2GBAA

Reduced cu(i) form at ph 4 of p52g mutant of amicyanin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMGHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Site-Directed Mutagenesis of Proline 52 To Glycine in Amicyanin Converts a True Electron Transfer Reaction into One that Is Conformationally Gated.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords amicyanin
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gbaA00
1E5ZA 1AZCA 4GP8B 2EIKB 1AS7A 1GS8A 4HCGA 3FSVA 3CG8A 3MX0B 1E67A 4DP0X 2XLLA 3ABGA 4A68A 1AR1B 1M9WA 1JZIA 1ZPUA 3JTBA 2J57A 3OMNB 1OE3A 4AI7A 2Y1AA 2DWSA 2CUAA 4BXSV 4FA7B 3D12B 4AKOA 4YSPA 1J9SA 1SF5A 2FT7A 1GS7A 1PY0A 5AFAA 3OMAB 1ID2A 5I6MA 3ZDWA 2J5WA 1AZNA 2PP9A 2HX9A 2WO3B 1J5DA 3JT2A 5F7AA 3T6ZA 1JZEA 1YLBB 1KBWA 1QNIA 1CC3A 2RACA 1KDIA 1OCRB 1V54B 3TBCA 2H47C 1AS8A 1SJMA 1L9SA 1BAWA 1KV7A 1PLBA 1NPJA 2PPEA 4YVNA 1E30A 3SBRA 5ANHA 1GS6X 4UF7C 1CYXA 1AG6A 2ZOOA 2ZWNA 3FYIB 3NYKA 5I5IA 1L9QA 1UATA 3FQYA 1EZLA 4E9SA 2VSMB 3X1GA 2I7OA 2EIMB 2YAQA 4E9VA 1TEGA 3GXUB 3PPSA 3BVDB 2DWTA 3U25A 4ZK8A 3NP4A 3PAVA 3T9WA 3CVDA 1AZRA 2XU9A 3AG3B 1WA1X 2CAKA 2UXVA 5D4IA 5PAZA 2GI0A 4BDVA 2OV0A 1GR7A 2HXAA 1PAZA 2QPDB 3NJHA 4G70B 1PLCA 5IY5B 1L9PA 1L9OA 4DPAX 1NWOA 3PLYA 4EF3A 2QDWA 4YVUA 1JVOA 4DP1X 2XWZA 1MZYA 5A7EA 4HHWA 5B3SB 2YAFA 2GIMA 1FWXA 4G71B 1AZBA 2YQBA 2YAHA 3TASA 4YSRA 2XV2A 3IEAA 1AS6A 2PCYA 2FQFA 1IC0A 4KOBA 3T71A 4DPCX 4AX3A 2GSMB 1HAWA 4GXFA 1SHXA 2BZ7A 3OQRA 1ZIAA 4CSPA 2IWKA 2HX8A 5B1JA 4YSEA 2DYRB 3OD3A 2HLEB 2FTAA 4YSSA 4DP7X 2BO0A 1OF0A 1A4AA 2EIJB 1NZRA 4BDVB 4L0PB 4HALA 3FU7B 4YSTA 2WO2B 1PLAA 1SFDA 3PAZA 3SQRA 1WAEA 3RYMA 2BW4A 2XX0A 3FPYA 9PCYA 1V55B 2ZXWB 3NJMA 1JXFA 1BYOA 3UACA 2VN3A 3DTUB 2CBPA 2DY2A 2LLNA 2PCFA 4KO7A 1NIDA 1TEFA 2ZONA 5D4JA 