2GB2A

The p52g mutant of amicyanin in the cu(ii) state.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMGHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Site-Directed Mutagenesis of Proline 52 To Glycine in Amicyanin Converts a True Electron Transfer Reaction into One that Is Conformationally Gated.
pubmed doi rcsb
molecule keywords Amicyanin
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gb2A00
2VW6A 3SQRA 3AY2A 4YSQA 1SDDA 2IDTA 3WKPA 3PPSA 4YSTA 4A68A 1L9QA 4YSDA 2BWDA 3S8GB 2UX7A 2B3IA 3X1FA 4HALA 1HAUA 3G5WA 2VSKB 2DYSB 1ID2A 2VN3A 7PCYA 5IY5B 1JZEA 2H3XC 2HX9A 1JXFA 2P80D 2XYBA 1MG3C 4BWTA 3NJLA 1RKRA 3FYIB 3NP3A 3RYMA 2UXFA 1AZBA 5B3SB 3TU6A 3ABLB 1KCBA 2HX7A 3EH3B 4PCYA 4NERA 2VSMB 1W8EA 1BXUA 3GDCA 1JXDA 2VM4A 3FT0A 1FFTB 1PMYA 5B1JA 1PF3A 3TA4D 5E9NA 3X2QB 1SF5A 2HX8A 2X87A 4W9ZA 1PNCA 9PCYA 2RACA 1L9OA 4JHUA 1CC3A 2XX0A 1SNRA 3AG3B 1XB8A 1J5CA 1V10A 1IKOP 1HFUA 1CURA 2PPCA 5F7BA 3QJUB 1A4CA 1AACA 1IBYA 2A3TA 4YSAA 1JOIA 5PCYA 2EIMB 1AANA 2IWFA 3AG1B 3CDZB 2DY2A 3PAZA 2R7EB 1NWOA 3MBWB 2PPFA 5B1BB 2PLTA 2XXGA 2EILB 1MZZA 1E67A 2HXAA 4BWWA 2UXTA 2XXFA 1J9SA 1WA1X 7PAZA 1GW0A 2ZXWB 3FPXA 5F7AA 2YAQA 2X88A 1IUZA 4Q8BA 3UADA 5A7EA 1MG2C 2PPEA 3CVDA 1E5YA 3N2JA 1RZQA 2W8CA 4DP2X 5I5MA 1TEGA 1ZDQA 3H56A 4A2GA 2PCYA 2YAOA 3NSDA 4HIPA 4KOCA 5D4IA 3H4FA 1QLEB 2I85A 2WO3B 2QPEB 4JHVA 3L45A 3NJGA 3PCYA 2HRGA 4YL4A 2P80A 2JXMA 5I6MA 2XV0A 3NSCA 1J5DA 4N4YB 4MFHA 5I28A 4DP8X 2IAAC 1R1CA 4GP5B 2BWIA 3DIVA 3N55A 5PAZA 1ILUA 1AQ8A 2Y69B 1PAZA 2GC7C 4G7QB 4WKXA 1AZUA 3WI9A 1MDAA 1JVOA 4DP4X 2EINB 3WNIA 2PCFA 2PP9A 1CYWA 1ASPA 6PAZA 2J5WA 1NIBA 1MZYA 5I6LA 1EZLA 2IDSA 1ADWA 2GHZA 4AKOA 2YARA 1ET5A 4A66A 3UABA 5EHFA 3FYEB 4PAZA 4UANA 1X9UA 2XUWA 4E9QA 3FU8A 2FJSA 1QNIA 3QJVB 4G7RB 1FA4A 1JZIA 1OE1A 4G72B 3OM3B 1ZV2A 3S3DB 3C75A 3OQRA 3SBQA 1SHXA 3FPYA 5B1KA 1AIZA 1M56B 1V54B 4AKQA 5I6KA 2CJ3A 4AX3A 4E9WA 2CAKA 1IBZA 1KDJA 2YQBA 2IDFA 3IN0A 5TK2A 1JERA 4YVNA 1GS8A 1SFHA 1A65A 1VLXA 1W6WA 4F7KA 3NYKA 6PCYA 4GP4B 2WSDA 4BDVB 1M9WA 1OCRB 2BP0A 2IH9A 4K9JA 2I7SA 2FT8A 1ET8A 3EH5B 4G71B 3ABMB 4E9TA 2NRDA 1SDDB 1KV7A 1WA2X 2IH8A 2CUAA 4E9XA 1AS6A 1OE2A 1PLBA 1AG6A 3ASOB 4WTQA 4FA7B 3T71A 1L9RA 1XMEB 1OCCB 1BQ5A 1KBVA 3ZDWA 1ILSA 4DP7X 4E9RA 4HCIA 3HB3B 2BP0B 3AW5A 2YAMA 1GYCA 2XV2A 1WS8A 1JZFA 2J57A 3PLYA 4KO9A 3NJMA 1PLAA 1ZIBA 3D12B 3FU7A 2VW4A 1BYOA 3V9EA 2GC4C 4P5SA 3NSYA 3NP4A 3OD3A 5B1JC 2GIMA 2DV6A 2MTAA 1PZAA 1QHQA 1PZCA 3PXLA 5LDUA 3GYRA 3KW7A 5I26A 3FSAA 3FU7B 3JT2A 4Q89A 2ZWNA 2E86A 1KCWA 2PPAA 1WAEA 3ZBMA 4KNTA 1T5KA 1JZGA 3NJHA 2YAHA 3IEAA 3NJFA 5TK4A 4F2EA 4KNUA 4EF3A 1AR1B 1I53A 3FS9A 3ZIYA 3MX0B 3IE9A 2GBAA 4E9VA 2QDVA 4A67A 2AFNA 3FQ2A 2FT6A 2J55A 1DZ0A 3FSVA 4HHWA 4HHGA 4BK5C 2ZOOA 3BQVA 1J9RA 2BHFA 3CG8A 3T6VA 1BQKA 2BO0A 3CVBA 4HZ1A 1IC0A 1E65A 2W88A 2XVBA 1NICA 2HRHA 5I5JA 3SBPA 1NWPA 1BYPA 4GP8B 1GY1A 3TBCA 2DYRB 2TSAA 3NJNA 4KO5A 1URIA 4GYBA 2ZONA 4A2HA 4BWUA 1CUOA 4AKPA 3WNJA 1ASQA 4F2FA 3FQ1A 4N8UA 1SF3A 4KO7A 2XX1A 5AKRA 4DP6X 1ZIAA 1ETJA 1AZCA 1L9SA 4CSZA 3OMIB 3FQYA 3IN2A 4GXFA 1ASOA 4CSPA 1AS7A 1E30A 3WKQA 2H47C 4DP5X 4W1TA 3PAUA 1KYAA 1KGYE 1RCYA 4ZK8A 3TASA 2GSMB 4YVUA 2IWKA 1RZPA 1SJMA 2UX6A 1NIAA 3SBRA 2CBPA 2YXVA 2CCWA 4UF7C 1NTDA 1NINA 4KNSA 1AAJA 1OCOB 3U25A 1A3ZA 5B1AB 2BW5A 2YAPA 3IBOA 5B7MA 3FSZA 4AZUA 1N68A 1GS6X 2FNWA 3S8FB 1E5ZA 4HAKA 1EHKB 3X1NA 3KW8A 3TBBA 4HCFA 2Y1AA 1JVLA 3DTUB 3X1GA 3H4HA 4DPAX 1TU2A 3PAVA 2AZUA 5AFAA 1OCZB 3QQXA 5I6PA 4YSPA 2QDWA 1NPNA 1GY2A 1OOWA 1W6LA 3UAAA 2PP8A 4YSOA 3T9WA 4A2EA 3AG4B 1AZNA 2N0MA 1KBWA 1OV8A 4YSRA 4G7SB 4DP9X 2FQFA 4DP1X 2GI0A 1A4AA 2Q5BA 2BZCA 3QJRB 2EIJB 3UACA 3WIAA 1B3IA 4ENZA 2VW7A 4DPBX 1ZPUA 1KDIA 3ZX1A 5I6NA 3DKHA 3T6ZA 4YSCA 5I6OA 4KOBA 2FQEA 2TSBA 3NSFA 1J9TA 1GSKA 1PY0A 1BXVA 1TKWA 3ASNB 1A4BA 5FC9A 2EIKB 1ET7A 3CZUB 3ABGA 2FQDA 1BXAA 2JKWA 2H5UA 1UATA 2YAFA 1PNDA 5ANHA 4BXSV 3OMAB 2OCCB 3V9CA 1AZRA 1PLCA 1F56A 8PAZA 2AZAA 2JFCA 1JZJA 3FU9A 3NT0A 2OV0A 4BXVA 3NJKA 2BP8A 2UXVA 5B7EA 2YAEA 2AVFA 4A2DA 3QPKA 2B08A 1AOZA 4E9SA 5AZUA 3CDZA 3BVDB 2R7EA 2I7OA 5D4HA 4RH4A 2J56A 2VM3A 2XLLA 3EHBB 2BP8B 4FAAB 2XV3A 4A2FA 1JZHA 4TXVB 1FWXA 3X1EA 1NDTA 3AG2B 1NIFA 1WA0X 1L9TA 3ABKB 5I5IA 1OE3A 1GS7A 3GXUB 1NIEA 4E9YA 1YLBB 1N70A 2BZ7A 2VMJA 1A8ZA 2QPDB 2BW4A 3X1BA 4X4KA 1X9RA 1BQRA 1NZRA 4P5RA 2AANA 1TEFA 1XB3A 3FSWA 1XB6A 2FTAA 2GB2A 1PZBA 5D4JA 4AI7A 4NB7A 4GY4A 1AS8A 4NAJA 3QJSB 4L0PB 1CYXA 1L9PA 4M3HA 2DWSA 1JXGA 3WG7B 1AG0A 3OMNB 1V55B 2LLNA 1NIDA 4YSEA 3CVCA 1J9QA 2IDUA 2Q9OA 1NPJA 3S3BB 3S3CB 3QJQB 1WS7A 3AZUA 2FQGA 4YSSA 2HLEB 5B7FA 1BAWA 1ZDSA 4QLWA 2IWEA 2XU9A 2OJ1A 4UAHA 4DP0X 1HAWA 2HZHA 2YXWA 3NJJA 2CALA 2PP7A 4G70B 3HEIB 4M4RB 4DPCX 1BEXA 2XWZA 3T6XA 3EH4B 1PCSA 3T6WA 2IDQA 1DYZA 3QJTB 2PPDA 1GR7A 3UGEA 3ERXA 2WO2B 3NJIA 4YSUA 2DWTA 4JKNA 3JTBA 2UXGA 1M57B 3UAEA 2MRYA 3EF4A 4HCGA 1OF0A 2FWLB 4KO6A 4QKTA 2FT7A 4BDVA 1SFDA 2QT6A 1SHWA
chains in the Genus database with same CATH superfamily
