2GB2A

The p52g mutant of amicyanin in the cu(ii) state.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMGHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Site-Directed Mutagenesis of Proline 52 To Glycine in Amicyanin Converts a True Electron Transfer Reaction into One that Is Conformationally Gated.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gb2A00
1M56B 5ANHA 3CDZA 3G5WA 4YSSA 2CAKA 3NJMA 3PXLA 5I6OA 4DP8X 1AZCA 1DYZA 4TXVB 3ABLB 1SFHA 3FQYA 1CUOA 1OE1A 1PF3A 3WG7B 3L45A 5D4JA 3FU7A 1L9OA 1PNCA 3NSDA 2XWZA 3CDZB 4A2EA 3FU9A 3X1NA 4KOCA 3EH5B 1NIBA 2IWEA 1J9QA 1NIEA 1MG3C 3NP4A 4YSRA 4BWUA 2YQBA 3AG2B 1AR1B 4A2DA 4ENZA 5AZUA 4JKNA 3FU7B 2Y69B 4Q8BA 1MG2C 3FT0A 2HZHA 4DP9X 1ILSA 3AZUA 3SBRA 2BZCA 4YSQA 2YAMA 1QLEB 4BK5C 1PLBA 4NAJA 5D4IA 1SJMA 3X1FA 1F56A 1AZBA 4GYBA 5B7FA 3TASA 4G7SB 5I26A 4DP1X 1PY0A 4FAAB 3NP3A 1E67A 4L0PB 2UXGA 2YXWA 4AKQA 1WS7A 2DWSA 2PPEA 3EH3B 3BQVA 3NJIA 1NIFA 1OF0A 1NWOA 2Y1AA 3OMAB 4YSOA 1GY2A 6PCYA 2N0MA 1BQ5A 1ZIAA 5B1AB 1JXFA 1CYXA 1GR7A 2VMJA 1ASQA 1NPJA 1A8ZA 3PAUA 3EHBB 1OE2A 1HAUA 5E9NA 4KOBA 2YXVA 3JT2A 3FYEB 3S3BB 1SHXA 1KCBA 2YAQA 2Q5BA 2UXFA 3ASNB 3FU8A 2XXGA 3AG1B 1PLCA 1IUZA 1GS8A 3UAAA 3HB3B 2YAFA 1BQRA 4E9XA 3ZIYA 4K9JA 2XV3A 1V55B 2DY2A 1JZJA 2YAPA 1GS7A 3ABMB 4AKOA 4GP8B 5TK4A 2EIJB 2X87A 2ZOOA 2P80A 3ERXA 2DYRB 2I7SA 4M3HA 1J9RA 1X9UA 3S8GB 3UGEA 4E9RA 5FC9A 1WA0X 1RZPA 5F7AA 3FPXA 1XB6A 2BWIA 3IE9A 2ZXWB 4JHUA 3AG3B 4HCGA 3NJLA 4E9WA 4UF7C 2TSBA 1AG6A 3QPKA 3NYKA 3IBOA 3V9CA 1J9SA 4YL4A 2VSKB 3FSWA 9PCYA 1ZV2A 1A4BA 4P5SA 1IKOP 3SQRA 4DP6X 3GDCA 1MZZA 3DKHA 3CZUB 4Q89A 1PZAA 1TKWA 1A4AA 1EHKB 2VW4A 4E9TA 2XV0A 2FT8A 2AZAA 2BO0A 4AKPA 3H56A 4MFHA 1AQ8A 2H3XC 2XLLA 3NJFA 2CBPA 1WA1X 1L9SA 2VSMB 2XX0A 8PAZA 5B1JA 4A2FA 1CYWA 3H4HA 1L9TA 1NIDA 1BYOA 5D4HA 2I85A 1A3ZA 3HEIB 4E9YA 5I6KA 1BEXA 2IAAC 5PAZA 3WIAA 2HRGA 3QJRB 2B08A 1ET5A 2XX1A 5TK2A 2GI0A 4YVUA 1PNDA 2XYBA 3AY2A 1ZDSA 2YAEA 2PCYA 2J5WA 3OMIB 2CUAA 2GSMB 2XU9A 4BXSV 5AKRA 5B1JC 1PLAA 3UABA 1L9PA 2PP7A 2WO2B 5IY5B 4E9VA 2Q9OA 2MRYA 1CURA 1E5ZA 4AX3A 5B7EA 3QJQB 1TU2A 2VW6A 5LDUA 4A2GA 1QNIA 3T6VA 3QJSB 2JXMA 3TBCA 1NIAA 4CSPA 4KO6A 1KV7A 3NJJA 4G70B 4X4KA 3EH4B 1SHWA 4KNUA 4A68A 2OV0A 3IN2A 2PP8A 4UANA 2YARA 1ETJA 3RYMA 4GP4B 2BP0A 1E30A 1YLBB 1VLXA 2QT6A 1JVLA 2CCWA 1J5CA 4YSPA 1AANA 1JXDA 2R7EA 3SBQA 5B1BB 1HAWA 2PPAA 2PCFA 4GXFA 2FT7A 2X88A 3U25A 1GY1A 1OE3A 2BP0B 4KNTA 4G71B 1E5YA 3UADA 1AIZA 1WAEA 1L9RA 5I6LA 4G72B 1ID2A 2R7EB 6PAZA 2IH9A 1SDDA 3WNJA 4KO5A 4HHWA 5F7BA 1XB3A 3FS9A 1OOWA 4N4YB 2EINB 2J56A 5I6NA 2BW5A 4QKTA 4A67A 5A7EA 4BWTA 2AVFA 2FQEA 2QDVA 2WSDA 3CG8A 2B3IA 5B3SB 2OCCB 1V54B 2LLNA 4DPBX 3IN0A 1OV8A 2IDFA 1SDDB 5I6PA 2FQFA 4G7QB 4N8UA 3ASOB 1AG0A 5EHFA 5I5MA 2GC4C 3OM3B 5I5IA 1QHQA 1DZ0A 2XVBA 1PCSA 3CVCA 3D12B 3NSFA 4HHGA 1RZQA 3T71A 3V9EA 1OCCB 2DWTA 3QJVB 4E9SA 2IH8A 1AZNA 2RACA 1M9WA 1J9TA 1AAJA 1MDAA 1BXVA 2ZONA 4AI7A 3N2JA 3T9WA 2HX8A 3EF4A 2AFNA 4WTQA 2IDUA 2J55A 1IBYA 4NERA 4KO7A 1A4CA 5B7MA 3AW5A 1KDJA 4PAZA 1B3IA 1V10A 1BXUA 3NT0A 3PAZA 3S8FB 1ASPA 1M57B 1KGYE 3WNIA 4AZUA 2A3TA 1JOIA 2DV6A 1ET7A 4NB7A 3ABGA 2IWKA 4GP5B 2PPDA 1BQKA 3QJTB 4DP5X 1BAWA 2TSAA 2E86A 1EZLA 3OD3A 1AS6A 2BP8A 2QDWA 4DPAX 2HXAA 3NJNA 2IDSA 5PCYA 2HLEB 4M4RB 2UXTA 2GIMA 2PP9A 3TU6A 1KCWA 3KW8A 4DP7X 2IDTA 3NJKA 2H5UA 1KDIA 5I28A 5B1KA 2XV2A 2YAHA 4HCFA 2EILB 3WKQA 1RCYA 3KW7A 4QLWA 2BZ7A 2PPFA 1J5DA 3MBWB 1TEGA 7PCYA 4CSZA 4F2EA 2FQDA 3ZDWA 1PAZA 4DP2X 2W88A 2BHFA 1JZEA 4G7RB 4BDVA 4DP4X 1NINA 3MX0B 2JFCA 1BYPA 3WKPA 2BWDA 2CJ3A 1OCZB 4HALA 2UX7A 1GYCA 1WS8A 1AACA 1I53A 3BVDB 3FSZA 1XB8A 3C75A 2I7OA 1TEFA 3JTBA 1PZCA 2QPDB 2UX6A 4JHVA 3NJGA 4P5RA 4BDVB 2GB2A 4GY4A 3FSAA 4E9QA 1HFUA 2VM4A 1ASOA 3TA4D 1ILUA 1JZHA 1PZBA 3AG4B 2DYSB 1MZYA 2NRDA 1CC3A 1ZIBA 1KYAA 2JKWA 3PAVA 1XMEB 1RKRA 3SBPA 1ET8A 4HIPA 2ZWNA 3WI9A 3ZX1A 2GHZA 1AZUA 3ABKB 3GXUB 1AS7A 1E65A 4FA7B 2XUWA 3DIVA 2UXVA 3TBBA 1AOZA 3X1EA 3ZBMA 2GBAA 4DPCX 2IWFA 2FT6A 4YSCA 1OCOB 4YVNA 1SNRA 1GS6X 2HRHA 2VW7A 5I5JA 1ZPUA 1JZIA 4HZ1A 1FWXA 2W8CA 1OCRB 2PPCA 2BW4A 3NJHA 2FJSA 4W1TA 1NZRA 3OMNB 2EIMB 1W6LA 1KBWA 3QQXA 2FTAA 1A65A 1NDTA 1URIA 4YSUA 2OJ1A 3PPSA 1GSKA 1SF5A 1FFTB 2XXFA 3IEAA 4YSTA 1NTDA 3NSCA 1NWPA 4PCYA 3H4FA 2FNWA 1BXAA 2FQGA 1JZGA 5I6MA 1JVOA 1W8EA 3FQ1A 2VM3A 3UACA 4UAHA 1N70A 4BWWA 3FPYA 3S3DB 3T6WA 3X1BA 2AZUA 1NPNA 2P80D 1N68A 4RH4A 3S3CB 4W9ZA 3T6ZA 3T6XA 2H47C 3NSYA 1T5KA 1NICA 1ADWA 2MTAA 2YAOA 1SFDA 3FYIB 3OQRA 1ZDQA 4F7KA 4WKXA 2GC7C 2HX7A 1AZRA 4ZK8A 4YSAA 1FA4A 4KO9A 3PLYA 4YSEA 2PLTA 1L9QA 3PCYA 1JZFA 3CVBA 3X2QB 1AS8A 5AFAA 4YSDA 2QPEB 3GYRA 4EF3A 4BXVA 2WO3B 4HAKA 2VN3A 1SF3A 1UATA 4DP0X 1GW0A 3DTUB 3N55A 3QJUB 4F2FA 2EIKB 2CALA 4A2HA 1IC0A 3UAEA 3FSVA 2FWLB 1PMYA 1WA2X 3X1GA 7PAZA 2BP8B 1JERA 1KBVA 2J57A 1R1CA 1W6WA 3FQ2A 1X9RA 4KNSA 4HCIA 3CVDA 1JXGA 1IBZA 2IDQA 2AANA 2HX9A 4A66A
chains in the Genus database with same CATH superfamily
