2GB2A

The p52g mutant of amicyanin in the cu(ii) state.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMGHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Site-Directed Mutagenesis of Proline 52 To Glycine in Amicyanin Converts a True Electron Transfer Reaction into One that Is Conformationally Gated.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gb2A00
4HALA 4QKTA 3FS9A 1I53A 1PLAA 3DTUB 3GDCA 1AOZA 1QNIA 2NRDA 1PMYA 1OCOB 4A67A 4G70B 2R7EA 2XVBA 1SDDB 1RCYA 3S3BB 1BQRA 2FJSA 5E9NA 1NWOA 1SFDA 3U25A 1M9WA 2CJ3A 3FSZA 5B7FA 3H56A 3T71A 4DP1X 4F7KA 2PP8A 2J5WA 2GB2A 1NIDA 1BAWA 1E67A 4YSCA 3FU8A 2PCFA 1NIBA 1W6LA 2BWIA 2IWEA 1WS7A 2IH8A 1NICA 1QLEB 4NAJA 3NP3A 1A65A 2IDUA 1JERA 1B3IA 2DY2A 1GS8A 2DV6A 1NZRA 2FT7A 4A2DA 1V10A 1PF3A 3C75A 3KW8A 1WA0X 3FQ2A 3ASNB 1ZIAA 2UXTA 1JXGA 2P80A 2GSMB 2UXGA 5ANHA 1V55B 1F56A 3FSVA 3EH5B 1NIAA 2PPEA 1MZZA 1MZYA 1JZIA 2BW5A 5I5IA 2MRYA 3BQVA 3NJMA 2YAMA 4QLWA 1CURA 2B08A 4BDVB 2OV0A 1X9RA 2LLNA 3FT0A 4KOCA 6PCYA 1J9TA 6PAZA 1MG2C 2BZCA 1E5ZA 2E86A 5B1JC 7PCYA 4GXFA 1PZCA 3N55A 4F2FA 1L9SA 4GP8B 3WKPA 2WO3B 4DPCX 3QJVB 3X2QB 2I7OA 1ID2A 3T6VA 3D12B 4KO7A 3NJLA 4DPBX 1QHQA 3NJJA 1AZBA 2Y69B 2A3TA 1VLXA 2Q5BA 4F2EA 3GXUB 3ABGA 2W88A 4JHUA 3DIVA 2CCWA 3WG7B 3FQYA 2GI0A 4M4RB 4KO6A 7PAZA 3UABA 1AR1B 1ZDQA 2X88A 4DP9X 4G72B 3L45A 1PNDA 3FU7A 2XX1A 5B1AB 5I6LA 1KBVA 2AZUA 1DYZA 1NINA 2BW4A 2YAPA 1AZUA 2H3XC 5PCYA 3NSFA 2YAFA 3ABKB 4E9SA 2FQGA 3WIAA 1AG0A 3OMAB 3PCYA 3ZX1A 5I6PA 2EIKB 2CAKA 5D4HA 4YVUA 2BZ7A 1MG3C 4NB7A 3QQXA 4G7RB 2DYRB 1AZNA 1GS7A 2J55A 3N2JA 5PAZA 3NSCA 2FNWA 3IN2A 1N70A 2GHZA 2PP9A 4BXVA 4G7QB 4Q89A 4YSOA 2QPEB 3JTBA 4WKXA 5I6KA 4GP5B 3BVDB 3PPSA 3PAVA 1JZHA 2XWZA 5AFAA 1BEXA 4YL4A 1AAJA 1L9PA 1OV8A 3UADA 4JKNA 1OOWA 3H4HA 1SF5A 3CG8A 4HIPA 3AG4B 5TK2A 1GR7A 1AIZA 2HRHA 2BHFA 3FU9A 1AZCA 4A2FA 1R1CA 1TEGA 4UANA 5B7MA 1E65A 3T9WA 1V54B 1E5YA 3FYIB 2TSBA 4YVNA 3EF4A 3NJNA 1AS8A 2PPAA 3TU6A 3CDZA 2HXAA 2HX8A 4AZUA 2XUWA 4HAKA 2YAQA 1W6WA 4A66A 2IAAC 3IE9A 2QT6A 1N68A 5I6NA 1X9UA 2BO0A 4YSAA 3PLYA 3WNIA 3V9EA 1RZQA 3MBWB 4AKOA 3CVBA 1M56B 3EH3B 5AZUA 2PPFA 3KW7A 4DP2X 5TK4A 1ILUA 2Y1AA 4ZK8A 2XU9A 2HZHA 1BYOA 1OE2A 1WA2X 3S8GB 5I5MA 1IUZA 2BP8B 1IKOP 2FQDA 3OQRA 4FA7B 2XXGA 4FAAB 2HX7A 4KO9A 4L0PB 1KV7A 1GYCA 1KCBA 3FSAA 2UX6A 5B7EA 2XX0A 4YSDA 3AY2A 4E9VA 1UATA 3FQ1A 2OCCB 1M57B 2BWDA 4YSQA 3EHBB 4AX3A 5LDUA 4K9JA 1BXUA 2N0MA 2VN3A 2ZOOA 3OM3B 5I28A 2IWKA 1ETJA 1PLBA 3QJRB 3QJQB 3X1GA 2TSAA 4HHWA 2BP0B 2HLEB 1PY0A 3ASOB 2IDTA 2PPDA 4HCIA 4NERA 2IDSA 2YXVA 2VW7A 1L9QA 3TASA 1AG6A 2WO2B 2HRGA 5F7AA 1KDIA 5D4IA 5F7BA 1SNRA 1WA1X 5I6OA 2YAHA 2YAOA 1CYWA 1BQKA 3UAEA 1GW0A 4MFHA 4Q8BA 1ILSA 2PCYA 2RACA 3HB3B 1A3ZA 1L9OA 4AI7A 1ET5A 4AKPA 1XB3A 4DP5X 2GIMA 4E9QA 1BYPA 3CVCA 1ZPUA 1BXAA 4HCGA 4ENZA 1W8EA 2JXMA 3X1NA 1AANA 1GSKA 2AVFA 2DWTA 1J5CA 3T6WA 2GC4C 3FPYA 4A68A 4DP7X 1NIFA 2ZONA 2AANA 4TXVB 4W9ZA 2JKWA 3AG3B 3ABMB 3T6XA 3TA4D 2VSKB 1J5DA 1OCRB 4PCYA 3PXLA 1PAZA 4A2EA 5IY5B 4W1TA 1NPJA 1SDDA 4CSZA 3OMIB 1PZBA 1A4CA 1T5KA 1RZPA 1PNCA 3TBBA 3V9CA 4BK5C 4A2HA 2XXFA 2P80D 4EF3A 3NSDA 3UGEA 4E9TA 1JZJA 2GBAA 2PP7A 3CVDA 1KCWA 1SF3A 3G5WA 4E9WA 1JXFA 2VM3A 3UAAA 1JOIA 4A2GA 5FC9A 2FT8A 2I7SA 2ZWNA 4E9XA 4PAZA 1AZRA 2AZAA 1NTDA 4GP4B 2QDVA 1BQ5A 1A4AA 2BP8A 2UXFA 1JZGA 1FWXA 4BWWA 4P5RA 3AW5A 1KDJA 1ZDSA 3S8FB 3CZUB 2XV0A 2QDWA 4DP6X 4GYBA 1WAEA 3GYRA 4M3HA 4JHVA 3FPXA 2VW4A 3AZUA 2CBPA 2YXWA 1TEFA 4DP8X 1GS6X 5B1BB 3QJSB 3DKHA 3QJTB 1SFHA 1KBWA 1AS7A 1NIEA 1A4BA 1HFUA 4YSTA 3OMNB 2CALA 1J9SA 4N8UA 2JFCA 1JVLA 1TU2A 2B3IA 1NPNA 4YSUA 2BP0A 1ASQA 1JVOA 4BDVA 3SBPA 1NDTA 4RH4A 1AACA 4YSSA 2HX9A 3IN0A 3PAZA 4WTQA 4G7SB 1KYAA 1L9TA 2UXVA 1L9RA 3X1EA 3AG2B 1FA4A 3NT0A 4E9YA 2XYBA 1CYXA 1ASPA 1JZFA 2FTAA 2XV2A 4HCFA 4X4KA 2IWFA 2QPDB 2UX7A 1OCCB 1ET7A 2YQBA 1JXDA 3SBQA 2R7EB 2PPCA 1XB6A 1FFTB 2AFNA 3CDZB 1OE3A 2WSDA 1ET8A 2YARA 3ZBMA 1OE1A 2IDFA 1EHKB 2EINB 2PLTA 5I5JA 4YSPA 4KO5A 5B1JA 1PCSA 2FWLB 3NJGA 2ZXWB 4UF7C 3T6ZA 1IBYA 4DP4X 3NJFA 2VSMB 2X87A 4GY4A 4BXSV 9PCYA 3ERXA 2DYSB 1HAWA 1JZEA 1MDAA 1AQ8A 3WNJA 2EIMB 2IH9A 2OJ1A 2GC7C 4BWTA 1EZLA 4DPAX 1ZIBA 3X1FA 4P5SA 3RYMA 5I26A 4BWUA 3WI9A 3S3DB 1A8ZA 2CUAA 1SHXA 1YLBB 2VMJA 5I6MA 3OD3A 2XV3A 3EH4B 2XLLA 3TBCA 1CUOA 2MTAA 4N4YB 4AKQA 2DWSA 4DP0X 2J56A 1XB8A 3JT2A 2VM4A 3NJIA 3WKQA 3PAUA 3H4FA 4KOBA 4KNUA 1PZAA 3FSWA 4KNSA 2FT6A 1GY2A 2Q9OA 4HZ1A 1URIA 1ZV2A 3IEAA 3SBRA 1J9QA 4YSRA 1OF0A 3ZDWA 3NYKA 2J57A 1CC3A 1SHWA 2FQEA 1OCZB 1ADWA 3ABLB 5A7EA 4CSPA 3QPKA 1WS8A 1RKRA 5B1KA 1GY1A 2I85A 4E9RA 3SQRA 1SJMA 1TKWA 1BXVA 1J9RA 4KNTA 2H5UA 8PAZA 1XMEB 4HHGA 5AKRA 1AS6A 1ASOA 1HAUA 4YSEA 2H47C 3HEIB 2W8CA 1NWPA 3NP4A 5EHFA 3X1BA 3IBOA 3NJHA 5D4JA 3NSYA 3UACA 1PLCA 3FU7B 2IDQA 1KGYE 3NJKA 1E30A 2VW6A 3QJUB 3FYEB 3ZIYA 4G71B 2YAEA 1IBZA 2EILB 4UAHA 5B3SB 3AG1B 3S3CB 1IC0A 2FQFA 1DZ0A 3MX0B 2EIJB
chains in the Genus database with same CATH superfamily