3L4ZA 4P5KB 3BPCB 3IDIB 4Y4HA 1KF9B 1WFNA 4M61A 4NP9A 4PHZA 5IJKC 2PYFA 4A68A 3Q8BA 3CFJB 1JP5A 4FQLL 4J3WA 2C1PB 4X5PA 5FDWB 4OCXH 3MRDA 4F7EB 3D52A 2EXYD 4Y5VA 2CRIA 5J6SA 2D7OA 4B9PA 3QORC 4EE2A 2H41A 3B2PA 5L4MA 2O61B 5SX4I 3V2AR 5B3SB 1KB9K 3HLAA 4OCXL 1GJIA 1JTPA 2HX7A 5GJSH 3BPOB 5C07A 1MWAB 2ENJA 2NXYD 4TLUA 1VA9A 3TBTB 4GRWF 3GDCA 1X3DA 1PF3A 4WJ5A 1VERA 4X0NA 1RJZA 2XG5B 2CR3A 4XBEH 5MHSE 1P4IH 4ZS6C 5IBUB 4PVBA 4L4VD 4AC4A 3RG1C 1WHOA 1J0IA 1VIWA 1J5CA 3MX0A 4X8CA 5T3ZE 1IAII 4OGAD 4Y88A 1KOAA 1CCZA 5DJDA 5F1SA 1A4CA 4WW1A 5GGSY 2XJKA 4PPTA 1Y0LB 1P4IL 2ZXDA 3LN5A 5CGTA 3T0VA 3UPCA 1I8AA 4YSAA 1JFQH 1TTCA 5EC2A 2P5WE 2OZNA 4XPBH 2EDRA 2L7EA 2EUWA 2ZJSH 1VACA 1LP9F 1CGUA 2XNAA 3TLRA 1MXGA 4BWWA 3MRKB 4TYUA 4U3SB 5EUOE 3ZDXE 1WA1X 7PAZA 4HJUA 2LU4A 1A2YA 1JFQL 4XBPA 5IB5B 3D0AA 2VABB 4XPBL 2CO6B 1M53A 2YGOA 2ZJSL 2PF6A 3W1ZA 4QTIH 3DYOA 4TNVK 3QYNA 3QIBD 1KPUB 3X12A 4LLQB 5KS9E 3GSUB 4JN2B 3PRZA 1IBGH 5I1KH 5EBGA 4PRIB 3PCYA 1AOHA 4JKKA 6FABH 4LKXA 2DTSA 1O6VA 2P80A 2X6MA 1KIRB 4QTIL 5FM8A 4B96A 3Q7JA 2XACC 1NCIA 1EJ6A 4OLYH 4FABH 3SDXA 3RNQA 4S1DC 1IBGL 4MVBD 3A6OA 5I1KL 4GP5B 2NT0A 1ILUA 3PUCA 5C2UB 2I9LA 4LCWE 2ORBH 1BF8A 1UXWA 3BUDA 4OLYL 4QOKB 2K9UA 4WKXA 2HB0A 1U8CB 4BSVB 4XCFH 1BPLB 4J4PC 2BHZA 4W4OA 2YQGA 1E27B 1RJYA 3ILQC 1MZYA 1S7XA 1C16A 2ORBL 2X10A 3GZKA 5D1ZA 4BJLA 4DSYA 3K4AA 4BKTC 5ADOH 3V7AE 3FU5A 3IFOA 4URTB 1I1YB 1YCSA 3GWJA 4PP1C 3MKGA 4XCFL 2PN5A 2ADFH 2BVYA 5AVQB 5EU4A 3RTLA 4NOFA 1U8MB 4G7RB 2GY7B 5TDPA 1E9QA 1PYWB 1QRND 3QUMH 5D1XB 3SY0A 5AOKA 1Z66A 2W07B 2Q87A 4OM0H 4GAYA 5ADOL 3ARVA 3S88H 2QPSA 3OKNA 5F1IB 3RGVC 5IFAH 3HG1B 2ADFL 4TSCH 2WSPA 5DWPA 2JE8A 3MBXH 1OTUC 3KGRA 1DE4B 1UB5B 3QUML 3MNWB 4JUTA 4OM0L 1H3PH 3GPSA 3ILPB 4K5OA 3W56A 3MOQA 3KGSA 3S88L 3LRSB 3GXIA 1VLXA 3G04A 4QXVA 1UA6L 4Y4KB 2RH0A 5FFOA 5IFAL 4TSCL 4L3ED 4ZJ9A 3S34H 2P5ED 5GZNC 1J5IA 1T0MA 4X4YA 1CD1B 4AQ1C 4CN6A 1IU1A 3PJSB 4DGIL 4MLIA 4G71B 4S1QH 3ABMB 2WZPA 3LH8A 2NRDA 5DHYB 5A43C 3A24A 1OE2A 1LO4H 3S34L 1A6VH 2BVOA 3BH4A 1M2OA 4NQTA 4LL4A 4LPXA 4J27A 4EOWH 2GFBB 4ZRGA 4ELKA 4S1QL 4OF3A 4UOQA 3UAJD 3RDTA 3II3A 1QFPA 3VVVA 1LO4L 2E6QA 1A6VL 1G87A 3GSRA 4ZMLA 1I4FB 3QT2A 4BK4A 4EOWL 2C9SA 3MMEB 3BEVB 4NQVB 3HAEG 3RWIA 3V4LA 3BWSA 2GBVA 5D72L 5JUEH 1QHQA 4PCSA 1F11B 4AE0A 2ARJA 4XXDB 1HSBA 2D73A 3MRHB 1I9JH 1E8XA 5CGBA 1LE9B 1IFGA 3NMEA 4JBSA 2YBRB 5F1OB 2ZKMX 4X6DA 1MCOH 3CZNA 3UYRH 3NJHA 5JUEL 4CNIB 4HJGB 3FFOA 4MDIA 1IJNA 1I9JL 2FLRT 3KYKH 3KNBA 4FQCL 2KH2B 4I4WB 3EO9L 4IBSA 3GZQA 2UZYA 1JV5B 5ID1A 4MNQA 4ODXA 1SBBA 2BFGA 3FQ2A 2LAAA 1MCOL 4XX5A 3UYRL 4A7UA 3FB8A 3OWEA 5MENE 1ZA3A 3BQVA 3KYKL 4XVJH 3WIIL 3CDGB 4I7ZC 2KLTA 4OD3L 3BVNA 2B14A 2HP4A 3I85A 3KPNA 3ESPA 4WI2A 4HJSA 5DD6B 2JK5A 3QDGE 1URIA 1QLRB 3CCHB 3HR5A 4N0FA 3V4PB 3AFLA 1M4KA 3BXNB 1HQRB 5SWSE 3PWPE 4RZCB 4FQQA 5CZXC 4HMDA 2Y7LA 4OQTH 3SDYH 2XWRA 3MRFB 4OZHF 5B4MC 2EDFA 4OJYA 1IM9A 3E3QC 5DZLA 2DOCA 3FOMA 3MUHL 4P46B 3RWFB 2GITB 1JK8B 4Z7OE 5HHNB 2MCPH 5IEHB 2X4OB 5J0BA 5I8EB 3VFRB 4GSUA 3VGHA 1TTGA 4OQTL 4CSPA 3DX7B 4CVXB 1IZJA 2W9LA 2UYLB 3ZT6A 1ZVSB 4M6ML 5IF0B 5TE4H 4OLEA 2CLRA 1R0AH 1LHZA 2MCPL 4ESKA 4NLAA 3QG6B 4BH8A 5HGHB 1T1YB 2EYSB 5EO0B 3U82B 1FNAA 2BDNH 2HT3D 4ONHB 4BIKA 1NTDA 5ICYB 2AW2A 3ULAB 4G83A 4KK8C 4JPKH 5TE4L 3TEZA 1R0AL 5CJXC 4HC1A 3T0XA 2CHDA 1KLGB 4JREC 3SKNB 4AZUA 3S8FB 3Q05A 2BDNL 1E90A 2HVJB 3UGXA 1CFQA 1T20A 4FNSA 2V7HA 4JPKL 2BVPA 4PTUB 4G82A 1JGUH 3KVDD 1TTFA 3K5RA 2A4CA 5J9PB 4QRAA 3UERA 4AIEA 4JB9H 3T2LA 3DVGB 3O4LD 2B1HH 1EHXA 1DVFA 1ZT1A 4I2XA 1YJDC 2P9RA 3ZK0A 1CGWA 4PRPD 2XWXA 3QXDA 5E1AA 3QIWD 4Y4FB 5EOCH 4U7MA 1B9KA 4JY4B 4NJ9L 2APTA 4JB9L 1K2DB 1AZNA 2F19H 2E7MA 3FQXA 4H2AA 2B1HL 4HEPA 4HG4K 5GZOA 4C55A 3Q43A 2ZWLT 3QNXA 1WFTA 2B1AH 2VAAB 2NR6D 3C6LD 2EXWC 3KPPA 3T0EB 5J4MA 1WZLA 1W0WB 5JXAH 3S3PA 1Z5HA 2F19L 3D3VA 1YZZA 2NY5C 4C83B 4L1BA 5DJ6B 1JMXA 2X1WL 5BNXD 1INDH 2BNQA 2B1AL 4HXAL 3L3GB 1HQ4B 1ZE3C 1T2QH 3L5JA 2LW3A 3LZQA 5HDWA 5JXAL 4HD9A 4FFWC 4JZJB 4ZMOA 1G0XA 3QQ9D 1KXVC 3QQ3A 4JM2B 1SXAA 1T2QL 4TSBH 5DJCA 1I7RB 1E3XA 3R8QA 3DIFB 1W15A 4A6YB 1NUFA 3ALPA 1C7TA 1TKWB 4IBZA 1ODUA 4PJ5D 3IKKA 3LNFA 4BQ6A 4IRSB 1AQMA 4PJBB 3P69A 1WBXA 3H9SB 1TEYA 3VMOA 2BY3A 5KANI 5I82A 3G9VA 4Z0XA 4LCUA 3ULVH 1AOZA 2Z8SA 1V7NH 4RGNB 3FQRB 5GRZA 4Y9FA 4WI3A 2Z3FA 4XGZB 4FTVB 5ADPL 3ARWA 3L3JB 4DAGH 4FTDA 2XV3A 3O9WA 4LE8A 3ULVL 1BZQK 1P9MA 1RZ8B 2W65A 1V7NL 3GBDA 3KPTA 4Q9BA 2HMID 3AG2B 2IWGA 1CN4A 2E56A 1RK1A 2NTFB 1OD9A 5I0ZA 1UZ6F 3R4DA 4ZX5A 3GBMH 1TMCB 2VRAA 5DK2B 3ATAA 4DAGL 4N28A 2J6EH 3VJ6B 5I2IB 2WWKO 1CDGA 1JMZA 4W68A 3N0AA 2Q1EA 3PQYB 3PWJA 5CILH 3SYPA 5ECJE 1IL1B 1QLFA 32C2B 3GBML 5CJBA 3OKMB 4FXGA 1TTUA 2XWBA 1D5MB 2IPTH 4WWPA 4TUOB 5C9JA 5EO9B 3IFNH 1HYSC 1JXGA 5CILL 4IJ3B 4NQCE 4R7NA 3HC3H 1NIDA 1PZUB 5AB2A 1A9EB 1CJYA 1ONQB 2BIPA 4FLOA 5D5MB 5G4MA 3RUGE 2CWRA 2IPTL 4MJID 4AWJC 1TZIB 1KBGH 3IFNL 1DBMH 4C58B 4HEME 3BYTA 4FC3E 5B7FA 1MDTA 1OZTG 3HC3L 4L9LC 5HJ3A 1SJVA 2J1KA 2BSDA 2GI7A 3IETB 1UB6A 2AXHA 4K8RD 3QP3A 4KJYA 3W3BA 1V05A 2C9VA 