A 3PRPB 1SXTA 1KF6B 4REZA 3A9KB 1J7BA 1WGKA 4M00A 5G55A 2KFKA 2PIAA 3C8YA 4W9DA 3PZ8A 4WWNA 3TEWA 4IG7B 5C2TB 3T3OA 4QAYA 1T0QC 5C1ZA 4LNKA 5IA7A 2WQYB 1P1AA 4EZJA 2NPTB 4NAMA 3FKYA 1VR9A 4ITKA 5CHWA 5G5GA 3I5JC 1UF0A 3P63A 3U8ZA 2LXAA 2AQ2B 1QZEA 3R7RA 3TBLD 2L83A 1ESFA 1KLGD 3MP9A 2WXHA 2V3NA 2RPVA 4M8MA 1E9MA 2D3GA 2IGDA 2LWPA 2JPHA 4JIOU 4F1SA 2DAFA 1UUPA 2N1WA 4RH6A 3LXFA 3K9PB 4GMVA 3RZWC 3WAPA 3VUYA 2FBWB 5D3DA 2UWQA 4MSMB 4MACA 4IDIA 4LDTB 1YOVB 2LGIA 1N5XA 2ZW0A 1ZDVA 1I7HA 3Q3JA 5IKCM 2WYQA 1V81A 3VTWA 1ENFA 2KC2A 1FIQA 1AW7A 2W3RA 4K7UA 4EZLA 3NVZA 5FR3A 4M02A 1VZ8A 4W9KA 1T0SC 1LFDA 4NJ7A 5AZHA 2VZKB 4XDCA 2AL6A 1RWSA 4ZDVA 4LNIA 3RYTA 3PZ7A 2A5UA 2GMIC 4HJKA 4K1RB 3DVNU 4JGHB 2J53A 3Q3NC 3ML8A 5FKAC 2CU3A 1K52A 2MBBB 1GC6A 1R4NB 1CQVA 1EU3A 2KWCA 3DHGC 4JE3B 2KN5A 1WI0A 2Y5PA 3AE5B 2LEKA 1J7CA 5H8YE 1FXIA 1CK1A 2WXMA 1L0XB 1YX6B 4EEWA 1T0RC 4DHZE 3VDZA 4FJYA 2KWUB 3PO0A 1S1QB 1XCTL 3NVVA 4W9EA 3RI7C 2KYWA 3ZUNA 1FXAA 1YQ4B 4AJYB 2V1YA 4WQMA 2WXFA 3NS8A 1PQSA 1D5MC 2KNBA 3BVZA 2QEJC 5IOIA 1WRIA 3CSFA 2K5PA 2INDC 3VR8B 3QWZB 1KOTA 4DXAB 4ZYSA 1GPXA 2LGSA 1RFKA 2O6VD 3RNGC 2Y3AA 2AEHA 2CJOA 4WAFA 2K22A 5H92C 2V4LA 5DPTA 2YVCA 3AEBB 5E6NA 2RR9A 3LB8C 4P1BC 4GGQA 4LNFA 3SDLC 1IUEA 2Y5BB 2LGXA 3PRMB 4DXGA 3PREA 1KFYB 3L4PA 1RM6C 1E0ZA 3VUWA 4YSXB 2EKEC 3WAMA 2IZVB 4MGKE 4YTMB 4B9KA 1WXQA 5D2MB 2DZMA 1J19A 1VLBA 1FCLA 3L16A 4WJOA 2CHZA 2A4ZA 1XD3B 4II2B 1I4PA 4BKSD 1WIAA 1ZPSA 1HZ5A 1VD2A 3Q8BA 1FEHA 3P4QB 4HEA1 5AZGA 2KMMA 3ZKJC 3HVZA 2O6VA 4BAXA 2N4FA 1ZW7A 4ZRKA 3DHIC 3GOEA 1YQBA 4P16A 1EWCA 3FILA 2LHEA 3ABVB 1NENB 2DYMA 1OQRA 2KQSA 4HJGE 4C4VB 4D2KA 1KJTA 4XE0A 3VH3B 1MI0A 4G11A 1YN3A 2WDVB 1C1YB 1N60A 2LHDA 4IM3A 1R4MB 3FAHA 4I6NB 1RYJA 2ZJDA 1WXMA 1L2NA 2QILA 2ZW1A 3OJ4B 4MH0E 4LNOA 2L7RA 2L52A 2LUMA 3UINB 3IXSA 1EM7A 4BOZB 2KX3A 2JWUA 2RD0A 2WP9B 1OGWA 2BYEA 4TV3A 1IPGA 2XEWA 1IYFA 1YN4A 2K8CA 3B1LX 4BKSA 3Q3OC 3P42A 2IO3B 2R2QA 2RPQA 1G6JA 3R7QA 2Y5CA 1KLVA 3AU5A 5J2RA 5D3IB 2WXPA 2J0KA 4MGIE 2AQ3B 3Q3MC 2MLBA 3AE8B 3CF6E 5IN7A 5LNK1 3GZNI 1SSNA 3AECB 4LNNA 1ZKHA 2BVCA 4C80A 3VH4B 4AOFA 1JROA 3ALBA 3BWUD 3ONSA 3AN1A 1N62A 1XLQA 2WNMA 5HKHA 2W82A 2MHJA 3SFDB 1IBXB 5CHVC 4MM3B 3JYUA 4DDID 3V62A 1UWXA 2KD0A 3CIRB 4RGNA 2BWES 4ZRPA 2DWQA 3AULA 2K1FA 3IBEA 4FLHA 3NUHB 2FIDA 4ASWC 2PJHA 4ACFA 4ZYNA 1NDDA 2D5GA 2Z59B 4FULA 1WZ3A 3CWIA 4O1NA 2EKIA 1ET9A 2PLPA 2ONQA 3AV8A 2VH2A 3TSSA 1WF9A 1DOYA 3DVGX 1JRPA 4N6EB 1ZGUB 2E3TA 4KZCA 3WANA 4KKIA 1C79A 3JSVB 4GIVA 3DBRI 2WXRA 3ZTDA 1PGAA 3H1UA 1ROEA 2AX5A 3H7PB 1V1PB 4LK0M 2G3QB 1I4XA 4JLCA 3ZNZB 2FE8A 2KFJA 3AB5A 5KHOA 2D3BA 5I4DA 3RNCC 1L5PA 2JX5A 5AEKB 1YJIA 2L32A 4MDKE 4BZAA 1CMXB 2R61A 1KRHA 3W1YA 4HWIB 4RFBA 1BT0A 3A4RA 3RUIB 2G1EA 1ISNA 2HTME 4US9A 2J52A 2CHWA 4YL8A 1IP9A 5BMGA 1Y8RC 2UYZB 1WRDB 4A8XC 3RT3B 2BKFA 2PTLA 2NCNA 1VZ6A 1GJZA 3DWGC 4NZLB 2M4NA 2JZPA 1T0YA 1SGHA 2KAJA 2WDQB 2HDEA 2WS3B 4I6PA 3EC8A 3PHWB 3A1QB 3U4EG 3B9JA 1ZP0B 1XCQL 2KXJA 3P4PB 2JRIB 3CMMB 5CHFA 5AZFA 4PK1A 4M0WA 1RRBA 4GDKA 4FADA 1QKZA 3SU8X 1IGDA 4NAWB 3AEEB 3AXCA 2DBYA 4ZRQA 2G4DB 1E8ZA 2KVRA 2INNE 4ICVA 1SE4A 1RAXA 1T5XD 5DPWA 1HZ6A 3B2GA 1FM0D 1LO5D 3TL5A 4IWQA 1BMLC 3IAM1 3RULA 2INCC 3BIID 1ET6A 4A3PA 1KTKA 1HTQA 4KIKB 4IKGA 3PS6A 3QA8A 4F8CB 1J7AA 3Q3FA 1QOGA 3MC0B 3AEGB 3W1SA 1DOXA 2N0SB 3ML9A 1UNSA 3NJTA 5J18A 1WMHB 3VRBB 4L2YA 5EDSA 1RLFA 1WX9A 3DBHB 2JF5A 4JL9A 4YSZB 2WU2B 1UBQA 1XT9B 3HRDD 4G50A 1MPEA 1GAQB 4XC2A 1R7SA 3L08A 2Q5WD 2V3PA 4ZHOA 1EF5A 1LQBA 4K81A 1WGYA 3X23A 2H89B 1SIJA 4XX5A 3RNFC 1F1HA 2K8BA 2O2VB 3GE8C 5BMHA 1E7UA 4XDDA 2HJ1A 5DCNA 1V80A 3TJPA 3GE3C 3T8MA 1SB3C 4RGTA 5KHQA 3HVDA 3O65B 2K39A 4JX1C 2OJRA 2GBKA 2FCNA 4EOYA 1Z5SB 3KW5B 4GDLA 5G5HA 3AEFB 3Q8CA 3TEYA 2JRHA 2ICIA 1J8CA 4US8A 3E9SA 4J3OD 1WM3A 5TSSA 3X0WA 1V9JA 4IM0A 3MHSD 1HEZE 1C4AA 3U7ZA 3ZNHB 4G0NB 4MSQB 1V2YA 5C23A 2J7QB 1K51A 1TS4A 2ZNVC 2QHOA 3SHQA 3RCZA 2LJ5A 1FMAD 3KYCD 1JQ4A 4HLEA 2QDFA 4FHJA 1H8CA 2KDIA 3Q14C 1P98A 3W2DA 4C56C 3V3XA 2J4XA 3M3JA 3U30A 2UU7A 2BB6A 4NQLB 2VRRB 4XZ4A 1MHXA 1QOFA 2DZJA 2BYTA 2JZZA 1FCCC 3V05A 1LM8B 3IT6B 2NTTA 2WDTB 4KZ0A 2INPE 1WZ0A 5EE3A 3BY4B 3DCGA 2GRIA 3SR6A 3PPAA 3P2BA 1AN8A 1I4HA 2GBRA 2CHXA 1GG3A 2ZNVB 2MW5A 4KX6B 4XYCA 1MG4A 1NVID 3R2IA 1Z2MA 3QX1A 1V8CA 3EFCA 5LLIA 3VVWB 1CZPA 2H88B 3HK0A 1I4RA 2M8SA 4BOSC 4DWFA 2W54A 3P4RB 2FUG1 4ANVA 2IYDB 5CX3A 3QJZA 1YN5A 3Q8FA 1F2RC 2KWVB 1WE6A 4H2AA 1GNUA 4ANUA 4CQNA 4EE2A 4FJVB 2K9XA 3Q6BA 4JPSA 3VXWA 1QILA 