1BF8A 1XIWA 4WFFE 1G9MH 3G5XA 4QRTB 1MFMA 3MRKB 1MVUB 2YWYA 4XTRC 5DRNB 3PFUA 4PJDE 5EU4A 4CU7A 4J3OC 3FH8A 4U6VL 3LKPA 5HYJD 1XH3B 5GGRY 4L4VA 1OT1A 1K85A 2WXLA 5TDOA 3EUUA 1IAIL 2ZUQB 1DR9A 2IOMA 1M9WA 2YPKA 3OXSB 1MFEL 2IBGA 3PWVA 4YIQA 1G7JA 2NYZA 1T7VA 5DI8B 4PS7A 5EUKB 3TONA 1QUPA 2EEXA 2GB2A 1BYNA 5T3XL 5GZOD 2VXQH 1YECL 4LEXL 2CMRH 1HNFA 2WCGA 4HJ0D 4R7NA 1NICA 3RWDB 5HDQH 1QLRA 1UJTA 3WS6C 3EJCA 2XWRA 4XVOA 4M48H 4YH6A 2H8PA 3V0FA 4X6FB 1JBJA 1H3PL 1JHKL 4FXKB 3QXAB 4OLXL 5AALA 3WD5L 5L4MA 2NX5E 3BKML 4LARL 3MYZA 4Y16B 2APFA 1ZSDA 2W0FB 1JXGA 3FRUA 4Q6YA 3TBYB 2P80A 4JANB 2PW2A 1JGLH 3D39A 3D69B 4N2NA 4OGZA 1U95B 4NM4H 1DBJL 4Y2DD 4ZMVA 4LP8A 4ZTEA 4Z6AT 3WO4C 1UACL 1IT9H 3QCVH 4XPFH 4OLVL 2YAMA 3BP4A 2WKOF 1CURA 5BS0A 4P9MH 5EORH 1JPFA 3QORA 3CXFA 2WVSA 3ARFC 1CXLA 4NQDB 3FTUA 1J9TA 1UXLA 3VXUE 5B1JC 2FB4L 3AUVA 3FUEA 3EGSA 5DZLA 4ZFZB 1OAUH 3GUTA 1OQXA 1PZCA 5AD0B 4GP8B 1AYRA 2GK2A 3U1QA 5ERWB 3D4YA 2DIAA 3FQTA 4YDKH 3S2CA 5DMIL 2FH6A 2W38A 3NSXA 4TNWF 3W38A 1KSRA 1AZBA 4LRIC 4ZG1A 2VR4A 2WLYA 2CD0A 2YN5A 3E0GA 4IOSD 2Q5BA 4JO4H 4F2EA 2A5UA 2E7BA 2W88A 2YSSB 5DHVH 3SZKC 3DIVA 1ETZA 3L3JB 4N90E 1HC1A 4XHJD 1XL4A 4UCFA 4MSWA 4KPHL 4Y5VB 4XCCL 2APVA 2VDKH 4RFOL 3L45A 1K3IA 1P84K 2AJZA 2X7LA 2VLKB 4UV7H 3LPWA 1VCAA 1QHOA 3NSFA 2YAFA 2W59A 3FQNB 4HOXA 1IBBA 1NBZA 3V0HA 2ZP9A 4MMYB 3HG5A 1PZ2A 1KLGB 4R4FL 1BIHA 3ZHFA 5I6PA 3MJ9H 1E3FA 3VMPA 3UJTH 1AZNA 2CIIA 4Y5XC 1VZHA 3V4VH 5IFAL 5DJ6B 3MRRA 5F7EL 5HDBB 5L4FA 4UNTA 4ZT1A 5ALCL 5C1MB 4PJGA 4G6JL 2L7JA 5DJ8A 2A99A 2R1YA 1AKPA 1LE5A 4CN6A 3F05A 5KAQF 1PJWA 4MJIB 1MFBL 1DTUA 2YA1A 2EYSA 4GG6F 2V33A 3CG8A 1K3ZA 4Z77B 1XVSA 2QJDA 3V0EA 5LN8A 2QGEA 3BPCB 5CD5C 1A7OL 5IROD 4A7TA 3MLTB 1QUNA 2BHFA 5FK9A 1QSZA 5ENWB 1IILE 3B3IA 3DYPA 3Q2LA 3V0VB 5AYUH 4NP9A 1G7MB 1U8QB 3RWCB 2AI0L 4MJ2A 2PPAA 4U1SA 5HGDB 1SY6H 3EJRA 3UJIL 2E7HA 3ABZA 2E5EA 4L5FL 1OALA 3CWGA 1I3VA 2ZX9A 4HAKA 2ZXQA 2QBWA 2CHWA 4UQ2B 1UZ8A 4DK3A 2PXYB 2NDFA 3WE1A 1YEHL 4HUMB 5DRWB 4UIKL 3I9AA 4FYRA 4U2YA 2W07A 3U4EB 5KYUB 3VH8B 1NLBL 1E9OB 1MLCB 3P2DA 5E2WL 3NQKA 5AB9A 4AW4A 3CLFH 1LO2L 4YPJA 3BVNB 1JG9A 4K15A 3GMOB 4AYFA 4MD5A 5AZEH 5KG9B 1CWVA 5D1QE 4MA3A 4R26H 4FA7B 2GBUA 4U1LB 4AJWA 4JQIH 2KC0A 4HS3A 1XAUA 2ZKMX 4N2DA 4MKMA 5F7UA 4LQFH 5EOTB 4BIKA 1RUAL 1FFPB 2KLSA 4DKEL 1JNJA 3MNWA 2MWCA 2VDOB 5J3HC 2IC2A 4LF3B 2QVMA 1EUTA 5AVUB 4K9JA 3RFZA 2Y3NA 2AEPL 1TCRA 4OLYH 1CE6B 1ED3A 3IE4A 3LQZA 5D6CB 3ZUCA 4RMQA 5EC2B 3RDTD 5IMLA 5E8EB 2BP0B 3ASOB 4XP9H 2IDTA 5E6ID 4FDWA 3VCLB 3RL1A 3QHZH 1FC1A 4XAKE 3HE6B 5BUGA 5JHMA 1F4YL 5A2LH 1DL7L 4NN7C 4EI5D 1RJLA 1UM5H 1A3RH 1DUYA 4PP1C 1Z32X 3SY0B 3T0VA 3DO7B 1CYWA 4ODUA 1N5YH 2R2EA 2W5PA 4XMUA 5IHLB 2JB5L 5I1KH 5ESVB 1SJEB 3ARTA 4HIIB 1QRND 4WHTB 2QFRA 3UBFA 3DVGA 1AKJB 3KHQA 12E8L 3SDYL 2D03L 1MWAB 1FF5A 1A0QH 2E27L 2EO1A 4HQQH 4AQEB 3FB5A 4YUEH 2DMKA 2A73A 1J88A 1T7XA 2YZ1A 1J87A 3HBQA 3X1NA 5G5DA 3QJFB 4Y4FD 4JFDE 4XXDB 4LNRB 3L7FB 1XD0A 4FQXA 5H37G 4IGBD 4FABL 2V5YA 2UY7A 5DRZB 3MO1B 4Q9RH 1KJVB 3RE0A 4KZDH 2IALB 3NIFB 2QHLA 3MX0A 2O5NA 4K0OA 2MQGA 4P05A 2AJ3A 4N5UA 2ZYSA 5BO1L 2P7TB 3T6XA 2PABA 2ZZUT 5I1EH 2DLTA 5DZPA 4PJ7B 4DH2A 1MCHA 5JQIB 4ZOBA 1PAZA 2OX5B 25C8H 3HNVL 4M5SA 4IHBA 3TYGL 4F7PA 3K5RA 5FWRA 3OMIB 4E5XA 1P9MC 1PZBA 3MV8A 4MXWH 2FJUB 4QHKJ 4H13C 4NQTA 2XZAH 2P44B 1IM9B 1ZWIB 4AEHL 3ZE1F 4ZO6A 1KZYA 1OSPL 2ADFH 1MREH 5J11B 1F90H 5K59E 4FP8H 4PJFA 3LXAA 1UGKA 2YS4A 4GW4B 1ZHNB 1AXIB 3HUJB 3UAAA 2AC0A 3E3QC 4GRLA 5E0QA 3NCYS 3FCBA 3QHTC 4NRZB 1RD6A 4TSBH 3TF4A 3HAEA 4JZNB 2AZAA 2DTSA 1I4FB 5FHAL 4ALAH 4WDIA 3M1OA 3KXFE 2VN6A 3FT1A 4NKQB 3S35L 3VWJB 1KBKA 2EE2A 4XXCC 2XOTA 4PB0H 4LMQI 2BOBA 2VDNL 3O0RL 4P5TA 3V5HB 2XV0A 2Z8RA 1JS4A 1UJ3B 1WAEA 2VN7A 4ZNEA 3G5YA 3QUGA 1E0OB 4P04A 5ICZB 1XAKA 5KUKA 4WI8A 4L3EB 5J06A 5AAWA 4TS6A 4KKAC 1OSZA 2NNFA 5J9PB 3SBWA 1T0NA 4UNIA 3RVVC 4EEEA 2ZT9C 1UM6H 3K72B 2OMVA 2LFEA 2MFNA 2ED9A 1FUNA 1OVZA 2F54D 3RLSA 1HI6A 1QEWB 1LJMA 4J3TA 3RY5A 1OTTC 4HC1L 4BDVA 3VH8G 1D7BA 4FFZH 1NDTA 1X4ZA 5D2LE 4ZUTA 1T04B 5CU9A 5HGAA 1T89A 2IPUG 2UXVA 5I8OL 2AJVH 4YMPA 3NUKA 4XN7A 1X5FA 2VH5L 3BIAX 2K7PA 2CH8A 1DBBH 1CYXA 2MHAB 4QXUH 4BZ1A 4E41E 3BAYA 3Q9QA 5FFOA 1YUKB 1F3DH 1OAZH 4ERSH 3ARSA 2ROXA 4MGXA 4LLAA 4KHXH 3NTCL 4GH7B 1AXTL 4GQZA 1MXDA 4M7LH 4JY6B 5JPMA 2R4RL 5CEXA 4ODTH 2QLYA 3ZDZB 3OKDB 3CDZB 3LXUX 2X2JA 4D2NA 4ZSOE 2H9GA 1ZLDA 1QI3A 4YN3A 1JWUB 2JQMA 2VUOA 5F9OH 2VDPL 3OBAA 4LDLB 4Z3EA 5IMMB 5BQ7A 5AZ2H 5BJTA 1YEDB 2X4SB 4NKMB 1PD0A 2NY2B 5I9QB 3QIWA 4KMTH 1DVZA 2CLRB 2AQPA 2JTYA 3ERXA 4WTXA 3KH4A 4FG2A 1F1DA 4Q9CA 4Q0XL 5CBAA 4DPAX 5BZDB 2JVUA 3GS4A 4U1JB 2DKUA 5I26A 4KV5F 3C60B 2CGZA 2MOQA 4OIAA 5CZXD 3U79A 2RQEA 3WI9A 4KUCD 1AQDA 5DCCA 2WYIA 3O3AA 1NGYB 1AVAA 1X5JA 4HGWA 4I18A 3EJZD 3FT9A 4PHZA 1G6RL 4LGRB 5BRZD 2QMKA 3UZVA 2GJPA 3S8WA 2Y06L 3F6IA 3VYNA 4Z7WF 1A7PH 1BWWA 4FNTA 5I1DB 2ICWJ 4RWYH 3GZOA 3QIBC 2GTQA 2EDTA 2A74B 4JRFA 1GY2A 1KELH 4OQ1A 15C8L 5KVGL 2BY3A 3II3A 2E7LC 1GZPA 4ZW5A 3GUFA 2DBLH 1VIWA 2XY1A 3BESR 1OM3L 4WWID 3SIKA 3PHSA 1CC3A 1SHWA 4MJ6A 1FGVH 5I15H 2CHDA 