2XVGA 1DBML 5F9JA 1NC2D 1D6EA 1XF3A 3U79A 4JDZB 3WEXB 4PJHF 4GXUM 3MV7E 5DS2A 3BZFA 3POCA 5DHVH 4JFQB 2WPGA 4PG2A 4XWOD 1FE8H 1SZNA 3D25B 1BBJA 3P77A 3UGUA 4HCGA 1JGDA 2A0LC 4I1PA 3FOLA 4MJ5A 5KSBE 1DJGA 3MLXH 1D5ZA 4F33A 4CJ0A 4K0OA 1SFDA 1N6QH 3IGKA 1DBBH 1FE8L 1A6PA 4B0MM 2UUDH 4MSWA 2Y5TA 5DJXA 3GUTA 1X5ZA 1CT8A 3TF4A 5AW8B 2WJ5A 3NCCB 4R0LA 4DT2A 2DKMA 3GIVA 3L95A 3MLXL 4UQ2A 1CE1H 1O9ZA 1KG0B 3VWKA 1N6QL 3J8F7 3ZL1A 2RD0A 1DBBL 2DQCH 2NQ3A 1NH6A 5DHXB 4HCRH 4HUVB 1PTZA 5H4YA 5F6HJ 4AOFA 3BPOC 2VR6A 1CE1L 1W72A 2HT2C 3W9DA 2ZXQA 1TSRA 3N85H 5F7NC 1ML0A 5D70H 3RU8H 2DQCL 1PG7W 4HCRL 3VD7A 4YHZH 3NIFF 4UM9B 4APQA 2IPUG 1JYVA 1G9HA 1EEZA 3N85L 4JR9H 4K7PY 2WQXA 1J1XH 5D70L 3RU8L 2HX8A 2BMKA 4TLSA 3GO1H 4GEIA 2WWOA 3KHQA 3N1QC 4O51A 3V6BR 1ED3A 5IBLC 2Q8AH 4YHZL 3IDUA 2DMCA 2CCVA 2OR9H 1JN6A 2A73A 4HIIA 4PRAA 4W9DC 4JR9L 1J1XL 2MIZA 1DEEB 3GO1L 2D3VA 5AG8A 3GHPA 3ESMA 2Q8AL 3K6OA 5C3TA 4NP4H 1AANA 1HEZA 3LXAA 1VEOA 4JG9A 2QLYA 4JFFB 4MJ6B 2DYPD 4G6KH 2Z31B 3QGVA 4XTRD 2OR9L 1PD1A 1NWOA 1FYHB 1BP3B 3MV9D 2YFOA 2F8VA 1XCWA 3S5ZA 1ZHBA 2XZCH 1VAHA 5AOLA 1PKQE 3SPVB 4NP4L 1QWUA 2H6OA 4QHLA 5DMGD 4OI8A 4G6KL 5EDSA 5EBWA 3NIDF 2EE6A 4Q8BA 5BV7B 1CD0A 4LVNC 4YIQB 3TYGH 3FTGA 4KKLC 1FVEB 1V3JA 5EOQH 3HS8A 3GJFA 5E94B 4NFBA 5AW9B 1OLZA 5ISZD 3V0FA 4E41A 3NSDA 4HT1H 1KT2B 1BX2B 1QLEB 2JF1A 3ELAT 4A2LA 4HJTA 3QFJB 4MQTB 4LPVA 1U0QA 2N3JA 3VXTB 4WW2C 5FUCC 3A6CH 4Z7VB 2R29A 3NSCA 1JHLH 3FFCB 4KKBC 3FCTB 3T8XB 2ZCKL 2IAAC 1YMMA 4HT1L 4JQVC 1H3XA 3LDBB 2O1AA 2ZG2A 5HVWA 1PG7H 2Y1VA 2C4FU 3MN8A 3GSXA 3A6CL 1JHLL 1S5IH 4XRCB 1NGXB 1WITA 2RB8A 3QIUD 1KTRL 3UZQB 4ZFFA 3CIQA 5EU6D 4L2YA 1XSIA 4GO8A 1FI8C 2HJLA 2YD6A 4L23A 2GHZA 4PJAE 4MMYB 4P8QA 5DVPA 1S5IL 4UM8A 4R84A 4NRYB 5D1XC 5KYXB 2N0KA 3B37A 4AT6A 1DLHB 3FCBA 4UANA 5DZOA 5T1KB 3WTYA 2FJSA 3SD2A 3KXFA 3ULUE 1CLVA 3EHBD 4GKSB 3OKYA 3MGOB 3VD0A 1U3HD 1ZTMA 1G7JA 1SHXA 4X9GA 5KG9B 3AITA 5T3ZH 3VFNB 2FJGA 3D33A 4OBSA 4AVHA 5K33A 4AX3A 3GDBA 4Y4KC 3GZPA 1KDJA 3AT8A 5BOZG 1J8HD 2P48B 3LB6D 1YHPA 2YQBA 3MGAA 3QDAA 3U7AA 2Q2LA 4AYGA 1JERA 5EEUA 1E0OB 5C0JB 1Q0XL 4KKAC 5F89A 5KBDA 1VFOA 3GMPB 3FB7A 2N1KA 3ZL2A 3VXNB 3JBG7 3WIFB 3NPSB 1ZS8A 4MMZB 3B83A 3MROA 4PJ9D 1W9XA 4HUMB 1W0VB 4TL4A 2ZYRA 1X7QA 2NY6D 5KVDL 2FWSA 2BIIA 2WBWB 2E27H 1B3JA 5CGYC 5K39A 1X4XA 5HD8D 4DP7X 3R19A 3QWOA 3HB3B 4JGUA 3HIZA 1IBFA 2NQCA 5EZJA 1JTOA 4X9BA 5EIIG 4ZO6A 3PREA 2E27L 1PGRB 3CVHH 4KK5D 2OMXA 3AM8C 2MOGA 2EXTA 2NY2D 3BFOA 4XH2A 1ZHLB 1R3KA 3MRBA 3O11B 2FO4B 4ZPVB 3QDMB 1KTLA 3WFDL 2QSQA 1U92B 2QELA 1OGTA 2X4SA 2WXHA 3T04D 1QBMH 4Z7UB 1YNLH 4EF3A 4YEFA 1PJ9A 1T89C 3SE9L 1HL4A 3DMMB 2HJKB 4U1IA 5BPPA 1PD6A 3DK2A 5E6ZA 3D85B 2EC9U 1NCWH 3BZEA 1XSJA 1NDGB 1CE6A 5F1NB 3L3HB 2O6PA 1QBML 2B1OA 1YNLL 3B3IB 3ILEA 5E2WH 1BQKA 2EO7A 3QZNA 2IAMA 3DSFH 5FO8B 2R27A 5J3HC 1NCWL 3APMA 4TLTA 1LNUB 1NWPA 4MD5A 3IFPA 4ODHH 3UP6A 1BZ7B 2PXYA 3B9KD 4ZO9A 1F5WA 4MAYB 2J44A 3J07A 1MCEA 5E2WL 3HE7D 4F7CA 5KYNA 2BNRB 3DSFL 2WZ6A 3PHOB 1FC2D 3BO8A 3TS8A 3WLWD 1PVHA 3GSWA 4P46C 3DSNA 1SYSA 4ODHL 1XIWA 3IDGB 1G7IB 5IHBA 1N10A 4W9FC 1AQKH 4RFOL 4EVNA 4UQ3B 4DP6X 3D09A 3EYFA 3Q8CA 1O7DC 1L9SA 4ZX6A 3W9EB 2JKJA 3FT4B 1BLNA 4FGMA 1MRFH 1NDMB 3NH7H 2A1WH 1T1ZA 1I8MB 1E30A 4MAZA 1AQKL 1YEEH 2PW2A 1KGYE 3WMSA 3TBYA 1QSED 2ZX7A 1MRFL 3H9YA 4PJ8B 3NH7L 1S46A 2A1WL 4PRHA 4P4RB 4ADGA 2WJ7A 4AH2A 5DZJA 5E8NB 4X7EC 2IANB 3NRFA 4EQ2A 2B2XH 3WJLA 1YEEL 2AJ3B 3VFOB 3BP5A 4MB5A 3ZDZF 2V33A 3K72A 5DK0B 5MEPB 5B7MA 2VLRE 4H1LB 2FL5A 3G08A 4MX7A 4C4UA 1UASA 2B2XL 3AU1A 3L7EA 3SDDB 1W80A 3U0PB 2LV4A 1E4XI 4QRUB 1N8ZB 4MQXC 3MJ7A 4XNUH 2YC1A 2NX5B 4R4NC 4TULH 2VAJA 2JIXA 3G5XA 1NPNA 1FFRA 4O58H 1V3LA 4LVHB 3EDFA 4HFWB 4LKCB 5C7XH 3OKDA 1TYEB 2ZSWA 4GO6B 4XNUL 1KJ3H 5HHOD 3T0EC 4CMMB 4YHPA 5JHDE 5T1MB 1CF8H 4DVBA 2ED8A 3MOAH 1O5DT 4K3JH 4TULL 4DP1X 4EI6B 4F58H 1ZLEA 4O58L 4X9FA 3KPLA 3QJRB 4XMWA 5AVTB 3AAZB 4J2QA 4NUGH 5JO5B 5C7XL 3M1OA 2CKBB 1GHFH 3R4RA 5FYKE 2ESVE 3HZKA 1KJ3L 5T1DH 3A4AA 2DEYX 4DW2H 2H2SC 3NZUA 1RIVH 4IOSD 2QVIA 1CF8L 2G5UA 1MY5A 4K3JL 4F58L 1KDIA 1OGSA 4CGTA 5J11B 2DQUH 5I6OA 2GJ6B 1QSVA 2L8AA 4YOKA 3OVUB 3KDMA 2DICA 3HUJE 5C0AE 2WAQA 4NUGL 2R2EB 2WUCH 1GHFL 1RJLB 5T1DL 4DW2L 1CBJA 1TIUA 1ZPLA 4X5XA 1SLVA 4OFPA 1RIVL 5GGVH 3ZTJG 3NZ8A 2DQUL 5LNDA 2JKWA 2EIEA 1UATA 4NHUA 3RAJH 1E2WA 5JOFA 3T3ME 2ZXEB 5D7LD 2WUCL 1ADQA 4WO4A 2OYLA 5JMOC 1DVTA 2OV0A 5GGVL 5F7EH 4RGNC 4WFHD 3RAJL 4CVUA 1E7UA 1HH6B 2AVFA 3STZB 1L0YA 3F85A 1C5CH 1E50A 5B8CA 4XNAA 1HXYA 2EC8A 3UJTH 5FECB 3VH8A 3MO1A 1MAJA 2GJPA 5E9DD 5JDSB 2YWYA 2DQTH 2ERJB 5F7EL 4HK0B 3C09B 1OTSD 3HFMH 15C8H 5FA4B 1H6TA 1C5CL 2WN3A 4LIQH 1JZHA 4ZUUB 3QNZB 1NDTA 5IJDC 3DECA 1SN0A 1AGFB 1AGBA 1XGUB 4PLKC 1PEZA 1C5BL 1D5RA 3EJTA 15C8L 1BVLB 5T3XH 4ANKA 1KIQA 1SXBA 4IK6A 4L3FA 4LIQL 1UT9A 1BMGA 1KGCD 5ERWA 1PZ5B 5C09A 4YMPA 4ZSOB 2VDKB 3WS3A 3PV6A 43CAB 3HPJA 3HJEA 3RWEA 2R1XA 2NYYC 4F2ME 2QV2A 4IBQA 3GBNH 3Q48A 4RVBA 2GB2A 4F1SA 5MEOB 5SWZE 5T3XL 4NB7A 3IGLA 4GY4A 1AS8A 5FYJD 3T3PB 2ITDA 