4N2GA 4DZ8A 1TZOA 2IBBA 2BCKB 3JWDH 3KLAA 3AT8A 1VF5C 4LKCB 1MSPA 2B1OA 2WOBA 3MREA 1AD0A 5JHLH 1BHGA 2AEQL 2AV7A 3EG9B 3ZHNA 3VXSB 1MHPH 3VRJA 5LCVH 3QQNA 5I75C 1U0QA 1B4JL 2AV1B 3S8WA 1I8MA 1FN4A 5I16A 5DTFA 5IMMB 3PWPB 4PJ5E 3V6OC 4U6XB 3F7KA 5FUOL 3HCVA 2KS0A 5FYKD 3GRGA 4XN4A 2Z31A 1ZLVH 4WIQA 4K9EC 4IBYA 2Y7OA 4FNUA 5TJWK 5C71A 4R2GC 3AG2B 1HOCA 3QDJD 2H3KA 3ARSA 4LEXH 1N6QH 1KPUB 2VMEA 2X3CA 5BRZB 4NHCH 3MLRH 1Q9KA 2PO6A 4NZFA 2GABA 1U9KA 5DMKB 4F8QA 5HDWA 4HWNA 1OGPA 4J5VA 2E74C 4DJMA 3TH4T 2Z31C 3GBMH 4ORGA 1UWFA 5L7XH 1A9EA 3CN3A 4B9GA 4MQ7B 1AZBA 1VGKB 4QNPF 3GTNA 1IKFL 1KJMB 2XXCB 4XH2A 5FYKH 1TJMA 5CKAA 1G1OA 1G6RB 3VFUA 3II1A 4PRAA 3U4BL 3N40P 5BVPL 3SPVA 4OLYL 1UWXK 1OAYL 1X5YA 1KIRA 3QNXA 2VR5A 5T1DL 3FMGH 3RX7A 3VI3B 5J9PB 1CVSC 3MVSA 1M53A 5AW7B 3EJYD 3OMAB 2VE6A 4NIKB 4YSOA 1YAIA 2K4AA 1U91A 2X4NB 5F9OH 4U6YA 3D0AA 2EXWC 2DBJA 3BAEL 1AD9B 2P45B 3SOTA 3SYCA 5CGBA 1OGAB 5BQ7B 3IMVA 4JN2A 2A9NH 4NFBA 1O75A 2P47B 1E4XL 1T1ZA 5E9NA 3MYJB 2YXVA 4FXTA 5I1CL 4ELMB 1LYQA 3RWEA 1WUZA 3ROLB 3GK8L 3FRPA 1QP1A 1QEWA 3INOA 4Y2OA 4CRPA 3ARGB 1MFEH 1F3DJ 2ED8A 3DNKA 1IUZA 2X40A 1EDQA 3IPFA 3NZ8B 3F5WA 4K2UH 4X7FC 3FRUB 1PJWA 1ZJAA 1IQWL 1Q9LB 2FSEB 4PJAA 3PABB 2FDBP 2JB6B 2K7QA 1SOXA 4JRLA 3W37A 3P4NA 3RA7L 4GP8B 4KDVA 5FYJE 4IRSB 1S7RA 2ED9A 3DXAD 1EGJL 4BV1A 3GI9L 4LXFA 1X9UA 4XOCA 5KVFL 3TT1L 3DWTA 2AQRA 4WJ5A 1WA0X 1RZPA 5ERWA 2J88L 4KI1A 2VQUA 5KW9H 2BWIA 1IZKA 4OU3A 4IBVA 2HH0H 3B34A 3OKNA 5J1SC 4GINA 2TSBA 2ITDB 3IBOA 1CE6A 2VSKB 1WUNT 2P5WA 2R4SL 5F7MC 9PCYA 5CINL 2KLTA 1ACZA 1J5HA 3F6LA 1WH0A 4MA1C 3DRQA 3L81A 1T7ZA 3T1WA 3S5LB 3LV3B 4PJFE 3MJ7B 4ZFGH 4EOWL 4ZDHA 2W9DH 1F58L 3WXVL 1WIPA 3Q8AA 5IB1A 4Z7VA 1MFUA 1ZK5A 1YY8B 2ARWA 2CBPA 4YQXH 1AP2B 3QEUB 3RI5F 1E3XA 1KLUB 1S7WA 5IBLC 5CU5A 5C08D 2H6PB 4G80A 4XB3A 1A4KA 1J1OH 3DROB 2D9CA 3MRKB 4YHOH 2EZ0D 1OXYA 1EZVY 1NBZA 1NFDE 2VIRB 4FQQB 3CVIL 3MV9E 4N28A 3PIQA 3IDIB 3RIAF 4U6HB 3CZLA 3N91A 1XQ4A 1JN6A 2OMNA 1F90L 1MCCA 1T7VA 4Y1AB 2J5WA 3VXNB 1CS6A 5C0FB 2YN5A 1QRND 5DJDA 1L9PA 1UM4H 2UZIH 5A6LA 3C5SA 1Z6JT 5EORL 1D5ZA 4X4ZA 5D1QC 4YUEH 1A5FL 4AW7A 1K2DA 4G9DA 2PUQT 1CBJA 1T3FB 1H15B 4HIXH 2EE0A 4IKLA 3GXTA 5EBMB 1CGVA 4XPBL 3KDMB 4X9HA 5F89B 2X2JA 1T04B 3BUDA 4QY8B 4M7KL 2R56H 1TTGA 3PP3H 4Y5YA 1EFXD 4HW6A 5JW4Q 3KG5A 1UWXH 2ZCKH 3D25A 3DUUA 4A2LA 5EF3A 3FHAA 5C0BB 3L48A 1FG2A 4GP4B 1MQ8A 3U36A 2FWOA 4M29A 4AM0A 1X6LA 1NAML 2CR3A 4FG4A 4MJ4A 1T1WA 5FDYA 4BQCA 4JO3H 3TTSA 2UZXA 5EOQH 4JG0H 2ATKB 2HJFB 3HZMB 1SDYA 4XBPA 1I9JH 2DM4A 4M7JH 3L1GA 2PPAA 2WJ7A 2I60L 4J7RA 5E0QA 3TX4A 4Y5YC 3VU1A 4YDJB 2SEBA 5CJBA 4APQC 5AOZA 4B3EA 4NC1C 5C6WH 3RIFK 2IXQB 4IIZA 4WV1A 4PWFA 4XWOC 3FB5B 5EZOL 1OTSD 2B77A 2HMIC 2J2ZA 5D1ZA 3KPTA 4KTDH 5EO0B 2WLHA 4G3YH 3Q43A 3WFDL 1ID2A 4IRJB 5DR5H 3QNZB 3RB7A 2J43A 2NUPB 1U3ZA 4DTGH 1HC1A 3V6FB 2IEPA 3SBWC 3VQLA 4IJ3C 2YO3A 1XF1A 1NCUA 2IPTL 4XP4H 2UZPA 5I73B 3MSPA 1U6AH 1CFSA 2X7LA 3VFVB 4X99A 2DQEH 4WV1C 5AEAA 2MTPA 1C16B 5IOPB 5CIPA 4NI3A 3Q1SL 1LE9B 4PQXA 2WSDA 2ZQKA 2DQHH 4Z1PA 5B3SB 4CJ1A 4RAUA 5CZKA 1O7SA 3O2DH 2MWCA 3LPPA 1JPSL 2EDEA 2AITA 2IDFA 3F8UB 3H0TA 2WXLA 2UVEA 3ARWA 1KYOK 1YN6A 1UA6H 4WEMB 1BIIA 2ZKYA 2KPNA 5DUPH 5JOFA 1SEBB 5L8KB 3E6HB 3MLWL 1T20B 1DZ0A 2GK0B 1S78D 1A3RH 5D5MB 4BA8A 4LLWA 4MXWH 4NRXA 2H0EA 2ZONA 1IC5L 5CJQL 4M03A 3OGCA 1Q72H 3AW5A 2JQAA 2E76C 4PJHB 1XFPA 2XQYA 3PDOB 3AFLA 4DN4L 1AGFA 2FEEI 3NAAH 3ZT5A 5DF0A 4DKAA 1RK0B 3WMSA 4IK6A 5GPRA 1ET7A 2DM2A 3UO1L 4GP5B 2DI7A 5A43C 1KCVH 3MTRA 1YCSA 3PNWB 5D7JC 1PD0A 3ZQWA 1YUHB 5K39B 5HHPA 1OARH 2GAZA 3HR6A 1BD2A 5DK0A 4QXTB 4H40A 3W56A 3SPCA 3BAIA 5C09A 2I9TB 4H20H 3GJFB 4DETA 1UWGL 2TRHA 1FL6B 1S2EA 1HI6B 4JPWL 2DWEB 4OR1A 1QTYT 3AXLA 1U41A 1E90A 5HDBB 4HDIB 3EYQC 1KTDA 1PKOA 2IDTA 4EAEA 3CMGA 3T77B 2C1PA 3HFFA 1X9QA 5FM5M 1FZMB 1QO3A 3PDDA 3GRWL 3B5HA 4EI5D 4JVUA 5FW7A 2VZTA 1G1YA 4GAYB 4Z3FA 3RVVC 3TV3L 5J89A 5E1HB 5IT2L 2IH1A 5DK3A 1RCYA 4IS6B 5CJXA 1CFBA 1MFDL 1X5MA 2PPFA 5HI3C 1J5DA 4PFEA 3RHWK 4DIXA 2DJUA 3NFPB 3ZR6A 5GRWA 1IBFA 4HKXA 4BJLA 2RMNA 2OYMA 3V7AE 3AMLA 2UVFA 3BXNB 3QIWD 3P30H 2F68X 4O02B 1CO1A 2CJ3A 2W07A 2OYKA 1QTSA 1RUKL 3A6BH 4LK4A 2UX7A 2CIKA 4JKPL 3B9VA 3NGBC 3EOAA 1NC4A 4NQDD 3HUJA 1DVUA 4TLSA 4C58B 4DOHE 5CJXC 2UYLA 5JIHA 4UM9D 4BFBD 3SY6A 2H32B 2Q76A 3FB8B 3QUZB 4W9HC 1JMZA 3VTTA 4I18A 1F2XK 1J10A 1W0VA 1YMMB 2C7FA 4LL9A 4MJIE 3V9FA 1FO0H 4IBWA 2K6WA 2OCFD 4LLDB 1RIUL 5IQ9A 1YSOA 2NRDA 4NAMA 5EZLA 1J8HD 1H6EA 1XZWA 2E9JA 4MRCA 2P52A 2WZAA 1IO4C 4GRLD 4W4OA 1AGBA 1OGTA 3GMMA 3QR1A 2P8PA 3VI4A 2Z93A 3NUKA 3X13A 5GGRY 5C8JA 5FECA 2VDQH 4FMVA 1NAMA 2J12B 3MRFB 2VDOH 1M42A 4M00A 2OTUA 1SYVB 4L0ZA 3J2PA 3ME0B 3MLYL 5DJAB 3LNIA 5HYSB 3H9ZA 5EF2A 1KTLA 3C9NA 3PWVB 5G55A 4B7IA 5GRYA 5E2UH 5T5FH 4N2KA 3PRZA 3WY3A 4W4OC 2JMRA 1XMWA 2ZCHH 4XP9L 3TBTB 5KUKA 5A2FA 1XGQB 1ZHNA 1N19A 2X89D 1GPOH 1BDYA 4I9XA 4AH2A 1MVUB 3VACA 2VO5A 3IDXL 4JQXA 4YHYC 4ABVA 4H2AA 3T0EA 3QJOA 2EXSA 3NIDE 3BPOB 1C8PA 2ZWYA 5BPPA 5DZJA 5JHAA 1DEEB 4S0SD 1HXMA 4ICXA 4LSPL 1H0DB 2IPUG 5GGUA 2HJLA 3PU7A 4U3SA 2Y2WA 3TO4C 4F91B 