3ZW3A 2NR2A 3TUOA 2HJ8A 4GU2A 1OQYA 1OEYA 1VJKA 3DBLI 4ARIA 2PVGC 4PS8A 3MJWA 2C5LC 1ZXHA 1Q0WB 4EFOA 1PYWD 4HPMB 1WY8A 3IHPC 4S0RA 1TZOA 4TQ0A 5DPSA 2JYTA 4KDLB 1QT9A 2KJRA 2I2YA 4DHZB 3PTFC 1C9FA 1KH0A 2LVOA 3ZJUA 1EWYC 1E5WA 1AYFA 4RNAA 3UIPB 1FFVA 3W5VB 2LUEA 4WWPA 4DHJB 4BKGA 1N63A 1QF6A 2RDGA 4AJWA 4YT0B 4TSSA 4RF0A 4FA6A 4HRSA 2KTRA 3GB1A 1FRRA 4W9FA 2I1KA 2QIEB 1XEEA 1E7PB 1QOAA 3RPFC 1XQQA 1JWUD 4HXDA 2C9WB 3BYTB 2E6XA 2IY1B 5T8IA 2HTHA 1AARA 1TY0A 2G9HD 4XWTA 1TKEA 1MG8A 2NMQA 2WDRB 3KWLA 1NEKB 3P1MA 3QHTA 3R3MA 2MWSB 1M94A 4HPPA 4NPNA 4RGOS 4TQ1A 1JMLA 4DK5A 2CR5A 1WR6E 1HTOA 3QCAA 1OEYJ 1P0RA 5JXVA 2MP2A 4I6LB 4LTUA 3QC8B 2NBWB 4BBNF 3JVZX 3ZXRA 3ZDMC 1UGMA 4GSWA 4OVZA 4B0EA 1RFAA 1L6VA 2MRPA 2WU5B 4PS7A 1SE3A 3ETRA 1WM2A 4GOCA 5HG2A 2EMTA 5JHBA 1T6BX 2N9EB 3D32A 2FNJB 2K0PA 3QARA 2JWZA 1D6EC 1PUTA 3DVGY 3AE3B 1FNVA 3A9JA 3C19A 2O6VB 2CJNA 1NYRA 4N9F4 4K3CA 2MBHA 2AL3A 3ZJTA 4HVBA 5D7GA 2KDEB 3OJ3A 2HD5B 2C7HA 3ZLZA 3L13A 2KDMA 3UGBB 1WYWB 3DWMA 1N5WA 3S2AA 3URYA 2DZIA 1F77A 1X1MA 1N61A 3BINA 1FNWA 2KLGA 1ZDXA 2KZRA 1I35A 1TJEA 4GLSC 3RNBC 3SFEB 1EU4A 3GP7A 5L83A 3H7SA 2ASQA 2GOWA 1A70A 1NI2A 2WXIA 1XO3A 4NNJB 1NBFC 1JWSD 2C7NB 1OTRB 1GB4A 2SEBD 2JZ3B 4ZOHC 4WIPA 2DLBA 4W9HA 3TEXA 4LJOB 2KMCA 3N20C 3P4SB 4RF1A 1V1OA 3I57A 2KDFB 2LGYA 2QCZA 3SD5A 1STEA 2L05A 2MA9B 2N7DA 3PV1A 1I4QA 3TMPB 1JALA 4TMAB 3WIMA 4DBGA 2LJIA 4KGRA 2MJ3A 2GLSA 1A5RA 2AYOB 4FBJB 1UELA 4HDQA 2KO3A 3J9CA 2Z0EB 4BFRA 3R2TA 1TS3A 1E7VA 2JY6A 4GB9A 3MC8A 2LMCA 1XXGA 4IWOA 4MJSA 5BMIA 2QC8A 1YMHE 2DYOA 2J0MA 4WQOB 2N1VA 2PKOA 3RMKC 4B95A 1TT5B 3APDA 3KYDD 4B6WA 3ZDTA 1GB1A 1H4RA 5CTRC 4X57B 5MPOA 3EUB2 2REXA 1SE9A 1F0ZA 1Q1OA 2JSVX 3L0WB 3AE4B 1XLOA 2ZPNA 4K3BA 4BVUC 3N1YC 1SJED 2M0XA 4OW0A 1E8XA 1WSPA 2TSSA 3W5UB 5AUKA 3RD2A 4MELA 4C7YA 2JQRB 2XNAC 4RGMA 4OZBA 3MJ5A 4ZHPA 1HQRD 4G3XB 3HHMA 3AI5A 2L0FA 3AMZA 2DHZA 3N3KB 2DZKA 1FNUA 2BWFA 3PSEB 4FJZA 3HIZA 1MJDA 4ZRIA 1UD7A 4K7SA 1PGBA 2BQQA 2FUHB 3CSTA 4J6IA 1SE2A 5DPRA 1Q5WB 3B2FA 2L8JA 1L4ZB 2ZCBA 4NY0A
chains in the Genus database with same CATH topology
3U7ZA 2W3SA 1L6UA 2K22A 3BYYB 1IBXA 2IDYA 5H92C 1NYQA 3E56A 5EE1A 3MFGA 3AEBB 4RCOA 3LB8C 1K51A 1TS4A 3GS2A 3SEBA 1IUEA 1FMAD 1JQ4A 2MEKA 3Q8AA 3BVGA 1QOBA 4DXGA 3NRZA 1D4BA 1PFDA 3AE9B 3BVMA 4YSYB 4MT5A 1SJHD 2RDHA 3W2DA 4C56C 1KFYB 4MH8A 3V3XA 2J4XA 3L4PA 1RM6C 4NJCA 1TYGB 3O13A 1E0ZA 1MVKA 2BB6A 1OFFA 2K3UA 4L1BA 4YSXB 1MHXA 1QOFA 1SF0A 2X38A 2BYTA 1FCCC 2OHFA 3IT4B 3V05A 1XF5L 4YTMB 5HFYA 1SBBB 4OZCA 4B0MA 3IT6B 1WXQA 2NTTA 1TS5A 1VLBA 1FCLA 2QSDA 2INPE 2BT6A 3OWEB 4GDKB 5EE3A 1I4PA 1ZPSA 1OQQA 2GRIA 3SR6A 3BK1A 3W9CB 1HZ5A 3H8HA 1V1PA 3Q8BA 1FEHA 2QJLA 1AN8A 1ACCA 3P4QB 4HEA1 4A6QA 4C7ZA 1I4HA 2KMMA 3NVWA 4KX6B 2L1AA 2BS4B 3ZYYX 3HVZA 1YQ3B 1NVID 3R2IA 4WH4A 1B1ZA 1CJEA 2OEDA 5HHDG 1T3QA 4P16A 1EWCA 3FILA 1V8CA 2LHEA 1VZ7A 3ABVB 3KWVA 1NENB 1CZPA 2DYMA 1OQRA 2H88B 2ON8A 1P7EA 1I4RA 4HJGE 4YTPB 4D2KA 3AM9A 2W54A 3P4RB 2FUG1 4XE0A 2BS3B 1WYGA 1SEBD 1MI0A 2VZKD 1YN5A 5BYSA 3Q8FA 1F2RC 1YN3A 2WDVB 1N60A 2LHDA 4H2AA 3FAHA 4OZAA 1RYJA 4CQNA 4EE2A 2QILA 2ZW1A 2K9XA 4JPSA 1QILA 5BYQA 2KACA 3NVYA 1KLUD 1YJJA 1MHHE 4P6VF 2L52A 3TUOA 2LUMA 3BK2A 1M4VA 1VJKA 3IXSA 4ARIA 2PVGC 1EM7A 1VDVA 1ZXHA 2JWUA 1UGJA 2WP9B 1QLBB 1PYWD 2IPKD 1ZXIA 4AS1A 1PDXA 3Q69A 1TZOA 2M0AA 4TQ0A 4KKJA 2JYTA 2AQ1B 1YN4A 1HA5A 3P42A 3KQ4A 1QT9A 2I2YA 2Y5CA 3KLSX 1C9FA 1KH0A 3ZJUA 1EWYC 5D3IB 1C4PA 2WXPA 1AYFA 4RNAA 1FFVA 3W5VB 2BB5A 2AQ3B 1BXTA 4USAA 3U52E 1TY2A 1C76A 1D5XC 2JYEA 3AE8B 1N63A 5LNK1 2IGHA 1QF6A 4GDLB 2LFIA 1SSNA 1JCKB 3AECB 2WXLA 2RDGA 1ZE3D 4C80A 2KWDA 2PMVA 4FXCA 4YT0B 3HUIA 4TSSA 3AE2B 4RF0A 4HRSA 2BBCA 3AEDB 4KGSA 1JROA 3GB1A 1FRRA 3BWUD 3EA6A 3AN1A 1N62A 1E10A 1FFUA 1XEEA 1E6EB 1XLQA 2QIEB 2WNMA 1E7PB 2W82A 1QOAA 3T3NA 3RPFC 1DYQA 3SFDB 3ZJVA 1JWUD 1C77A 1IBXB 2WXNA 3BYTB 1K50A 2E6XA 5T8IA 1FRDA 4PT5A 4MM3B 5AUIA 1DOIA 1TY0A 3IAS1 2G9HD 3NZ3A 2MH7A 4XWTA 1TKEA 1UWXA 2NMQA 2WDRB 3KWLA 1NEKB 1NI3A 2I38A 2YEPB 3CIRB 4N58A 3P1MA 4RGNA 4KGTA 2XN9C 4HKZE 1XLNA 4ZRPA 2DWQA 4YXDB 4RGOS 4YWGG 4TQ1A 5EE9A 3NUHB 3R8BA 1HXYD 1JMLA 3LYYA 3FC4A 1GOZA 1V97A 2RMMA 4DXFA 1B9RA 1ZOYB 1D5ZC 1TKGA 2ACZB 5JXVA 2D5GA 4R3DA 2IJ0A 2MJEA 1L4DB 3CWIA 4O1NA 4LTUA 1UWMA 2EKIA 1JWAD 3VRAB 1ET9A 1L0VB 2PLPA 2ONQA 3AV8A 3TSSA 1DOYA 2BS2B 2N7JA 2KN4A 1JRPA 4OVZA 4B0EA 4N6EB 2E3TA 5E6JA 1L6VA 3AE6B 3RFZB 2PW9A 2WU5B 1SE3A 4KKIA 1C79A 2WXJA 2WXRA 1PGAA 2Z8LA 3ETRA 5HG2A 2V0GA 1ROEA 