2BP0B 2A3TA 3AG1B 1PNCA 1N68A 3C75A 3WNJA 2E86A 2IH8A 1I53A 2AVFA 5LDUA 2IDUA 2J55A 1ETJA 1JXGA 5B1KA 4A2FA 1PNDA 2XX1A 4HAKA 5I6LA 2X88A 2XXGA 2PPDA 5B7EA 2XV0A 4G7SB 2XUWA 3FU8A 2W8CA 4KNSA 1DZ0A 2VM3A 1NIBA 3S8FB 1L9TA 1L9RA 4Q89A 2YAOA 1NICA 2HZHA 1KGYE 4TXVB 1M57B 4BWTA 3SBPA 2TSAA 3AY2A 4BK5C 3L45A 3ASOB 1OCZB 1WA0X 1NTDA 1RKRA 3QJSB 1X9RA 5AZUA 2YARA 1KCWA 4N4YB 2YAEA 2BHFA 1KBVA 4GP4B 2BW5A 3X1EA 5I28A 1AZUA 4DP9X 2FJSA 1AQ8A 4KO6A 2BP8A 4KOCA 1DYZA 3UADA 3AZUA 3TU6A 4E9QA 5D4HA 5PCYA 4A2GA 2AANA 1XB6A 1ZV2A 2Q5BA 1ZDSA 1ET7A 3G5WA 3QQXA 4QKTA 3S8GB 3S3BB 3IE9A 2BZCA 3EF4A 2VSKB 4PCYA 3TA4D 2FQEA 2JKWA 4JHVA 4K9JA 5I5MA 4HHGA 5AKRA 2MRYA 3ZX1A 4DPBX 1NWPA 1AACA 3KW8A 2WSDA 5TK4A 5EHFA 3N2JA 1BXUA 3PXLA 4RH4A 3QJUB 3T6VA 8PAZA 3HEIB 3QPKA 4A2EA 4YSCA 1QLEB 4KNUA 1IUZA 2FWLB 3IBOA 1AAJA 3OM3B 1JZGA 1ILUA 4ENZA 1GY1A 3WKQA 1AIZA 3IN0A 4GYBA 4HIPA 2VMJA 2XV3A 2DYSB 3NSYA 4YSQA 5E9NA 3NJKA 1OCOB 3FU9A 2AZAA 4A2DA 2CJ3A 4DP6X 2NRDA 3QJVB 1GSKA 3EH5B 3QJQB 5B7MA 4UAHA 1FFTB 1RCYA 3AG2B 1XMEB 1CYWA 2P80D 2XVBA 1A4BA 4G72B 4NB7A 4Q8BA 1OCCB 5B1AB 2UX6A 4E9YA 1PZAA 5I6KA 1PF3A 2EINB 1N70A 3S3DB 4YSDA 4DP2X 3NSCA 3UABA 2H5UA 2J56A 2FQDA 2UX7A 1NIEA 7PAZA 3TBBA 1J9RA 4UANA 3MBWB 2PP8A 1NIAA 3PAUA 1AANA 1PZCA 2FQGA 4JKNA 4GP5B 2YAPA 3ASNB 4KO5A 3WNIA 2PP7A 3FQ2A 2Q9OA 2MTAA 5TK2A 3NSFA 3EHBB 4QLWA 2UXTA 1JVLA 2BWDA 4MFHA 1A65A 3NSDA 4E9TA 1SDDA 1KYAA 1BQ5A 1PCSA 1F56A 1A3ZA 3H4FA 1MZZA 4E9RA 1SDDB 3WG7B 1SFHA 3WIAA 3FSWA 3GDCA 1ZDQA 2IDTA 4X4KA 1URIA 2FT8A 4E9WA 2BWIA 3OMIB 3DIVA 1W6WA 3IN2A 1IBZA 4F7KA 3UAAA 1W6LA 2IWFA 1MG2C 1JZJA 4W1TA 5I6PA 2QT6A 2CALA 1ET5A 3N55A 1GYCA 3SBQA 1IBYA 2W88A 3V9EA 1GY2A 3AG4B 4BWWA 4N8UA 1TKWA 3GYRA 3WI9A 3NJIA 2B08A 1ASOA 3HB3B 4HCIA 4BWUA 3FSZA 1OV8A 1AG0A 3ABLB 