1UCBH 1YECH 3HN5A 4K3EL 2AXHA 3BN3B 3FT2B 3ULUF 1A7NH 2YC1A 4BGLA 4LHUD 5I74B 1PSKH 4IOSD 1BOGB 4JZJC 5LGHL 4GSRA 4APXA 5AVYB 4KH2A 1EEZA 5D70H 3T6XA 1E6OL 3EJUA 4WI8A 4CN4A 3JT0A 3VSQA 5HDOA 5D1XB 1M7IB 1O6VA 2WLZA 5GSRB 3CIQA 1AIFA 4UT9L 4Y19E 1TSHA 3HC0A 4P2QE 1I4FB 2J5LB 1LO2L 3VWKD 2IQ9L 1VEMA 4HV8A 4ZK8A 3LN9A 3TLRA 3V4UH 3FTYA 4OZHE 2EUZA 3RGHA 1ZE3C 2X6UA 2K3TA 1JZFA 3QO0B 4HYTB 4WY7H 4YSDA 2XKNA 4Q97A 2E7HA 2ZKWA 2H3NA 1UD8A 2PYEA 3DX7A 4UOW0 4V2CB 3RE0A 3WD5L 4HAKA 5D7SL 4PI2A 3GBNL 3PHAA 3VWJD 2Z91B 1WZKA 3FSOA 5KTEL 3QORC 3VD3A 2YWYA 1P7KB 1JS4A 5AAWC 3UAEA 1MQKH 2Y6SC 3IJ7A 1INEH 1RPUA 1M71A 4RESB 1U8HB 5DHYB 3D4YA 3NCJH 3BAWA 3O9WA 2YGQA 3ILDA 3FTUA 1KPVA 2OLDA 4K94C 4H1LB 4NOFA 2A6IA 3CVDA 3HN8A 1HEZB 4DQOL 3P77A 2V9TA 2WINA 4N1EA 3G7TA 1B0IA 1R24B 3ZKXB 1JZ7A 1J8KA 3GRWA 2J25A 4FFZH 3MRMB 3W0WA 2Q8BL 2CAKA 2ICWB 3PXLA 1S9VA 3BCDA 3OKEB 5BRZD 5D9SB 3EYVB 5E6ZA 1MCQA 3ABLB 5J3HD 1DR9A 3BP7B 3LHPL 4NO2A 3FFCE 4RISH 5H37G 5H35B 5TE6H 2BNRB 3WL9A 4JREB 1UFGA 1H9VA 2XICA 3APNA 1HHIB 1RZ7H 2BY3A 1H3PH 1YC8A 5J8OA 5IVNA 3D0LB 3MYZA 3C60A 5F0MB 4MMXA 3V5HA 1OT2A 5J5EA 3SYAA 3B8SA 1MEXH 3FZUD 2VXQH 2DTML 3OKDB 4UAOC 2IFFH 3FU7B 4Y9GA 3B6SB 2MOVA 5EC2B 3GIZH 5LBSH 2HZHA 4GG6B 4OT1L 1NJ9A 1J1PH 5DO2C 4BSWA 4K71C 2YAMA 3TP4A 3VQ1C 1FL3A 3MGAA 3Q44A 2CBMA 5SX5H 3TA3D 4YHZH 4PWGA 4NBXB 4OF6A 4OGAC 2CR6A 3MTXA 3FUEA 4XMLL 2JQMA 1GJIA 1RZKL 5KBKA 1VZIA 5A3IC 3O3BB 3ARTA 4JRXB 3A4AA 1G0DA 4ZTPL 2DQGL 1TQCC 1BLNA 1FZOA 3QQ3B 2DWSA 4AITA 3ULUC 3QZBA 4TNWF 3NCXA 5FHAH 4ZD3L 4A39A 3QDGE 4QJ3B 1AGDB 6FABH 4LRIA 4Q6IA 4DKDC 1W2KT 4WI2A 3QJZA 1P7BA 3EBHA 3U9UA 1S7QB 1YN7A 2EE6A 1LK2B 4UU9A 1A8ZA 3WEAA 3KPRE 1KBBA 4E0RA 2Q86A 4KQ3H 2Z9TA 1A1MA 1ZWIA 2VYRE 3B37A 1SHXA 3MA7B 4AZ8A 3WN5C 3QUKB 2O1AA 1MPAL 3GSOB 3UTQB 5FA4B 5DUBA 4N2MA 4IBUA 5T33H 1EX0A 3UTTB 3NK4A 4J4PD 1CG9A 4MAUH 1DBAH 3S7GA 3LEVL 4YPGA 1JAEA 3FL7A 1CXIA 1YPZE 4FKKA 4JW3A 1MRFL 3IRPX 3B9KD 1M7DB 1FGVL 4FNLH 4AV0A 4PJXB 4P2OC 4WUUB 4JFFB 1H9DA 5KUMA 5FYJL 5GS3A 4LVHC 2ZF9A 2YGPA 5I1AA 1CLYH 3N43B 4XMUA 4AQ1A 3SB3A 1CDIA 4HIJA 1FDLL 2FBRA 2ZXWB 1W72B 4E9WA 1YNKH 3SKNB 2DIAA 1JF5A 2KZWA 3KYKH 3P40A 1MFCH 2F74A 3QSKB 5KYWA 4NGHH 1HSAB 1L0XA 2CBOA 1LP9B 3BP4B 3S48A 3OC5A 1TYEB 4NZJA 3QDAA 5LO7A 5EUOA 1O0VA 4XX5A 1IEAA 2VABB 3BZ5A 4AQ1C 1AGCB 4CU7A 4ZUTA 1UXWB 2VDKL 1TYJA 1A4AA 1C12B 3WNLA 1F4AA 1SLVA 3QFJD 4W9JC 5JPMB 2BSTA 3NJFA 2ZWLT 1OZTG 2RGSA 4KVNL 2FAUA 5DEGA 3SGKC 3DMMC 4WTZA 2IQAA 5B21A 1NKGA 2EKJA 4NN7B 4RRPG 4KV5F 4QHUB 2WO4A 4L9LB 4R83A 5LGKA 3T8XA 4OM1H 1RZGA 2ZUXA 2D4DA 4LGSB 4YVUA 2EVIA 4UQ2A 4B96A 1YEEH 3ZE0B 2PCYA 2F8VA 3CJJA 4PJCE 1JPST 4DVBA 2XN9E 3C8KB 5IY5B 3BT2L 4JKLA 4PG9A 1CGSH 3WTTA 1Z3RA 5TDOA 2X2YA 3QJQB 5GGQL 5LUMA 4XAKE 2OMYA 4GKSA 1DQTA 4JO4H 1UQSB 2HPTA 2QQKL 4P06A 2WK2A 2X6AA 1HWHB 4PJ5A 3ZDYB 4M4PA 4NHUA 1A3LL 1BFOB 4UANA 4M5YL 4X7CC 4MRBA 1K5NB 4Z95H 3E8UL 2D7MA 5D7LE 3S3JA 4I88A 4YDZA 2N56A 2XHNA 1BM3H 3U2SA 1CGXA 5J6GB 4JHZA 2LABA 4GXFA 3GSXB 5IBUB 5HHXH 4N9GB 5DFVC 4PW3A 4UQDA 3MRBB 2ZXDA 4K3DL 3UCRA 4ZMXA 2QELA 5F7KC 5GGVH 2GY5A 4DGVL 2AK4E 3WNOA 1NDMB 4EE2A 3H7BB 4HCRL 1U92B 3MROB 1WAEA 2GK2A 5E0FA 4G72B 1NGQH 1QFPA 4JZNB 3QR0A 2D0FA 5E6UB 5FS5A 5I8CA 2X4OA 3VSTA 1SHSA 2NZ9C 2JJTA 5ACLA 3L4ZA 1RZKC 3D39E 3O3EA 2EYSB 2QDVA 4HLJA 3VD7A 3QWRD 4KAQH 5CBAB 3WIHL 5GRZA 2XTJC 2OK0L 3HE7B 4UBDC 1FPTH 5EULV 4L2LA 4ZFFB 3CQPA 1FFPB 4JCLA 1FIGL 3FUFA 4JM2C 1GTNA 4PS4L 4N90D 4YPJA 4HHGA 2NY0B 1I1AA 5SWSE 2DLTA 4HGWB 1BX2B 5F0JB 4N8CL 3D9AH 4EQ2A 3UJTL 2R29L 5IJKA 3VTMA 4M5SA 5A7BA 3U0TB 3BPNC 4WTWA 5GS1C 1R6VA 2EH8L 3OKKB 4JJHA 4PJ9D 1N59B 4Y2DD 4ERSH 5EOCH 4UQ3A 3MUGA 3UCQA 1HL4A 4PAZA 4X9GA 1K3ZA 2ARJB 2J8UE 1B2YA 1P4IH 1RP9A 2K0RA 2R2HB 1I1AC 1ASPA 2FYYB 1T5WA 3EJJX 4MA8L 4OUUB 4YLCA 3DSNA 4QNPE 1TTCA 3IJ9A 3BQUB 1DE4B 2CGRL 2VC2B 4OQTL 2IWKA 4D8PA 3GD1C 5T1LD 2PPDA 2A9BA 1FYTD 4PV9B 5HHOB 3I2CL 4GFTB 4WI5A 2TSAA 4GKNA 5I2IB 2UY7A 5LLIC 4NT6B 4JRYE 1CPUA 2TAAA 4LQFL 4MX7A 4CW1B 4G6KL 4X42A 5J57B 2ID5A 1MHHB 3GXPA 4R7NA 3GSRB 3SODB 3BUYB 3QQDA 3OR7B 5IR1A 3P0YH 4N0YL 4Z0BL 4PJFA 1MUJB 4LSVH 4ODWB 2JKNA 1MI5B 1F41A 1DLFH 2QV2A 3KW7A 2I32A 4R5TA 3UBHA 4J3OG 3SDXF 2ILLA 3CZFB 3N5AA 1OSPL 3QC5X 2W88A 4E41D 1CDGA 3BW9A 4GPVA 1QPXA 5AYUL 1NINA 3OB0H 4Q52A 1TF4A 4FEMA 4PREB 1ZT4B 3CCHA 2XBZA 4HALA 1NFDA 2DQCL 1KJ3H 2BNUA 4ILDA 5DZLA 3ZYIA 4OV5A 1BZ9B 1LK3L 2EDKA 4UNUA 1JHKH 2HKHH 2AXGA 2J1WA 4XRCB 2CO7A 3A67L 3DETD 4WDIB 2EDNA 1KULA 2O6FA 4OSUH 1URZA 3VGBA 3MRRA 1NGZA 3ILPB 4I9WD 4HJJL 3GPEA 4KKAC 3W5MA 4G5AA 1AKPA 1NGXB 1W15A 2F5AH 2X10A 4LU5H 5LG6A 4L05A 5HYJE 4OD2A 3PAVA 3EO0A 3FHQA 4DVRH 4BKLB 2GBUA 2ZUVA 3TEYA 4R6UA 2DQUH 2FYVA 3KMDA 3RVTC 5EO9A 2AP2A 1IBGL 1AOZA 4JDTH 3H9SE 1KLGA 3RNKB 2DQTH 1LO3L 2WLMA 1VFUA 2ZXEB 4XAWH 1OAQH 4DPCX 4Z7OE 1FFOB 2CK0L 5KSUA 3N6YA 1TNMA 4OCYH 2H6OA 4BFEA 1KCLA 1DVFD 5IEHA 3ALWA 4AQ8C 1CICD 5CHNA 4GKOA 3WEXA 4PH8A 1R5VA 1XZ0A 2BW4A 1KCRL 1XGZA 3BMWA 1EUUA 2O6CA 5H2BB 2H26A 3CDFA 3TJPA 2EDHA 3V0AC 2AJVL 