2AX5A 4YTNB 1T6BX 1V1PB 4LK0M 1I4XA 2K0PA 3VQIA 4XWWA 2FE8A 1K53A 1D6EC 1JWMD 1PUTA 3AE3B 1FNVA 5C3JB 3AB5A 2M56B 2CJNA 1NYRA 4JWSC 4HKQA 3ZGZA 5I4DA 3WCQA 1L5PA 3AE7B 3U2SC 1TS2A 2JX5A 3ZJTA 3AH7A 1YJIA 4A55A 1SXTA 1KF6B 2L32A 4REZA 4WURA 5D7GA 1J7BA 4L23A 4N59A 1WGKA 1L0YB 2R61A 1KRHA 2PIAA 3C8YA 4RFBA 1VRAB 3PZ8A 3N9YC 3TEWA 2G1EA 5C2TB 3T3OA 1TKYA 2HTME 4US9A 2J52A 2WXQA 2KDMA 3DWMA 5BYRA 1N5WA 2WQYB 4WWMA 5BMGA 1Y56A 3URYA 1F77A 1N61A 4HROA 4NAMA 4A8XC 1VR9A 4JWUC 4ITKA 1FNWA 2M19A 3BZDB 5G5GA 2PTLA 3P63A 1VZ6A 2BW2A 1ZDXA 1TJEA 4GLSC 2AQ2B 3SFEB 3DWGC 3I9V1 1EU4A 4NZLB 1PGXA 2JZPA 2JXTA 3GP7A 5FK9C 2L83A 1ESFA 1A70A 1KLGD 2WXIA 1XO3A 3AEAB 2WXHA 3MP9A 3MHZA 2V3NA 2KAJA 2RPVA 1JWSD 1JWBD 2WDQB 4UDUC 1E9MA 2HDEA 2WS3B 1GB4A 1AWDA 2IGDA 2SEBD 4ZOHC 4WIPA 2DLBA 3U4EG 3B9JA 3TEXA 1ZP0B 2V4IB 1XCQL 2KQ4X 3P4PB 1UUPA 3ZQ4A 1JW9D 2QMTA 4RH6A 3LXFA 4DQOC 4M0WA 3P4SB 2BTEA 4RF1A 2FBWB 1V1OA 1QQRA 2GB1A 1ZUD2 1QKZA 3I57A 1IGDA 4NAWB 5D3DA 1STEA 3AEEB 3Q8EA 2DBYA 4ZRQA 4MACA 1F2RI 4IDIA 2INNE 1I4QA 2LGIA 1JALA 1SE4A 4ARCA 1T5XD 2IGGA 1N5XA 4TMAB 2ZW0A 1ZDVA 1HZ6A 1I7HA 4A9AA 2YEPF 1FM0D 3B2GA 2WXKA 2LJIA 1LO5D 4KGRA 1IGCA 2MJ3A 1ENFA 1BMLC 1I4GA 3UI3A 1FIQA 3IAM1 1AW7A 1ET6A 3BIID 1KTKA 2W3RA 1BUIC 3J9CA 3NVZA 1C78A 4IKGA 5FR3A 3R2TA 2J42A 1VZ8A 1TS3A 1J7AA 1P7FA 2VZKB 4Q2JA 2SAKA 1QOGA 3MC0B 2WXOA 3AEGB 3W1SA 2JU6X 1DOXA 2LMCA 1XXGA 4XDCA 1FO4A 2N0SB 5BMIA 3TEZA 1UNSA 5GXGB 1RWSA 1C4CA 1YMHE 2DYOA 2PKOA 3VRBB 4L2YA 1XLPA 3AE1B 3PZ7A 4A90A 1YNTE 2J53A 4YSZB 4OHJA 1GB1A 4LLGM 5FKAC 2WU2B 2CU3A 1K52A 5MPOA 3HRDD 1MPEA 1Q10A 3EUB2 1GAQB 1CQVA 1R7SA 2Q5WD 1EU3A 2V3PA 4ZHOA 1F0ZA 4JE3B 2JSVX 3AE4B 1XLOA 3VR9B 2H89B 2Y5PA 1SIJA 3AE5B 4OW0A 1SJED 2LEKA 1J7CA 5H8YE 1FXIA 1CK1A 1WSPA 1L0XB 2TSSA 2WXMA 3W5UB 5AUKA 5BMHA 3FILB 4XDDA 5HI1A 3EGRA 4C7YA 2JQRB 2XNAC 4RGMA 3PO0A 4OZBA 1XCTL 2WLBA 3MJ5A 3NVVA 4ZHPA 1HQRD 1SB3C 2PVOD 4RGTA 1FXAA 1YQ4B 3HVDA 1WWTA 4JX1C 4IOIE 4WQMA 2WXFA 3AMZA 1DGJA 1D5MC 3BVZA 2EELA 2QEJC 2N9LA 1WRIA 2WXGA 1FNUA 2K5PA 3VR8B 5G5HA 4AQ7A 2B76B 3AEFB 2N9KA 3Q8CA 4ZYSA 3TEYA 2ICIA 2MJDA 2NTSA 1GPXA 2GI9A 1PGBA 2W55A 1RFKA 4US8A 1SE2A 3E9SA 1FD6A 5EE0A 4J3OD 3B2FA 5TSSA 1L4ZB 2Y3AA 2CJOA 4WAFA 1HEZE 1C4AA 3NS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PLP A;  2ONQ A;  1IBX A;  2ZW1 A;  2IGG A;  2ZW0 A;  1HZ6 A;  2N7J A;  2KAC A;  2KN4 A;  1MHH E;  4KGR A;  1IGC A;  2LUM A;  2PW9 A;  1EM7 A;  1K51 A;  3UI3 A;  1ZXH A;  2JWU A;  1PGA A;  5HG2 A;  4IKG A;  2K0P A;  1D4B A;  1P7F A;  1K53 A;  3V3X A;  2JU6 X;  2I2Y A;  1MVK A;  5BMI A;  1MHX A;  1C9F A;  1KH0 A;  1YMH E;  1FCC C;  1XF5 L;  1YNT E;  5HFY A;  2J53 A;  4OZC A;  2IGH A;  1GB1 A;  1K52 A;  1FCL A;  1MPE A;  2KWD A;  1Q10 A;  2QSD A;  2J52 A;  2KDM A;  4KGS A;  5BMG A;  3GB1 A;  2JSV X;  1HZ5 A;  5BMH A;  2PTL A;  3FIL B;  5HI1 A;  1IBX B;  1K50 A;  4GLS C;  4OZB A;  1XCT L;  1PGX A;  2JZP A;  2JXT A;  1UWX A;  2NMQ A;  4WH4 A;  2I38 A;  5HHD G;  2OED A;  3MP9 A;  2RPV A;  4KGT A;  3FIL A;  4HKZ E;  4IOI E;  1GB4 A;  2IGD A;  2LHE A;  2EEL A;  2N9L A;  2ON8 A;  1P7E A;  4HJG E;  4D2K A;  1JML A;  1XCQ L;  2KQ4 X;  2N9K A;  2QMT A;  2RMM A;  2GI9 A;  1PGB A;  5JXV A;  2GB1 A;  1MI0 A;  1QKZ A;  1IGD A;  1F2R C;  1FD6 A;  2LHD A;  4MAC A;  4OZA A;  1F2R I;  1HEZ E;  2LGI A; 
#chains in the Genus database with same CATH topology
 2W3S A;  1L6U A;  2IDY A;  3E56 A;  4NAW A;  1P9D U;  1FXT B;  5EE1 A;  3MFG A;  4W9I A;  3QQ8 B;  1MFW A;  3I63 C;  3N1Z C;  4BBN C;  2D2Q A;  3GS2 A;  3SEB A;  3L10 B;  4NQK E;  4DDG D;  2WX1 A;  3BVG A;  1QOB A;  3AE9 B;  3BVM A;  4YSY B;  4MT5 A;  3ZO5 B;  3M95 A;  3EHV A;  4HCN B;  4NJC A;  1TYG B;  3O13 A;  4KIK A;  1OFF A;  2K3U A;  4L1B A;  2K25 A;  2X38 A;  1WX7 A;  3ZTC A;  1WJN A;  2K6D B;  3W1S C;  2OHF A;  3IT4 B;  1XF5 L;  5HFY A;  4EUT A;  1SBB B;  2FIF A;  5G2N A;  4B0M A;  1V5T A;  3LJ3 A;  2QSD A;  4M0W B;  2BT6 A;  4GDK B;  2DNF A;  3UQA A;  3W9C B;  2WGS A;  3DPD A;  1EO6 A;  4A6Q A;  3PHX B;  4C7Z A;  4S17 A;  4E74 A;  3NVW A;  4LDT D;  2L1A A;  2BS4 B;  5JH5 C;  1YX5 B;  1YQ3 B;  4OVU A;  2XK5 A;  3PVL A;  2KMA A;  4WH4 A;  5E6P A;  1B1Z A;  5HHD G;  1T3Q A;  2O2V A;  3A9K A;  1VZ7 A;  2BGF A;  2ZCC A;  3TIX A;  2ON8 A;  4PS3 A;  4CYE A;  3JW0 X;  4A3O A;  2BYV E;  3AM9 A;  2KKC A;  2DYB A;  3KUZ A;  4MGZ E;  4JQW C;  1SEB D;  2VZK D;  5IP4 D;  2KX0 A;  2J0J A;  2NPT A;  4OZA A;  3ENE A;  2L0T A;  2OOB B;  