1T1WA 3WEXA 1NAKL 5D7KD 1GGBH 1YYML 4X5LA 5CCKH 4GS7C 1ZLUH 1T7ZA 2P52A 4TSCH 3I2CH 3PABB 1HHKA 3FXIC 2CLVB 4Y9FA 4KNTA 3WDIA 2Y1YA 3PFQA 3TBVA 5KBDA 4OFKA 5EU7C 5GRUH 1KC5H 3AXLA 1S7TB 1IC5H 1AO7E 2WKGA 3MXVH 2C9QA 2XVKA 3EOTL 5F6IB 3FU7B 4NJAL 3TFKD 1CIDA 1CICA 4OB5L 1YG9A 2CIKB 3DOSA 4F58L 1QSFE 4ZFOL 4P57A 1KTLB 1NCCH 2Y0SA 3CQPA 4I48A 5DK0A 4GRWH 3FT2A 4HJGB 4OVVA 1MJ8H 4UM9A 3V55A 3RTQC 2KZWA 4CDHA 4F8NA 5E7FA 3FO1B 2CKBA 4KY2A 5EU3A 5B3SB 3ZDXE 3L3GA 5K1NA 1MH5A 1QFWI 1HHGB 1GL4B 4PR5A 4ZXBB 3RG1C 5JOEA 4OAWB 3UTSA 1ZS8B 5CGYC 1I85A 5CGTA 5EBGA 1ITBB 3BP6A 4L9LC 3SPCA 5LWYH 2CPCA 2YK1L 4WO4A 2XXMB 3IKCA 1SN2A 3A6OA 2ZX6A 4MAYC 4MDJA 1ZLVH 2F53B 1RCYA 4QI3A 4V2CB 1L5GB 2X4RA 4WWNA 3AY4C 3HC4H 3WN5B 4YR6B 1NDMB 2YEVB 1JYXA 5MI0C 3AU1B 1PG7L 4ZUWA 3RX9A 1IM3A 4N87A 3LAFA 1ZVYA 2WTRA 1RV6X 4FQ2H 2JV6A 1SUJA 3C9NA 3DUSB 1N7MH 3HZMB 4NQVA 2PNDA 2DQCH 2QR0A 3NZUA 3P4NB 5C08A 4N2GA 4JO1L 1G9HA 3LH9A 2X41A 3MMEB 4PVMA 5C0GA 5L7XH 1I7ZA 3DSFH 5E5LA 2Z8WC 1O7DC 4WHCA 1OB1A 4PG9A 4PRHE 5FYKH 4LAJH 3DDFA 1PF3A 3VFMA 5AUMA 1A6WH 3IDMB 1YEIL 3LRMA 4LLYA 4IKNA 3O4LE 1XF3A 2QQLH 4PW4A 3W1ZA 5FECB 3M7OA 4EDWH 5T1JA 4HUUB 2PYFA 2YPVL 5IK3A 3QEUB 1OWWA 3G5ZB 2TAAA 4X0KB 3F65A 5DHYA 2WMPB 2BSRA 2EE0A 1QBAA 3F58H 2QSTA 1JZIA 3IFLH 5E9DD 1EX0A 2I60H 5HVGB 2MRYA 1INDL 1EVUA 1E2ZA 4H1LA 4K94C 4PRAA 4Y9EA 1WC7B 1VEPA 5FWQA 3MRBA 3EFOA 1SYVA 3MA7B 1N18A 1MHCA 2H6PA 4HWZB 4L1BA 3ZKNC 4BCXA 5D1XC 4U1KA 4UBDD 2D4FA 4O02B 4AH2A 1SXBA 4YJZL 4FZEH 5ITFA 3CV5A 3MJ8A 1MG2C 1YA5A 3PQYD 4OCWL 4QRUA 5GSVB 3ROLA 5C3IA 2WO3B 4O58L 2W9EH 1ZE3H 3UMNA 5IFJB 5IVZB 3X2QB 3J27A 2IO5A 4GKOA 4UOZA 1B9ZA 4X7TB 4JW3A 1QHQA 2PUQT 3NJJA 3LZPA 1Q8MA 1KIUA 4GBXC 4ODHL 3RNQA 1L4IA 4MDIB 5D5MF 4DN4H 3IWUA 3LB6D 3GINA 4M4RB 2H1LM 4G8GE 3FFDA 1PG7W 2V5SA 2JQAA 5E4IA 4MJ5A 4NJ9L 4DQOL 1MNNA 2VMFA 3EO9L 1FNSH 1OGAA 4DTGL 3DPBA 3KLHC 5KYYB 5KANI 1E4KC 1GVIA 2DQHL 1EZUA 1DQVA 2R2BA 2EUVA 1K5NA 2WINB 5AVTB 1F42A 1KIRB 2IPTL 2VLJE 3P3RA 5JNYA 1ZLUK 1RY7B 5F93C 1PCXA 5SWSE 5JHDE 1Q0XH 1C8QA 3WXVL 5D4HA 2UVEA 4ANUA 2BZ7A 1QTPA 5D7IB 3KLAB 1WIUA 4KTGA 1CQKA 1R5WB 4QHKI 5MENB 1CFNA 4TUKH 5BV7H 4Q89A 2YD5A 3P0YL 3IJYA 5F8QC 2B5IC 2DI7A 2XTJC 1SBBA 5GGVH 1UM4H 2P5EB 1JZHA 3V5DB 1MHHA 1MW3A 2VR5A 3KBPA 3AABA 3FHQA 4XOBA 3OHXB 3DOHA 4HUXB 1QVOB 1GYWA 4XNZB 4NIYE 5AVRB 2BOCB 3CBJB 3QEQD 2VUKA 3LNFA 5IW6B 1NFDE 3FQWB 2A6DB 5T3XD 3IGKA 1U3HB 3LS5L 1UKTA 4Q97A 1MCWM 3CXDH 4KY1L 3M46A 2CXGA 1VB9A 4YVNA 1BQLH 5KYWB 1TVDA 3BT2L 1ZLVK 1OF2B 2EDEA 4DO4A 4PWGA 4J3VA 5FKAB 1EUUA 3N0AA 2OYKA 3FOLB 4QYOB 4WUKL 5EBMA 2Y5EA 4BZYA 5IJKA 5HBBA 2P45B 1H3VA 5DO8A 4MAUL 4X5WA 4G7VH 1H8NA 5HYSG 3PHOA 4UZSA 1EWHA 4IBTA 3B3BA 4Z7UB 4XB8A 2JLLA 3JWNC 1NMBL 4PJDF 3IJ9A 1OQOA 3BFOA 1JXJA 1IEHA 2BSCA 3QUMH 5TK4A 1ILUA 3OGCB 3OLEA 3MBEB 5HHVH 3MV01 3RWIB 2NY7L 1RP9A 1OE2A 3SDDA 4AT6A 3BP7A 5KJRL 2YFNA 1DBAH 1A7NL 4MZ3A 2IVFC 3BZEB 3OXRA 1CFQB 1IAOB 2HX7A 4KXCA 1KIQA 4ZUSB 1GYCA 1BFVL 4PCKA 5ACLA 1CDCA 1DJYA 3QCTH 4F93B 2OJZL 3KZ8A 5CKAA 3H3BC 4NP4H 4YQXL 3OLGA 2N56A 3GTNA 1G1KA 3E6HA 5B8CA 3QUXD 4UQEA 2H2SD 2ZCHH 3J2PA 4X7FC 4M61B 5IW3A 4W9GC 2J2ZB 1CFTA 1NEPA 1TQVA 3CFKA 3PL6A 3DOIA 5JORA 4S2SA 4FZ8H 3MCKA 2IDSA 1DSWA 3LEXB 3EAKA 3O9WC 2PCPB 1FIGH 5F7AA 4NQCB 3EXLA 1AD0B 2A9DA 4IMLB 1N0LA 5JOFB 1EVTC 4QDGA 4HZLA 2OL3H 3T8XB 3BSGA 1FVDB 5J6GA 4PJ5D 5M95B 3HMXH 3ZYZA 1WCQA 3LYRA 4N2MA 3SCMC 3B2DC 4NBZB 2EYRB 2ICWI 5CFHA 5CJOL 2Q6WA 5KVDE 1HXKA 2WZ6A 1LO3H 2X4QB 4WEBL 3KE0A 5KYNA 1F4HA 1KB5B 3NCFB 3S7GA 3MJ7B 2GYSA 2L0DA 3J07A 1K8DA 4BELD 4AVHA 1Z3GH 2Z8SA 4XX1G 5EU7E 2EXWC 2FGZA 5FHBH 2WHVA 3LS4L 1HZHH 1PZSA 3O45A 3IXAB 4G80B 3L3OC 1JF5A 2W60A 3HPLA 1FG9C 5EMYA 4M02A 3V4LA 2QGCA 4HIEB 4LVNB 4MDRA 4Y19D 3JWDH 4KH9A 4D0CA 3CVIH 4LHUA 3ULUL 1G9EA 1EO8H 1KFAL 4PFEA 4DFHA 4AUYA 1JGEB 1B6DA 3TPUA 2E9JA 2QPUA 2VKXA 4RGND 2PWEA 3PHQA 4NSKB 4WWKB 4HETA 3T65B 4HXAL 3EO0B 4M5ZH 4TVPH 4B9ZA 1I7UA 1WFJA 3QQNA 2HRPH 2A9NL 3ETBF 1JK9B 4LLVB 4JK0D 1BAGA 3G6AA 4ZUVA 2W0LA 2GBAA 6CGTA 5T33L 5DR5H 3G5WA 4YZFF 4G43A 3T2QA 4R0LC 3U0WH 4PW3A 1VA9A 1N8OE 1GCFA 4DKFH 5GS2H 3K6NA 4QRRE 1FE8H 1MCPL 3K0YA 3KVDD 3PP3H 2UXFA 4YXLH 2HT2C 1T2XA 4XCFH 4GQ9L 1RZ8B 1WZKA 4XMLL 4YC2C 3SPGA 1KDJA 5I8KL 3CPLB 4WUUD 3U6RA 4D9LH 5HHQA 1Q0YL 1AGDA 3VI3E 3GSOB 1M53A 1EDQA 4IJ3C 4F8OA 3LIZL 2WIMA 4JHVA 2WB1A 4BFKA 1Y0LB 4AEIL 1AXSA 4AEEA 3BAXA 2YXWA 3LDBC 3VVWA 3P1VA 4G6FD 4RMWA 1BVKA 4NXKA 5LXGL 2F8VA 1JFQH 4PLJD 5E8NA 4ZQKA 4XCNB 3K2IA 1FVEB 2L7QA 2Y1ZA 4LESA 1QFWL 3BUQA 2I07A 4XVUC 4GQPH 5JIPA 4N0YH 5D2NA 4CC4C 3GMLB 3OAUL 4PRID 3A4EA 4FLOA 4XNUH 5C0ND 1LM8V 5D1XE 3MRMB 5AYTA 3QG6A 4Y4KD 5TE4H 3GIVB 3TA3D 2XJLA 2VGLM 4KMLB 3W0WD 3WNMA 1EGJL 1S9YA 2BNRA 3O8XB 4QHNB 5FCUL 3SBQA 1IKNA 5BRQA 4KZEH 2O61A 4HCRA 3W2DH 1DQTA 1GYVA 2R39A 4PV8B 1ZA3A 1GZHA 1MJ7L 1XCTA 5FV2A 4NO3B 1ONQA 4PY7B 3B6SB 4X5RA 3RILA 4HIXL 3T0EC 2WOBA 3BH8A 4PJDB 4K3DL 3CIQA 3OKOA 1A1MB 5IESL 3AAZB 1H6EA 4JRWA 4GY4A 4PJAA 1E9PA 3EDDA 3QHFH 1AQ8A 4OZGF 1REIA 1E3XA 3E1ZA 1M7IA 