3NP3A 2BP8B 4HZ1A 4E9XA 4P5SA 1FA4A 1R1CA 1AOZA 5B1JC 4DP5X 1ADWA 1A8ZA 1QHQA 1M56B 3CDZB 4WKXA 4BXVA 4YL4A 1W8EA 4DP8X 1JZHA 1NIFA 2PPCA 1RZPA 5I5JA 2AFNA 4M4RB 1E5YA 1BXVA 3FU7A 1WS7A 2XYBA 5I6OA 1PZBA 1SNRA 2JFCA 2FNWA 2N0MA 3KW7A 4NERA 4AKPA 2R7EB 3S3CB 1IKOP 2IDQA 5I6NA 3NJGA 1BEXA 2OCCB 3T6XA 3X2QB 1HFUA 3CVCA 3ABKB 3FQ1A 2JXMA 4WTQA 4KNTA 3X1FA 2FT6A 2QDVA 2I85A 4YSOA 1T5KA 1NPNA 3FS9A 4G7RB 1XB3A 2P80A 1EHKB 1MG3C 1SF3A 4HCFA 1WS8A 3PCYA 3ZBMA 1JERA 3FT0A 4CSZA 4F2FA 6PCYA 2TSBA 2IDFA 3QJTB 1TU2A 4JHUA 3NJFA 3ZIYA 4P5RA 2AZUA 2H3XC 3X1NA 2UXFA 1CUOA 1J9TA 4YSUA 5B1BB 5B7FA 1NINA 1PMYA 2IDSA 2XXFA 1JXDA 3H56A 2PLTA 3X1BA 2OJ1A 2B3IA 1NDTA 3CZUB 2UXGA 2GC7C 3QJRB 1RZQA 2VW4A 1A4CA 2EILB 3AW5A 3NJJA 1HAUA 1ASPA 2IH9A 2PPFA 1JZFA 2R7EA 2VW6A 2GBAA 4PAZA 3EH3B 2VW7A 2YXVA 4F2EA 1BXAA 1JOIA 1ZIBA 2PPAA 3UGEA 1GW0A 2YAMA 2GB2A 2CCWA 2HX7A 3NJNA 4AKQA 5FC9A 3FPXA 3CDZA 1BYPA 2HRHA 1X9UA 3BQVA 1XB8A 4GY4A 1OE2A 4YSAA 2QPEB 1J9QA 1MDAA 1KCBA 3EH4B 4KO9A 2I7SA 1VLXA 1E65A 3CVBA 2GC4C 1WA2X 4FAAB 3H4HA 4NAJA 4W9ZA 1ILSA 2IWEA 4A2HA 2HRGA 3ABMB 4G7QB 3T6WA 3UAEA 4DP4X 5I26A 3WKPA 2BP0A 5F7BA 4AZUA 1V10A 1ASQA 3ERXA 3NJLA 1OE1A 1ET8A 1OOWA 4A67A 1J5CA 1B3IA 4M3HA 2DV6A 3DKHA 3NT0A 1SHWA 6PAZA 3FYEB 2GHZA 2VM4A 1BQKA 1BQRA 1KDJA 4A66A 2IAAC 3FSAA 2X87A 2Y69B 1CURA 3V9CA 7PCYA 2YXWA
chains in the Genus database with same CATH superfamily
5IOPA 1RZ7L 4JVWA 1R5WA 2R1YA 3BVUA 2VERN 4WTZG 3QS2A 4ABWA 2W60B 3QW9A 3RWHA 4IBVA 1GS8A 4U1SB 3QDJA 3D0LB 2NNFA 5K9QI 1NH6A 4M03A 1Q9OA 1JGLH 4WUUB 3LHPL 2J43A 3N1GC 1QTYT 1MCQA 5AKTA 2GQHA 1CTOA 1HE7A 3L4ZA 1RJYB 4AI7A 1GIGH 1I1FA 3QZWB 2Q86B 4GRWB 3ILQC 3D12B 5GS1B 5HYEA 1E9OB 3AUWB 3VFGH 3UROR 3UTPD 3BWAB 4L37B 1ID2A 3MJ7B 4YHNB 3ZDWA 4A7UA 2FR4A 1HYSD 1ETB1 4FLSA 2PP9A 