2C60 A;  2D07 B;  3DBS A;  2KAC A;  3NVY A;  1KLU D;  1UZX B;  4IC7 B;  1YJJ A;  4P6V F;  2W9N A;  3HM6 X;  3N30 A;  3BK2 A;  2K6Q A;  2MCN B;  1VDV A;  3VHT C;  3UQB A;  1UGJ A;  3EEC A;  4AS1 A;  1PDX A;  3PT2 B;  3Q69 A;  2M0A A;  4KKJ A;  2AQ1 B;  4AP4 C;  3KQ4 A;  3A33 B;  2KFK B;  3V61 A;  3KLS X;  1EF1 A;  3NZS A;  2BB5 A;  4USA A;  1TY2 A;  1C76 A;  1D5X C;  2JYE A;  3Q2A C;  2IGH A;  4GDL B;  1JCK B;  4CO7 A;  3M63 B;  1V49 A;  4FXC A;  5GMV A;  3AE2 B;  1WXV A;  5FR6 A;  2WX0 A;  3AED B;  4KGS A;  3EA6 A;  3KH0 A;  2VH1 A;  2D10 A;  1DYQ A;  3IG3 A;  1C77 A;  2B3A A;  2WXN A;  1K50 A;  3NOB A;  2MH7 A;  1TIF A;  3V6E B;  3B08 A;  4IW0 A;  1U4A A;  3ECI A;  4KGT A;  4HKZ E;  4MGY E;  1EUV B;  2ZZP B;  2L3Z A;  3WAL A;  4YWG G;  5LXH A;  4DHJ D;  3R8B A;  2LZ6 A;  3LYY A;  4RM8 A;  1V86 A;  1GOZ A;  2RMM A;  2JT4 B;  2NBV B;  1B9R A;  2DX5 B;  3K9O B;  2ACZ B;  2LGD A;  4R3D A;  2MJE A;  1UWM A;  2BKR B;  3DOW A;  1J0G A;  2CU1 A;  3PLV A;  3VAW A;  2KK8 A;  2BS2 B;  2KN4 A;  1GC7 A;  5E6J A;  2KJ6 A;  3AE6 B;  2PW9 A;  2JUO A;  3RNA C;  2KOX A;  2WXJ A;  2BF8 B;  2Z8L A;  2V0G A;  3N32 A;  4RMA A;  4HK2 A;  1GUA B;  4E3C A;  2PE9 A;  3VQI A;  4K7W A;  4W9C A;  1JWM D;  5C3J B;  4JWS C;  1R4N I;  3DBL B;  3WCQ A;  2IO0 B;  3AE7 B;  2K8H A;  3U2S C;  1TS2 A;  1TBE A;  3AH7 A;  4A55 A;  1WGR A;  1UBI A;  2LI5 A;  4WUR A;  4L23 A;  4N59 A;  1L0Y B;  4E71 A;  3QIJ A;  4GN1 A;  1VRA B;  5L95 C;  3WAO A;  4URK A;  3N9Y C;  4EKU A;  3U7D A;  3NG0 A;  1TKY A;  1UH6 A;  2KTF A;  4A20 A;  2WXQ A;  3A4S C;  1K8R B;  5BYR A;  4WWM A;  1Y56 A;  2PEA A;  2JXX A;  3DQV A;  4HRO A;  4JWU C;  4MEM A;  4W9L A;  2M19 A;  3BZD B;  2BW2 A;  3IVF A;  4WAA A;  3I9V 1;  1PGX A;  2JXT A;  5FK9 C;  3AEA B;  3MHZ A;  1E90 A;  1JWB D;  2LD9 A;  4UDU C;  1L7Y A;  1AWD A;  2YLM A;  2V4I B;  4BKT A;  2KQ4 X;  3ZQ4 A;  1JW9 D;  2QMT A;  2ZVN A;  4RM9 A;  2LAS A;  4DQO C;  4KDI C;  4HCP B;  4AWJ A;  2BTE A;  1QQR A;  2GB1 A;  1ZUD 2;  4GXB A;  3Q8E A;  2FCM A;  4NJ6 A;  1F2R I;  2M1M A;  3L54 A;  3VFK A;  4LJP B;  3NHE B;  4ARC A;  3R66 C;  2IGG A;  4A9A A;  2YEP F;  2WXK A;  1SIF A;  3VTV A;  1IGC A;  4IM2 A;  3HM3 A;  4PYU A;  1I4G A;  3UI3 A;  3OG5 A;  2KTR B;  1BUI C;  4C00 A;  1C78 A;  1WGG A;  2CS4 A;  2ZEQ A;  1YIW A;  4C4V A;  2J42 A;  4IWP A;  1P7F A;  3VUX A;  1F52 A;  4Q2J A;  2SAK A;  2WXO A;  2JU6 X;  4FHK A;  2LXC A;  1FO4 A;  3NZU A;  1LGR A;  3TEZ A;  5GXG B;  1HE8 A;  1WFY A;  1C4C A;  2FAZ A;  2LVP A;  2PPH A;  1XLP A;  3AE1 B;  3H6N A;  3NY5 A;  4A90 A;  3EFU A;  2RDB C;  3DDC B;  1YNT E;  3TCA A;  4OHJ A;  4LLG M;  1TTN A;  2PE6 B;  2KC1 A;  2Z0D B;  4ANX A;  2G45 B;  1Q10 A;  2MP2 B;  5TR5 A;  3VR9 B;  2N9P C;  2D11 A;  1I42 A;  2MQJ A;  4M01 A;  4IUM B;  3V60 A;  3FIL B;  5HI1 A;  3EGR A;  2RGF A;  5LXI B;  2WLB A;  2KHW B;  5BO4 B;  1P3Q U;  2NS5 A;  3VTU A;  2PVO D;  1WWT A;  4IOI E;  1DGJ A;  1R4M I;  2IY0 B;  2EEL A;  2N9L A;  3OAW A;  2WXG A;  2BYF A;  4WWO A;  2L00 B;  4AQ7 A;  2B76 B;  2RSU A;  3ZXV A;  2N9K A;  2MJD A;  2NTS A;  1KM7 A;  3A9J B;  2BPS A;  2GI9 A;  3GZN B;  2W55 A;  5JZE B;  1FD6 A;  5EE0 A;  2GBJ A;  3IFW B;  1N6Z A;  3WA0 A;  2XBB C;  4P7I A;  3NS1 A;  2KLC A;  1JRU A;  3BYY B;  1IBX A;  4MM3 A;  1NYQ A;  4LCD E;  2N7E A;  4ZRJ A;  2JVC A;  4RCO A;  2MBQ A;  3RZF A;  3KVF B;  4CHK A;  1WGH A;  2MEK A;  2WWZ A;  3Q8A A;  3ZNG C;  3V6C B;  4WJP A;  3NRZ A;  1D4B A;  1PFD A;  5JHA A;  1SJH D;  3APC A;  2RDH A;  4MH8 A;  3PGE A;  2OJW A;  3MC9 A;  1MVK A;  1WXA A;  5J17 A;  4W9G A;  2LVQ A;  4KSK C;  1SF0 A;  3H9D A;  4HPL B;  2KJH B;  3ZVV A;  4OZC A;  5D94 A;  1TS5 A;  2KT7 A;  3C0R B;  3OWE B;  2MX2 A;  4FN2 A;  3JSV A;  4ICU A;  2KAN A;  2IO1 B;  1OQQ A;  3BK1 A;  3H8H A;  1LXD A;  3H7P A;  3KUC B;  2I1J A;  1V1P A;  2QJL A;  1ACC A;  3DBR B;  2R2O A;  2D3A A;  3ZYY X;  2IBI B;  2GBM A;  2KDB A;  1CJE A;  2OED A;  2G4S A;  4HDO A;  2C7M B;  2FCS A;  3KWV A;  3DVN V;  4P1C C;  1P7E A;  4YTP B;  1V5O A;  2BS3 B;  1WYG A;  2X8X X;  5IAA C;  2CKH B;  1D3Z A;  4WJQ A;  4MJS B;  5BYS A;  2ZVO A;  4KVG B;  1YJ1 A;  3M62 B;  1TGZ B;  4F7Z A;  1E8W A;  2HE7 A;  3QK0 A;  1F9J A;  5BYQ A;  4ANW A;  1MHH E;  1WJ6 A;  1WJU A;  1M4V A;  1TZ1 A;  1WJ4 A;  4WJN A;  2NBU A;  1FPY A;  1WX8 A;  1QLB B;  4AUQ C;  2IPK D;  3A1Q A;  3PRZ A;  1ZXI A;  4OVV A;  4II3 B;  2L76 A;  1HA5 A;  2ZPY A;  2WHI A;  1V6E A;  4TUU