4BRJA 2PW2A 3ESNA 4HOXA 2ZOWA 2CRYA 4UDUB 5I0ZA 1JGUL 4JY6A 2HCZX 2A1WL 3AQXA 1X7TA 5IMKA 4V33A 5TH2A 5CSZA 3OHXB 2ZUWA 3UO8B 3O3UN 1CCZA 2ODIA 3MGTA 3Q3GB 2GBTA 4LMQI 4R5VA 2P5PA 2F53A 4BZYA 3S5YA 5EG6C 2DF3A 3HG2A 3IFPA 3U7YH 3W9DA 4A6YH 2ITCA 4PJ7E 3ZO0A 4XBGB 5ESAA 1XF5A 2OJEA 2AQQA 2EC9T 4LDEB 5KVEL 2AGJL 3WIHA 1Q9WB 1MCDA 3KPMB 3NIFB 3LIZL 4JVPA 4RGOL 3BRFA 4PHXA 4BSJA 5EU6B 3HB3C 5C0DB 1JFQH 1NCNA 1YNTF 3D8MA 3V4VL 4LCIH 2AZUA 2ERJC 4XO5A 4A7GF 4O2CA 4RH4A 5IHBA 2EEAA 4NKMA 5F44A 2H7WA 4F9PA 1HH6B 1OLLA 5BV7L 4JFDB 3GSQB 4HUWB 3FT1A 4EI6B 1I9RL 3GSVA 5L4IA 1T5KA 2R29A 2ZKXA 1MLCB 3QWNA 1G7PB 5I1LA 5L0QC 5FOBB 3QI9D 3HKFA 3QXAB 5C0AE 3TN0C 2XKSA 4BZ2A 1AZRA 4FYQA 3O3AB 2EXYD 4G82A 3C5ZA 3IDMA 4X8JA 4F33A 4TPRL 3CVBA 4NKQB 5FB8B 2X6VA 1R3HA 2NLJB 2ZX7A 4ALAL 4PRDA 3UEQA 4F9PC 4LP8A 4OQTA 3SDAB 3MRHB 1A6ZB 5F7NC 4IOFD 2CALA 4KDWA 1AJ7L 1F3JA 5I71B 2P42B 1CD1B 2TRYA 1CFQA 2FWLB 4L8DA 1I8LA 3JSSA 1S7SB 3U46B 1JERA 4FGMA 4BUQA 2DQMA 3IAPA 3X11B 3BDYL 4K7FA 5IMOA 1AHWB 1I8KB 1GOHA 4G9FD 1NBYB 1P6AB 5EBLA 1HIMH 4JR9H 3OBAA 4PRHD 4LOFA 4YSSA 3AS2A 4IKNA 3A4FA 2QTEA 3BCFA 1QSFB 1I8LC 4C83B 4G6MH 3LZFL 3JTTA 1SFHA 4UILL 1CUOA 3T2NH 3HHRB 5LN4A 4MKMA 3KWUA 4ZTOH 2NW2B 3ARBC 5BZDB 1KELH 3O6MH 3IYLW 3P4OA 3DIFB 4GBXB 1IC1A 2IWEA 3T3MB 5KEZA 2FNBA 4JRXD 4CVZA 2Z7ZA 1QUNB 4OF7A 4YGVB 3G5ZA 3MKKA 1TQUA 1BZOA 2PN5A 5AW9B 1KN2H 3QIBB 2X1XR 4GMTL 4PLJC 5A6IA 3CU7A 4MHHG 2P7TB 1LGVA 3NZHL 3S96B 1FG9C 2B20A 3I6LE 2BOCA 3FRPG 2ED6A 4U1IB 4A04A 2A83A 4HC1H 4MJIA 1FCGA 3L8QA 4H8WH 1F1AA 3EDEA 3L5XL 1MIEL 5GQBA 1QTPA 1YRKA 3F7LA 3GXMA 3IJEB 3DBSA 4GYBA 4NCC2 3ZJAA 3PJLA 1EAPB 4XN7A 1IEBA 5I8KH 1JRHH 1TVHA 4MAYA 3R0MA 4OCXL 4G7SB 4PP1C 4FFYL 1PY0A 3BUIA 5HGDA 1IGCL 2YXWA 4PGBB 5D93C 2FZ3B 1QW8A 1WBXA 2Q7YA 1X5GA 4JG5A 2V3EA 3DPBB 1D6VH 3BKMH 3F7YA 1UADC 4U49A 2BP3A 2DIBA 1ZS8A 5E8NA 1SOKA 1JXFA 5DJ8B 2GY7B 3KLKA 1Q8MA 2HWZH 3D51A 1J8SA 2JNZA 5I8OH 3WTXA 1QATA 4JE0A 3PAUA 1MDTA 1FFNB 2WXNA 3F85A 3I50L 3LHAA 1UXSA 1F45A 2QPFA 2WBJC 4XGZA 3NFSL 3TH3T 2ZAIA 2VISB 5C07E 4FX5A 3IS1X 4TL4A 2GIXA 3LMJH 1S8DB 4HWZB 2X12A 1CTOA 5ISZA 3LKOB 5IJVB 3C6LB 1VGEL 3MI6A 1IGMH 3AM8A 4P4KB 4R4NC 5IB2B 1YYLH 4X5XA 3MNZB 5AUMA 4F58L 3NQIA 4QRRB 1M05B 2GJ6D 1NCBH 4YDKH 3OPZL 4OJCA 2CWRA 4WFFD 1E9PA 1D9KB 3L1EA 1PJ9A 3V4VA 5DJ6B 2Y06H 5IOKA 2B0SH 3IGUA 4P3CL 2OULB 3AG3B 3FN0L 2FHBA 2OYLA 4JK0D 3RDTA 1IM9B 2R69A 4JPIA 5ENWA 3WGVB 4DHLA 1JGLL 3EJZD 1FGNL 5DYFA 1AQKL 3VXUD 3HMWH 4N0UB 3GT6A 2DH3A 3O11A 5KZCD 2EO7A 3U0WH 4ZYKB 4Y19A 3BJ91 3HBZA 4ELMF 1DN2A 2VRAA 4NQTA 5KVGL 1QHPA 4ZUVA 3MRGB 4KXZH 3BFOA 3QPQD 5ACMA 1CI5A 2DWDA 1P84J 4PBWD 1JTTA 2H3XC 4L4VB 3L4UA 1MIMH 4BA0A 1LO4L 3GMRB 1FAIH 2ZZUT 4F57L 2YBRA 4K5NA 1X7QB 1SOQA 4XPHL 2BFVH 3CN2A 1A3ZA 4LCVA 3VGAB 3L3GB 4Z76B 1IVTA 3S3SA 3QG6B 4PJDE 4ZFZA 2HRGA 4UINL 4Y5XA 1SMDA 4YC2C 4OBRA 2VLRE 5KG9B 2VLJD 4B9JA 2XYBA 3HZVB 3LNEA 5FDWA 3LEYH 1A0QH 4L2YA 4CBZA 1HH9B 2C9VA 2FBJH 3WTSA 5GGSB 3K72A 2DJSA 1DVXA 2XU9A 5IB3B 5C0IB 3UABA 2PP7A 3T04D 1EZSA 4JFTA 3CMOH 1NGWA 1ZHLB 1ZV9A 3G9VA 4N2FA 2C9SA 2MRYA 5JR1H 4YEEA 1WIUA 1SDAB 2K3HA 4KKCD 5HJ3A 3KLLA 4FG6C 1M4KA 4AY0A 3SOBH 3BGFB 3FT9A 4WWOA 1U33A 1OB1B 3ARRA 3D0VA 2ZG2A 1QNIA 5LKNA 2C9PA 4XC1L 2HN7A 5ICZA 2CHWA 3BH4A 3FFCA 3LRSB 5F7DA 3LPWA 4PBVC 3WE6B 4WHYG 1ZVSA 1XSJA 2MQCA 4G70B 1CLZL 3D85B 5FO7B 4CILA 4BQ6A 3UZEC 4JQVA 3WU1A 5DFWH 2Z8SA 2NR6A 4FQ2L 1D5IH 2PP8A 1ETJA 5B4MD 2BP0A 3JUZA 4EN3A 4O4YL 2CCWA 2GSGB 3FKUS 3NDZE 1S7UB 1DFXA 4WO4A 2KQNA 1I7UA 4GXVL 1FH5H 2O6DA 4M8UA 3TO2B 1RZFL 4BHUA 1P5VB 4JQVC 4TQIA 5E95B 1N64L 4LLVB 4NSKB 3SDDA 4H5SA 4LPWA 2G4GA 1GZPB 1E0OB 1KXTA 4FFYA 1GC1H 3H8NA 4KNTA 1F4WL 3UTPE 3CZSA 3H9HB 3OKOA 4FXGA 3WLWD 1VENA 5KAQF 3IFOB 2EIDA 1L9RA 5F6HJ 2V5YA 2F8XC 1SYSA 2EIZB 1VFAB 2JVUA 4JJ5B 4XVTL 5SWQA 1C7TA 1OAZL 3AAZB 1FVDA 1KIQB 2IH9A 3FW6A 5LAPA 2XQYG 5FO2A 4QJ5B 3CC5A 1XB3A 2RB8A 1ZGLM 5IROC 2NUTA 3LKPA 3QDGA 2Y2YA 4LGPB 4NEHB 5E1AA 2A6JA 3DURB 2BNQB 4NQVA 2ZUYA 3AREC 5DI8B 4CSTA 3K6SA 4ZAKD 2WLLB 3KPRA 2ICEC 1BZQK 1AKJD 1TTFA 4QRBA 2AEPL 4FQLL 4KJYB 3HRZA 3QA3A 2ZOLB 2L04A 3T71A 3C5JA 3GB7A 3ESUF 3ETBJ 4LAJH 1JTPA 2B59A 4OLVH 3WFBH 1AAJA 2R39A 4LKXB 1EHXA 1EPFA 1RZIA 3MRLB 5FA3A 3F12A 3T9WA 1TJHL 4D9RE 1NL0H 4C4KO 4PWEA 1CR9L 2NY4C 3PWUA 3KPQA 4NZTL 2OX5B 3RWHA 1KLFA 2G3XA 5EN2A 2AC0A 3HRZC 1YPZA 3I6KB 4RZCA 2MFNA 3T4YB 5EFIB 3RUGF 2ODHA 3RILA 4BZ1L 4OQ1A 4R90L 3TBSA 4M4RA 2UZYA 5IVXF 4WHTA 3TV8A 4I5BB 2VC2H 4OD3H 3KEHA 1GZQA 3TCLB 4D0DB 2V2XB 2AQPA 5FYLE 4BQBA 3O4LE 3C8DA 4K0OA 1MH5B 2VNCA 2R1YB 2BP8A 2JF1A 1A8JH 4I3SH 3EDDA 1JV2B 3HG5A 2BMKB 1UM6H 2HXAA 3L9BA 1DVSA 3MJWA 1YYML 4IU3B 5E4EC 4KQ0A 1OAXL 4GW1B 4LSUH 3ZSTA 2G5UA 4LB8A 2MQGA 2IPKB 5D5MF 3CSBA 4NCC1 3N0PB 1Y0LB 5F7YC 3S37L 1JYVA 1G7MA 3ILEA 1R5WB 2BY2A 4E2OA 4QLWA 3Q6FB 1AHMA 3UPRB 4AMWA 1XGYL 1M1XA 2QQNH 1UH4A 4IYKA 4F2EA 7PCYA 3BPCB 3TBWA 3OKLA 2ZUSA 4DP4X 1F13A 3DJRA 3DOIA 4KRPB 4Z7WB 4PJHF 1ZHBB 3CVHH 3BDXA 4DEPC 1U8PB 3RFZC 3PUCA 4IGBC 4J3XA 1TJIL 4P04A 4YE0A 