1EQWA 4FEMA 2V5YA 2V2XB 3FQUA 3SOTA 3MRQB 1HZLA 1QZNA 3OXRB 5JPMB 1UOWA 5CP3H 4HYTB 4AGNA 2VLJA 2VMCA 4FJYA 3EGXA 1CGSH 1S7WB 1SN5A 2AQNA 4N8VB 5J57B 2AV1B 4POZD 1F1GA 2G3NA 2J2ZB 1F3DH 2ZYIA 4B41A 4YSSA 1KULA 2X42A 3EFFB 2K6ZA 1EXUA 4LLUA 1ZV9A 3BGFB 1U93B 3VTMA 4UAHA 1G7LA 5B39B 2CALA 2HWZH 2CPUA 3AREC 4LCWA 1NCTA 2XWZA 5CF3A 3Q2WA 4NEHB 4LCCB 3ZE0B 2X1OA 1PCSA 4EUPB 1DYZA 2DM2A 3DI2B 4HISA 3E9UA 3S3SA 1TZ8A 2NY0B 5HHMD 4GUQA 4RQQA 3UGEA 2OKMA 4U1KB 1EMTH 1VFMA 2HWZL 2MNUA 4NZUH 2GJRA 3C8DA 3WDIA 4F7MB 5FYKU 3JQOB 2VKXA 2E9GA 4M93B 4NLHA 1MCWW 1WVZA 2EIZB 3X3FH 4ZFOB 3NBNA 3KYOA 3B9VA 4FQHA 4IOIA 2RFXB 2KZKA 2B59B 5JIQA 1I3GH 3DI3B 3G6JF 1YEHH 2YPLA 5A16A 3SQRA 3HRZA 4Y2NA 4M43L 4WHYG 3X3FL 3K0YA 4WAFA 4GUCA 4Z3JA 3VFPA 4Q9CA 4H1LG 4GG6B 3Q44A 2JSFA 1I3GL 4QRRE 3QDJD 1KCKA 1IM3D 2ATKA 1WO2A 1YEHL 3CHOA 1IBBA 4EI5D 5HYEA 1G7MA 2J8UF 1C08B 3WY3A 3EYVB 4P9MH 4X6CF 4ACTA 2JKIS 3WEAA 2KI6A 2XQYA 3OHXC 1D2OA 4M61B 3WFBH 1QATA 1BFOA 2X4NA 3VFUA 1RK0B 5LGJA 1RZ7H 1C8QA 4N2BA 3RYMA 5EPMA 5FKAB 3MRNB 1MUJA 1QUNB 2XPGA 3DX6A 3VXRE 3WFBL 4L4JA 4Y5VB 1IBDA 4R96A 4KI5D 3GPEA 4JJ5B 1RZ7L 3I02A 5TD4A 2IMNA 4NO0A 1NC4D 4UMGA 3SO5A 1UYWL 1OGAD 4LEOB 4X5QA 3VB8A 4G8IA 5AWNH 4JFUA 1N3NB 2FBOJ 3P40A 3IDNA 2YGPA 3JXAA 3PP3H 5D2LE 1N7MH 3VD5A 3QJHB 2K8MA 1V10A 3KPRE 4HP5A 4D8PB 4ZD3H 1NFDB 3VXSD 1THAA 1B6UA 2Q6WA 3S3JA 3TCTA 2K6YA 4IHOB 1YUHA 3PWLB 3RLSA 5AWNL 5L9DL 1J1OH 4BV1A 4JPIA 3ETSA 3MA7A 1N7ML 1FGNH 2R7EB 3T65A 3V8CA 1HHHB 3IPFA 2A9BA 4HBCH 5DVKA 3VRJB 1E67A 1Z9LA 1D5XB 3Q8EA 1FIGH 4WW1B 3DHPA 3N1PC 4Y4HD 4DWHA 2R23A 1FGNL 1F4HA 3Q8FA 4PJXF 4ZAKA 4KTDH 4MDJA 5GS3A 3PHQA 2GSGA 3MHZA 4HWBA 3LQZA 3TA3B 4HBCL 5ANMB 5EF2A 4OLWH 1RAMA 4U3CA 4JDEB 2ZPKL 4AM0B 1FIGL 2VC2B 4YJZL 5HHPA 1XCQB 4KTDL 1AMXA 2BY0A 3L9RA 4KXBA 4XVUC 4G9FD 4UQBA 4WDIA 1MRDH 4GQPH 4OLWL 1OAJA 3N5AA 2CO7B 4YFDB 3LDBC 4DFIA 1S7SB 1AO7D 3QO0B 3QDGA 1GZHC 2EDMA 3SQBA 3MUGB 1OT4A 3PWPA 5AVRB 1JTTA 4WWKB 5C8JA 5FB8B 3Q6FA 1MRDL 3O6FD 5IHHA 1QWHA 4S2SB 1DDHA 5I19H 3LXBA 4KI5F 1OAKH 3WI9A 1EX0A 4LHUA 4NN7B 3LPWA 4C4KO 1MCHA 5ESVA 4G42B 3L1EA 3F7RA 5IGXH 1TTRA 4L1TA 1FVDA 5DZVA 1CK0H 1I8LC 2VLKD 1JDDA 3EF7A 3F62A 4N0YH 5GSRB 5I19L 4Z0BL 4GSQA 1S9XB 3ZLQC 1OAKL 2MQ0A 2XXMB 4QNPE 5TDNA 3FYEB 5HGDA 3OKOB 3ZE2F 1MFMA 4RMRA 3WEMA 1HT6A 2ICWA 1HCYA 1GC1H 5IMKA 1XGTA 3TPKA 1EV2E 4N0YL 3OQRA 1RJYB 1S7XB 4BQ9A 4Z3HA 1TQCB 1C16B 1F90H 2MNWA 3FDWA 4N8VG 3M7FB 2BSBA 1UFUA 3LQMA 1O75A 3SYCA 5IVXE 3V0DA 1GC1L 4PJCF 1FYTB 4HW6A 1OP4A 2XWDA 3KWTA 4RAVB 4KI1A 1E9QB 2A6IA 4TL5A 4YVNA 3NPSC 4MMZC 3SDAD 3WO3B 2YSSB 1NBZA 1FHGA 4CKVX 5B39G 1TQUA 4MQ7B 5MERB 3OKNB 4HIEB 1AGDA 3T4AA 4EUPG 5KWYC 2ICWJ 5DRXB 2YD2A 3HE6A 3OXSA 3TEYA 3M7OA 4XNDA 3DRQB 3H8NA 1MCRA 1SDDB 4P07A 3KPSA 1H6UA 3HB3C 4NT6A 3ASOB 1JPFA 3L3DB 5HDOA 1E2ZA 1L9RA 2LQRA 1F4WH 1DQVA 3D18B 4LK4A 4RNRB 2JNZA 3VFGH 2V9UA 2VO8A 1L6ZA 4LLYA 1DUZA 2VXQA 2ZXCA 1I85A 2E75C 3LV3B 4PRDA 4YL9A 4ELMA 3GD1C 1F4WL 4JPWH 3QZWA 4LLMB 1E43A 1I7TA 1M05B 1NMBH 2VE6A 3GSOA 3HFFA 2ZOWA 3T5WA 4ELKB 2EEXA 2PO6A 2KL6A 2JWYA 1P1VA 2BS9A 3BHBA 3QJFB 1T4KA 2FB4H 4JPWL 3F6IA 3GSRB 2E86A 1KCWA 5AVZB 1IAOB 1NMBL 4G6MH 4KKPA 5FGBA 3DMMC 2W92A 4ODWB 1EAJA 5HHVH 4ZUWA 3IEAA 4AIXA 1G9MH 1JWMB 3CFTA 1AR1B 3ZIYA 1KB5B 2J71A 2FB4L 3QEHB 1B0IA 3QO1A 3TBWA 4DGUA 1JZ4A 2PW1B 3PE9A 1IEAA 4O2EA 2N56A 1F18A 2G2RB 4G6ML 3RTQA 4ATTA 3L81A 3MLUH 2CJTA 4U1GB 3IM1A 5HHVL 3TO4B 3BUIA 1G9ML 1JUFB 4UINH 5C0CA 1E7VA 2CUMA 2FSDA 3T2NH 4FJ6A 3RWGB 1LP9B 2Z4QA 3B56A 2VCOA 2WZAA 3APFA 2DPKA 2BINA 2HRHA 3ARBA 3MLUL 1FNHA 1RP9A 1D9KB 1IZKA 3CDCA 1G4MA 5C9KA 4DUVA 3E3QE 4UINL 3V6ZB 4PJEE 4GYBA 2AP2A 3T2NL 5D1QD 1ZA3B 3KR3H 1QI3A 4BWUA 1G6RA 2IPKB 4JNXA 2P8LA 1P4BH 1CQKA 3ABZA 1LXMA 4UOJA 2X4TB 2H9GB 3DXAE 4IW4C 4F8QA 3PHAA 1ACYH 1T5XB 3ARGD 1DQJA 5DD1H 3WS6A 2Y7SA 3KR3L 3VE0A 2W91A 1AZCA 3HR5B 5D2NB 4BFJA 2SODB 1CFNB 4FERA 1DSYA 1P4BL 1R3HA 3VI4E 4UDTB 4BEIA 2OR8A 1L5GA 3V5DA 4C56E 1ACYL 3A21A 3WKQA 2NSQA 5DD1L 5KVEH 2WTRB 1C12B 1SMAA 5AAMA 3RP1A 4NQCA 2NXYB 1IBHA 3D39D 5CWSA 3MRMB 2C5DC 4R7DA 1JCKA 1RI8A 4KQ3H 1NGPH 4LPYA 5KVEL 1U95B 4KFZC 2X6BA 4HEMA 2VJ8A 2ZUQB 5IQ9B 3C8KB 2O4EA 4EIBA 2IALB 4YBLC 2ICEB 2C9PA 3EJYD 3DTXA 4G80B 4KQ3L 1NGPL 4PWHA 4DTGH 1S3RA 4RAUA 2PWEA 2EDNA 5EEZA 3FN0H 4QRQA 4PGEB 3HZMA 1RURH 4LVHC 4IGBD 4XNMB 4F57H 4JRXD 3OGOE 3K2UH 5I6PA 5B21A 4XE5B 3ZZSA 4P2RB 1OT1A 4NC1C 5A2IH 3MV7A 2VRQA 1FPTH 1OXYA 2MNJB 3FN0L 2BVPB 3KWWB 3Q8AA 1KGWA 1RURL 3OB0K 4JFSA 4OM1H 4OQ1A 1BJ1H 5DSCA 3UTTD 2EACA 5SX4H 3IF1A 4F57L 1XDTT 2E7HA 4OCWH 4OF8A 4QMEA 5IVZA 5H2BB 4F7PA 3P2TA 2D7QA 2FK9A 1FPTL 2Q5BA 5TF0A 5J11C 3TVMA 1ZTXH 4QHKI 1BOYA 4OCWL 4YHKH 4JFOB 4G9DB 3VXMD 2A6JA 3BKCH 1EDQA 3SEPA 1L7TH 4RLDA 4HIHB 4JFDA 4ZUTA 1YPZE 3UO8B 4CVWA 1SXCA 1KXTA 5ICUA 1IAIH 1ZTXL 2ZOLA 4UB0H 3RX7A 4YHKL 1KTJA 3ABGA 4ADIA 3BKCL 1BQSA 1BXAA 1MH5A 1L7TL 2ZWSA 3UTZB 4IBVA 4AEFA 4OUUA 1NAKH 2YR3A 3DO7A 5D7IA 5E6IA 2AJZA 1GCFA 1JZJA 3FU9A 4P3WA 5FAAA 1OHZA 1XGZA 1FJ1A 2MKLC 4PJ7A 4W6WB 2CBTA 1NAKL 3TFKC 