4HPYL 2WXFA 5HYJA 4DO6A 3DXAD 1KBPA 4K2UH 5DFVC 4P46B 3U6XS 3RNKB 3A4FA 3KL0A 3F5WB 3RYMA 2DQIL 3ARGA 4HKBA 4CC1A 2LLLA 1XF2A 3Q2VA 5FYKE 3NEXA 4PJIF 2BVQA 2R0LL 5JW5B 1NGWB 4R97B 3X11B 3KGUA 3WHXA 1HXMA 4E9LA 1JNLL 3GHPA 5GZOA 2ZXDA 3QAZB 3UPRA 1I82A 3LN4A 3QXUA 2H1XA 4WSGA 3SKNA 2OP4L 2E76C 3FSWA 3D4CA 2HKFL 4IRSC 3GWJA 2AGJH 4RRPA 3L9BA 4YSRA 4U31A 4FCAA 3NFPB 4FLQA 4EO5A 2ZXCA 5EEXA 4V1DA 4S1SL 2Z4QB 4LBEA 5CCGE 5IT2H 2WW8A 4MMZC 4JPVH 1QMUA 2B1HL 4GI6A 3OZLA 2EVGA 4NO0A 1RULL 4R5VA 3EH1A 4H8WH 4OBSA 8PAZA 3VXUB 2Y2TA 1V27A 4JN1L 1I9IL 1ASOA 3L4VA 3U9PL 1R3HA 1MRFL 1R3LB 4TRPL 4LSVL 3ULVL 3KWUA 2NY3B 5CEZL 2YQ3A 1C5CH 4DCQB 1Y6KR 3GBEA 3PP3K 5C6TL 1EEUA 2CBOA 3L3IA 5F1NA 3IJEA 4K3JH 1E30A 2WWKT 1TJHL 4GKLA 3C8HA 1YYCA 1A6AB 2VW6A 3BEWA 4L8CB 4A7GA 3N40P 2YAEA 2WVUA 3FQUB 2EILB 3MZGB 3QI9A 1DZ0A 1V7MH 3JTSB 3O4OC 4F15B 1Q9OB 2R69L 1I53A 3ULSA 2NT0A 5F1OB 5F96L 3T2LA 2FR4B 1IGTB 1JHLL 3FCSB 2NRDA 4H26B 1KXVA 1S7SA 4BQ8A 4F37F 4Y2OB 1CE1L 2KZKA 3V4PA 1YZZA 3MVSA 2R7EA 3WEOA 1WUNT 2W81C 2P8PA 1FL6A 3CE1A 5E9NA 4M6OH 4N0UE 4XB7A 5G4MA 1YEWA 2EXTA 4ORZC 4UT7L 3CUPB 3KYAA 3B43A 4FS0A 5EOCJ 2YJLA 3TBWB 3W9DA 1XIWC 5EEVA 4KKCD 4LU5L 3EHBC 3SYOA 1T1ZA 2NUPA 5EZOH 4PTUA 1I9JH 3C6SA 5IVXA 1HESA 4N8PA 3FRPA 2XKUA 3PG2A 4M5YL 1R3JB 2H26B 2NY1D 3DX7B 4Z3GA 2XRAL 1RK7A 1XGRA 4PRPD 3MLPA 4RAUA 5J13B 3VWKA 5TFSH 1KT2A 3OG6B 4FFWC 3M86A 2EIZA 4Y1AE 3GLAA 3UTZB 1K5WA 1QFOA 1VFAB 1BG9A 4R5TA 3BUIA 1LO5A 4NO5B 4WGKA 1V55B 1BLNB 1L6PA 1TYRA 2ERJC 3FSVA 1FJ1B 2WXPA 2GTZB 4B96A 1IJ9A 2MQ3A 3G5VB 2DQGH 5F7DA 3ESPA 2C5DC 4TNVF 4WFED 1G9NC 3MFFB 5IQ9A 2FUQA 1LDPL 4QF1B 4XP5L 2YHGA 1UXSB 4QXVA 2X1PA 3PWNA 5F7WC 2OR9L 1XH1A 4XO4A 4ELKB 3GXFA 6PAZA 3TZVD 2GCYB 1LTXA 3ZYIA 3C08H 1KG0A 2WWKO 4I3SH 4PVLA 3QJVB 5D1QB 2ZP0T 3STLB 4BCZA 2VXSL 2HUHA 2KYIA 4GIAA 4LRNL 1MW0A 2KHAA 2J4WH 1YDPB 4ONOA 4XNXH 3IMUA 2NNXA 2VQ1B 3LZLA 1N64H 4APQA 1RP8A 3BGFB 4PSRA 7PAZA 2ZKYA 5CJXC 3SDCD 4DSYA 1ZDQA 5LGJA 3ATAA 4I87A 4XMWA 3A4DA 1BBJA 4TUOB 5CMAA 4WJG3 1EJOH 4Q74A 3MLXL 4R8WL 2VMEA 5DXWA 1BMZA 5LBSA 3X14B 1RK1B 4R96B 4JO2H 3KPRD 2ZOWA 2RJMA 3M1BA 4BK5A 3IJ7A 4LCWD 5AAMC 5E8DL 2J7LA 4QRTA 4P2RE 5E6IA 5DRNA 3KD4A 2EDXA 3AS3A 3P0VH 5CSBA 3IN2A 5AOJA 3SQOL 2GHZA 1ORQB 2ATKB 3B9KB 4UNUA 4UQ3B 3WSQH 1C5DB 5T5FL 2JIXB 1QZNA 2QPEB 3FB8B 4Q6IB 1ID5I 2XWZA 3GKZA 3PIQA 4KROD 2EDQA 2WTPA 1NMCC 1SEBB 1OV8A 4JKNA 4OFQA 2OI9C 4OBRA 5DI8A 2O30A 2VAAA 4OJFH 5CGMA 3EBHA 3QUHA 3T3ME 1GJUA 3C6LC 3K4AA 4JGNA 1I9RL 4UANA 3RX5A 5C71A 1E65A 3HS0C 4JFDB 5DTFB 5HHXH 1R4XA 1V54B 2ZF9A 2DMHA 3VVVA 3V7MA 2WBJA 1I8MB 3C5ZA 3B2VL 3QXAA 4FXKA 3CZKA 4LCCA 3TP4A 3ZKXB 4YX2H 5EPMB 1BZ9B 3IK2A 4ZTOL 2W0FA 4F80A 4IGBA 1BREA 3BMVA 4JANA 2P5WE 2EE6A 3SE6A 5I30L 3OLIA 1K8IB 4NWTL 3J8F7 4I0PC 2YGPA 1W91A 2SEBA 3K0WA 3L6FA 3VD9A 2M1KA 3QDGD 3UDWC 4M7KL 2LU4A 2GJ6A 4KVPA 1JPTH 4G8FB 4PBDA 4UTAA 4ZW3A 1A5FH 2BRQA 1J5OL 2DICA 3H3PL 3CFBB 4B7LA 3JUZA 1TXKA 4WI7A 2XWTB 3RP1A 4NQDA 3WD5H 1FVCB 4OGYL 2J44A 3MUUA 3OZ9H 5L88L 1CLZL 4HFWA 3C87A 3KWXA 1DUZA 5TDPB 4A6YA 4D8PB 4XC1H 1I8LA 3KXFB 4QRPD 2XQBH 3TJEH 3VFGH 1JV5A 3TVMA 4ZMLA 1DBJH 1PY9A 2FJFB 3QJRB 2Q76B 1HNGA 1CFVL 3DI3B 1TLMA 4HKJB 5EU6E 3X1GA 2W94A 2WNGA 4DGVL 3NACL 3L3JA 4KI5D 4KRMB 2PPDA 5F9AC 5DEGA 3ORJA 2VJXA 5H37A 2YXVA 1ECZA 3D3VE 1H9DA 1BQUA 4QRSA 4XPAL 1UKSA 5DMKA 1P1ZB 3O2VH 4JAMB 1BZDA 1KV3A 4G8EA 5AB1A 3FQNA 4YE4L 5CR8A 4OVUA 4MMYA 4OM1L 2YAOA 3PWPE 1KLGA 2B9AA 3ETBJ 3WTUA 4N2EA 4KU1A 1LK2B 1YNTB 4LIQL 5D2LB 5DMIH 5F7LB 1U6AL 3QS2A 3WO4B 1ODUA 4EZMA 3NA4A 5EO0A 2Z4TA 4BUGA 3A67L 1F8TL 1ZLSL 1UADC 1XGPB 4R84A 4HU8A 1XB3A 4E41B 3ARFB 1KYDA 4LVEA 3L3KB 4XCCH 3UBXA 4U6XA 4RFOH 4AIXA 3OJDA 4GMSL 1KPRB 3NIDE 2EDKA 1Z1WA 4GSRA 4MWFB 4MJIA 3EO1A 4OZHB 5JOPD 4PJ8C 4ZSOB 2HPTA 2OPCA 3FU6A 4FXLA 1LLAA 1WO2A 2BVOB 2Q0ZX 1HINH 3VI4B 4GAYB 1KJ3L 3MLTA 4YHLL 2EDYA 4CL7A 5TQ0H 4LVHC 2JKWA 3NBNA 1QBML 3SDAB 4H88L 3GI9L 4CJ1A 3FUNA 3RWCA 2YGVA 3SN6N 4G6JH 3HHMA 3QUYC 1NPJA 4G2AA 2NY4C 5BVPL 4PS3A 4B6ZA 4IKKA 2VC2H 3ILQC 1SUHA 4UYQA 1JGUL 5C0AD 2PXYA 5DEJA 5LO7A 4NQEE 3IAPA 3UAJA 4ZFGL 1WSST 2XFGB 3U4EA 3BDYL 2Z7ZA 1JZJA 5C0CD 1ZD6A 4AG4H 4HHAB 2WAQA 1AY1L 1WWBX 5EEWA 3VJ6A 3BVNA 3GMOA 4LCIL 5E23A 3L1EA 2LE9A 3UC2A 2ZXGA 1JZGA 5C0BD 1HOCB 3NJVA 2EH8H 4XNMB 5FGRA 1U8CA 1WCBB 2AI0H 5LBVA 3BWZA 5L4IA 4M1GL 5L8KB 1TTCA 4KGJA 1VHPA 4JFFD 5EEYA 1UCBH 1NFDF 4H0LC 2V2TB 3GSXA 2IAND 1RK0A 3UGXA 2Y5TB 4PH8A 5CUSL 3SDXB 1CGSH 2LR4A 1YEHH 3AZUA 4LF3A 3O2DA 4FTVA 5F70A 1S7XA 1TEFA 4XMZA 1X4YA 3D6GA 5HTSA 3WNNA 3V0GA 1CE6A 4F2MA 5KVFH 4I2XA 3QQ3A 2OXGB 5EC2A 5D7LD 2WXMA 2BP0A 5E5MB 3ZL4L 4JZOB 2XG4B 3VCLA 4YSSA 3AB0C 4XP1H 1J8HD 3ESVF 1X9QA 3HE6A 1UH2A 3O6LH 3N85L 2ZNWA 5DVKA 5LXVA 1AO7B 5AAWC 4J3OG 3VACA 2BIQA 1S9VB 3SBWC 1COBA 3SY0A 1UWYA 2PR9A 2N4IA 4AVKA 3WEAA 3IMWA 4PD4K 3D85A 5SWQA 1WVZA 1QSFB 3CIAA 4HPHA 3RVUD 2FLRT 2QPDB 3D39E 2YQBA 4Y4HD 5ESVA 2AXGB 4P3WA 1SJEA 4WHTA 4RSYA 3L9YA 1FFTB 1I1CA 2YARA 3IDXL 4GXUN 2EINB 3EBGA 3I84A 3ZDXB 1T89C 1KMGA 4W6YB 4YSPA 