1RUQH 1WS8A 1MCFA 2KMWA 5DEZA 4JKKA 4K07A 2E3VA 2Y5TB 1I1CA 3V0VA 4TSBH 3WFEL 1VFOA 4JFZH 4J8RB 4IBSA 4NJ9L 1NBQA 2WLJA 3UG5A 1XVSA 4C4UA 4JHVA 4LDLB 2AQ1A 4P5RA 3T2QA 4PJCA 3FSAA 3DX2A 4NNPH 3BRDA 4GSDH 3IDJA 4W6YB 2PTVA 2XN9A 5AZ2L 3L6FB 3MV8A 1Q0YH 1CXEA 4KXBA 4Y4KB 2ICCA 3FFDB 4RGNC 1HTYA 5D72H 1KYAA 2BSSB 2ZWNA 2YQ3A 1RH8A 2J1KA 2VXSL 4Y9CA 1AQDA 2AJYL 3KWTA 1PG7H 4KQ4H 3MFFA 3TFKC 2OZNA 3FO9B 4GRMA 1UT9A 5KSAB 1G7HB 3HAEA 4JFXB 3MACL 1INDL 1A6WL 3MLTB 3GLZA 1HHHB 3SDCA 1OPOA 2CQVA 1R3IH 4UZUA 1E5BA 3ET9F 4O58H 2IV9A 3V6ZB 3ZGIA 2YPLA 1JF1A 2IWFA 1OCOB 1TZIB 3JYCA 5D6CB 1SNRA 2CO2A 5D7LA 4NQSA 4XCNB 4NXSA 3SD5A 1ZPUA 1HQ4A 1A7BA 5DRWB 5CD3A 2XBTA 4KV5E 4KUZH 3DYPA 3Q01A 4ZZFA 1ZT1B 2WLIA 4X7TA 1NZRA 2HLAA 4JQIL 3P73B 3WTVA 2Y7QA 3F84A 4AW4A 4KRMB 3G6JA 1A65A 3U82B 2AK4A 2QKIA 1VERA 5C3TA 1EXUA 2G75B 1L0PA 3NA9H 1FFTB 3GUTB 2MJWA 3RU8L 3C2AL 4PJ8A 2HAZA 2D03L 4ODBD 4U1NA 4AQOA 1W16A 5K1VA 4RGMC 4QRSB 2M2DA 3DXAE 3D39A 5ELIA 4CU6A 4UAHA 1FNHA 2YPVL 4RAVA 1X5AA 2H6UA 2XQBL 4Q4IA 4DKEH 3NEEA 1B0WA 1A3QA 4UMGA 1N68A 5HSFA 4ETQA 4PJ8C 1DLHB 2NT0A 5JO5A 4JE4B 1OAKL 2AXWA 1W0WB 3P0GB 3FYIB 5SWSA 3QWQB 2C3HA 3RL1A 4URKA 2HSIA 3WHXB 5KBLA 3E1ZA 2SODB 3TZVB 3P3YA 1KN4L 4G7YH 4LL1A 3WDHA 1FL5B 4QT5B 5JMOC 2RD0A 4R96A 3DI2B 4OIAA 4BZ1A 3FU6A 3QCTH 3MGOA 5I76A 4HZLB 4PGDA 1GGBL 2J8UA 3SQOL 3BZ4B 3CFEB 4Q9RL 2FATL 4I87A 5ALBL 2C7UA 3RI5K 3EBIA 4I0PA 4OLUH 5TF1L 1KACB 1R0AL 5MERB 2XOTA 4KNSA 3GS7A 3LQAL 4QIRA 3VFWB 3PHSA 3NPSC 3VFMA 3LKSA 2HX9A 5B7MA 4UMSA 3RZCC 1BMWA 2WKLA 4OB5H 4QHLB 3QUHA 4R4BB 2Z7WA 4RRPM 2EEBA 3T09A 4G1EB 2MKLC 1LNUA 4JM4L 1AZCA 1LO5A 3PV6B 4B60A 2LVCA 3DJ9A 4CL7A 1EWHA 2XQYK 4FTVA 1OTUD 3KYOA 4KHXL 2O93L 4QRUA 5T8IA 2EJ1A 3QEQB 4AVIA 3RPIA 1ODAA 1ZSHA 3ZHFA 4UOZA 3CDZB 4A2EA 3SE8L 4W68A 3KBHE 4JN1H 1XL4A 3JTSA 2IANB 3WKYA 1RIHL 3BYTA 3ZMRA 1I3RB 1E5AA 1BAGA 2I07B 3NMEA 3ARDD 2OZ4L 5F96H 4QRPE 1RZJC 2BP5M 4P57B 4R0LA 4Q8BA 5I1HL 3GDBA 3UZVA 1ZD6A 4KJPC 5KYNA 3D18A 5DJYA 1QLEB 3EJCA 3N85L 4L4JA 4YDMA 4DPRA 1MRDL 3REWB 3BVTA 2DQFA 1B4JH 3X1FA 1OT4A 5C0ND 1PTZA 5HYJA 2XVGA 1RJLA 2N01B 2WXKA 4OCSL 4F7MA 1FORH 3P9WB 3MOBH 3DC0A 4AEHL 4JUTA 3NSJA 3ZQ9A 1U4FA 3PHOB 2Z92A 1U3HA 3TVMB 2MCPL 5DD3L 4B9IA 4FQ1L 2FB4L 3QXVA 1NIFA 2WBKA 4YL9A 1MFBH 3O8XC 4WLCA 1IL1B 5T3XD 4Q58C 3UTOA 4P4KD 3H9SA 5I30L 1GY2A 6PCYA 2D7TH 4JL2A 1JRHI 4LPXA 2B15A 5DS8A 1L7TL 4ZPTA 3IMUA 3QGVA 5I1KL 2Z35B 2WCSA 3AS0A 3KLHD 4D0BB 2DQJH 3SDXE 4G83A 1MRCH 2X4QA 4PLKD 4JQIA 1K72A 5IJDC 2K9UA 1KB9J 1LEGA 2DLHA 5DHXB 1N4XL 1J7VR 1X4XA 1Z9LA 3P9LB 4LCCB 1DDHB 5FLUA 3KPSB 1IKFH 4Y16A 5JORB 4OLWL 4DK5A 3OPUA 1ACCA 4DUWA 4GG6F 4FJZA 4X6FB 3U4BH 1IM9D 5T3XH 4ACPA 1T0NA 4MCMA 5BVJB 1U36A 2NYZA 3W38A 3EDJA 1XCQB 4TS6A 4F2MB 3ARPA 3IJYA 4QOKD 2VDMB 1DL7L 3FB7B 5HDLA 2W5PA 1MVFA 1IAKB 1EDYA 2X87A 5AB0A 4ONGL 2WXIA 4AIOA 3GMPA 4PJ7A 2YPVA 3CV5A 1UVQB 2BVOB 4WTZG 3UP1A 4DH2A 3GZPA 4X5LA 1PS3A 3H42L 2DI9A 4M3KB 1UD6A 5CIPH 4BK4A 4MD0A 1N6UA 1ECYA 3COOA 5FF6A 5I1CH 3LH9A 3S35L 5ECGA 1D5XA 2BOLA 2F54E 2J1XA 4PS7A 5BJTA 5IV2A 2A6KA 2FR4B 1B9ZA 2ZSWB 3K0YA 4N25A 2OQJB 4OGXH 1CJYA 5EU3A 4ISVB 3R19A 3HC2A 2XWCA 3HZ3A 3ARXA 1DVZA 4U1HB 2WD0A 1MZZA 1GGUA 1BD2D 1DQLH 5C0AA 3ZL4L 3TBVB 1U8QB 2V5RA 2J5LC 4UCFA 1PZAA 1KJ2L 4AYMC 1G9NH 3GBEA 2H9GA 3L3OA 4JFHD 4QD2E 4O9HL 1NFIA 4MA3A 4WEBL 1Z9SA 1KJVA 3HC3L 1NFKA 3SYPA 3BAYA 4PY8J 1WK0A 1JCKA 1ODUA 5ES4B 4NAQA 1L6PA 5I6XC 3TGXA 4MJ5A 3CFKB 5DRXA 1MCOL 2I85A 3IJHB 2AQ2A 3M1BA 4G42B 3VXMB 3VDCA 4PJXF 1DN0B 3QJRB 2B08A 4LO9A 3L3OC 1CIUA 1PNDA 2R4SH 5K93A 4BFGA 4ZUSB 2WAHA 2ADYA 4NQDE 4TUKH 3KGUA 5CEYA 3JV6B 1M6OB 4NCDA 3DO3A 4FP8L 1BJ8A 1M3JA 3GRBA 4WU5B 4EOWH 1LP9F 3GSWA 1F58H 4QI3A 3WXVH 5B7EA 1T21A 1TU2A 1RUAH 3Q9PA 4WWNA 4X6BB 4GT7A 5L6YH 3HE6A 3HLAB 1FE8L 2OR9L 5F1IB 1NIAA 4UNVA 2VXTH 4FQCL 4X6EB 4QRTB 2VZVA 1I1FA 3B7YA 3WFZA 3KGTA 4H7VA 4JFOA 2P8MA 5ID0A 3VU2A 2OZ4A 2R2BB 4WW1A 3TCTA 2NNCA 1E30A 4XHJC 4P4RB 5AVVB 2OTWB 3QUMB 3KE0A 3HE6C 3A22A 2X1QA 3FXIC 4X4YA 4NQCE 4EDWL 2FJGB 2XN0A 2NDFA 5JLZA 4ZZKA 4PJIF 1L7IL 2WZ6A 4G8FA 3U25A 4M7LL 1HHJB 3UBXA 4ZI8A 1KG0A 3IAGC 2VWEE 1R47A 4G6JH 4QGTA 1F97A 2NT1A 2QVKA 4XPBH 3IMBA 3QVAA 3A3YB 2IAMB 1UOLA 3I02B 2LGNA 3BP5B 2K8MA 1ZAGA 1P84K 3QWOA 3DHMA 4IMLA 1AGEA 1T1XA 3WDJA 1BQSA 4V2BA 4YXLH 1PY9A 2NQ3A 3T0ED 1GH7A 2CR0A 4LESA 3Q6GL 2Q3AA 3PFUA 4TUJB 5CD5C 1PYWA 1ZLUK 2X2IA 4O51A 1HQRA 2MHAA 2LU7A 3DVGB 3ZDYF 1M3IA 2MEJB 4AQAA 3CXFA 3L9RB 5DMGD 4S1DD 3H2WA 2I60H 3GLDA 5JNYA 4GIAA 2G2NA 3N44F 2WANA 3MRDA 3R1GH 2CU9A 4FLRA 5D6DA 5C07A 4U1LA 5C0CE 5DD0L 5E6IB 4N2OA 1QVOA 1F4YH 4WWID 3RURA 2YIHA 3LKRB 3ARFA 4LQ1A 2PABA 1MDAA 4NP4H 4TTDD 5FO8B 3DV6A 2FK9A 3W9EB 3ULSB 2HX8A 4HBCL 3SCMD 1FBIL 2IPTH 4M8QB 4NERA 4PRBA 5IW6B 4NQEB 1A7PH 1E5UI 4PRPE 2NY7L 3GINA 1HE8A 3BH8A 1QFWL 1O7DC 1P1ZA 5D6DC 3DX3A 4L0YA 4PU2A 2AKRA 1GCYA 5F8RC 5GXBB 4NO3A 4LEOA 1MN4A 1PDKA 2JJWA 32C2A 3K4DA 5FM4A 3D1MC 4HIIB 1C5DA 1CQYA 3K4ZA 3RRQA 3VXSE 1LM8V 1MCJA 3ATAA 2FJHA 1MHPL 1SMOA 5LCVL 4ZMQA 1XCXA 4ZODA 