4FHKA 2OJEA 3K1KC 3MRJA 4LO9A 1IGFH 2ERJC 3ATDA 2E46A 3L2NA 2AXFA 3FMGH 3NFPA 1T0PB 1UJ3B 1RK7A 3EGSA 4A7GA 5J6GA 2XLLA 3B1UA 4YC2B 4M8VA 4AVJA 1QRNB 1TFPA 3SYAA 4J1UB 4APXB 1T21A 3DUUA 3BUQA 4H2CA 2CHNA 1FWXA 3UG4A 3FMGL 3VXOA 4EN2A 3GB7A 1OALA 1XCTA 2XBDA 4P4KA 1ZJAA 3S36H 4HHAA 3UTQB 5CJ5A 3A3YB 1JVKA 2YIHA 1F00I 1A8ZA 3RB5A 2QPDB 4DHLA 2EUXA 3RIFF 1D7BA 1DVUA 3EJPA 4N87A 2ITCB 5CEYA 4XE0A 1BM7A 4TKWA 1NZRA 4FL4B 4L3EB 2AANA 2P5EB 3MI6A 5E4IA 3S36L 1J5OH 1XB3A 3BN3B 1NCUA 2IEPA 1BYNA 2DL2A 3ARFD 5FV2A 1PLGH 5GIRB 5JPMC 2J73A 4KJWD 4XPTH 5KJ4A 1LO5A 5CSBA 1NCAH 3CXHJ 3DURA 2J12B 1L0QA 4FNUA 2YD8A 4OZHB 3TBVB 2XWJB 1J5OL 4O00A 2OSWA 3MLTB 4GB9A 3BRDA 4XPTL 3TYFA 1I7ZA 1QOKA 4JW3A 2AKRA 3VDBA 1QMUA 3BGFC 4D7PA 3LSOA 3TJHD 4GIPD 2RMNA 1WPCA 3MUZ1 3L08A 1U2HA 2G9HB 4HOWA 2JJTA 4JANB 1ZDSA 4QLWA 4QRPE 2IWEA 5FM5O 1SLXA 4RFNC 4Z23A 4NUMA 4LCCC 1U42A 4YAQB 4MNGA 3JWNC 4YPGA 2FWUA 3FCSA 2NY0C 1B0GA 2WOBA 2FH8A 1M3IA 3HG4A 3QEQD 1AJ7H 4KH2A 5ESQA 2PPDA 2DH2A 5HJ3B 3D8MA 2CXKA 5SV3A 3I3EA 4NQDD 3WIHH 4M93C 4OI9A 2DWDA 8FABB 3MXWH 3O9WD 4UBDC 2PWFA 5JW5A 2GABA 3REWA 5E1QA 1AJ7L 4W9CC 2XZQH 3BAIA 3GMOA 3ZRCC 5F3HA 1KLUA 3WIHL 1TZGH 5I6XB 2FWLB 4LHJB 3U1PA 3NIGB 2EDOA 2W0KA 4A7SA 4G11A 4XO3A 1YN6B 2NY7H 1ZLVK 2CBQA 4BGDA 2XZQL 4WLCA 1II4E 3IPBA 4YSTA 1TZGL 4L8CA 1Q1JH 4ZTOH 3SKOB 4IBTA 3S8WA 1CFSB 5E1IA 5E2VH 2C9RA 4O2CA 4MJ5B 4XXWC 3VWJD 4H40A 1D5ZB 2GK0A 2HTLC 4X9YA 2NY7L 1PDKB 1P5VA 4IS6A 1ZLWK 3B2XA 3QPXL 1YN7A 4P05A 1UWFA 2X28A 1Q1JL 4ZTOL 5DJXB 3GUTB 3F5WA 5AYUH 1FAKT 5E2VL 3K3QA 2G3ZA 2QMKA 1RKRA 3K46A 3C60A 4UQ2B 5ACZB 3BISA 5JQ6H 1KCBA 3IJYB 3S5LB 1WLHA 3UBXB 4WHTA 4O02B 1U8JB 4NZTH 2OSLB 3GXNA 5AYUL 3WNPA 4DQAA 3U6RB 1BWMA 4OD1H 2ZX5A 4WI9A 2NW2B 1TNMA 1QHOA 3D30A 3CTTA 4Z7QF 4QHMA 4PY8J 2Z65C 5AZEH 3SKJL 1Z5YD 5I8CA 5E8OB 3V6FA 2XX0A 2VR4A 4NZTL 1KY6A 4TF4A 4OD1L 1P5UA 4TNGA 1FCGA 4HEPG 43C9A 4GW4A 1NBVH 3EUUA 4KC3B 1SJEB 1H6EA 3G5YB 1MAMH 4PTTA 1FL5A 2XPYA 4YDJA 4P0DA 2CGRH 2IWFA 4O51B 1FO0H 4X6BB 2DY2A 1T04A 1T5WB 4RDQG 4TTDD 1LE5A 5B1BB 2A73B 4PRAB 3FO9A 4X2UA 5DLMH 4N2NA 4YN3A 3R18A 4FMKA 4PRIE 3O4LB 5DS8A 4PREA 3MBED 2D4FA 2CGRL 4LPTA 4EZLA 1FO0L 4PRPB 2HUEA 5DR5H 1JWUA 3QUYB 4IBLT 4UQEA 4XC3L 2AC0A 1OK8A 2CIKB 2EDHA 8CGTA 1OAQH 1TCRB 4P5TD 4LZKA 4XN2A 3TZVD 4IOFD 3VWKD 1XH2A 4XMKH 5LGHH 3QI9D 5E5MB 3BAKA 5DR5L 1IC5H 3C6LB 4QOKE 4RWHA 2KZBA 2BVTA 3QAZC 1T03H 2WO3B 5C0ND 3RIFK 1NCDH 2EDKA 5I9QB 3S0PA 1CBVH 1OAQL 5DA4A 3RZCB 1RLWA 4WWKC 1OAXH 4EIUA 3PPEA 4XMKL 1J5DA 3WFZA 3VU2A 1UD8A 4XHQA 3EJQA 4J6RH 3X13B 4POYA 1HZKA 1IC5L 3AS3A 5C0GA 2ZWKA 4RMSA 3D0LA 4E41B 1T03L 1NCDL 1CBVL 5I0VA 1TENA 4TQHA 3CN1A 3Q06A 3HOGA 4XN1A 4WQOA 1Q72L 2VR8A 4TPRH 5D1XE 3SKUD 3TO2A 4J6RL 1GYUA 2E59A 4Y1AE 5H35B 3HG1E 4PS4H 1ES0B 2J5WA 3O2DA 4YE4H 1EZLA 3ZGIA 4H26B 2J8OA 1EFXA 5ISZB 4NN6B 4TPRL 1JWSA 5CO1A 4H8VA 4WUUD 5DI8A 3IDYC 3FU8A 3OAUH 3QJVB 3BGAA 1PQZA 4PS4L 4KKZA 1XF5B 2CO4A 4YE4L 3UC2A 4PJHB 2FX9H 2H6UA 1JXKA 3FT9A 3P0VH 3MLWH 2HJLB 3HCVB 1B0WA 3ZDYF 3PDOB 4ALAC 3OAUL 5IW1B 3RWHA 2VLRA 3BQUA 5L2KA 3AT0A 4HKBA 4AIZA 2FX9L 4PBVC 3P0VL 3GS4A 3MLWL 4V2CB 4GI9A 5HY9A 5DRNB 2R8SH 3BUBA 4GP4B 1KJVA 3ZE1F 5BQ7A 5IROC 2LAGB 2XHNA 3VSUA 1CVRA 3O4OB 4JKWA 3JWOC 4P2QA 4K9JA 4EKJA 1FNEA 3ZVVA 5CJOH 4JVWA 4AYDC 4HQQH 3IJ9A 2RIKA 3M45A 3R06B 1LGVA 1URLA 5KYUB 2R8SL 4LGPB 3WHXA 4Z7WB 3ZTCC 1SLUA 3AMLA 3NAAH 3SPHA 5JHDA 1JZ7A 1K5WA 1PPIA 1CQYA 1V5JA 1YMMD 3FHQA 5CJOL 4HQQL 2XG4A 3DJSA 1PLAA 5EB9A 3NAAL 4LB8A 2F9BT 2VMFA 1BYOA 3CUPB 2FDBP 3ISRA 4GS7C 5CNHA 5K39B 3HN3A 1XGQB 3BT2H 1QBBA 2MTAA 2GIYA 3NIFB 4GKZA 3PL6A 1PZCA 3HUJA 3ZJAA 4U3HA 5CP7A 1SDYA 4ACPA 2Y06H 2BSRB 2Z93B 1OP3K 4H8HA 4CUCA 4G6AD 2FX8L 4BK8A 2ATPB 2GJZB 3LHAA 1AR1C 1NAMB 4JL1A 3BT2L 3MR9A 4HV8B 3V10A 3ULVD 3MFGB 1WCBA 1NC2B 2VDOB 4XH2B 4KNUA 4AV0A 2Y06L 2JJSA 4U1GC 4WV1A 3IE9A 1VFBB 1UG9A 2ZKHH 3LJ3A 4KJQD 3TO4C 4E9VA 2B16A 3EJZD 3NJVA 2DRUA 2F8XC 1N67A 1A02N 4AEHH 3K6IA 1DJYA 2W5PA 4HHWA 4GRLA 5JZ7C 1ORSA 3JUZA 3VSQA 5GS2D 1J9RA 4MKMA 1D9KC 3DTDA 5F0MB 2ZXAA 2VERA 3CVBA 2ZKHL 3TCLB 4I3RH 2HTKD 4LSPH 5DQJB 4XVTL 3GJEA 3SY6A 4Z7NF 3FFDA 4U1IB 5D6DA 5C0BA 1DJHA 4AV4A 1BZDA 4AEHL 4FQXD 2OQJA 3L4XA 1S3KL 2CD0A 4BQBA 1O7DE 1A4KA 1MW1A 2HRLA 5E4AA 3LRKA 5CN2A 5GGQH 4I3RL 4ZFOL 1GTFA 4JCLA 4N0UB 2OMZA 2DW5A 1T0OA 5IHLB 4GW1B 4F2FA 1NQBA 4IIQC 2EXYC 5D2NC 3IK2A 3NSXA 2WIIA 4G1MA 1WFIA 2QKIA 5IQNA 2PXYB 4UAOB 5GGQL 2AJVH 4P2OA 2HFGH 1I8IA 2JCCB 2AXWA 3WUWB 4CSZA 4F2MA 3BVWA 3OMIB 3QUXD 3CVIH 5IWLC 2AEWA 4UQ9A 2GUOA 2NXYC 5CBEA 3WOVA 2H3NA 3FH7A 3MCLL 2H47C 3MU3A 5DHDA 1QVOB 2AJVL 1ZAGA 3MQIA 3EYFB 3BSGA 4UNVA 2FUQA 5EWIH 4I87A 3CVIL 4HS8H 2AABH 2ZUQC 4GI6A 4WI7A 1CLYL 2ICEC 4K2UH 3VXUD 1L0XA 4OGAC 4QLRA 5KVGH 5EWIL 3ULVF 5JLZA 1D5BB 3TBYB 4HS8L 1K4DB 2AABL 1GGBL 4AH2B 3CFKB 1K3ZA 4K2UL 3A22A 5KSUA 3VX1A 2Y1AA 1JVLA 4PLNC 4KTGA 3T0EE 5KVGL 4NZJA 2ZXBA 2DYPB 3K72B 3CK0H 4FRWA 5CZVH 5I16A 4Z3IA 3G08B 4W4NA 2GTZA 3CLEL 4H13C 1KN2H 3GMNB 1R24A 3EAKA 2JI3A 4QCIA 2Q7YA 3S2CA 2ZX8A 1OV8A 4ZG1A 