1GGIL 3FN0H 2C1PA 5D7SL 4GUPB 4UF7C 1LO4H 1C1EH 1MJUL 5BS0E 3QJFA 1MF2H 4XXDA 1J1OH 3L7FA 4QGTA 5C09D 3RI5K 2DH3A 2DWDB 2CRYA 5DRZA 5T1LD 1UURA 1KCVH 1KJVA 5JPMC 4LASH 2HKHH 2VWEE 3VTMA 5BNXD 2P7TA 4FQ1H 2NCEA 2YBRB 3KBEA 3D09A 4HKZA 1HTYA 2BHYA 4PJ7A 3ULUD 3ARQA 1XEUA 1ZT7A 2OX5A 1YPZA 4X4XA 2E27H 2MIZA 3QIWC 4NC2B 2PCXA 1FNAA 2V7NB 2WQSA 1BEYL 1FZKB 2QELA 1C12B 4P3DB 4XMPH 4L8DB 2G2NA 4LLUB 5ACZB 4DETA 1FG2B 2CBTA 2R23B 2FT6A 3O4LB 5F3HA 4W6XB 4XH2B 5E2UL 2ZOLB 2K9FB 3MRDB 4GW4A 4WKZB 3HUJA 4AWJC 5CLWA 4XP4L 3K91A 3GBML 2E75C 1HEJC 1P84J 2D3LA 1NEZB 1PW3A 1FO0A 4HBCL 1CDYA 3MUGA 4CSPA 3B7RL 2BIHA 1NGQL 2CBMA 4NCDA 1NGPH 1MW1A 4PJGE 3HNVH 1HJBC 3VNYA 3KCPA 2VE6B 3FTSA 1U3YA 4HT1L 4PLKC 5I71B 1KY6A 4J5VA 2VMCA 5T3ZL 3TYFB 3ZSSA 5J9PA 4E0RA 1RIVL 2DJSA 4YSEA 1Q90A 3K1KC 3K72A 4ESKA 3F7PC 2H4EA 1K4CB 2YKLH 2WJ7A 5LN4A 5D4JA 3NEEA 4YHOH 5EZIL 1EHLL 2RGSA 2WJ5A 1DVFA 4TNFA 3AXIA 3QC5X 4YBHA 3OKMB 5I76B 5DUBB 4NPJA 3WFEH 2ZXEB 5GGTH 3TH4T 5B1CA 3TV8A 1YEEH 2WBKA 2VZVA 1D5IH 4R4BA 1ZEAH 3DV4B 3QJHB 4N9GA 2MHAA 2EIDA 4HAFA 1WPCA 5A6MA 4OLZL 3RIFK 3QYMA 3FHAA 4NZJA 3MXWH 2FD6L 1RUKL 1BM3L 3HNTH 4GMTL 3RPIB 5F6HI 2VLJB 3M07A 1IE5A 4X42A 3BPNC 3GSNH 3KWVA 2R0KH 5JHDB 1CICC 1FLRL 5IQLA 3RVXD 4R3SB 5ALBH 1TQCB 2Y6SD 1NWOA 1SFDA 3D2UD 4P23D 2CJ3A 4X6BB 1B0RB 4M3JA 1F4XH 5IMMA 1L7TL 3KM2A 5DT1L 5HPOA 4NKMA 1NIDA 2CLRA 3SO5A 1LP9A 4JQXA 4L9DA 4ZZFA 4OGXL 1W6LA 2XIIA 2I5YH 4QAMB 4HS8L 4JDEB 2FLBT 3PS6A 2V9UA 3A6CL 3T2NL 5F21B 3QRGL 1JF6A 4FXTA 2DY2A 3P3TA 5BZDA 3Q9PA 5I6XC 2R4RH 1QBLL 2VDQB 5A2FA 1NFDB 3C60A 4LL9A 2P24B 3TWCL 5LAXA 4M3KB 3RRQA 1ZIAA 3ECBA 1NGYA 4PWJA 2UXTA 4G7YH 3UFIA 1LQSR 5EA0H 4FFVD 3T3PE 3NG5A 2FVNA 5C0DB 5IJVB 5I1DA 2C9UA 1QW8A 5IZ7A 1S7QB 2VLMD 4XNYH 4BSWB 1J0HA 1SN5A 2A74A 4WFHD 1TMQA 1HYSD 3S4SB 2A7BA 4NKDA 3VD2A 1RUMH 1U21A 2RCSL 5AB2A 4QRQB 1G5AA 2YMOA 1H6TA 3U7YL 4OZ4B 2Q3ZA 3WJLA 3LKQB 3X12A 2BZCA 4D3CH 5DUPL 1F2XK 4LSSL 4EBQH 1DN0B 4LO9A 1JNHB 3I9GH 1PZ3A 4WY7H 4HMCA 2Y06H 4U0RC 3WEMA 1HKLL 3PABA 1CD8A 3KGRA 1CDUA 1XBDA 3S36X 3JSSA 3I02A 3TLRA 2BCKB 5KVGH 1SOXA 4F8PA 1JIBA 1S7TA 1MHPH 5I8CB 1AR1B 4UQ9A 2X88A 1DLHA 4DESA 2VDLB 3KYNB 3FU7A 5B1AB 4FJYA 2GIXA 2AZUA 4GJTB 4WK4B 3ZE0B 3M17A 2MSPA 2UZPA 1RIUL 3FH5A 5PCYA 3UYOD 4EUPH 2F18A 1NGXB 2VDRL 4AV4A 2R27A 2APWA 3AFLA 2XICA 5TF1L 3HHSB 4WZ9A 2UWEA 2ZQKA 1NEZG 3QIBB 2BFVL 4NBXB 3Q1SL 3ILPB 2DM4A 4G7RB 1VENA 4ISVB 1X5YA 5E6SB 4OAWA 3GD1C 5L6YL 2FHCA 1WTLA 3PJLA 4JPKL 3EOBA 3IF1B 3VRJB 8FABA 1BECA 1P6WA 2PP9A 4NUGH 1M3IA 4PJFE 1O5DT 5HYSA 3D18B 2WVVA 2PYEA 5BZXA 4B9PA 4NJAH 2WUBL 3WN5A 2DYPA 4YR6A 4EN3B 4G8IB 5I23A 1BZ8A 1XHHA 1C16A 1H0DA 2HCZX 2VLKD 3IFPB 4HWUA 4U2ZA 4XN1A 1XCWA 5GS1A 2F58L 1RIHL 3FCTB 3FAXA 3LNEA 4GW5A 4OT1L 2H2PC 3HZMA 1NM9A 5JYMA 5DJZB 3UTPE 4ZNEE 4H2CA 3FYIB 3BGAA 1KOAA 4OFDA 3EF4A 5GSRA 2NNAA 4G9FD 3RL2A 2HB0A 1I3RA 3LKRB 1P7QD 2ESVD 3LH8A 5B39B 1WFUA 3IDMA 1KBGH 2XNAA 2FSEA 3SPVB 2A77L 2JQZA 1KXTA 1HCFX 3VXMD 3TF7C 1JYWA 1MUJA 1HQRA 2QT6A 3QEUA 3G5ZA 1YQVL 3RTQB 1X9UA 4BFJA 2QQNH 1ACZA 2WMPA 4NI3A 3V9EA 1M56B 3GNML 4JFOB 2GHWB 2KUTA 4ONHB 2Z31C 4IHOA 4X6CE 2GVYA 4DP2X 1WC7A 3CSFA 4HWZA 5AVQB 4L9LB 3MA7A 1AHMA 3D5OF 4A2LA 2HZHA 2E7DA 3EDKA 4HOWA 3TCLA 1B4RA 1UVQB 3FU0A 4O02A 5AKSA 4MAYB 4YGVA 4AGNA 2IMNA 3EJQA 4KC3B 3EZJB 2OMWB 5MI0B 1NCJA 1WAPA 1FNEA 5J6HB 3LEYL 3EW3B 4LGSB 5FKPB 3NH7L 4UAOC 4QRRB 4G59C 1D2PA 1BIIA 3MRIB 5IVZA 2OCCB 5IG7B 4BHUA 4DGIL 3JV5A 3ZTDC 2RTTA 3GGWB 1RPUA 5L2KA 1HOEA 2E9BA 3P9WB 2AJXH 4JM0A 4MDIA 4N2OA 3VI3B 3BN9C 3CVHL 4POZD 1HHJA 5IHZA 3M8OH 4M4RA 5JXAH 4ZMPA 3DGDA 2VW7A 4JM2C 5LAPA 1CJYA 3UEZA 4X98B 5GRVL 3Q2CA 2WLNA 4Z7QE 3SYAA 1WIPA 2R2HA 3ARDC 1KIRA 4TL4A 4NNPL 2E8ZA 4I3RL 3C5JA 1AZVA 1MFDL 2XSKA 1I7TA 3VSTA 1L7IH 1P4BL 1P4UA 4ONFH 2FGWL 1L9OA 2WOYA 5MENA 3PL6C 5D1XB 4W4OA 5E6YA 4ODHH 1DQMH 5KS9F 3QZWB 3B2XA 1VESA 4IS6B 5E95B 2FZ3B 4NQSB 1JSYA 4DP5X 3HG1A 4AMWA 3ZMNA 4PRIA 2WWNA 2F61A 2C1OB 2NXYC 3AT8A 1Q9LA 4HCGA 4UDUA 4Y4KA 4LEBA 1ZANL 4HKXA 2DQTH 4YHML 2G2RB 4GW1B 1DQQA 1MY7A 5DD1H 1WP6A 1VJSA 3P3YA 5IW6A 2BNQB 1FV1B 3VX0A 2NW2B 3OF6D 5GS0C 4KFZC 5LCVA 2DJUA 2NQDA 3DETD 3FUMA 1OANA 2HA1A 3N42F 3OX8A 4GBXB 4NGHH 3WXVH 3RWGB 1CTOA 2WY3B 4UWQB 1F11B 1OAKH 3QCUH 2BSTB 4FE9A 4LSDA 3MJWA 2ZCLH 1AE6H 1NC2B 3FO0L 3GXIA 4A2EA 2FO1A 1JZ5A 3P0YH 1T5KA 2XN9D 1Q94A 4W9EC 1RZPA 1AKJD 1A3LH 3FOLA 2FLMA 4QYOA 4TOYL 1Z9OA 3QH3B 5DD5H 1OTSD 1S6NA 2A9AA 2YPLB 3FT4B 5E0FA 3TO4D 4F7MA 1U58B 1BGXH 2HLAB 2LOEA 4PJXA 4JHZA 5DZNA 2MCAA 2P43B 1BZQK 3GIZH 3TS8A 3HI1A 2HVJA 2W9DL 3MBEA 4OZIA 3GT6A 3MUZ1 4U7MA 4QOKD 1W2KT 3UX9B 4BEIA 1NTDA 1Y1UA 4GSXA 4XOCA 2B5IB 1IAOA 2XTJB 3GS0A 3UTSE 3ZXAC 2JKXA 3AW5A 4TV3A 4PBXA 3D9AH 2B20A 4PJHB 3A22A 4FFYL 1YSOA 2L7UA 5L8JB 2XKSA 4JG0L 4OCXH 5DC4B 3T3MF 1I1RA 3MLYH 3CXHK 3BW9A 1F3JB 1DO6A 3BUPA 1TQUA 5BQDA 4XNDA 5B39G 2DRUA 2OMZA 5HI5C 2OM5A 5FUOL 5DMYA 2CO6B 4PRNA 5DD0L 2NY5L 5D93C 4M61A 2BXZA 1GHFH 2DQEL 1KN2L 2J2ZA 3AVEA 4WQOA 5K9JH 4QY8B 5TQ2H 4OLWH 4F20A 3MODL 1XGUB 5C08E 1O9WA 