5FYLL 2VN5A 5JHDA 3IM1A 5ESVA 1KYDA 3PWPE 5MEPA 4EQ3A 4N5EC 4WU7A 1ZA3A 1IC5H 2PP9A 1KJ2A 1KNOA 1ZSDB 5CJQH 5DHVB 3NJKA 3O9WD 3RTQC 4KXCA 1EZVX 3I3DA 3UYPA 3BZDA 3ML8A 4GI6A 4PN6A 2H2SC 5SWZD 4S10A 4J27A 5KSVA 5CBEA 5BRZE 2GSIA 4LEXL 3LKQB 1N6QL 3UO1H 5I82A 5AAPA 3VH8G 1Y18B 3W11C 4HUVA 3MLRL 3FTVA 2VL5B 2OMXB 5JDSA 1BYPA 4PJBF 3VXRB 5D2NC 1PIFA 2IDCA 4X7EC 4Z7UA 4PJDA 3IMTA 3IRCA 1RJYB 4AVHA 3GBML 4P5TC 2VLRA 3L95A 4JPWH 5L7XL 5KSAD 2I7OA 1OK8A 5JYMA 1Z2KA 4MCNA 1PCXA 5FYKL 4KKRA 3PGDB 2UX6A 3DO4A 4BDVB 2GB2A 3D3VB 3C60D 2BSEA 1UKQA 4X6DE 3VI3E 3OB8A 3TIEB 4QYOB 1A1NA 2EYTB 3BUQA 3ZY7A 3VYPA 5D7KD 4AYBA 5I0WA 1OGAE 1CL7H 1YEFL 1JYWA 4KWUA 2QHLA 3QG7H 4HK0B 2QMJA 2FSDA 4YHIB 2A9NL 2F0CA 2N7BA 4FQXA 3DIVA 4O2EA 4ELME 3QUYB 2MQ0A 3QDMB 1RUKH 2J1ZA 4A38A 1NUFA 4XN1A 4IOIB 5DURB 5A2KH 5B8CC 2MNJB 4XP5H 1OSZB 1E6JH 3C09B 4YSCA 4X6CB 1ZTXH 4URTB 2OMVA 2VW7A 4K2UL 5FK9B 5FEBA 4LCWB 5EEXA 2FX7L 1JXKA 4MJ6A 4K7PH 1WISA 5BNXD 2WB7A 1TO5A 3BSGA 2IMMA 2OI9C 5DXWA 2N7SA 2BVQB 3IPEA 3VGDA 2XPZA 4XCFH 4CGUB 1TDQA 4WFEE 3VXPA 3RGVB 1TG8A 2Q3ZA 3NK3A 1JZ2A 3ZE2B 2AJ3B 5KW9L 2YZ8A 3FUHA 2YGNA 3FQTB 2Q0ZX 4ZOBA 5C2BH 4J6IA 1MW2A 3O2VL 3POHA 3QIUA 1DBBH 4F3FA 2E6QA 1BVOA 4R84A 3RAJH 1EEYB 4F7CA 4YGAB 1IU1A 1LQBC 5HVFB 4YBQD 4NJAH 3FB6B 3P54A 3U0PA 4K5MA 1VFBA 4M56A 3T6ZA 4UUJA 5GZNA 4JZOA 1N8OE 4ZFGL 4HLZG 3ILQD 5IIEA 1TQVA 4AGNA 4NYLB 1E28B 3T65B 4IM8A 4YQXL 3HNVH 5F88A 2YMOA 1X5HA 12E8H 2FUQA 1PZSA 2I27N 2IMNA 2R1XB 4N3UA 1S5IH 4MHHI 4LSPH 4YDNA 1J1OL 3DO7A 1UJTA 4XMPH 1U8IA 2BK8A 1ZLWK 1ETA1 3MJ6A 3SDYL 3L13A 5HGAB 1A4JB 4Y1AE 1G7QB 2VSCA 3V7AG 2VZ3A 2ZCZA 5LGHH 3VW3L 4HUXA 3B2PA 4JMNA 1BVLB 3OSVA 3P3SA 4W9LC 1QFHA 1UM4L 2UZIL 2XG5A 4FYSA 5LCVA 5DFTA 5LN8A 1KBVA 1HYSC 3KPNB 3L9EA 4YUEL 1DTUA 3MCKA 4JFSA 3DJZA 3AABA 5E4OA 1QLRB 1HCVA 2IWGA 2IAND 4G8GA 4YBLB 4D0CB 4ZMTA 2IQ9H 2RTTA 1JGVH 3JWDC 2X6CA 4C55A 1XF2B 3AMKA 3NOIA 1U8CA 1JDCA 5FGSA 1JHLH 2R56L 4HKZA 4RWYH 5C0BE 2R1WA 2JIXA 3BEVB 4MCZA 2ZCKL 5EEUA 3WD5H 4MJHA 2X6MA 4JFWA 4NO5A 4AT6B 2BCMA 2YRLA 3WMQA 4UV7H 1WHPA 1JP5A 4QXWA 5KTEH 1DQJB 4JO3L 2D9QB 3CPUA 3X1NA 1U2YA 2W60A 4JG0L 3OAYH 4PGCA 4P3DB 3STLA 4OLXL 4KKZA 2ENYA 3QNFA 1I9JL 1WZMA 2JQZA 4M7JL 3UTSB 3K8KA 5MI0B 3TTYA 3ZKQD 3NP4A 4N9OB 1B0RB 3UTZB 4HIHB 1AR1B 1KY7A 4DQOH 4JB9H 5JTWA 5I1EL 2W92A 5FX3A 4NLHA 4X98A 4PJ5D 2BH0A 4P23D 2BRRL 3NVQA 4HUUA 1D5MA 2WTPA 4G3YL 1LWJA 3B5TA 3EYOB 1I8IA 2QQQA 4F7PA 4G7VH 2A5UA 1CBVH 3LRMA 2F15A 4DTGL 4TKWA 1GZHC 1IKNA 2C8NA 2F1EA 5E94B 5FGCB 5CKGA 2DQEL 3MV7B 3BZFA 1Z3GH 2XC8A 5I26A 3QUXA 1UYWH 2XNAA 3AADB 1PKQB 1AMXA 4KTYA 4EO5A 2DQHL 2AJZB 3OC8A 5KS9B 3L3DB 1OD7A 2M8XA 3O2DL 4RNRA 1F5WA 43CAA 4HBQA 1KTCA 3IF1B 1E9OB 5D5ME 5DUPL 2QLYA 5HVWA 3DVNB 1A3RL 5F1NA 1ASQA 4MXWL 4OLZL 4P46C 4ZMNA 3EHBB 4HJ0D 2HVKA 3E7JA 3TWYA 5GIRA 4YHPB 1RSFA 1UD5A 2XWDA 2Q5BA 4PJHE 5IQNA 1R75A 3MUHL 4PIBA 2A73A 3VRIA 2YGOA 1Q72L 1ACYH 2XXGA 4OV6F 1EXHA 2QADD 2JB5H 5H94A 5E70A 1IQDA 2XZAH 3NAAL 4L3EB 1AVAA 2Y24A 4ZXBB 2ZNXA 4XCYB 3GZKA 4LBEB 2OL3L 2YAPA 3UROR 1KCVL 4NFCA 4Y9BA 1AFVH 4AGMA 3KLSA 1G0YR 4MXQD 3QHZL 2YXFA 1DP0A 1FC2D 1KB5B 4H20L 3BGAA 5FC9A 5HDBE 5I8EA 4OZ4A 5D1ZI 3DXAA 2IG2H 3E6FA 4YHLL 4RA0C 3MUJA 1A9BA 2BC4B 1WCBA 2WLNA 2YN3A 1NGYA 1LEKB 5FYJD 2O26U 4HD5A 4NKOB 3S36H 3U4EA 4E9LA 3O6FB 4N2CA 4M6NH 3X14B 1T7WA 2HKFH 5E23A 1ONQA 5FW8A 5B3NA 4HPOH 4HS3A 4N68A 1E4XI 5FGBA 1PZDA 3GDCA 5JW5B 2NY3C 1UJ3C 1T22A 3D2UB 3CHPA 4EXKA 5EO1B 3TIDA 4M7LT 1MRFH 2XV0A 3P30L 4X5WB 1OM3H 1N3NA 1P5UB 2IALA 4KKBD 4RX4A 5AW6B 4XZUA 4Q9CA 3HHSB 4MFHA 3A6BL 4QHPA 1E4WH 2VJ0A 5FYJH 2OMWA 1BZ7A 4QXVA 5L4FA 3MNVB 1Z0MA 2YSTA 2NZ1A 1FZKB 1YMME 3HBGA 5TQ2H 4ZO9A 2NW3A 4AVKA 5I75B 5AKVA 4D7PA 4B50A 4PJEB 1TR7A 1R9FA 3BH9B 1FO0L 1KIPB 4NRZA 3HMXH 3ES6A 1KB9K 1U8MA 3V5DA 4LSSH 1XCTA 3OG4B 3RBSA 4YXHH 2KZ1B 5KN5B 2W91A 4BK5A 3MREB 3D48R 5MEQA 2AQNA 2P49B 3I6GA 3F7PC 1VJSA 3MV9D 3QB7C 3VRJB 1SLWA 4R2GB 5E00A 2VDQL 3FOMA 4OZGB 2IBGA 5LHDA 1EMTH 2VDOL 4XNZC 1UM5L 2OS7A 5E4AA 1I8MB 4IDJH 2EZ0C 5I16B 4EZKA 1SMAA 5DTFB 4CSPA 4XMZA 1U2HA 2NY2D 1HCYA 1RU9L 1JZ6A 1ED3A 1N5AA 3QCUH 1QKZL 2X9ZA 5T5FL 1EERB 5D4QA 2Z31B 1T1YA 1YEGL 3G6DH 2DMBA 2W9EH 1KTKE 2ZCHL 4RWHA 3D07A 5HJBA 4JBSA 4ZOEA 2YARA 1J0JA 3MJ8A 1HOCB 1GPOL 3MXWL 2JELL 3FBQA 5AVXB 1EFXA 4DKTA 2RCSL 4CSSA 2F9BT 1Q9KB 4QRPA 1WYJA 2AQSA 4Q2ZA 3WUWA 1HAWA 4QO1A 4AQEB 1WPCA 2PCFA 2FIKA 3G5XB 4TVUA 4F80A 3HW7A 3DECA 5I66B 2JK5B 1OE3A 2EDFA 3BP6A 3P3RA 1OP3K 1WF5A 4DCQB 4JFVA 3VD5A 2QQKH 1MHCA 1UCBL 1YECL 3CLWA 3SPVB 5I6LA 1A7NL 4XE5B 2E4TA 2C3GA 2VDRB 3O2DA 1FNEB 4UI2A 1DJHA 3VFTB 4ANKA 3RIFF 1PSKL 3L4WA 1FNGB 4XXWC 2PWGA 1NMAH 2E47A 3WGUB 4NIYE 2WQSA 1PFCA 3SKJL 4M5YH 2VE6B 5D1XE 1U95A 1U91B 2CE6A 5I6NA 2QSVA 1K4DA 4ETYA 3UH8A 5A7EA 3A0OA 3ZE1F 5CGMA 1V54B 1T1ZB 3P69A 4XPFH 1EVUA 4G5ZH 1OTSC 2GW5A 3B2MA 4NWTH 1XF3B 3FRPB 2P24B 4Y2OB 1DQQA 2GCYB 4W9CC 3FONB 4M43H 4G11A 1X5ZA 4QHKJ 5JXAL 1AZNA 2OL3A 4ZO6A 4PJAB 4ZUUB 3K7UA 1G7LB 3RGBA 3D06A 2DDQH 3WJLA 2JWYA 2GFBA 1MQKL 1INEL 