1R3IH 4N2AA 3BMWA 1F11B 2KDGA 4UAOC 1G7JA 4IOIA 1QNIA 2A4CA 3CIAA 5K1VA 3U4BH 3VFVA 4PRPE 4D0CB 4YXHH 1QBBA 4HOXA 3DX9A 3QUGA 4RWYL 3MI6A 1E7VA 3GS0A 5BZXA 1KV7A 1LMKA 4UT9H 4MA7L 3PRZA 5KSBA 2R23B 1MJJB 2WVTA 5AVTB 4XPGH 2RHEA 5LXGH 3SKOB 4IHOB 4X9HA 4YAQA 3U30C 4ZS7L 2ATPA 3COOA 5TQ0L 4WFED 1YDPB 3IFPA 3TLRA 3DOSA 5KTEH 4YO0B 3OKNB 2XBTA 1EV2E 2CO4A 1P4LA 2G75B 5ESQB 4E9SA 5FECA 2X7LA 1OW0C 3BN9C 1JV2A 1DJHA 3NA4A 3EYFB 5IROA 3VFOA 1WPCA 2WNGA 4PY8J 1TEGA 3U6XA 1XD1A 2Z0BA 3PAVA 3MA9L 4ADJA 1YEEL 4XNUL 1B2WL 3TF7C 1E43A 3L3KA 3WFZA 3A21A 1JNHB 1JXKA 5ECGA 2UXVA 2XTJB 5D4IA 2GI0A 4PLJC 5AVWB 3LPPA 3BDYH 5AOLA 5LGJB 1X5GA 4TVPE 4ATTA 2JQMA 3ULUE 2OMNA 1UM4H 1AE6H 4OLEA 5D1QD 4LF3A 1FZJB 2GIMA 3GTTA 3B7SA 3LN4B 3PGCB 4K8RL 1D5BA 3CXHJ 1JCVA 4JR9L 2EIZB 4Z3IA 3LPWA 3I75A 3JVGA 4LEXL 3PL6C 4FXKA 1XF2B 1GZPB 2APXA 2ENQA 3RKDC 2OKMA 3KPLA 3PQYE 4IKIA 2FQFA 4YC2B 3MV8A 3GHEL 5AAWA 2GSMB 2JB6A 3BQUD 1NANI 1C5BH 1L0XA 2H32H 4IGBB 3O4LD 4N2NA 4M7LT 1ZLSH 3R7RA 1KSRA 3WTSA 5AYQA 1SHXA 5FO9A 2DQTH 4GUPB 2ERJC 5ESQA 4O5LH 1HHKA 5D2LE 3WYRA 2Q3AA 1GGYA 3QT2A 1JYNA 2ZPKL 4IOSD 3SDXA 4YUEL 4JBSA 3W0WA 3T1FB 4YHYB 3MGOB 2PWGA 4Z7IA 2AJYL 2FNBA 2DQGH 1HS6A 2ILLA 3FN0L 3NJXA 4G6KL 4F9LA 4NCC1 1AXSB 2AV7A 3ZQ9A 1MCLA 2JCCF 5DVMA 3JYCA 2FUTA 1YMMA 2WYHA 1SLXA 3BUYA 2ZXWB 1H9VA 4M29A 1KTRL 3H0TA 4OFYA 4WI5A 2KL6A 3KE0A 2JKLA 2PWEA 4LSTH 2VN3A 4ZBJA 4AQAA 3MCLL 5DEJA 4GG6B 5ALBL 2F1AA 1RZ8A 4IEFA 3TCLB 3I3EA 4KO7A 3WIIL 1QA9B 2G2PA 2X41A 3PU7A 2V3DA 4F93B 4HIIB 3D6GA 1D5BB 3F7LA 2AXGB 5AG9A 4S10A 3AWFA 3UZVB 2BK8A 1KC5H 1BV8A 4RBPK 2XVKA 5I71B 4LIQE 4HS6A 5F0PB 1XCTB 4UQ9A 3SY6A 5BZDB 1QW9A 4Q52A 3NEEA 5F7NC 1D5XB 2VLKE 4HULB 4Z7WF 4PGBB 3MRKB 1EHNA 1GOGA 4NBZB 2X88A 3GGWA 2PPDA 5IOKA 1D5IL 4FZEH 3RBGA 3BI9X 2GTZA 1DZ0A 