4Z0BH 1KIPA 5CILL 3LEXA 2D7PA 4YO0A 1AACA 3G6JA 2KQNA 4EKXA 3MRNB 1KF9B 2BHUA 5DK2B 3QNZB 3UJJH 3GHBH 4NQCA 4NNXA 1IC4H 3V0DA 3S3PA 3BE1H 1RURH 3VWJD 3RURA 3CN0A 4H8QA 1F3DJ 1UWGH 5FB8A 3T8XA 2HFEB 3WUZA 1CLVA 4IRZL 2UX7A 1NAML 2V3DA 5J1AB 3EXJA 1MWOA 2EYRA 2WBWB 1OW0C 1IGCH 3WS3A 1SBSH 3ZBMA 4YNYA 4HC1A 5C2BL 1BZ7A 2AJSH 1WBZA 1JD9A 1IGIL 2JK5B 4N5EC 4YDIH 3FJTA 4XNAA 2K8QA 2FHBA 1PCSA 2BH0A 3QIUC 4UUJA 1C5BL 3VG9C 3ZRSA 4Q9QL 2JKIS 1P4LB 1GRWA 4LLWB 9PCYA 2DLFH 3MLZL 2ICEC 5GGSB 5HD8D 2R9HC 3JVGA 4UYPA 4N0UB 2YRBA 2NR6D 3RIKA 3UZEA 1Q9KB 5LJYH 1P5UA 1D5XB 3BKYL 5T1DL 3D7PA 4HU2A 4HZAA 5CZKA 3FFCB 1OD7A 4LL1A 3FBKA 1DJIA 3VQLA 1XFPA 1A8ZA 3O9WB 4B9CA 2ZIDA 4WK0B 2VISA 2YEZB 4RGOL 1JGEA 3R8BB 5I6MA 1HHHB 4N8VB 1FL5B 2EO7A 4ADJA 1M42A 4WWKA 2ZKWA 3FU5A 3QR1A 3EO0A 1D7DA 3QZWG 2J56A 1UOKA 1CXHA 3NJIA 1OGAE 5FA3A 5I16A 1NFKA 1JK9A 1GCYA 1WYJA 2IGFL 3QFGA 2KZ1B 5BZZA 3VFPA 1JPSL 1OP5H 4NQQA 2GJJA 3DVNB 5GJTL 4NKIL 3SCMB 1J1XH 4WHYH 3SBRA 3LV3B 2ED8A 4ES9A 2WUCL 3LY6A 1DE4B 2J1YA 2OBGA 3NYKA 4U7KA 3V4PH 3NIDF 3L4YA 1WFNA 1YNKL 4NNYB 3B2UD 3RGVB 3T09A 5JPNA 3HFML 4UTBL 5GZOC 4HJ0C 4LCYB 3BZ5A 2FWSA 3FSOA 3MNDA 4HXAH 1KPUA 3L3OB 1SEQL 3NCJL 5IB2B 1Y0LA 1F6LL 1I1AA 2DM7A 1FNFA 1I9EA 5AKRA 1CYGA 3AS0A 2Z7UA 5FUCE 1FZMB 3QFDB 2XBDA 5F9JB 5IKCB 4XVSL 4NOBA 2X70A 3KPTA 5C0IB 2OYPA 4R7VA 3S98A 2IDQA 4U3XA 4HWEL 1R47A 4B9KC 5JXED 5EUOE 3IFOB 1XGQB 2H32H 3A0OA 3ILEA 4L1HA 4Y2DC 2Q7YA 2ZUSA 3GMLA 3POHA 4AEFA 2DQFA 3RVWD 5I8KH 4KKQA 3GSUA 5LBGA 5JDSB 5IEKA 3FB6B 3GIVA 1NCUA 1ZTXH 2XIBA 3QK0A 5LB1A 1LEKA 5I66A 5JDJA 4KXZI 1J10A 4R0LB 2EVIA 3O8XA 2M83A 2BINA 4L1SA 4CSTA 3KWTA 1R24B 2X09A 2F5AH 5A2KH 3UYRH 1CI5A 4MB4A 3F00A 1TOXA 4PY7A 2EP6A 4KK5D 4ZFOA 4YC2B 3NQIA 1FGNH 1HQ4B 1QFWH 1TDQA 3B6SA 1KGJA 1INQB 2E7CA 1RZJH 3EBIA 3IPEA 4OI9A 3PWLB 2AEOA 2P9RA 2AK1L 4IJ3B 3CFCL 3VFRB 1GIGH 3P77B 2VIRB 3GJFK 4LK4A 4RDQF 4OCSH 5F1IB 1MI5B 2BWIA 4XHJC 3LDBB 4PJ9D 4QO1A 1KXVC 1AGBB 4CU8A 1UA6L 3VFTB 4D9QD 1G7LA 3MV9A 5HYQA 3QO1B 3GS7A 4EVNB 2W0PA 5GPRA 4P46A 3E8VA 3F5WA 1IC7L 4X9FA 4Y8DC 4P4RB 1JZ6A 1V10A 4ZXBD 1ZHKB 1TQSA 3I6GB 3JWNG 1I1YB 4WCYL 3T3MB 1GGCH 4Z8FH 3X11A 1A6PA 4XP6L 2FJHB 5C0JA 2C7UB 2V9QA 1XWVA 5ANHA 4XE0A 2F53D 1PZ5B 2Z91A 1FZJB 4PY8J 1HSBA 2VRAA 3ZQXA 4AENB 4NKOB 4WW1B 3MRHA 3U46A 1Q1JL 3E2HB 1SXAA 1DSFL 3CC1A 4HPYH 5LG6A 2QPFA 5IHUH 2P5WB 3F7VB 4XGZB 4BQBA 4K9EH 1JN6B 3BAJA 5FDWA 5E03A 3NDYE 3O0LA 4AZ8B 1NDGB 4GXFA 5IROC 3ZUNC 2AAVA 4Z5RB 2YPVA 5TGBA 4J12A 3ARBA 4JFPA 4ENED 4OD1L 2X3BA 4UIMB 2J1WA 3H42H 1B2WL 3QDGA 1RZIA 5IB3B 1DBMH 3RZCB 4WTZG 1OP5K 5ECJE 2YD7A 3BXNB 3RY6A 4N8VG 2X53A 2H3NA 3HLAB 3GB7A 1F4AA 1NANH 2JH2A 1KCUH 3QWRA 2X5PA 4KK9D 3NFNB 4FNLL 3D4GA 4J3WA 3WIHH 4DCQA 5EZLB 5T5NF 4ELMF 3PGFH 4UILL 3O6KL 4YHNB 4XRCB 2WK2A 4Z7NB 4L8CA 3WIAA 2D73A 1H8OA 3DRTA 4DWHA 4QYAA 4BQCA 3D3VB 3D2TA 3IETA 4EN2A 3JTSA 4AGOA 1J8SA 1UZ6E 4IRSB 1OM9A 4V11A 2F19L 3NZ8B 3JUYA 4C56A 3FCSA 4HUCA 3BGMB 4MQ7A 1NBQA 4JN1H 2VZOA 1I9IH 4N2BA 5EBWB 1QWNA 4BXVA 1FAIL 3FOMA 4TRPH 3ZJAA 3ALPA 4RAVB 1XGTB 3GSQA 2D0FA 4WKXA 2N1KA 1J0KA 5KBNC 1T03H 1MVFA 1BEXA 4UT9L 4JG1L 3N5AA 4MMZB 4PJEA 4ODBD 1RH8A 3L16A 4XN2A 3CUPA 3O41B 4NZDA 5DHXB 5ISZD 2B59B 3A4AA 4OF5A 4NC1C 4PRBB 4S10A 3T1WA 2DOCA 3RDTC 1QG3A 4J27A 5ADOH 5E6IC 1O9VA 4XC3H 1L9NA 1R3JA 2H26A 3DX7A 4IMKA 5I19L 4FMKA 1E5YA 2VOTA 1CE1H 4QTHA 5DC9B 4EI5C 1HT6A 1TYEB 1EEZA 1QQDA 4WNJA 1HU8A 2CUMA 1AIFB 1NCDL 2YAQA 4MZ2A 1VFAA 5EZJB 2TRYA 3EOYG 2OTUB 3B9DA 4NEHB 4XO9A 2G5UA 1D3CA 1G9ML 5ETUA 1BLNA 3KLDA 5DD6B 3N1FC 1X44A 2GTZA 3O4OB 1KTDA 5E2TH 2PO6A 1TIUA 3EH3B 4XCYA 1KJMA 1GJWA 3A47A 4FQIH 4LU5H 4O51A 2FO4A 3MFFA 1II4E 1XZWA 2WCPA 2ICES 5I1AA 2KMWA 4NQEB 4IW4C 2XRAH 4LCCC 1CDBA 4Y4FC 1U3HD 3KPLB 1F4WH 1PFOA 2RD0A 3E6FB 4IIQC 4L0PB 2W65B 2BNRE 5C0AA 4IGBC 2I9TB 2GCYA 3MR9B 5IIEB 1KCBA 1ETA1 2QZ5A 4GLRI 2K7QA 4BH7B 1H6FA 5KSUB 1ZHBB 4PGEA 5CLTA 1IMHC 1LHZA 3UROR 5JO5B 1XIWB 3STLA 5HDQL 3EHBB 4M48L 4Z3JA 1BXUA 1YAZA 3OM3B 3IJHA 1IARB 4KJYA 3GLEA 3T08A 4KQ0A 2HKAA 2VQ1A 5L8LB 4PJAE 3P9LB 4C57C 2ATPA 4QXTA 3I3DA 3FCGA 2IADA 1LDPH 2CKNA 3NCBB 4BJLA 4XP5H 3Q2WA 2VUYA 2YPKB 4JB9H 5EB9A 1JGLL 1W72B 2OFQA 3PWVB 4YIQB 3T3PF 1G7JB 4WF7A 5HYJE 1J5HA 4GXUM 1QNZH 4NM4L 3X14A 3TV3L 5I6OA 3WEBA 3QZPA 2CHZA 5KW9H 3CZGA 2ERJB 5FYKU 4PI0A 1IT9L 3QCVL 2H1PH 5ICUA 1BQKA 4MFHA 1QLRB 3HPJA 4PWHA 4ZPTA 1PX3A 3LCYA 4P9ML 2IG2H 2J3SA 3BSZA 2H8PB 3IBEA 1WWWX 3C09B 3S3JA 4Z7OF 4Y88A 1A7BA 2WXOA 2P46B 3AUWB 3WY2A 2EECA 3MKGA 1N2RA 3B9KA 5EF1A 3ZO0A 4UQ3A 4ZOAA 1C5DA 4E9QA 2JIXA 4YDKL 2XPZA 2FBJH 3FB8A 3FRUB 4Q6IA 1BFTA 4X7DC 2EC9U 4JLRA 2PW2B 3D39B 1W8EA 2AVFA 2X89A 4LEEA 4V1DE 1HWWA 1OD9A 3BAEL 4ELDA 4JO4L 4OF7A 3DX9A 5L9DL 1CF8H 3TIEA 1NMAH 1JGDB 5ID1B 4OSUH 3GRBA 1DQIA 2F7QA 3BP4B 2VDOH 2VDKL 5BS0B 3WTXA 1JPFB 3ABMB 1YO4A 2CNYA 3F12B 3ARED 4UV7L 2HFGL 3EGSB 1I8MA 3SQOH 1AD9B 4P2YA 5T5FH 3FQTB 2ZF8A 3MJ9L 1QLFA 3RI5F 3UJTL 4AW7A 4HOZA 1K8IA 3V4VL 2ENPA 5JHLA 3NCEB 1A6TA 3JWOC 3UTOA 3KR3H 1W0VA 1ETZB 1JXFA 1N10A 