5E8OB 5B38A 1PU0A 3BJLA 4OZFA 5G4MA 3K2IA 4RSVA 3NCJL 3FT3A 1ECZA 2A38A 4MA1B 3WIHH 2OK0H 2CKBA 1S78C 5FCSH 3RNQB 4QPEA 3L4CA 1T0MB 3OKNB 1SM3H 3U2IA 4FFZL 4WWKA 4AG4H 4HIEA 4NNXA 3FQXA 25C8L 2F54A 3L4XA 4WSJA 2P5WB 2BNRE 3UJTH 1MF2H 2ROYA 4G8AC 3RKDD 1S3RA 4RISL 5CP7A 4LNVA 2ATPA 2GIMA 1P4LB 2EH8H 1KCWA 2VERN 4MCYB 2H5UA 1KDIA 2FX9H 1J05A 4BZ2H 2XV2A 5DRZA 1JD9A 1H3PL 3NPZB 3UJJL 5IB1B 2ZX8A 3F62A 4Z7VB 4IBLT 2D3LA 4N24A 4MA8H 3QHTC 4JY4A 4LZKA 3F65A 4EI5A 1MEXL 2CGRH 4GQZA 1E2VA 2VXQL 5GGVY 3HAEG 4U1GC 4DZBB 3D2TA 2V7HA 2BHFA 3C6SA 4I0KA 2IFFL 3N06B 2JKTM 5HHNB 3GIZL 5LBSL 5D1QB 1FO0A 3IXTB 3FCTA 3VQMA 4PPTA 1J1PL 1OCZB 1ND0A 2WKOF 3RHWF 4PS3A 3WTWA 4UTAH 3CSYB 3MRNB 2DKUA 1XO8A 2CHXA 2WXPA 3QIWA 1JN6B 4X4XA 5IFHH 2YGVA 4ZX4A 4G6KH 4JRXE 4B5ZA 4UIKH 1J5IA 1HL5A 4EI5C 3VJ6B 2N1KA 5DJDB 4NQDA 1KFAH 2LOEA 1W80A 2FWUA 4BM7A 1G6RL 3HG4A 3JUYA 5DURD 3C5SB 1OPGH 2A0LD 4Z0BH 4G6FB 1FAKT 1Q0EA 4R7XA 2EKSA 5FHAL 3P4MA 6FABL 4I7ZC 3IGLA 5E9DD 1OSPH 3BLKA 5F7WC 4Y4HC 1JNHA 3ZTJH 4Y5YB 1R3JB 4KJWD 4APQB 2GT9A 4N0FA 4AENA 3D25B 2Z8VC 4BQ9A 2ALAA 4KQ3L 4GRLA 3O45B 4X2UA 2DQCH 4RQQB 3N1QC 1FG2B 3X1EA 3U36B 1T89A 3FU3A 3UP6A 1BMGA 2ZX6A 3GPSA 5AG9A 3UTTE 5J06A 2XFGB 3EO9H 1BV8A 3ARUA 4YH6A 2HRHA 4XBPB 1AO7B 4XCEA 3ULVD 1CFNB 3FCSB 4IJ3B 1FWXA 4TLKA 1G7JB 1TVDA 4NQCA 5CZVH 5K9OB 5IHZB 4OM0H 1DBAL 4JNXA 4Y9EA 1U93A 1P9MC 3D30A 5TFSH 2HUHA 4WV1B 4HAFA 4GRLC 2FJSA 4PJXE 4GSXA 5IF0A 4BH7A 1GGYA 4JFFE 4WUUE 4CMMA 2X89A 4AUUA 5J6HA 2FTAA 2WM0A 1TZHA 4FNLL 3QNYB 3DARA 2VAAB 4DERA 2YZ1A 1CLYL 3WENA 2FD6H 3EXLA 1CFSB 3Q9QA 3H4FA 4X99B 3ULVH 1LP9E 1BXAA 1CVRA 2VJXA 1UCTA 2GJ6E 3IDNA 1MFCL 4AJ0A 5KJRH 4GRWB 1F6AA 1OKEA 3A4DA 4QTHA 3O4OC 4RAUB 4WFFE 3WHE0 4F8NA 4JG1L 4C56B 4HUKB 2VJ8A 1TQWA 2X42A 1BIIB 5CSBA 4OVUA 5A2BA 2PETA 3NEXA 4Z3EA 1Z9MA 5FYJU 1JSYA 3I9AA 3MN8A 5J56B 3K2UH 5C0CA 1LE5A 4BUGA 1M2VA 2PWFA 2EDJA 2P8LB 1JGUH 5E5MA 2GTZB 1ZDQA 3SKMB 3LAFA 5D7JB 2IF7A 3RDTD 2QQLH 5LAXA 1B4LA 2V4LA 1ZOXA 4OI8A 3U6RA 1A6VH 2OMZA 4YE4H 1MNNA 2GEQA 4ES9A 2R83A 2ADIB 2VDLH 1A66A 1ZANL 1WWWX 2B14A 3RY6A 4OM1L 4BCYA 3BSZH 4Y19D 1L9MA 1Q1PA 2Z1KA 1YY9D 4P2QD 3U48A 4X8XA 3ZE0E 3QJUB 4MD5A 4ATTA 4WW2F 2BCKA 2I5YH 5HHPB 4LKCA 5ICXB 1E5CA 1PZ5A 4K55A 5DK0B 1DJWA 1WA2X 3EG9A 2EUVA 3VXSA 1F0LA 3IJ8A 2RJMA 4FI7A 5C09B 3VWKC 1CGSL 4HWBA 2R69H 4J3TA 5F6HI 1R1CA 4IRZH 1W6WA 5D7IB 4Z3IA 2XVKA 4HCIA 2NY5H 3DX6B 1QBBA 3AXLB 5BOPA 1NC2B 2QHRH 3PWPA 4JO4L 1UB6A 4U6XA 5ANHA 2C1PB 4ZS6D 1M2OA 5DHEA 4MNGB 1QWNA 4HP5A 2NSXA 5IVOA 3VWJC 3NGBB 3SN6N 2YD7A 3CK0H 2IH1B 2VXQA 5HYFA 5C0JB 2NQCA 3AY4C 4L23A 5BRZA 4Z95L 5AAMC 1XWVA 4NUJB 3T0VA 1GCFA 2D31B 4KI5F 2A99A 4WK0B 1G43A 2O5ZH 2I69A 5DMKA 1BM3L 2W07B 3HZYB 1SXAA 4U7MA 1JCVA 4UDTB 1PLGL 3GMNB 1I3GH 3O6LL 5J6SA 1DSYA 1K4CA 1NC4B 3HUJB 4MQSB 4MQ7A 1VGKA 3W2DH 2UYLB 1KJMA 1UGKA 3S97C 1NCAL 5GGVL 1G6RA 2Z8RA 4CA4A 2GHWB 4K3JL 4CC4A 3S9DB 5J3HC 4NM8L 3WFHA 1NGQL 4B41A 2DZEA 5FXCH 1WWBX 2ZP8A 4HF5H 4X6DA 4Y4FC 4EN3D 3F83A 3VI3A 5J9PA 2X4NA 2E46A 3WO4C 3KVPA 4WO4D 4GI8A 1AD9A 4OGYH 5B7FA 3STZB 3TASA 1QSEB 1I85C 3GMMB 3VI4B 2M1KA 3VSUA 4GQPH 2Z93B 3CZKA 5C8JB 2VR7A 3FZUC 3Q5TA 4U6VH 3SDDD 3FULA 5I1JH 4OCNC 3EGDA 1V3LA 1NAMB 2HUEA 3BHBA 3ROLA 4YHYB 3L3HB 3ARGA 2LAGB 2HT4D 1BQ5A 1KTLB 2WAQA 4YIQB 3NZ8A 3NRFA 1GR7A 2YA1A 5AOLA 3V8OA 4CJ0A 4N3TA 3E9TA 3TA3C 3FRUA 3NZHH 3D9AL 1Q9LA 2FSEA 1XGRA 3ARVA 2JB6A 2QFRA 4AH2B 3FQWB 3TO4B 4Z7IA 4IRSA 4GB9A 3B1UA 3PE9A 5D8JH 5EOCL 2J8HA 4ZFOB 4TSAH 2I25N 1KGCD 2FEDC 1IGJA 2OTPA 1P4IL 1MHEB 3C5XA 4JZJB 5GHWL 3WJMB 1LDPH 2PTTB 3KPRD 3K46A 4K9JA 1IGCH 5HHOE 3V10A 3UFIA 4MZ2A 2DY2A 4I3RH 2YOAA 4J4PA 2CKNA 2CBTA 5GGUB 2HJLB 2ITDA 3OKMB 1N26A 4U3SB 5IJCC 5FV1L 4WW2C 1MFAL 4I1NB 3U7WH 2Y2TA 3D2UD 2YC1B 3S8GB 5A2IH 2DTSA 2NSQA 3NRPA 4KZCA 3B9KA 3FPXA 3I50H 3EUDA 4JHUA 4K15A 3LV3A 3BT0A 4JFYB 3MJ7A 1REIA 2AMUA 1MI5E 3V0DA 1CDUA 2VGLM 4J4PC 2AEOA 3P0YL 4NM4H 3NBNA 1QNZH 3FQ4A 4LSVL 1AIFB 1DLFL 3KVQA 4LLUA 3UAJA 5L2KD 1YY8A 1PW3A 1LILA 1VGEH 2Y5EA 3QEUA 3QORB 4UOW1 4WSKA 1KLUA 4P5SA 5DLML 3VCLA 8FABB 5HXMA 4MZRA 2H6PA 2X3BA 4DNLA 4F58H 5J11C 4YX2H 4BINA 2EVHA 2CMRH 2C3XA 2VIRA 4FQQA 4W93A 3FHEA 2V8LA 2H3NB 4R4FH 2AZAA 4U6HA 2P26A 1KJ3L 2YQ2A 4RLDA 2DAVA 3D33A 1JHKL 5DMIH 2HKHL 4Y1TA 4FA6A 1JGEA 4P3CH 3FN0H 2WVSA 1CYWA 3L4VA 2VQ4A 1M71B 2YKKA 3P4LA 4L48A 1HHKB 4E9YA 2HT3D 1FLTX 3FU0A 1BEXA 4OSUL 3S88L 2ZKMX 4IK7A 1YEDB 4ZMPA 4MNHB 1T3FA 2F5AL 1MY7A 2B8OT 1H15A 2YWZA 3P77B 4LU5L 1GVIA 2VLKB 3KDMA 5F89A 1WHOA 2K9FB 3OJDB 1LTXA 4QY8A 3W0WB 3G6AB 4DVRL 1ID5I 1A1OB 1SY6H 3UBXG 3ZHKA 2Q9OA 5B39B 2Q7NA 4NZ8A 3HI1B 4LSDA 5C0BA 4OVVA 2DQTL 4UAOB 4UT7H 1L9NA 2AXFB 3KH3A 1PBYA 2WUCH 1G7IB 3RWIB 1F6LL 3WL9B 4XAWL 5HJDA 4W9EC 1N2RA 2ATKA 2HJFA 4FFVC 3HZMA 4K71B 4QXUH 3TPUA 4OCYL 4OZIF 2EXWD 1SHWA 1E4KC 2A74C 4A68A 4YDJA 3V5HB 4UINH 2IXQA 3GTVA 4XAKD 4EDXB 4Q74A 3FB5A 1GW6A 1O7VA 2Y23A 1KWKA 1TQCB 1A22B 5ABDE 2CD0A 1EJ8A 2IGFH 4IRJA 3D7PA 2O5NA 4Q9BA 5B1BB 1EZUA 1UZ6E 2PCXA 3SDCD 3V6FA 2X88A 4K3HA 3BD4A 2CLRB 3U7YL 