4J5VA 3QIBC 1MW3A 2JKTM 3BSZL 3CK0L 1R17A 2F74A 5CZVL 1MREH 2XTJE 5ABDE 5IJKA 1KN2L 5DJAA 4NAQA 2BM3A 2HFEB 4PJIE 4WI6A 1KXQE 2EJ1A 5DT1H 4WSKA 1KJ2H 3M1BA 2R1YB 2JKRM 1MHCB 1MREL 3NEEA 4PJBE 3BYYA 3H9SE 2ADIA 4MVBC 5CKGA 2ZNWA 3FTUA 3RRQA 5KJ7E 3ASNB 2OW6A 4O9HL 1A4BA 3ZT7A 5HJBA 5DT1L 4MXWH 3U6XS 2V2WA 1KJ2L 1KMGA 1A7PH 4AK1A 2VDRH 4RGNE 4AW7A 3AS0A 5E03A 2DQDL 2N4IA 3TEXA 3DBXA 4N90D 5JW4N 1XSKA 3HBPA 1DJZA 1MCBA 4FTVE 4PRHD 1QFWI 3KDMB 2AZAA 1ZLSH 2H32A 3KS0H 3QIUB 1AGEB 1FHNA 4MXWL 2VDRL 5FIEA 5BO1H 5EU6B 4GXVH 3I6LD 4UV7H 2BP8A 2ENQA 3NACH 3NZ8B 1UJ3C 3UJJH 1ROCA 2XOTA 3OAZK 4ZXBA 1NGWB 3LX9A 4WTZG 4YC2C 4F91B 1ZLSL 3U9UA 2XKNB 1MN4A 2OLDA 1EXHA 4GIOA 3O3DA 4GXVL 1N0LA 2FEDD 4UV7L 5DLLA 3NACL 3PQYE 3EHBB 2VL5A 3UJJL 4BFGA 1T7VA 5D2LA 1U3HB 2ISDA 4A2FA 2JIXD 3KPRA 5J7CC 2O72A 2WLZA 4AQAA 2IH3B 4B6ZA 3MO1B 1QI5A 2NUTA 4XCEB 1JK9A 4PWFA 2XN0A 2Q86B 5D1ZI 1N59A 1J8HB 4HJJH 4NKDA 4FL4C 5JHLH 3HC0B 1XGPB 4BCYA 1QQDB 2VDPH 3MV8E 4RWYH 5D5ME 2VLMD 4LEXL 3OLIA 4HS3B 4EIGB 5JA9A 1CFBA 4WSJA 1AXTH 4YFLI 3L1OH 1H15A 4DJMA 4NPYB 2N1TE 3GSNH 4ORGB 4HJJL 5BVPH 2FTAA 4KVPA 5F7LB 2BSSA 5JHLL 4PJFB 1T0NA 2VDPL 1KIQB 2DIJA 3HZVA 5DTFB 5FW6A 3G7TA 1MHEA 2NNAA 2NY6B 5FCSH 1CDCA 1HI6A 4DEPB 3EW3B 3RWEB 1LDPH 3GSNL 4QRSA 1J9QA 2ROYA 3UAJC 1TDQA 5BVPL 1IC7H 3HC2A 1FNGA 2JKLA 3S3CB 3IMVA 1CS6A 4DF9A 4NI3A 5INCA 5DMJB 2FQGA 1BIIA 4WO4D 3UTSA 4MCNA 1LDPL 4PG9A 3VFMA 1IC7L 2VLJB 5HVHB 4J4PA 2CNYA 1NGYA 1E40A 2OJ1A 3I3DA 4GRWH 5ALCH 2HZHA 1HKFA 3H6AA 4RIRA 3TTSA 4WKZA 3DHJA 2X4UA 2YRBA 1F97A 1G5GA 2VSDA 3DVNB 4OAWB 3ZDZB 5ENWA 5ALCL 5C08A 2VLLA 3EO0A 2MMXA 4HIJB 2X9ZA 1WUZA 5T3ZD 5I6XC 3BEWB 5FWRA 1LEKA 3LRGA 4X6FA 3RGVA 3QG7H 3WL9B 4YHMH 5F9OH 3EF4A 4RQQB 3GMRB 3NDYE 2Q76A 3L5HA 1P6AB 5JYLA 3MJWA 2PPCA 2P5WD 4RFEA 3BDBA 1OAYH 3QG7L 2OMYA 2H0PA 2R2BA 4Q4EA 4YHML 3V0WH 4YSQA 3WKPA 4XMVA 4NNYA 4B9GA 2Y7QB 4XNZB 4WY7H 3X14A 4AQ1A 1G7HB 2G0KA 2BOCB 3B9KB 3M17A 2XPZA 4MMXB 4PY7A 5IMMA 5ID0A 3I50L 1X5XA 3HE7B 3VGDA 1AZVA 2WXIA 4H0LC 4TLKA 4QF1B 1OAYL 3CFIC 5IKCA 3PNWA 4O2FB 5A16B 3V0WL 3HRZB 4B9JA 5IY5B 2YA0A 5D96B 3TPUA 4HUWA 4W9HC 1Z1WA 3VG9B 1XCXA 1A7NH 2E7DA 3LQAC 1UQSA 2OFQA 3GMLA 3OG4B 3ABLB 1YSOA 3EH3B 1PEWA 3MAWA 5I8OH 1UGKA 1GTNA 5BRPA 2RBLA 1TG8A 1JXDA 1U30A 1A7NL 2X4NB 3BUYA 2HT3C 5IV2A 4JFFE 5LGJB 1U6AH 5JORA 3VCLA 1I1RA 2HVBA 1HDMB 2QVKA 4LCWD 1D5IH 3IE4A 4ICWA 1L9OA 1CC3A 5I8OL 4EZKA 2FJUB 1IV8A 4DO4A 5AVUB 4IMLA 3ZO9A 2CK0H 3HBGA 4QT5B 3U36A 2NXZD 5A2AA 4JVPA 1U6AL 1E5BA 1M6OB 1U8QB 1X7TA 4NO0B 4XN9A 5JXED 1D5IL 2EDYA 2YRLA 1DUYA 2A6KA 4DKDC 3CDZB 2EP6A 2VQTA 2CK0L 1UXMA 4KU1A 3A67L 4B95C 3D5OF 3GT6A 2PPFA 4G7VL 5DVMA 3HAEH 3P11H 1MZZA 2VZTA 5GRWA 3QUZD 5J13B 4D0BA 3QIWC 3QFJE 4W6YB 4Z7VE 3FFCE 1AZZC 4XBGA 5KVFE 4ADJA 2IQ9H 4Q58C 4AQEA 2NR6C 1E5YA 3C6LC 3N2JA 3P11L 5EUOF 5BJTB 3ZDXF 5HHOB 4Z3FA 3GXDA 5I9QC 1T83C 4ZMYA 2L7UA 4MS6A 4ZNEE 2WKOF 1CDBA 3M8OH 4HIPA 4ZAKB 4EI0A 4ELDA 2D03H 4MDJB 3L7FA 4WFEE 5F3BB 2IQ9L 3E6FA 4UT6H 1CLOH 2UUDK 2C9XA 1O5PA 5KS9F 4PJEA 1J05A 3F65A 3IJHA 5I28A 3VH8G 3QQ9C 3M8OL 4UWQB 3HHSB 3SZKC 2D03L 2CLZB 1YUKB 4X7DC 3OX8A 4UT6L 1CLOL 4JQXC 4XVSH 4C54A 1O9WA 5EF3A 3U46B 2X6CA 4G7QB 5IMOA 2A99A 1JVOA 3OZKA 5HYQA 1E4XH 4NN6C 1GZQB 3UBHA 2R0WH 2KQNA 3EH1A 5IG7B 5I0WA 3HPLA 3B7YA 4XVSL 4C56A 2BXYA 1EO5A 3LS4H 3AVEA 3MRIA 5CJXA 3WTUA 3Q3GA 2ALWA 2CQVA 2R0WL 2ZZUT 3SYQA 4LAQH 1OE1A 2VXVH 5C0IA 3WTTA 1ZV2A 5SX5H 4Z76B 2A83B 5IR1A 3SBQA 2IADA 1MCLA 3LZFH 2Z1PA 5DVNA 4MASA 2HMIC 2XFXA 5BS0D 5I6KA 1JF1A 3V79C 1U91A 4AJ0A 2CAKA 3OMZA 4LAQL 1BCIA 3QH3A 2VXVL 5HPMB 4IEFA 1TYRA 3CFDA 5BCAA 5IMKB 3PIQA 2WP3T 3TT1H 3O4OC 5TK2A 3LZFL 1DVZA 1M7UA 1SFHA 1TPXB 5MEND 1BFVL 1HNYA 1DVQA 3G6JB 3BCDA 3RPIB 2Y7MA 3K74B 1G7PA 1XGRA 4K3GA 3JTTA 2YGQA 4HDIA 2A6IB 4XP1H 1Q9LB 3RWCA 1S9VA 1PLBA 4EQ3A 4MAUH 3LYRA 1NBZB 1J48A 4KFMA 1OW0A 1CICB 1OCCB 2J8UB 1IC4H 3RL2A 4X6CB 3GEFA 3STLB 2WC7A 3QDME 5SWSD 2DLFH 3TP4A 2AJXH 4XP5H 4I77H 5LCVH 1GYCA 2XV2A 2DQ6A 5FO9B 3V6OC 3Q6GH 4MAUL 3DX4A 1KXVA 4RSVA 5GS0D 4Z7UE 1IC4L 5JYMA 2WINA 5FXCH 3L5XL 4OZFH 2DLFL 2W0LA 3NP4A 2AJXL 4HUXB 4XP5L 4I77L 5B1JC 1LK2A 1YPZA 2WVVA 4K8RC 5LCVL 1GXEA 3RFRA 4OCRH 3Q6GL 4C8XA 3KW7A 1UA7A 35C8L 4ELMB 4PRDB 1WUNT 3ME0A 3V4VA 4HU8A 2PCXA 2GVYA 2V3DA 4JO5A 2AK4D 2NSMA 3K91A 4N5ED 3D2UA 2R0LH 1RZGB 1I7TB 5DUBB 2ROXA 4OCRL 5J12B 5KAQF 2VL4A 1A1OB 1N5AA 3QWNA 3RFZA 2HFFB 4HSCX 4XWOC 3TCXA 2BNRE 4HLZG 3QR1A 4ZNCD 2AK1H 4Q9QH 3TBSA 4FOMA 3BH8A 4YNYB 4CAGA 1HKLH 3KGTA 2JI2A 2XQYG 1BVKA 3T6VA 1XH3B 4P23D 3DC0A 2CO2A 5EH1A 1RZJC 3QO1B 1NICA 5E95B 3CQPA 1T1XA 2AK1L 2ZICA 3WAKA 4NAMA 1HKLL 3VTAA 3WKMH 1GY1A 3D08A 3HE6D 3NJNA 4YZFE 5C0CB 1SPDA 2XRAH 1S6NA 3KM2A 3WNJA 4UAOC 2WVSA 2F8OA 4PW3A 3OR7B 4TQEH 3K6SB 1B9ZA 4LVEA 3QDJB 4EI5B 1IM3B 3C5JB 3WKML 2Y7NA 3V0HA 3HHRB 1QKZH 3MNVB 5F6HI 3TNMB 2IANE 1E9OB 2XSKA 4J8RA 3AWEA 4B60A 1G6RB 4CN1A 3L4YA 4TQEL 3IN2A 2D3JA 4JLRB 1BVZA 1MCJA 1GZPA 5F7KC 1RUKL 1MEXH 1QKZL 4Z7OF 3MOBH 5LBSA 1O9VA 1ETA1 3BAYA 2D7NA 3BJLA 4L9LA 3PF2A 4YVUA 