A;  2V3S A;  2DEN B;  4KSL C;  4M8N A;  1C4P A;  3MTN B;  3I3T B;  1VCB A;  1WGD A;  1WR1 A;  2MSE D;  1BXT A;  3U52 E;  2IO2 B;  1S3S G;  2LFI A;  2GBN A;  2WXL A;  1ZE3 D;  2KWD A;  2PMV A;  4XGA B;  3HUI A;  3PLU A;  4PYZ A;  2BBC A;  3ZIM A;  3ZRC A;  1E10 A;  1FFU A;  1E6E B;  4KV2 A;  3T3N A;  1WH3 A;  3ZJV A;  3QAQ A;  1FRD A;  4PT5 A;  5AUI A;  1DOI A;  3APF A;  3IAS 1;  3NZ3 A;  2V9H A;  5E6O A;  2YEP B;  1NI3 A;  2I38 A;  3AU4 A;  3B0A A;  3OLM D;  2MBO A;  2NVU I;  4N58 A;  2XN9 C;  2FCQ A;  1XLN A;  2AWT A;  5IO9 A;  1WMH A;  1E8Y A;  3LDZ E;  4YXD B;  3ZNI D;  5EE9 A;  3UF8 A;  3RN9 C;  1HXY D;  1WXS A;  3KUD B;  3N1X C;  4TKN A;  3FC4 A;  4EZK A;  1V97 A;  2LRW A;  4DXF A;  1ZOY B;  1D5Z C;  1TKG A;  3UIO B;  2KVZ A;  2IJ0 A;  1L4D B;  5D6J B;  1JWA D;  2D3C A;  2LRU A;  3VRA B;  1L0V B;  1WE7 A;  2N7J A;  3RFZ B;  2KQ7 A;  3ZRF A;  3DHH C;  4YTN B;  3L17 A;  3DBH I;  3T9L A;  3RNE C;  2N9X A;  2DAJ A;  1C3T A;  2MBE A;  4XWW A;  2EMS A;  1K53 A;  1YD8 U;  3PZD A;  2M56 B;  4HKQ A;  4W9J A;  2XK5 B;  3ZGZ A;  2M17 A;  3PRP B;  1SXT A;  1KF6 B;  4REZ A;  3A9K B;  1J7B A;  1WGK A;  4M00 A;  5G55 A;  2KFK A;  2PIA A;  3C8Y A;  4W9D A;  3PZ8 A;  4WWN A;  3TEW A;  4IG7 B;  5C2T B;  3T3O A;  4QAY A;  1T0Q C;  5C1Z A;  4LNK A;  5IA7 A;  2WQY B;  1P1A A;  4EZJ A;  2NPT B;  4NAM A;  3FKY A;  1VR9 A;  4ITK A;  5CHW A;  5G5G A;  3I5J C;  1UF0 A;  3P63 A;  3U8Z A;  2LXA A;  2AQ2 B;  1QZE A;  3R7R A;  3TBL D;  2L83 A;  1ESF A;  1KLG D;  3MP9 A;  2WXH A;  2V3N A;  2RPV A;  4M8M A;  1E9M A;  2D3G A;  2IGD A;  2LWP A;  2JPH A;  4JIO U;  4F1S A;  2DAF A;  1UUP A;  2N1W A;  4RH6 A;  3LXF A;  3K9P B;  4GMV A;  3RZW C;  3WAP A;  3VUY A;  2FBW B;  5D3D A;  2UWQ A;  4MSM B;  4MAC A;  4IDI A;  4LDT B;  1YOV B;  2LGI A;  1N5X A;  2ZW0 A;  1ZDV A;  1I7H A;  3Q3J A;  5IKC M;  2WYQ A;  1V81 A;  3VTW A;  1ENF A;  2KC2 A;  1FIQ A;  1AW7 A;  2W3R A;  4K7U A;  4EZL A;  3NVZ A;  5FR3 A;  4M02 A;  1VZ8 A;  4W9K A;  1T0S C;  1LFD A;  4NJ7 A;  5AZH A;  2VZK B;  4XDC A;  2AL6 A;  1RWS A;  4ZDV A;  4LNI A;  3RYT A;  3PZ7 A;  2A5U A;  2GMI C;  4HJK A;  4K1R B;  3DVN U;  4JGH B;  2J53 A;  3Q3N C;  3ML8 A;  5FKA C;  2CU3 A;  1K52 A;  2MBB B;  1GC6 A;  1R4N B;  1CQV A;  1EU3 A;  2KWC A;  3DHG C;  4JE3 B;  2KN5 A;  1WI0 A;  2Y5P A;  3AE5 B;  2LEK A;  1J7C A;  5H8Y E;  1FXI A;  1CK1 A;  2WXM A;  1L0X B;  1YX6 B;  4EEW A;  1T0R C;  4DHZ E;  3VDZ A;  4FJY A;  2KWU B;  3PO0 A;  1S1Q B;  1XCT L;  3NVV A;  4W9E A;  3RI7 C;  2KYW A;  3ZUN A;  1FXA A;  1YQ4 B;  4AJY B;  2V1Y A;  4WQM A;  2WXF A;  3NS8 A;  1PQS A;  1D5M C;  2KNB A;  3BVZ A;  2QEJ C;  5IOI A;  1WRI A;  3CSF A;  2K5P A;  2IND C;  3VR8 B;  3QWZ B;  1KOT A;  4DXA B;  4ZYS A;  1GPX A;  2LGS A;  1RFK A;  2O6V D;  3RNG C;  2Y3A A;  2AEH A;  2CJO A;  4WAF A;  2K22 A;  5H92 C;  2V4L A;  5DPT A;  2YVC A;  3AEB B;  5E6N A;  2RR9 A;  3LB8 C;  4P1B C;  4GGQ A;  4LNF A;  3SDL C;  1IUE A;  2Y5B B;  2LGX A;  3PRM B;  4DXG A;  3PRE A;  1KFY B;  3L4P A;  1RM6 C;  1E0Z A;  3VUW A;  4YSX B;  2EKE C;  3WAM A;  2IZV B;  4MGK E;  4YTM B;  4B9K A;  1WXQ A;  5D2M B;  2DZM A;  1J19 A;  1VLB A;  1FCL A;  3L16 A;  4WJO A;  2CHZ A;  2A4Z A;  1XD3 B;  4II2 B;  1I4P A;  4BKS D;  1WIA A;  1ZPS A;  1HZ5 A;  1VD2 A;  3Q8B A;  1FEH A;  3P4Q B;  4HEA 1;  5AZG A;  2KMM A;  3ZKJ C;  3HVZ A;  2O6V A;  4BAX A;  2N4F A;  1ZW7 A;  4ZRK A;  3DHI C;  3GOE A;  1YQB A;  4P16 A;  1EWC A;  3FIL A;  2LHE A;  3ABV B;  1NEN B;  2DYM A;  1OQR A;  2KQS A;  4HJG E;  4C4V B;  4D2K A;  1KJT A;  4XE0 A;  3VH3 B;  1MI0 A;  4G11 A;  1YN3 A;  2WDV B;  1C1Y B;  1N60 A;  2LHD A;  4IM3 A;  1R4M B;  3FAH A;  4I6N B;  1RYJ A;  2ZJD A;  1WXM A;  1L2N A;  2QIL A;  2ZW1 A;  3OJ4 B;  4MH0 E;  4LNO A;  2L7R A;  2L52 A;  2LUM A;  3UIN B;  3IXS A;  1EM7 A;  4BOZ B;  2KX3 A;  2JWU A;  2RD0 A;  2WP9 B;  1OGW A;  2BYE A;  4TV3 A;  1IPG A;  2XEW A;  1IYF A;  1YN4 A;  2K8C A;  3B1L X;  4BKS A;  3Q3O C;  3P42 A;  2IO3 B;  2R2Q A;  2RPQ A;  1G6J A;  3R7Q A;  2Y5C A;  1KLV A;  3AU5 A;  5J2R A;  5D3I B;  2WXP A;  2J0K A;  4MGI E;  2AQ3 B;  3Q3M C;  2MLB A;  3AE8 B;  3CF6 E;  5IN7 A;  5LNK 1;  3GZN I;  1SSN A;  3AEC B;  4LNN A;  1ZKH A;  2BVC A;  4C80 A;  3VH4 B;  4AOF A;  1JRO A;  3ALB A;  3BWU D;  3ONS A;  3AN1 A;  1N62 A;  1XLQ A;  2WNM A;  5HKH A;  2W82 A;  2MHJ A;  3SFD B;  1IBX B;  5CHV C;  4MM3 B;  3JYU A;  4DDI D;  3V62 A;  1UWX A;  2KD0 A;  3CIR B;  4RGN A;  