1D7CA 1CO1A 1JOIA 4MSWB 2MOVA 2PTTB 5FC9A 3DDGA 3KHOA 2AJZB 2K45A 1I9RH 2KLRA 3CFBA 1T7YA 3S36H 4HH9A 4MNQD 2WYTA 3P11L 4AIZB 3ECQA 4P5RA 3KGSA 4FG4A 1ZDSA 2DDQL 1T20A 4HWBA 1FVCA 5DVNA 4IM8A 1NBZB 3L08A 2YGQA 3MRFB 4OTXH 2YFOA 1MWAH 3STBA 5DC0A 2VLRD 3U0PA 4UB0H 1BOGB 2CIIB 5AYUL 2VRQA 1A4JA 3MRRB 5KZCD 1VFMA 5CZXC 5C0EA 2EUWA 2Y2WA 3C6LB 3KEDA 2CJSA 1RSYA 2Q76A 4PJGB 3WS6A 3HS0B 5I1HH 1SY6L 2H45A 5DJ8B 4M7KH 3RQ3A 3EJZC 2R1YB 4YSUA 2WKLA 3UTTB 1HIMH 5IVXE 1J5OH 2FIKA 1N6QH 3BUYA 4HBQA 4G7SB 1L9TA 1TTUA 2EYSB 5GZND 3WJMA 4JAMA 1BF2A 1URLA 1WWCA 2PW1A 2N59A 2XV6B 1RJYA 4XVTH 4FYQA 4I0PB 1HVXA 1XXFC 5FK9B 4HCFA 5H94A 3OPZH 5AZEL 1YYLH 5D2LA 1LK2A 3U2SA 4F9LC 3Q2NA 4I0KA 4R26L 4JQIL 3G08A 4U1SB 2AFNA 1U3NA 1NCAH 4K73A 4DGVH 4LQFL 2IDFA 1XGYH 2XKNA 3C2SA 1AI1L 3NABH 5B1JA 4R2GD 1AP2B 2KH2B 4PPTA 4XPAH 4JS7A 1H5BC 2W07B 3IMBA 4MWFA 4OLYL 1RFDL 1FFQA 4OZHA 1NOLA 1SXNA 5DEFA 1MDAA 3KBFA 5BOJA 4HIJA 1THCA 2BVOA 4LRIA 5DS1A 5E9AA 3VI4A 4GAYA 1DVYA 3MNVB 3UG3A 1EGJA 4AYFB 3OJ2C 4MD5B 3TFKC 3QHZL 5EN3A 1DHKA 4MA3B 3IYLW 1QA9B 4N2KA 2UZXA 3QDMD 1F8TH 2DQJH 4HEPA 4A04A 4HS3B 4MXVF 4KWUA 1GZQA 4K7PX 3RWJA 2XV3A 1UM5L 4IBVA 1A3RL 4XODA 3QRFM 4PS4H 1WT5A 1N5YL 3MNWB 2NSQA 1P6AB 1U8PB 2DWSA 3GO1H 2VSCA 5AYQA 3RFZB 5IQ7H 1TCRB 5I1KL 2Z65C 4M56A 3NN8A 1DEEA 2B9BA 1URIA 3LD8C 4HHAA 4LL4A 1KJ2B 4Y5XA 1VCBC 4KK6D 4ZI8A 1A0QL 4U1IB 4HQQL 1DN2A 2HUEA 4YUEL 2LABA 4JN2B 2MMXA 3RL1B 3K2UH 5IHHA 1X5ZA 3GI9H 5CFAA 3A21A 1NSNH 4O2CA 5IJDC 1YJDC 1CPUA 2I9LA 3F6JA 1RJLB 4BKLA 5BVPH 2LHAA 4Q9RL 3VGAB 4ZPVA 4KZDL 1TTRA 4ODUB 2R2EB 2V2TA 4Q6KA 4PJ8B 1TKWA 2BRRH 1R17A 3SODB 2Y5TA 1FFOA 3SDXA 3N50A 5I1EL 4JJHA 3PREA 2AAAA 2G0LA 2WXJA 4DZBA 3NP4A 4LVHB 3X1BA 1OK8A 2DWYA 1QRKA 3DVGB 4ETYA 2NX5D 4PGZA 1AY1H 25C8L 3NSYA 1LYQA 4UOQA 3FB5B 3OG4B 2A73B 1CR9H 2R59A 4MXWL 1BBDH 4M9OA 4ZD3H 4KVCH 2XZAL 5G5DB 4UINH 1D9KD 3R0MA 5KOMC 3FYEB 1MREL 3L2NA 1F90L 1USZA 3P30H 2R29H 4RBPH 1WGVA 2XJKA 1IBZA 4FP8L 4M1GH 1H3GA 4O5LH 1WAAA 4EIBA 1PQZB 5ES4B 3X17A 2C9VA 1S9VA 1YEJH 3MX0B 1CXEA 3WTVA 2EIJB 2CJTA 4UBDC 5K9OA 3GDCA 4PV9A 4TSBL 5CUSH 3MCYA 4ALAL 5CP3A 4PUBH 3UG4A 3VFOB 3C6EA 4LDEB 4I9WD 5H8DA 3VXUD 4G70B 1TZGH 1TJIH 4PB0L 5FYLH 3PP4H 2FH8A 1QYGH 2GJ6E 2ADIB 1NBYB 2NY3D 1UFUA 5F0MB 3FQRA 43CAB 4RMBA 1XDTT 5B21A 4C8XA 1HL8A 1UM6L 2MH4A 3OWEA 4NQDE 4PJFB 3LB6C 2ZOUA 4TNWK 2R69A 4GRLB 1O5PA 2EEFA 1YEGH 2CBQA 2EDRA 3HAEB 4FFZL 3CDGB 3WGVB 4WDIB 1JZ3A 4AM0Q 5CJQH 5K93A 4A1RA 2AJVL 2G5BA 4RFNB 4X8XA 2YRPA 2BOBB 4P5TB 5BW7C 1DBBL 5DJCA 1CDIA 3BKJH 4ERSL 1KXQA 1OAZL 2V7NA 1FZKA 4JQXC 4A7VA 4BGLA 5D7SH 1F56A 1OSZB 2X1WL 2PPEA 4M7LL 3TT3H 3QYCA 4ODTL 2OMVB 1U30A 2R23A 2ZOLA 2X1XR 1HI6B 1XMWA 3OL2A 4BDVB 5F9OL 1U2YA 1EEYB 2DZEA 4KOCA 3K81A 2ITEA 1ZK5A 4ZUTB 5HGAB 1NUFA 1NEZA 2IV9A 5IWLC 5DURD 4KMTL 4X6CB 1GYAA 1R5VB 3EGDB 3WKPA 3D0AA 1E5BA 1PY4A 4TNEA 4R83A 1NFIA 3ATEA 3O6FD 4BFGA 4GSDH 2Z64C 3R1GH 5DGRA 3T6VA 1I8IB 1CFMA 3D12B 1IKFH 4HXBH 1MXGA 5JPMB 5CEXB 4MJIE 1LWRA 4FNRA 3BCDA 4ODSH 1SYSA 1K4CA 2ZUXA 3NIGF 4XBEH 5ESAB 2ZNXA 2Q7NA 5D4QA 3GBMH 5T1KB 2BSED 3O6ML 2FHFA 5BQ7B 5BJTB 1A7PL 3HI6L 4X0NA 4RWYL 5D71H 4GUCA 2YD8A 3QIWB 1P9MA 4RMSA 3L3DA 3VB8A 5TJWK 3FH7A 1FSKC 1KELL 1T83C 4UZUA 3HG0A 1XX9C 1BJ1H 3HI5H 3LN5A 4W70A 2DBLL 1MG3C 4NB7A 5CBAB 2IFFL 3GJEA 4Z7QB 1UGNA 2CCVA 3CX5J 2N7SA 4PWIA 3RPIA 3SSGA 1FGVL 1GOFA 5I15L 1CS6A 1AQDB 4ZMQA 3S88H 3O3AB 1JUFB 1GGBL 1IL1B 4J4PD 5CCKL 4I18B 5HYFA 3UZVB 1FPTL 4XXCA 3I2CL 1SHSA 4O02H 1MAKA 3L4XA 4X6BA 5FS5A 1B0RA 1HWHB 1RZKH 3IDNA 5HGBA 5D8JH 3QUXC 4BV1A 2H2SC 2BSBA 1A66A 2KPWA 2VYRE 5GRUL 5TK2A 4Q58C 1OPGH 1IC5L 1OPOA 2ARJQ 4TLKA 2OXHA 3MXVL 4GXVH 4JDEA 1WV7T 4OFPA 5B7MA 2V5MA 4I3GA 4DGUA 2ADGA 1I7RB 2FD6H 1RUKH 4Z0XA 4MJ6B 3S3SA 2A4CA 3BQUD 4FTVE 4UMSA 1NCCL 3MOAH 1T1WB 5GISH 3JXAA 5ABAA 4F2ME 4I2XE 1FP5A 1LD9B 1FLRH 2CHNA 5J8OA 2JCWA 1YMMA 4JRYD 1SRDA 5GS1C 3V4UH 4HUKB 1HHKB 5ILTH 5I6NA 1EQWA 2XA8H 1L7TH 5DT1H 3TBVB 1TT6A 5IJVA 3MBWB 3CVBA 5LWYL 1S7QA 3MV7D 2X4PB 2C3GA 4BSWA 3AXLB 1DJXA 1F6AA 3P69A 4OJYA 2FRGP 5IW1A 1MCDA 5E2VL 2AQQA 4NXSA 4LPTA 2IH1B 1S46A 1WWAX 1A9BB 3BPNB 4QRQA 2K8MA 5I5MA 3HC4L 2BP8B 1VRSA 1CICB 4OZ4A 3DOSB 4P57B 1BMWA 2E6QA 4U1NB 1E7UA 3LKQA 4JFDD 2WNWA 4I48B 1QASA 1NCWH 5DK0B 4UQBA 4GAGH 3IGLA 3QWOB 3EFFA 4FQ2L 4RNRA 3KJ6H 1N7ML 3HAEG 4JUTA 2DQCL 1JNHA 2CKBB 43C9A 3L3GB 2NSXA 4PD4J 2BWDA 2XDHA 2WIIA 5L7XL 1RZFH 4HFUL 3DSFL 3NESA 4J6RL 5IF0A 3UTSB 2XWDA 3BP6B 5FYKL 2WKOA 4QOKA 1H3WM 3QUKB 4UMGA 4DKAA 1DVXA 2X3AA 4WO4B 3QJQB 4XN5A 3IKCB 1A6WL 4MDJB 2QQLL 1A4KA 4RGNC 2ZYRA 5AW2B 4EDWL 5I8CA 2EAEA 4WIQA 3K6OA 2K0RA 2X4RB 3NIFE 4N6QA 4OKVB 1XL6A 2WO2B 4LP4A 5E94A 3B2PA 1IM3B 2FEJA 2IH3B 3TN0D 3F58L 2WTRB 3IFLL 2I60L 1U93A 4H4NA 4NQVB 3HHSA 5C08B 2XWBA 2IWGA 3PPEA 1YPZE 1CK0H 3GMQA 3QIBA 3QPQD 2AK4A 1ILSA 2X9YA 5C0GB 1FH5H 1I7ZB 4OIIH 1QI5A 2YUVA 4FZEL 5LGKA 1OB1B 4PG9B 4TYUA 2E7LA 3HC0A 5BO0D 3KXFD 4NFDA 5AUMB 5KVEH 4LLYB 3CQQA 1XF3B 1OOAA 2GIMA 2J21A 2W9EL 3DHUA 1F5WA 2C3VA 2XN0A 1FAKT 3HUJE 5IK3B 3TIDA 