2WLIB 3MGTB 1SJMA 5HYIA 3BVVA 3MODH 4Y9EA 1JZ3A 2WSKA 5JHAA 3SJVD 4HS6A 1MEXL 1MFEH 2MWCA 2NX5E 5F0PB 1HHGA 4KNSA 3NCBB 5EBMB 1H9VA 1OGAB 3MOBL 5JIPA 1H3WM 1JYNA 1NCJA 2OMWA 1OCOB 2PCFB 5BRZD 2HN7B 4X8GA 5CWSB 5DJYB 2EADA 3MODL 4QRPA 3M6DA 1W16A 1E28B 1E5ZA 4M48H 4DN3H 2WAHA 2WBJD 4N8PA 4KBPA 3VXSB 3ZE2B 1MFEL 4HWEL 1T6VN 1QBLH 1MFBH 2YPVH 3TBBA 2NNFA 4XTRC 3P4NB 5J56B 3P30H 1HIMH 3QSKB 1VRSA 4IDJH 1TU2A 1TZHB 2FVNA 1M7IA 4M48L 4DN3L 4P5KA 3BPCA 3IDIA 2I32A 5DMGC 1QBLL 5DC0A 1MFBL 2YPVL 3ARBD 4YGAB 4AIOA 4DK3A 3UAAA 2GJ6E 1HIML 1SXSA 3T6QC 4E5XB 4IDJL 4YSRA 3RJDA 2C1PA 5FDWA 1FCCA 1P7HL 1CU4L 5DQ9B 1WAAE 4F7EA 1Q90A 4LHUG 3QULB 5HDRA 5C70A 3BZ4B 2ZAGA 5AVVB 4PB9H 5DSCB 1ZPUA 4G9FB 2O61A 5LDSA 4YFEA 3FQ4A 4F7PB 4M6AA 1MCFA 4LLVB 3ZMEA 5L88H 3IDJB 5BZXA 3X17A 1AO7B 1BXVA 2A74B 3TBTA 1I1AD 4PB9L 5E2TH 2EYTB 2VITB 2XG5A 3QIUC 4BFIA 1PNDA 3O6FB 3LKRB 1PY4A 2EEBA 4JO1H 4OY9A 5L88L 2FO1A 4JFDB 4HJ0D 4ZODA 4RGMB 4S0SD 4Y19D 1J0ZA 2FHFA 3NT0A 5E2TL 4QRTB 2ZOLB 1QW8A 2W94A 5ILTH 1T22B 2YD1A 4PJDF 4A2DA 2XN9D 1UZ8B 4JM4L 2OA9A 1UWXK 4I3GA 4ONOA 4JO1L 4Y16D 3RBSA 5D7IB 3EHBC 3B7TA 1U3HC 2AJZB 3QRGH 1KYOK 1MFAH 4ZSOE 5ILTL 2J56A 2XKSA 4QRBA 3SKMB 1IGMH 4PJ7B 3MRKA 2OJEB 3FTWA 4U3SA 4TXVB 4ZW3A 3HZYB 3FC8A 3LB6C 1OSPH 2QZ5A 3ABKB 3CV5A 1OE3A 3GXUB 2VABA 1NIEA 2WQVA 3NFPB 4V1DB 4WEMB 1CDUA 1ERNA 3BVXA 5LGKA 5CSGA 1N70A 1IGML 3LNGA 1KPUA 2EECA 2HKFL 4LLQA 1RUMH 2G0LA 2G3MA 1T21B 3GSUA 1LM8V 4JN2A 1VZHA 3ZZLA 4EEEA 3SDAB 1OSPL 3QZBA 4PJ9C 4Z1PA 4X8JB 1X9RA 1BD2B 5JHMA 2AITA 4XPAL 4PRIA 1XCTB 4E68A 1KIRA 2NY6C 3A4FA 5FLUA 3GM8A 1N0XH 1RUML 3LNEA 4EJ1C 4M3HA 5HD8C 3OF6A 5CEYB 4WW2A 2EH8L 1L9MA 5B3JF 3CPUA 2IV9A 1LO3L 1WEJL 3O41A 1N0XL 2R15A 3ZE0E 4QOKA 4JQVA 4P2YA 1DLFH 3JWNE 2OL3H 4BSVA 4KK5C 1FSKC 3VGGA 2ZKXA 4KGLA 1EJ8A 2NY2C 4ZX4A 3QXVA 1PSKH 1WFJA 1E27A 3RUGF 3PWNB 2QZQA 2VWEC 1U58B 4Y7MA 1ICTA 1FZOB 1WTGT 4QTFA 2OL3L 4WZ9A 3RVVD 1I1YA 3TYFB 1I7ZB 1P4LB 5JIHA 1PSKL 3FTVA 3QBTB 1JGVL 1R5VA 4M03A 1PYWA 2M8XA 3IAQA 4K8RH 5D1XA 2XBZA 1QW9A 2W07A 1KPRB 2BVQA 2G9KA 3L4TA 1RZKC 4PFEA 4QHNB 1Z7JA 5F1IA 5H37A 4NSKB 1JDAA 1OZUA 5E6UB 3COOA 4YPGB 1DE4A 1UB5A 3KH3A 4K8RL 4FA6A 3MNWA 2PCPB 5JIIA 4GG6E 4KUCD 3U4EB 3ILPA 3JTBA 3O2VH 5K9KB 3LRSA 2CA3A 4Y4KA 2VDOL 4XCYB 3G5ZB 3QUKA 4H88H 1B88A 1CD1A 1P84K 2DWDB 1RHFA 5D7JD 4F37F 4XNZC 3BLPX 3B9KC 4MMXC 2AS5M 2VW6A 3PJSA 3HE7C 3AC0A 5DHYA 5KSBF 2YK1H 3WLWC 1KELH 4NQXB 3CPLB 5CP3A 1VGEH 5D96C 4JO2H 5D1QB 4UCFA 4N8CL 2GFBA 3C5ZB 4MD0B 4WTXA 2NPLX 2DYSB 5F9DC 3MRCB 4LQFH 1ZLUH 4J2XA 1K9TA 2H3XC 2YK1L 5F8QC 3KL3A 1I4FA 4OU3A 2GSIB 1VGEL 4JO2L 1DVXA 4NX0A 2HJFB 4N2DA 3BEVA 3WKYA 2GK0B 1NFDE 4IS6B 4LQFL 3P4LA 4DIXA 1F11A 4JO8A 1KTBA 4NRXB 4XXDA 3AM8A 4TNWF 1ZVHA 3LKQB 1LE9A 1QO3B 3EKCA 1Q9KB 2YBRA 3KL5A 5CEXB 4XP9H 1BF2A 5C86A 4CNIA 2TRHA 4NQQA 1XD0A 4HJGA 4PRNB 3B4NA 1M2VB 4G2AA 4JDVA 3ZPDA 1QX1A 3FONB 4I4WA 4R8WH 3WN5B 2AHIA 1JV5A 1G9NC 4A7GF 4ISVB 1YEFL 4BRJA 4XP9L 5EEVA 2F54D 4JFED 5ANME 1ZSHA 1T89A 2F8IA 1OSYA 4V2BA 2WXNA 4R5XA 3V6FB 1A6ZA 2Q3AA 3QJXA 4H4NA 4JFZH 1BLIA 1EGJH 4JG5A 3CDGA 4R8WL 1RVFH 5DC2A 3ZRFC 4KUCF 2PLTA 2QMJA 1P5UB 4ZFGH 3CZKA 2EILB 4D9RE 4FP8H 4JRXB 1J9SA 1UWEH 3FPXA 2ZXWB 3OAYK 5DD6A 4JFZL 3CCHA 4J3XA 1EGJL 2AQQA 2I25N 3DWTA 4R2GD 3ECQA 3V4PA 1RVFL 1HQRA 5L4JA 1BOGB 1HL9A 3AGWA 4ZFGL 4RZCA 1TMQA 5T5NG 1P7QD 3FO9B 1I3RB 4FP8L 5DFTA 1RPQA 4WIQA 1X5AA 3QCTH 4PGZA 1ODAA 1GSMA 3RWFA 4P46A 2GITA 1JK8A 3FQNB 5HHNA 2X4OA 3BAEH 5I8EA 4JHVA 4NCC2 1RXLA 4ZFZB 1KZYA 4GG8B 3WGUB 3IU4H 3C60D 4BFRA 3DX7A 4CVXA 3QCTL 3VXMB 1CDJA 2ZYHA 1J87A 1ZVSA 4DP8X 5IF0A 5KOMC 2A9AA 3BAEL 1MY7A 3BPNB 1NANI 4OGZA 3QG6A 5HGHA 3FZUD 3VDAA 1SMDA 2EYSA 4YXKH 3V95A 1TVDA 3IU4L 3U30B 5K9JH 3OR6B 4ONHA 4OZ4A 2GC7C 4YBQD 1H5BB 4A1RA 4UILL 1SQMA 2FD6H 2DLGA 4YBHA 3ZYJA 3WNMA 5E5RB 1KLGA 3SKNA 1GKEA 4YXKL 1FYTE 4DFHA 4BE5A 1DQTA 2HVJA 4PWEA 5E56A 1UKQA 1CXEA 2FD6L 4PTUA 4X80H 5J1AB 1CXIA 4OCMC 5J9PA 4PJGB 1QNIA 4LSDA 1GGCH 3H6JA 1JZIA 4XVOA 4Q9RH 4G72B 1OTSC 1E4HA 4PJAF 3DVGA 1RFDH 4YDLC 4PU2A 3PP3K 1I1FB 4M7ZB 1XR8B 2YXMA 3SCMD 1Z32X 4X80L 3S48A 1QP1A 1QUPA 4JY4A 1GGCL 5EDXA 5CD5D 1TPXC 4Q9RL 5E70A 1JD9A 3E6HB 1K2DA 2F68X 1PQZB 1TT6A 3S98A 2ZSVB 1RFDL 1J9CT 5A2FA 1ORQB 2F7PA 2OCJA 3ES6B 4X83A 2VAAA 2C3WA 5AL8A 2AEOA 3T0EA 1W0WA 5CR1A 2C9UA 3MNDA 2ZF9A 3FO0H 3DV6B 1P0SE 3JZYA 5DJ6A 1C9SA 4F37K 3L3GA 1HQ4A 1JGLH 2DBLH 3ARFB 4LFHG 4NYLB 2HG5B 3FO0L 3ZDWA 1ZKAA 1R9FA 4LLAA 1HXMB 1KNOB 2P47B 1QFUH 4JM2A 1LO2H 3LXCA 1JGLL 4GOSA 2DBLL 4POZC 4KO9A 4NN5C 1KXQA 1I7RA 4TNFA 3DIFA 4A6YA 1KTKE 4NKMA 4DGYH 1XZWA 3C5XA 4I1NB 5BUAA 4IRSA 1EH9A 1UZGA 2ZOUA 1QFUL 4PJBA 5FOJA 5AAWC 4DZ8A 3H9SA 4G8GD 5J6HB 5AW7B 5IJVB 1S9WB 2AJYH 4W9IC 4AE1A 1EFXD 4X6DE 2WQAA 4CVZB 4EMZA 1DO5A 5BO0D 3E80A 1WV7T 5J12C 5TGBB 3FQRA 2PPAA 4DGYL 4AL8C 4KRPD 2FYVA 1LP9E 3ARDB 4QY8B 3KBHE 5EEXA 3FUEA 4XGZA 4FTVA 4TNWK 5AB1A 3IYLW 3GIZL 5I71B 2AJYL 4GKZB 2J7LA 3QEQB 3L3JA 3RQ3A 4AYFB 3TESA 2KQMA 4DZBA 1UT2A 4QGYA 5H94B 2AQ1A 3ZTJH 4U1MB 4NQDB 4IRZH 3QUMB 2VLRD 