2BWE S;  4ZRP A;  2DWQ A;  3AUL A;  2K1F A;  3IBE A;  4FLH A;  3NUH B;  2FID A;  4ASW C;  2PJH A;  4ACF A;  4ZYN A;  1NDD A;  2D5G A;  2Z59 B;  4FUL A;  1WZ3 A;  3CWI A;  4O1N A;  2EKI A;  1ET9 A;  2PLP A;  2ONQ A;  3AV8 A;  2VH2 A;  3TSS A;  1WF9 A;  1DOY A;  3DVG X;  1JRP A;  4N6E B;  1ZGU B;  2E3T A;  4KZC A;  3WAN A;  4KKI A;  1C79 A;  3JSV B;  4GIV A;  3DBR I;  2WXR A;  3ZTD A;  1PGA A;  3H1U A;  1ROE A;  2AX5 A;  3H7P B;  1V1P B;  4LK0 M;  2G3Q B;  1I4X A;  4JLC A;  3ZNZ B;  2FE8 A;  2KFJ A;  3AB5 A;  5KHO A;  2D3B A;  5I4D A;  3RNC C;  1L5P A;  2JX5 A;  5AEK B;  1YJI A;  2L32 A;  4MDK E;  4BZA A;  1CMX B;  2R61 A;  1KRH A;  3W1Y A;  4HWI B;  4RFB A;  1BT0 A;  3A4R A;  3RUI B;  2G1E A;  1ISN A;  2HTM E;  4US9 A;  2J52 A;  2CHW A;  4YL8 A;  1IP9 A;  5BMG A;  1Y8R C;  2UYZ B;  1WRD B;  4A8X C;  3RT3 B;  2BKF A;  2PTL A;  2NCN A;  1VZ6 A;  1GJZ A;  3DWG C;  4NZL B;  2M4N A;  2JZP A;  1T0Y A;  1SGH A;  2KAJ A;  2WDQ B;  2HDE A;  2WS3 B;  4I6P A;  3EC8 A;  3PHW B;  3A1Q B;  3U4E G;  3B9J A;  1ZP0 B;  1XCQ L;  2KXJ A;  3P4P B;  2JRI B;  3CMM B;  5CHF A;  5AZF A;  4PK1 A;  4M0W A;  1RRB A;  4GDK A;  4FAD A;  1QKZ A;  3SU8 X;  1IGD A;  4NAW B;  3AEE B;  3AXC A;  2DBY A;  4ZRQ A;  2G4D B;  1E8Z A;  2KVR A;  2INN E;  4ICV A;  1SE4 A;  1RAX A;  1T5X D;  5DPW A;  1HZ6 A;  3B2G A;  1FM0 D;  1LO5 D;  3TL5 A;  4IWQ A;  1BML C;  3IAM 1;  3RUL A;  2INC C;  3BII D;  1ET6 A;  4A3P A;  1KTK A;  1HTQ A;  4KIK B;  4IKG A;  3PS6 A;  3QA8 A;  4F8C B;  1J7A A;  3Q3F A;  1QOG A;  3MC0 B;  3AEG B;  3W1S A;  1DOX A;  2N0S B;  3ML9 A;  1UNS A;  3NJT A;  5J18 A;  1WMH B;  3VRB B;  4L2Y A;  5EDS A;  1RLF A;  1WX9 A;  3DBH B;  2JF5 A;  4JL9 A;  4YSZ B;  2WU2 B;  1UBQ A;  1XT9 B;  3HRD D;  4G50 A;  1MPE A;  1GAQ B;  4XC2 A;  1R7S A;  3L08 A;  2Q5W D;  2V3P A;  4ZHO A;  1EF5 A;  1LQB A;  4K81 A;  1WGY A;  3X23 A;  2H89 B;  1SIJ A;  4XX5 A;  3RNF C;  1F1H A;  2K8B A;  2O2V B;  3GE8 C;  5BMH A;  1E7U A;  4XDD A;  2HJ1 A;  5DCN A;  1V80 A;  3TJP A;  3GE3 C;  3T8M A;  1SB3 C;  4RGT A;  5KHQ A;  3HVD A;  3O65 B;  2K39 A;  4JX1 C;  2OJR A;  2GBK A;  2FCN A;  4EOY A;  1Z5S B;  3KW5 B;  4GDL A;  5G5H A;  3AEF B;  3Q8C A;  3TEY A;  2JRH A;  2ICI A;  1J8C A;  4US8 A;  3E9S A;  4J3O D;  1WM3 A;  5TSS A;  3X0W A;  1V9J A;  4IM0 A;  3MHS D;  1HEZ E;  1C4A A;  3U7Z A;  3ZNH B;  4G0N B;  4MSQ B;  1V2Y A;  5C23 A;  2J7Q B;  1K51 A;  1TS4 A;  2ZNV C;  2QHO A;  3SHQ A;  3RCZ A;  2LJ5 A;  1FMA D;  3KYC D;  1JQ4 A;  4HLE A;  2QDF A;  4FHJ A;  1H8C A;  2KDI A;  3Q14 C;  1P98 A;  3W2D A;  4C56 C;  3V3X A;  2J4X A;  3M3J A;  3U30 A;  2UU7 A;  2BB6 A;  4NQL B;  2VRR B;  4XZ4 A;  1MHX A;  1QOF A;  2DZJ A;  2BYT A;  2JZZ A;  1FCC C;  3V05 A;  1LM8 B;  3IT6 B;  2NTT A;  2WDT B;  4KZ0 A;  2INP E;  1WZ0 A;  5EE3 A;  3BY4 B;  3DCG A;  2GRI A;  3SR6 A;  3PPA A;  3P2B A;  1AN8 A;  1I4H A;  2GBR A;  2CHX A;  1GG3 A;  2ZNV B;  2MW5 A;  4KX6 B;  4XYC A;  1MG4 A;  1NVI D;  3R2I A;  1Z2M A;  3QX1 A;  1V8C A;  3EFC A;  5LLI A;  3VVW B;  1CZP A;  2H88 B;  3HK0 A;  1I4R A;  2M8S A;  4BOS C;  4DWF A;  2W54 A;  3P4R B;  2FUG 1;  4ANV A;  2IYD B;  5CX3 A;  3QJZ A;  1YN5 A;  3Q8F A;  1F2R C;  2KWV B;  1WE6 A;  4H2A A;  1GNU A;  4ANU A;  4CQN A;  4EE2 A;  4FJV B;  2K9X A;  3Q6B A;  4JPS A;  3VXW A;  1QIL A;  3ZW3 A;  2NR2 A;  3TUO A;  2HJ8 A;  4GU2 A;  1OQY A;  1OEY A;  1VJK A;  3DBL I;  4ARI A;  2PVG C;  4PS8 A;  3MJW A;  2C5L C;  1ZXH A;  1Q0W B;  4EFO A;  1PYW D;  4HPM B;  1WY8 A;  3IHP C;  4S0R A;  1TZO A;  4TQ0 A;  5DPS A;  2JYT A;  4KDL B;  1QT9 A;  2KJR A;  2I2Y A;  4DHZ B;  3PTF C;  1C9F A;  1KH0 A;  2LVO A;  3ZJU A;  1EWY C;  1E5W A;  1AYF A;  4RNA A;  3UIP B;  1FFV A;  3W5V B;  2LUE A;  4WWP A;  4DHJ B;  4BKG A;  1N63 A;  1QF6 A;  2RDG A;  4AJW A;  4YT0 B;  4TSS A;  4RF0 A;  4FA6 A;  4HRS A;  2KTR A;  3GB1 A;  1FRR A;  4W9F A;  2I1K A;  2QIE B;  1XEE A;  1E7P B;  1QOA A;  3RPF C;  1XQQ A;  1JWU D;  4HXD A;  2C9W B;  3BYT B;  2E6X A;  2IY1 B;  5T8I A;  2HTH A;  1AAR A;  1TY0 A;  2G9H D;  4XWT A;  1TKE A;  1MG8 A;  2NMQ A;  2WDR B;  3KWL A;  1NEK B;  3P1M A;  3QHT A;  3R3M A;  2MWS B;  1M94 A;  4HPP A;  4NPN A;  4RGO S;  4TQ1 A;  1JML A;  4DK5 A;  2CR5 A;  1WR6 E;  1HTO A;  3QCA A;  1OEY J;  1P0R A;  5JXV A;  2MP2 A;  4I6L B;  4LTU A;  3QC8 B;  2NBW B;  4BBN F;  3JVZ X;  3ZXR A;  3ZDM C;  1UGM A;  4GSW A;  4OVZ A;  4B0E A;  1RFA A;  1L6V A;  2MRP A;  2WU5 B;  4PS7 A;  1SE3 A;  3ETR