3KPPB 2YD1A 5DHYB 2BSRB 4AXWB 1J5CA 1CDHA 2GC4C 5DJDA 2Y1VA 4PLJC 3IFPA 4A68A 4H1LB 4DN4L 4CVXB 3CTTA 4DAGL 5KBPA 3DMMD 3EFOB 1SYVB 2WZ5A 3MRBB 4TUJB 2H6PB 5TF1H 4L0YA 5C3LD 4W9ZA 4OKDA 4U1KB 4W4OC 4I1RA 1PDKB 1RJCA 2D31B 4AH2B 2FEDD 1FNSL 3K4DA 4ORGB 3MJ8B 4K7PY 5C0NC 1SQ2N 3PXLA 3MOQA 4OJAA 4QRUB 1HJCA 5KBLA 1NGZB 3DYOA 1OAQH 4Y4KC 4W1TA 5EO1B 3ROLB 1TFPA 2JI3A 2ETWA 1ZT4B 3TA3C 5GGQL 2EADA 5EF0A 4F7TA 1Q0XL 4E41D 4GG6A 4MQSB 1UZ6F 2D3JA 2F1EA 4ICWA 1KEGH 1V3KA 3QR0A 4KTDH 5FYJH 4CGTA 2VZ3A 3H53A 1KIUB 4TVUA 5C07D 3RNQB 3BFWA 5BV7L 5IP4A 2VM3A 4ONHA 4OT1H 3IS1X 3FFDB 5EWIH 2VDMB 1DEDA 1PIGA 2I7SA 3MFGB 4MJ5B 3CSYB 5GGVL 1UM4L 2J20A 3DPBB 5F3BA 3KPQB 3L9EA 4JPIA 2NZIA 3CMGA 4MAYA 1FWXA 2R2BB 4ANVA 1QW9A 3SDAD 4E68A 3AY4A 4KDVA 3VFSB 3WN6A 2OMWA 1MHEA 4GYBA 4M3HA 4TLSA 4DVRH 1KB5H 2A77H 1RXLA 4FI8A 4QRRA 1VFBB 3CXDL 5G4OA 4H0IA 2WXRA 2Z92A 3GGWA 3B34A 1CFNB 4YWGH 3DUHA 3DKHA 1KBWA 2B14A 3Q0HA 1BQLL 3VD1A 1BP3B 5EIVA 1ZKAA 2DPKA 1LP9E 1DQLH 2H0JA 4P3CH 5K39B 1JVOA 3N1PC 4P49A 4RWHA 5D96B 1OP4A 4WTQA 5GJSH 2PF6A 3AG2B 1FA4A 2D0GA 5CXPA 2I25N 3FNKA 1FBIH 4F9PC 3QUML 5LVEA 1VADB 2HLFC 5HHVL 3CZNA 3R4RA 2Z31B 1DBAL 3BIBX 2ZSWB 5EUOB 3HBPA 1XZ0A 1OCCB 2Y24A 5T3XE 4PIBA 2N7BA 1QI4A 2FZ3A 5DJ0A 3UYPB 3QCTL 3THMH 2UV3A 3VU1A 2BX5A 4NP4L 3MRQA 3V8CA 4X5WB 4UAOB 1J0JA 4BXSV 2ZCHL 5HVFB 1SOQA 4GW1A 5CD3A 3WNJA 1SPDA 4HPOH 4FLSA 2BNQA 4OI8A 1NUGA 1KWKA 4FZ8L 1IV8A 4GBXA 3SDDB 1EZLA 4AT6B 3BP7B 3RWGA 4PLOB 1FIGL 2YRLA 3OXRB 2FGWH 5EG6C 3LPOA 5A2CA 3W11C 2YLHA 2CUAA 3QA3A 4JM2B 1KIQB 1FRGL 2IDCA 3TO2A 3TURA 1E4KA 4QGYA 4P59H 2A4ZA 2G3ZA 2OL3L 4TLUA 3ARDB 3LJ3A 1FYTD 2VITA 3HMXL 3AXHA 2VM4A 3QH3A 3HW7A 3GM8A 4PJ9A 1UT2A 1H8LA 2YPLA 3E6HB 3HKFA 1XEDA 2D7MA 3V0WH 3U6XA 4FI7A 2YOAA 2BVYA 1P5UC 1CFTB 4F92B 5DD3H 4GKZB 1LO3L 3CFKB 3PL6B 2CRMA 4BUQA 3MCKB 2UWEE 4D0DA 1Z3GL 3PHAA 1SJHA 3QG7H 3ZTNH 4U1HA 4H1LG 5FHBL 3MREB 2E7MA 4TQIA 1HEHC 2NXYB 1HZHL 4P4KA 4MCYA 4KKCC 1N0LB 3CFMA 3CN3A 4MA8L 1UENA 2IQAA 4PJHA 1FQ9C 4CBPA 4PBVC 4KKBD 4U3SB 5E6UB 5K9KA 2NY1C 5DRXA 5J6GB 3GEWB 1E8YA 3VDBA 1OAXH 1U42A 3DNKA 3OSVA 2PYEE 3NZHH 3GRWA 3JWDL 3HNSH 1F86A 1HZLA 3CVIL 4PRDA 4OV5A 1MCBA 5F9WB 4CADA 1EO8L 4PRHD 1S9XA 4QAWA 4AE0A 1NCHA 2YD6A 4PJ5E 3LTVA 2YMXH 1CBVH 2EDDA 3BO8B 2W9DH 3UPAA 1K8DB 5DS8B 3FO9A 1TFHA 4M5ZL 3K1DA 4TVPL 4JVPA 2HRPL 5BVJA 1C7SA 4MMXA 4WW2F 2D8KA 4FFTA 5AOKA 3QJUB 3S97C 3O45B 2VERA 2CPUA 3KGTA 4IKIA 4YDJA 2W60B 5DR5L 3HPLB 3AG1B 1IC0A 3U0WL 4L1DA 4A7GF 5J12C 5HHPA 3DTUB 1E4HA 4CW1A 3BP5A 2F8XC 1G94A 4D0CB 3SKJL 3TZVC 5J1AA 2BVPA 5FUOH 1U8LB 4UQAA 1NC4A 2QGBA 4D9LL 4ODVH 4G1EA 2WQ8A 2JK5A 3PHQB 1Q4NX 3U25A 4MNGB 1N19A 4Z7VB 3H56A 3K6DA 4PJBA 1M7XA 3SO3B 4ZO9A 4BZ2A 3VYOA 2E0PA 3B8YA 4L5FE 1JFQL 4LHJB 3TNNA 4HISA 5EFIA 4XO3A 3SDCC 2WGXA 3W81A 4G8GD 1QLEB 3W57A 4NAJA 1LGVA 1Q9KA 3FB7A 5D93B 1HH6A 5IVXF 5MERB 1OAYL 2E4TA 1IAIM 4LE8A 4N0YL 1MCCA 1XCXA 3FL7A 3FFCA 1S9WB 2GSIB 2W95A 3IDUA 4OFYA 4XNUL 5F88A 3WCYA 5L2KE 4G3YH 3U6RB 2VLJD 3K74B 4WTZA 1AGDB 4XX1E 4JE4B 5TE4L 2V3EA 5ISZA 1IGIH 1MFAH 5SWSD 4X7SH 1TZOA 5GRVK 3H9ZA 1AXSB 1NIAA 1BVKB 1BXXA 5I1GH 3BWUC 4KZEL 2XQ0A 3MLZH 5E8NB 3U2IA 1QSEA 3DVNA 4U6HA 3SCMA 3D25A 4QRAA 3FTXA 4FI6A 5K5YA 3K6SB 4Z1PA 4GPVA 4KROC 3VGBA 2VABB 3MOBL 5TH2B 3D30A 3U1SH 3WE6B 3Q44A 4I9XA 1B4JH 3BVVA 4U4IA 4Z7WA 1NBVH 5MENE 3QHFL 3C5SA 3HBZA 4PWFA 2MQ0A 3VG9B 4EMZA 3H6AA 1X7QA 3HG1E 2WZAA 3N91A 4KO7A 3KPNA 3NJLA 4PRIE 3L3OA 2FJGB 4K2UL 4L4TD 2A3TA 5E08H 2BNRB 3B56A 3REVB 1QABA 2O61B 4JFWA 1JPSH 3CFEA 4FQCH 2WWMD 1YMHA 3B7SA 3US0A 1SJVA 1FZMA 1ZA3B 2WLHA 2CDEA 1XCTB 4KZ0A 5F9JA 5IKCA 1ZXQA 2ZKXA 1ONQB 4G72B 3JV4A 3DVFA 4PCSA 3ENEA 3BH8B 1NINA 2OZ4H 4FHBD 4QHLA 4F57H 3NCMA 4U6YB 3ARBC 3DJRA 4WNQA 3OKOB 1YNKH 2B4CH 1D5ZB 4GB9A 4PJAB 1TSHA 1E9PB 3U36B 2APBA 4JNXA 5JDSA 2IOIA 5IMOB 3O11A 3RY6C 1WK0A 1DBKL 5HYJB 3PDOA 1TO5A 3QQXA 1LEGB 4IOIB 4J3XA 3NCJH 5J1TC 3MRPB 3D0LA 4F8QA 3KPSA 4HKBB 2X40A 4QJ4B 2CRIA 4TPRH 2BVQB 1R24A 1TJGH 3K80A 4NT6A 2XZCH 2VZTA 3KAAA 4PJXE 4XVSH 5IT2L 4JR9H 5I6KA 2MTPA 3Q5TA 4OZIE 3PAVA 4N8CH 1HQ4A 5AFAA 1AR1D 3UPRB 2FSDA 3LN4B 4H8WL 1JCVA 4MTMA 3SKNB 2ZE0A 4K7PH 2GABA 1CCZA 2VIRA 3IFNH 2AABH 1MI5A 4KI5C 1AZCA 1AGBA 1W0YT 2J1ZA 1UUNA 4A2FA 3W5MA 2AEIT 4WFGE 4V1DB 1S5IH 5KSAD 2TSBA 2BS71 4K3JL 2WVTA 4IRJD 3WIFA 2HX8A 1ZLWK 3CPUA 4BK4A 2ZAGA 3P40A 4TMPA 1U8KB 4CC4A 1V7ML 1V3MA 4X8GA 3QEHA 3BKCH 1AHKA 4NZRH 3G6JE 2C9AA 2AK1H 4AENA 3CFCH 4EN3D 1EEQA 1R3HB 4WW1A 3KW7A 4NQCE 3VFNB 1FHGA 3F7VA 5IR1A 3S5ZA 1P4IH 1UCTA 2ALWA 3BSZH 3L3IB 5F1NB 3MZTA 2A6KA 4WGWB 4RESB 3BEWB 3F2LA 1NDGA 5AENA 3ETTA 3T0EA 2WN2A 5EZOL 3RFRA 1I9JL 4HV8B 4OGQC 4DW2H 1SHMA 4LFHG 2B15A 4UIMA 2YEQA 3ULSB 3TBSA 4OIBA 4MRBA 1DLFH 1S7SB 5DFWH 2OYLA 2VN3A 3UGUA 2EEDA 3KLSA 4W9CC 3BXNA 5TFSL 3RTQD 3S5LB 1LE9A 4LLDA 2KLTA 1JRHI 3DJ9A 2P8PB 2GPZA 3FCUB 4RMUA 1FL6B 3NFNA 1V8HA 1L9QA 3SE4C 5D9SA 1K2DA 1AG6A 3WMSA 2HFFB 2UUDH 1KDIA 1NFAA 4P8QA 2VLRA 1YHPA 4MD4B 2GJRA 2DQGL 1F97A 4XRCA 4YEEA 3W9DB 4JFSA 4ZMYA 4M6NH 4ZW8A 2NUPB