3OSKA 1C16A 4A6YL 3NIFE 5EZIL 5IOPA 3FQRA 3NN8B 1WFNA 5EU6E 5JDJA 1LE9A 4YBHA 2EAEA 2VDRH 1RV6X 1F1DA 6PAZA 1JFQL 1S7VA 4KO5A 3HAEH 4LCIL 4JFDE 1EHNA 1SEBA 3FS9A 3S6CA 2AK4D 1OY3B 3E6HA 1T20A 2GK0A 4O4YH 4AYEC 3KM1A 3U9UB 1CK0H 3IU3A 2Y9RT 4UM8B 2VN6A 3CG8A 4UU9B 1CU4H 1H3GA 4GXVH 4M6AA 5GS0D 5E5RB 3ZKSD 3IN0A 1RZFH 3CFJA 1UACH 2Q86B 2OJZH 4QHNB 1VIWA 2X0VA 1SDDB 5I6PA 1Y6MR 1N64H 2C3VB 2JJSC 4M9OA 3QWRA 5F3HA 5D2LA 3GXFA 2G3ZA 3D39D 4P2OB 3JXAA 1F4WH 3PDOA 1IMHC 3KPOB 2IBZY 5AL0A 4LVHB 3VFRB 2QV4A 4NO0B 1OP5K 1S9YB 1CG9B 3T2PA 4AJYV 4L5FE 4LLYB 4FG2A 2X9XA 4BIKA 1CZ8H 4YPGB 3PNWA 4EKXA 4PMEA 3SE3C 2J55A 4KMQA 1GYVA 1Z9OA 5GS0H 5SWSD 1P1VA 4P2AA 2VDPB 5I1GH 1X5LA 3GJFA 3APMA 3SPJA 4AV5A 4U0QB 5E1GA 1FL6A 4A63A 2Q7AA 1HI6A 4PG2A 3WEMA 2DWEA 1B3JA 3SE9H 3KYMB 2GITB 2H0JA 2MOQA 3NIGB 4AQ1B 4ZW6A 3IXAA 3QPXH 1IBDA 3QJTB 3T77A 4JR9L 2C5DC 1QSFE 1FZMA 5CCKH 3SGDH 3THMH 2F74B 5KYWB 2FLRT 1AS6A 4GAYA 5SV4A 4PJ9C 4IS6A 4G6ML 3MMEB 4Y2DC 3W57A 3DMMB 5F9WC 5D1QD 2UXTA 3NFPA 1U8NB 5FM5O 4FLOA 4MB5A 1TTAA 2QZ5A 3T3ME 1KELL 4I0PD 4IEFB 4ZUTB 3BXNA 4YR6B 4O02A 1P7HL 1AH1A 4JRYD 3AACA 3PFQA 2BSTB 3ZRFC 4NQXA 4BZ1H 4PCTA 3LKNB 2EO1A 1QG3A 4Y0GA 1Z5YD 1H8SA 2H32A 4G6FD 1KN2L 5AOJA 1NOLA 3FB8A 1NMBH 1I8UA 1JZEA 3G9AB 3QEHB 3MX0B 2GVYA 5JA9A 3BYYA 2X4PB 5CGYD 4HC1L 4UQ2B 4POYA 4LLDA 4MWFB 4H8WL 3LEXB 4L3CA 3TJHD 4CU8A 1YYMH 3BAJA 3CDGA 4KNQA 1RQ5A 1ULVA 2WWKT 2XWRA 5I8KL 3UJIH 1IAIH 1KEML 4DVBB 5BQDA 4DAGH 3IU4H 2NTFA 3ZQXA 5B3JF 5AOMA 5DA0B 5TDOB 3S37H 1JNLL 1X5KA 2EO9A 3MRFA 1SYVA 1ZEAH 3AU1B 3INUH 3ME0A 4PD4J 1WTLA 5DJAA 1D6VL 5HYSA 5LBVA 3DGGB 3KXFB 1U30A 3BE1H 3WI9A 4JFQB 3BGMB 4DT2A 4XHQA 3TBTA 5DZOA 3BDBA 2HWZL 4ONHB 5I8OL 1XGQA 3LQZB 1FJ1B 4FFWD 4QKXB 3ZIMA 3HG3A 4XX1E 1UC6A 1MCPH 1W9XA 4EZJA 1SN0A 4XMTA 3LMJL 4NJ9H 2CNZA 5T3XE 4I1RA 4M6ML 4RA3A 1U3HD 4QRRE 2Z65C 1IGML 3VRLF 1DEEA 1YYLL 2GEEA 2QBWA 2N3JA 2K4WA 4C4BA 1BF5A 2AJSH 2PPCA 3G04B 3NJHA 4FNSA 4LPVA 1TPXC 4PY8I 1DVFA 1H0DA 3D6GA 4HMEA 4CN6A 1NCBL 1CICA 1DFBH 5CZXC 5E7FA 4C56D 5I19H 4YDKL 5IQ7H 2AJYH 3ZN6A 2EDYA 3PPSA 1NCOA 2XTJB 2HT2D 3HJ0A 3O0RH 2BS9A 4LCUB 5A16A 2WXHA 4RDQF 5I8CB 1KEGH 2Y06L 1XGTB 3NSCA 4P8QA 4JM2B 1A6WH 3DBXA 2B0SL 1IRAY 3V0IA 5EIVA 4N0UE 5DQJA 3OZKA 1DVFC 3OHMB 1OWRM 4OTXL 4QOKE 1FVCB 1M7IA 5D1XA 5IEKB 1CICC 3BKCL 3HMWL 5ALCH 5GGRB 4BD4A 4PVBA 4AXWB 2ZWSA 1I4FA 2CO6B 3BPNB 5GS1B 1JF6A 4XNBA 4H0HB 2N7AA 3U0WL 3I85A 4L8SA 1QZNA 4WEEA 1OOAA 2LU5A 3AUWB 2OA9A 3QO0A 2ZUQC 1BFTA 3AXIA 2VR9A 2R2CA 1I1AB 4L4VE 4X4MA 5FUZH 2Q6WB 4XP1H 1RVFH 1NCGA 2IC2A 3K0WA 3VD9A 4POZD 5E8EA 3GXDA 3L3JB 5AYQA 4OCMC 2Z91A 4BCZA 3RU8H 4KITB 1P7KA 4CVXB 1KXVC 3PLYA 2EDXA 5DK2B 1FFQA 3T08A 4L8SC 1FAIL 1U8HA 5DHYA 4IKIA 3X2QB 2OR8A 2C1OB 2BFVL 1ZHKB 1NC2D 1T5WB 4LRNH 3GYRA 4H1LA 4BXVA 1K9TA 3DSNB 1CLCA 1HEZA 3SY0B 5C0AD 1QASA 3IDYC 3LEYL 1A0QL 2WB1A 3N41F 4L4TB 4XXDB 3ZE2F 1VEPA 2XQBH 4TRPH 4D8PB 1R24A 5BO0D 2YJLA 3PL6C 3LCYA 3K1KC 3MRMA 4ODSH 2OPCA 4NPYB 3V0HA 2ICWA 3QI9C 5JPNC 1XIWD 4KDTC 3KH4A 2FHFA 4PGJA 1DBML 2WGXA 3OKEA 5D9SA 3EYVA 5JR1L 2YD0A 2EXYC 4NKDB 3SOBL 3ULAB 1T5XB 4R7NB 5AW5B 1NBCA 5T5NG 3ZLQC 5H35A 2IDQA 2BNRA 4PGEB 1YA5A 4WI6A 3V55A 1KN4H 1F6FB 1HHIA 5GSVA 4G9FA 5JIQA 3D0LA 4KUCF 2MCG1 4IOFC 4S0HA 5LGYA 3MODH 4M5ZH 4E5XA 4GMSH 1JZ4A 3FOLB 2FATH 3P2TA 3FU7A 3JV4B 3B6SA 1L9OA 4TULH 4ZW8A 4CKQA 2P1YA 2UWEF 2C4XA 1FH5L 1UHVA 1CXHA 4Y5VC 3H3PL 4OV5B 3LQAH 1NEZG 4CADA 3Q48A 1KGUA 2CO7B 2VUOA 3O3BA 4RFOH 1ESOA 4JRXA 4KY1H 5AZUA 4HS8H 2AK1H 2D0HA 3UEZA 4S1RH 3DX9B 3J07A 1MG2C 3K4AA 4FZEH 4Z8FH 2VR8A 2ZD0A 1V7NH 3QCVH 1NGZB 5BZXA 3QQ3A 2BZCA 1EHLH 4JM4H 1CDYA 1S9WA 5AG8A 2B4CH 1JTOA 1AGDA 1U8KB 2ZWKA 3B56A 1S7XB 2LTQC 4OD2B 4QF1B 2BNQE 5KBNC 2MKWA 5DZAA 1S7QA 2Y1YA 1LK2A 1YVLA 3I6LD 4KMTH 4F37K 3TO4D 1I9EA 3LY6A 3MRPB 3LVTA 5F3BB 3VH8B 2M83A 1RIHH 3N1PC 5CR1A 4N8VB 3MA7A 1GGCL 2D3JA 3QUKA 4Q14A 3UTQA 1WQVT 5FA4A 4JL1A 5HHVL 2OZ4H 1Q0XL 4AMXA 2XCMC 3H7LA 4OLVL 3WFBL 5IEHB 4JO2H 5CHNB 2H41A 4HD9A 4B27A 3S35X 2CO1A 5CEZE 3KJ4C 4P5MB 3ZR5A 2D7OA 1BVNT 1M7DA 2PW2B 5AW8B 1ADQH 5ACZA 3OZ9H 4JFFA 3HB3B 4JY6B 1J0ZA 2EE9A 5TH2B 3AWGA 2ERJB 4HU2A 1HEHC 3DX8B 3R4RA 4KH9A 2VC2L 1MFVA 2MCPH 2F53B 2G9KA 5HI4D 4PYGA 3SKNA 2X4RB 4AKOA 2WYZA 3DVFA 4LARH 5L0QB 3HRPA 3ERXA 4H8UA 1HSAA 3BP4A 4I3SL 2GJ6A 3ZUNC 4J3OF 4E9RA 3TN0B 4G8EB 1UM6L 2Y25A 4ZUWB 4N6RB 2VABA 1AGCA 3VMOA 4LSUL 1MJJB 2D3VA 4NKMB 1UXWA 1N4XH 3M7OA 1C12A 3GI8H 3ALXA 1R34A 3A6CL 2GI7A 1PGRB 1R3LB 2L7EA 5I1LB 4LOUD 3WTUA 3K8LA 3VXUA 2AS5M 1UA7A 4N0CD 1IKOP 1WBZB 3SQRA 1OAUL 3SZKC 4L3AA 2QQNL 4Z7WE 3KVDD 3DUSB 3IDMB 4QHUA 4X8JB 1DZBA 3BOVA 3BIKB 4L9LA 1W8OA 1J18A 3WNNA 5M94B 1KGIA 3CVHL 3N9GH 5CCHE 1AQ8A 4TQEH 1VESA 4PIRF 1RUQL 1QEXA 1QBAA 2RR3A 4TSBL 3ORJA 3K6NA 1OP4A 2P46B 4JFZL 3VAEA 5KYXB 1F2QA 5BS0B 4A2FA 5IM7A 4KROD 2R0ZH 5F0PB 4NNPL 3QXUA 4GSDL 4FQHA 4ADIA 5A40E 4K7FB 5IMOB 1TCMA 3O41B 3AY2A 4I3GA 4GEIA 3ARBB 1WFUA 5DGQA 1UQSA 1EEUA 4KK8C 3QPQC 5EBLB 4RMTA 4XNUH 5SX4H 2MCMA 5E8DH 5AW2B 1UWEH 3L5IA 5AKRA 3ZL4H 5CAYB