2QPFA 4QYAA 1RZKH 1MFUA 1U8HB 2VMDA 3MRGB 3I9PA 5LO7A 3RWDB 1E8YA 1K4CB 1WCBB 4P49A 3VJ6A 5I2IA 1F13A 1M7DA 1QFHA 1FH2A 4JO3H 4R7VA 2RCSH 3BP7A 4IKNA 3MJ8B 1ZT4B 3CSYB 3CXHK 3IGUA 3PQYA 5D2NE 1IL1A 1URZA 3MJGX 1RZKL 1QSZA 2FNBA 32C2A 3PFUA 4PSRA 3Q1SL 5EMYA 2R69A 1AHKA 4C59B 1M71A 1ORSB 1QBAA 4JO3L 1WZ1L 2ZONA 1D5MA 5AL0A 4EI5C 4TUOA 2RCSL 3WJJA 5EO9A 4AKPA 5FGSA 4GMTL 2GJJA 1DJSA 2APFA 1SOSA 3MYZA 1H3GA 2DMGA 3O2WH 3FQ1A 5C0BB 5HP5A 1SF3A 1JCVA 2D9QB 1UC6A 1HEHC 3VWJB 1KGXA 1A9EA 1ONQA 3HNTH 2YFNA 1A1MB 4XT1C 4YGVA 5D5MA 5E23A 4OGXH 5TQ2H 3IAGC 1DQKA 2JB6B 2C34A 3B9EA 1ZIAA 3D4GA 3LIZH 5D9SA 1CFTB 4AEIH 3VRLE 3HKFA 1TZIA 2H1PH 3FL7A 4DGWC 5FYKD 2ESVD 3F7KA 3O2WL 5LB1A 1ASOA 3LKPB 5TH2B 2OMZB 4QWWD 1WAPA 1BF5A 3HNTL 4FNLH 4OCNC 1GIGH 4KI5C 3IETA 5TQ2L 3E1F1 3LIZL 2P52A 4G1MB 1BIHA 5C0AD 4AEIL 2H1PL 2IXQA 1T1WB 3CE1A 5I73B 3K8LA 5DURB 2VYRE 4UF7C 5CBEB 1GIGL 5F72S 4JDZA 2H3NB 3WEXA 2GPZA 4LDCA 3AREA 4P2RE 3FO2B 3UFIA 4F9LC 2Z8RA 3FH8A 2BW5A 3NOIA 2WBKA 2XTSA 4JN1H 4LDOB 1N68A 2G2NA 3FUFA 3KJ6H 3SDCD 4JFQA 5GRVL 5HYSB 3D25A 5GGTH 5HI4D 4HGWA 4I2XE 4FXKC 2YUWA 1UXSB 3X1GA 2DJMA 4JN1L 1G9NH 2A9NH 3KPOB 1U8LB 4NKOB 3KJ6L 1HL5A 1OCZB 1C7SA 4Y4HC 4YSPA 5GGTL 1CD9B 1TETH 3PUUA 1SMOA 2UV3A 1G9NL 2A9NL 2DI8A 2OX5B 1KG0A 1Q9OA 2FQFA 1A4AA 1PJWA 4PW9A 1TETL 3KMDA 2FEJA 2W60A 4HUVA 2XN1A 3TZVB 2DDQH 3E8VA 3KBEA 3L9YA 4DPBX 3QI9B 3GK8H 3Q9PA 5AW0B 4P5MB 2A74C 1GGIH 2I5YL 3WSQH 1M42A 2AI0H 1AP2B 2F74B 3UCQA 5C0RH 5SWZD 4X7TB 5L8JB 2DDQL 5HBBA 1AVAA 1J8SA 3O6FC 4OSUH 4I9WE 3GK8L 3R0MA 3B7RL 5EBLA 2QVMA 1GGIL 3WSQL 2AI0L 2YAFA 1YMHA 3HUJF 2YHGA 4KDWA 1CLCA 1QRNE 2ARJQ 3QORB 4OSUL 4L0ZA 5JW3H 3ML9A 2V2WB 1A9VA 2E47A 1DEEA 4P2AA 3T3MF 3M86A 4H5SB 3DBXB 1IGTB 4DCQB 2VISB 1NGZB 3FHAA 4M62H 1R6VA 4JFFA 3SQOH 5C2BH 5JW3L 4WUUB 5HDBB 1OARH 5E0FA 2G5RA 4BZ2H 4L3EE 2P5EE 1JNLH 2BP8B 3HJ0A 3DHUA 4B7IA 4WWID 4KK9D 5CJQH 1MCKA 2WCSA 4K55A 1K85A 4ZS7H 3SPVA 2B0SH 2L4OA 1HXKA 4M62L 3UG5A 5CEZE 3SQOL 4XMXA 5C2BL 5GSVB 3L5WB 4JGNA 4FFYH 1OARL 4XB8A 4E9YA 1RL1A 1YLBB 4J23A 4YIQA 3SDAC 1TJXA 3O3DB 1U2CA 1JNLL 4OZHE 2BZ7A 5HYJD 5CJQL 4WO0A 4FI6A 3RJOA 5E94A 4ZS7L 3ATEA 3X1BA 1BAFH 1RHHB 3TOPA 3GMMB 1EBPA 4AQAB 1MJJB 1KT2A 1BX2A 1QHPA 3FN3A 4BA0A 4CC4A 3SKJH 3QCUH 2NUTB 3QFJA 3G3LA 3VXTA 2BOLA 2DJ4A 4Z7VA 3JSSA 4NAJA 5LXGH 3FFCA 3V4UH 3FJTA 3L16A 1CIDA 4F20A 2NY1B 1BAFL 1WZAA 3FCTA 1TJHH 3T8XA 4H8UA 3DUHA 3DGGB 3QUGA 4Y89A 5IW6A 5E08H 1LMIA 4QRRD 1P7KB 3DETD 2W9DH 1N18A 2IBZX 3LN9A 3QCUL 4JFYB 2P8PB 4U1NB 1H15B 5IT2H 5LXGL 1UOKA 3V4UL 2FIKB 1NGXA 3UZQA 3QJQB 3D7PA 1TJHL 4LOEA 1JG9A 1UH4A 5E08L 4JX0A 5A1AA 5FYJL 2W9DL 2NW3B 5IT2L 1YY8B 3QS2A 4QRSB 5F0LB 4MMYA 5HGBB 4KY1H 2Q0ZX 4X6EB 3CHSA 3F6JA 4NRYA 1EVUA 4XZ4A 4EN3D 1WBYB 3VXRD 5KYXA 2YMOA 5AD0B 1DLHA 1I8LA 3NJJA 3VFTB 5T1KA 4ZXBD 4D9LH 5G2NA 2PP7A 3MUUA 4OKVB 1OM9A 2WOYA 4GKSA 3C5SB 3FKUS 3MGOA 1IQWL 3NIGE 3AABA 5I8KH 4JHBA 2XBTA 4N1CA 2W9EH 6CGTA 2CLVB 3WXVH 1Y18A 4JEGB 2F7IA 4KY1L 4W9LC 4EXKA 1YEGH 5KG9A 1F1DA 3ECVA 5E6SB 4D9LL 1AD0B 3KPRD 5GRJH 4P59H 2IH1B 5I8KL 4DVRL 1HILB 2KDGA 3T08A 3WXVL 4OW6A 1YEGL 5C0JA 2MRYA 4E9LA 3GMPA 5IIEB 4FKEA 4JG0H 3VXNA 5GRJL 4P59L 3CFUA 3WIFA 3GI9H 4MMZA 3GGWB 1W0VA 2XZZA 3GMQB 3U2JA 1LEKB 1KFGA 5D1QC 1X5KA 4CL7A 2WYTA 2BSEA 4XOCA 4FQXB 3WTVA 5HTSA 4OIBA 4YXLH 5DMIH 3DGDA 3X1FA 2PWGA 3GI9L 4Y5XB 4GMSL 1X7SA 2QPUA 1A0QH 3ARGC 2O6FA 2VN3A 3DDFA 4W9EC 4I5BB 4CW1B 2R2BB 4H25B 1HL8A 4YXLL 5DMIL 1T66D 4LASH 3FYIB 1O6SB 2FSEA 3S37X 1AXIB 1A0QL 4FQPA 1JNNH 4NDMB 4W9JC 3QUXB 2OZ4L 1WQVT 3M46A 1TXKA 2DI7A 4ZPVA 1TVHB 4Z3EA 1WTLA 3QDMA 2O26U 4WK2B 4PS3A 1QSFD 3HMXA 1U92A 4PCKA 4ZT1A 1JNNL 2KBGA 4JZNB 3WN5C 2CNZA 4GUPB 3RY5A 2IBZY 3BIBX 3WIHA 1LQBC 4Z7UA 3JVGC 1G6VK 3O4LE 2X3AA 4GBXD 2FBRA 1L3WA 3DMMA 3EJYC 2HJKA 3NPZB 4PRPE 3VXUB 3BUYB 1UZ6E 4BZ1H 1DJIA 3D85A 5C0FB 3FUJA 5CCGE 2DB8A 5IV2B 1NDGA 2WXKA 1AE6H 5F1NA 2EIMB 1CPUA 1RJCA 2UWEF 3QCVH 3B3IA 5DZPA 3OPUA 4IGBC 4OT1H 5DHVB 5FO8A 4BZ1L 5I17B 3AT9A 2X4RB 3RJQB 4U2ZA 2HXAA 4FMFA 1IGCH 4NS0A 4J39A 1AE6L 1LNUA 4JG1L 2APSA 1BZ7A 2E6JA 3SGKC 4MAYA 3QCVL 2R59A 4OT1L 2Q3ZA 3PHOA 4HKZA 3CSGA 2XWTB 4E41E 4N2IA 1IGCL 1ZMYA 3IDGA 1G7IA 4HPHA 1KEMH 3L4WA 4D0BB 4UQ3A 4L4TD 3TX4A 3H4FA 3FT4A 2QADD 1DFXA 1A14H 4LNRB 2Q7AA 1NDMA 1WRFA 2XWCA 3BPNC 5I6MA 2NY3D 1KEML 1I8MA 4CC1A 3DBSA 4LVOB 1KCSH 3ARYA 1CL7H 5ISZE 3U30C 1R19A 4WI0B 2EDXA 3LAFA 2I07B 1H5BC 3RGHA 5H8DA 2EABA 4I0CC 1KYDA 1KIUB 4P4RA 4PJHE 2OYKA 5E8NA 2V2TA 4R26H 2IANA 1KCSL 1CL7L 3F64A 2AJ3A 3VFOA 2PP9A 3B6SB 5KEZA 2Y22A 4HKXB 4G6FD 2JJWA 3KWXA 2LE9A 5MEPA 1ZLDA 2X89A 3UZEC 1PL3A 3OGCB 3H9HB 4R26L 4TUUA 1BVNT 2EEAA 4UTAH 3SDDA 3QDHA 4AGPA 4H20L 1DTUA 4M7ZC 2GW5A 5CZRA 5I76B 1MCQA 5F8RC 4QRUA 1QD0A 2BSTB 2OMBA 3S97C 5FFGA 2OTUA 3H2QA 5B1KA 1AIZA 4BYHA 4UTAL 4B9FA 4G43B 4AKQA 3L3OB 3Q3GB 3F01A 4XO8A 2PTUA 2YD5A 1MJ8H 4Z7WE 1BECA 1XH0A 5IOKA 4CMMA 5C0IB 3VD9A 1OPGH 3KWVA 5T1MA 5IR1B 3F8UB 5AW6B 3QEGH 4N2LA 5IVXF 4PLJD 1J0KA 2VZSA 1LO0L 1MJ8L 2QQKH 2CKBA 4Q6YA 1U91B 1VDGA 2IH9A 1U41A