A;  1WM2 A;  4GOC A;  5HG2 A;  2EMT A;  5JHB A;  1T6B X;  2N9E B;  3D32 A;  2FNJ B;  2K0P A;  3QAR A;  2JWZ A;  1D6E C;  1PUT A;  3DVG Y;  3AE3 B;  1FNV A;  3A9J A;  3C19 A;  2O6V B;  2CJN A;  1NYR A;  4N9F 4;  4K3C A;  2MBH A;  2AL3 A;  3ZJT A;  4HVB A;  5D7G A;  2KDE B;  3OJ3 A;  2HD5 B;  2C7H A;  3ZLZ A;  3L13 A;  2KDM A;  3UGB B;  1WYW B;  3DWM A;  1N5W A;  3S2A A;  3URY A;  2DZI A;  1F77 A;  1X1M A;  1N61 A;  3BIN A;  1FNW A;  2KLG A;  1ZDX A;  2KZR A;  1I35 A;  1TJE A;  4GLS C;  3RNB C;  3SFE B;  1EU4 A;  3GP7 A;  5L83 A;  3H7S A;  2ASQ A;  2GOW A;  1A70 A;  1NI2 A;  2WXI A;  1XO3 A;  4NNJ B;  1NBF C;  1JWS D;  2C7N B;  1OTR B;  1GB4 A;  2SEB D;  2JZ3 B;  4ZOH C;  4WIP A;  2DLB A;  4W9H A;  3TEX A;  4LJO B;  2KMC A;  3N20 C;  3P4S B;  4RF1 A;  1V1O A;  3I57 A;  2KDF B;  2LGY A;  2QCZ A;  3SD5 A;  1STE A;  2L05 A;  2MA9 B;  2N7D A;  3PV1 A;  1I4Q A;  3TMP B;  1JAL A;  4TMA B;  3WIM A;  4DBG A;  2LJI A;  4KGR A;  2MJ3 A;  2GLS A;  1A5R A;  2AYO B;  4FBJ B;  1UEL A;  4HDQ A;  2KO3 A;  3J9C A;  2Z0E B;  4BFR A;  3R2T A;  1TS3 A;  1E7V A;  2JY6 A;  4GB9 A;  3MC8 A;  2LMC A;  1XXG A;  4IWO A;  4MJS A;  5BMI A;  2QC8 A;  1YMH E;  2DYO A;  2J0M A;  4WQO B;  2N1V A;  2PKO A;  3RMK C;  4B95 A;  1TT5 B;  3APD A;  3KYD D;  4B6W A;  3ZDT A;  1GB1 A;  1H4R A;  5CTR C;  4X57 B;  5MPO A;  3EUB 2;  2REX A;  1SE9 A;  1F0Z A;  1Q1O A;  2JSV X;  3L0W B;  3AE4 B;  1XLO A;  2ZPN A;  4K3B A;  4BVU C;  3N1Y C;  1SJE D;  2M0X A;  4OW0 A;  1E8X A;  1WSP A;  2TSS A;  3W5U B;  5AUK A;  3RD2 A;  4MEL A;  4C7Y A;  2JQR B;  2XNA C;  4RGM A;  4OZB A;  3MJ5 A;  4ZHP A;  1HQR D;  4G3X B;  3HHM A;  3AI5 A;  2L0F A;  3AMZ A;  2DHZ A;  3N3K B;  2DZK A;  1FNU A;  2BWF A;  3PSE B;  4FJZ A;  3HIZ A;  1MJD A;  4ZRI A;  1UD7 A;  4K7S A;  1PGB A;  2BQQ A;  2FUH B;  3CST A;  4J6I A;  1SE2 A;  5DPR A;  1Q5W B;  3B2F A;  2L8J A;  1L4Z B;  2ZCB A;  4NY0 A; 
#chains in the Genus database with same CATH homology
 3U7Z A;  2W3S A;  1L6U A;  2K22 A;  3BYY B;  1IBX A;  2IDY A;  5H92 C;  1NYQ A;  3E56 A;  5EE1 A;  3MFG A;  3AEB B;  4RCO A;  3LB8 C;  1K51 A;  1TS4 A;  3GS2 A;  3SEB A;  1IUE A;  1FMA D;  1JQ4 A;  2MEK A;  3Q8A A;  3BVG A;  1QOB A;  4DXG A;  3NRZ A;  1D4B A;  1PFD A;  3AE9 B;  3BVM A;  4YSY B;  4MT5 A;  1SJH D;  2RDH A;  3W2D A;  4C56 C;  1KFY B;  4MH8 A;  3V3X A;  2J4X A;  3L4P A;  1RM6 C;  4NJC A;  1TYG B;  3O13 A;  1E0Z A;  1MVK A;  2BB6 A;  1OFF A;  2K3U A;  4L1B A;  4YSX B;  1MHX A;  1QOF A;  1SF0 A;  2X38 A;  2BYT A;  1FCC C;  2OHF A;  3IT4 B;  3V05 A;  1XF5 L;  4YTM B;  5HFY A;  1SBB B;  4OZC A;  4B0M A;  3IT6 B;  1WXQ A;  2NTT A;  1TS5 A;  1VLB A;  1FCL A;  2QSD A;  2INP E;  2BT6 A;  3OWE B;  4GDK B;  5EE3 A;  1I4P A;  1ZPS A;  1OQQ A;  2GRI A;  3SR6 A;  3BK1 A;  3W9C B;  1HZ5 A;  3H8H A;  1V1P A;  3Q8B A;  1FEH A;  2QJL A;  1AN8 A;  1ACC A;  3P4Q B;  4HEA 1;  4A6Q A;  4C7Z A;  1I4H A;  2KMM A;  3NVW A;  4KX6 B;  2L1A A;  2BS4 B;  3ZYY X;  3HVZ A;  1YQ3 B;  1NVI D;  3R2I A;  4WH4 A;  1B1Z A;  1CJE A;  2OED A;  5HHD G;  1T3Q A;  4P16 A;  1EWC A;  3FIL A;  1V8C A;  2LHE A;  1VZ7 A;  3ABV B;  3KWV A;  1NEN B;  1CZP A;  2DYM A;  1OQR A;  2H88 B;  2ON8 A;  1P7E A;  1I4R A;  4HJG E;  4YTP B;  4D2K A;  3AM9 A;  2W54 A;  3P4R B;  2FUG 1;  4XE0 A;  2BS3 B;  1WYG A;  1SEB D;  1MI0 A;  2VZK D;  1YN5 A;  5BYS A;  3Q8F A;  1F2R C;  1YN3 A;  2WDV B;  1N60 A;  2LHD A;  4H2A A;  3FAH A;  4OZA A;  1RYJ A;  4CQN A;  4EE2 A;  2QIL A;  2ZW1 A;  2K9X A;  4JPS A;  1QIL A;  5BYQ A;  2KAC A;  3NVY A;  1KLU D;  1YJJ A;  1MHH E;  4P6V F;  2L52 A;  3TUO A;  2LUM A;  3BK2 A;  1M4V A;  1VJK A;  3IXS A;  4ARI A;  2PVG C;  1EM7 A;  1VDV A;  1ZXH A;  2JWU A;  1UGJ A;  2WP9 B;  1QLB B;  1PYW D;  2IPK D;  1ZXI A;  4AS1 A;  1PDX A;  3Q69 A;  1TZO A;  2M0A A;  4TQ0 A;  4KKJ A;  2JYT A;  2AQ1 B;  1YN4 A;  1HA5 A;  3P42 A;  3KQ4 A;  1QT9 A;  2I2Y A;  2Y5C A;  3KLS X;  1C9F A;  1KH0 A;  3ZJU A;  1EWY C;  5D3I B;  1C4P A;  2WXP A;  1AYF A;  4RNA A;  1FFV A;  3W5V B;  2BB5 A;  2AQ3 B;  1BXT A;  4USA A;  3U52 E;  1TY2 A;  1C76 A;  1D5X C;  2JYE A;  3AE8 B;  1N63 A;  5LNK 1;  2IGH A;  1QF6 A;  4GDL B;  2LFI A;  1SSN A;  1JCK B;  3AEC B;  2WXL A;  2RDG A;  1ZE3 D;  4C80 A;  2KWD A;  2PMV A;  4FXC A;  4YT0 B;  3HUI A;  4TSS A;  3AE2 B;  4RF0 A;  4HRS A;  2BBC A;  3AED B;  4KGS A;  1JRO A;  3GB1 A;  1FRR A;  3BWU D;  3EA6 A;  3AN1 A;  1N62 A;  1E10 A;  1FFU A;  1XEE A;  1E6E B;  1XLQ A;  2QIE B;  2WNM A;  1E7P B;  2W82 A;  1QOA A;  3T3N A;  3RPF C;  1DYQ A;  3SFD B;  3ZJV A;  1JWU D;  1C77 A;  1IBX B;  2WXN A;  3BYT B;  1K50 A;  2E6X A;  5T8I A;  1FRD A;  4PT5 A;  4MM3 B;  5AUI A;  1DOI A;  1TY0 A;  3IAS 1;  2G9H D;  3NZ3 A;  2MH7 A;  4XWT A;  1TKE A;  1UWX A;  2NMQ A;  2WDR B;  3KWL A;  1NEK B;  1NI3 A;  2I38 A;  2YEP B;  3CIR B;  4N58 A;  3P1M A;  4RGN A;  4KGT A;  2XN9 C;  4HKZ E;  1XLN A;  4ZRP A;  2DWQ A;  4YXD B;  4RGO S;  4YWG G;  4TQ1 A;  5EE9 A;  3NUH B;  3R8B A;  1HXY D;  1JML A;  3LYY A;  3FC4 A;  1GOZ A;  1V97 A;  2RMM A;  4DXF A;  1B9R A;  1ZOY B;  1D5Z C;  1TKG A;  2ACZ B;  5JXV A;  2D5G A;  4R3D A;  2IJ0 A;  2MJE A;  1L4D B;  3CWI A;  4O1N A;  4LTU A;  1UWM A;  2EKI A;  1JWA D;  3VRA B;  1ET9 A;  1L0V B;  2PLP A;  2ONQ A;  3AV8 A;  3TSS A;  1DOY A;  2BS2 B;  2N7J A;  2KN4 A;  1JRP A;  4OVZ A;  4B0E A;  4N6E B;  2E3T A;  5E6J A;  1L6V A;  3AE6 B;  3RFZ B;  2PW9 A;  2WU5 B;  1SE3 A;  4KKI A;  1C79 A;  2WXJ A;  2WXR A;  1PGA A;  2Z8L A;  3ETR A;  5HG2 A;  2V0G A;  1ROE A;  2AX5 A;  4YTN B;  1T6B X;  1V1P B;  4LK0 M;  1I4X A;  2K0P A;  3VQI A;  4XWW A;  2FE8 A;  1K53 A;  1D6E C;  1JWM D;  1PUT A;  3AE3 B;  1FNV A;  5C3J B;  3AB5 A;  2M56 B;  2CJN A;  1NYR A;  4JWS C;  4HKQ A;  3ZGZ A;  5I4D A;  3WCQ A;  1L5P A;  3AE7 B;  3U2S C;  1TS2 A;  2JX5 A;  3ZJT A;  3AH7 A;  1YJI A;  4A55 A;  1SXT A;  1KF6 B;  2L32 A;  4REZ A;  4WUR A;  5D7G A;  1J7B A;  4L23 A;  4N59 A;  1WGK A;  1L0Y B;  2R61 A;  1KRH A;  2PIA A;  3C8Y A;  4RFB A;  1VRA B;  3PZ8 A;  3N9Y C;  3TEW A;  2G1E A;  5C2T B;  3T3O A;  1TKY A;  2HTM E;  4US9 A;  2J52 A;  2WXQ A;  2KDM A;  3DWM A;  5BYR A;  1N5W A;  2WQY B;  4WWM A;  5BMG A;  1Y56 A;  3URY A;  1F77 A;  1N61 A;  4HRO A;  4NAM A;  4A8X C;  1VR9 A;  4JWU C;  4ITK A;  1FNW A;  2M19 A;  3BZD B;  5G5G A;  2PTL A;  3P63 A;  1VZ6 A;  2BW2 A;  1ZDX A;  1TJE A;  4GLS C;  2AQ2 B;  3SFE B;  3DWG C;  3I9V 1;  1EU4 A;  4NZL B;  1PGX A;  2JZP A;  2JXT A;  3GP7 A;  5FK9 C;  2L83 A;  1ESF A;  1A70 A;  1KLG D;  2WXI A;  1XO3 A;  3AEA B;  2WXH A;  3MP9 A;  3MHZ A;  2V3N A;  2KAJ A;  2RPV A;  1JWS D;  1JWB D;  2WDQ B;  4UDU C;  1E9M A;  2HDE A;  2WS3 B;  1GB4 A;  1AWD A;  2IGD A;  2SEB D;  4ZOH C;  4WIP A;  2DLB A;  3U4E G;  3B9J A;  3TEX A;  1ZP0 B;  2V4I B;  1XCQ L;  2KQ4 X;  3P4P B;  1UUP A;  3ZQ4 A;  1JW9 D;  2QMT A;  4RH6 A;  3LXF A;  4DQO C;  4M0W A;  3P4S B;  2BTE A;  4RF1 A;  2FBW B;  1V1O A;  1QQR A;  2GB1 A;  1ZUD 2;  1QKZ A;  3I57 A;  1IGD A;  4NAW B;  5D3D A;  1STE A;  3AEE B;  3Q8E A;  2DBY A;  4ZRQ A;  4MAC A;  1F2R I;  4IDI A;  2INN E;  1I4Q A;  2LGI A;  1JAL A;  1SE4 A;  4ARC A;  1T5X D;  2IGG A;  1N5X A;  4TMA B;  2ZW0 A;  1ZDV A;  1HZ6 A;  1I7H A;  4A9A A;  2YEP F;  1FM0 D;  3B2G A;  2WXK A;  2LJI A;  1LO5 D;  4KGR A;  1IGC A;  2MJ3 A;  1ENF A;  1BML C;  1I4G A;  3UI3 A;  1FIQ A;  3IAM 1;  1AW7 A;  1ET6 A;  3BII D;  1KTK A;  2W3R A;  1BUI C;  3J9C A;  3NVZ A;  1C78 A;  4IKG A;  5FR3 A;  3R2T A;  2J42 A;  1VZ8 A;  1TS3 A;  1J7A A;  1P7F A;  2VZK B;  4Q2J A;  2SAK A;  1QOG A;  3MC0 B;  2WXO A;  3AEG B;  3W1S A;  2JU6 X;  1DOX A;  2LMC A;  1XXG A;  4XDC A;  1FO4 A;  2N0S B;  5BMI A;  3TEZ A;  1UNS A;  5GXG B;  1RWS A;  1C4C A;  1YMH E;  2DYO A;  2PKO A;  3VRB B;  4L2Y A;  1XLP A;  3AE1 B;  3PZ7 A;  4A90 A;  1YNT E;  2J53 A;  4YSZ B;  4OHJ A;  1GB1 A;  4LLG M;  5FKA C;  2WU2 B;  2CU3 A;  1K52 A;  5MPO A;  3HRD D;  1MPE A;  1Q10 A;  3EUB 2;  1GAQ B;  1CQV A;  1R7S A;  2Q5W D;  1EU3 A;  2V3P A;  4ZHO A;  1F0Z A;  4JE3 B;  2JSV X;  3AE4 B;  1XLO A;  3VR9 B;  2H89 B;  2Y5P A;  1SIJ A;  3AE5 B;  4OW0 A;  1SJE D;  2LEK A;  1J7C A;  5H8Y E;  1FXI A;  1CK1 A;  1WSP A;  1L0X B;  2TSS A;  2WXM A;  3W5U B;  5AUK A;  5BMH A;  3FIL B;  4XDD A;  5HI1 A;  3EGR A;  4C7Y A;  2JQR B;  2XNA C;  4RGM A;  3PO0 A;  4OZB A;  1XCT L;  2WLB A;  3MJ5 A;  3NVV A;  4ZHP A;  1HQR D;  1SB3 C;  2PVO D;  4RGT A;  1FXA A;  1YQ4 B;  3HVD A;  1WWT A;  4JX1 C;  4IOI E;  4WQM A;  2WXF A;  3AMZ A;  1DGJ A;  1D5M C;  3BVZ A;  2EEL A;  2QEJ C;  2N9L A;  1WRI A;  2WXG A;  1FNU A;  2K5P A;  3VR8 B;  5G5H A;  4AQ7 A;  2B76 B;  3AEF B;  2N9K A;  3Q8C A;  4ZYS A;  3TEY A;  2ICI A;  2MJD A;  2NTS A;  1GPX A;  2GI9 A;  1PGB A;  2W55 A;  1RFK A;  4US8 A;  1SE2 A;  3E9S A;  1FD6 A;  5EE0 A;  4J3O D;  3B2F A;  5TSS A;  1L4Z B;  2Y3A A;  2CJO A;  4WAF A;  1HEZ E;  1C4A A;  3NS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...