1XF5A 5D7LD 4I85A 3MMEB 1L9RA 4KI5F 2IWGA 5AKVA 4X5WB 4I89A 4W9EC 2COVD 2TSAA 3QIUD 3QK0A 3RWCB 3VFPA 4OD2A 5HJ3A 4MKMA 2HCZX 2HLFC 5TD4A 4IGBA 4OB5L 1T6WA 3U30B 2HFFA 2FSEA 5T1DH 1JZ6A 1GOFA 3OHMB 1A7PH 4FTDA 4FCAA 4OCSH 3IT8D 1W8OA 3RDTB 5F3BB 5BXFA 3TU6A 1NGYA 3KPQA 2PO6D 4X80H 4R26L 2BRRH 3S3BB 3IE9A 4IBYA 2VWEC 4NUGH 4OZ4B 4L1HA 4PCYA 4RMVA 3C87A 4OVVA 4JHVA 4JB9H 2GSGA 2MRYA 3AS3A 2BC4A 2E47A 4L8DA 2H2SD 3KZ8A 4EI5D 5IWLC 1DEEA 1X5KA 2IFGA 1QEWB 4A7QA 3F5WB 1ZGLM 3SBWC 4K3HA 3H3PH 1YNTA 4KNUA 4DQOH 3RWDB 1KFAH 1LILA 4U1JB 4XMLH 3I6LE 4OSUL 1SZNA 3R06A 4R84A 3V9FA 4N9OB 1ZLVK 1U8LA 1XIWA 3EADA 1PCXA 4R4FH 1RZIB 2C7UB 2VDOB 4PJIF 1BZDA 1S9WB 4RNRB 3P77A 4YDVB 1JVKA 4FD0A 1OCOB 2WTRA 1P2CA 3B7TA 4I13B 1HWWA 2D73A 4DP6X 5DYFA 2WIMA 1AMYA 5DUML 5ADOL 3CC1A 3IGAA 5DD1H 1P4LB 2G75A 5B7MA 3AG2B 1UFUA 4L8SC 4J8QA 4S1DD 4I1PA 2NY4B 1P1ZB 2W91A 3TA3A 3IDGB 1SHSA 5C0AE 5BV7H 2AHIA 4U7KA 4GS7B 5E6IC 3Q1SH 1S7UA 5FGBA 5FM5M 1PF3A 1BF5A 3D3VD 2F53A 2XWDA 3S36L 4F5CE 3WUWA 1T2XA 2VDKL 4OZIE 2NNRA 1OTTD 2NY4D 2VR9A 4XPHH 4PJDF 2Q2LA 4E41E 5IHBA 1NIEA 4HCRH 4NKQB 4NNYA 2XY1A 4QY8A 1T3FB 4Q0XH 4MAYC 4LOUC 1UD5A 5ISZA 4Y4KA 2MTAA 2WLLB 1I9EA 3NSFA 1T5XB 4ZZKA 2MJWA 3RGBA 2AJSH 3GLEA 5EF1A 43C9B 4G59C 1OCWH 3F7PC 1HCVA 3M07A 2WBXA 1N2RB 4ZFOB 4ODSH 1HINH 3CN0A 1L7TH 4ECNA 3F12A 2DI8A 3HUJA 3GBMH 4HS8L 5IQ9A 3MRPA 1TQUA 4W9GC 3UJIH 5KYXB 1OAUL 1T5WB 3GDCA 4JG1H 3UO1L 4LU5L 1HDMB 2QGDA 4Q9BA 2JKIS 5LLIC 4U4IA 1M7IA 3HMXL 4JDEB 5E70A 1MFNA 4X83A 4FFTA 1KYDA 4MYWB 5IT2H 4FLQA 2ERJB 2C9SA 3O2WL 3MV8E 1XZ0B 1ZT4A 3B2MA 3HKFA 2R8SH 3WI9A 4I0PA 2B08A 3HB3B 4HCIA 1G9NC 2EH8H 2PR9A 2YOAA 4PJ8D 3UTTE 5IIEB 4QRTB 3K6DA 2CUIA 1MLBB 5HYJE 4FL4C 3VFTB 1S9YA 3OTTA 4NRXB 1I8LC 4XB7A 4AIXA 1K2DA 1KTBA 3EYSH 1XBRA 4TLKA 1IM9D 5HI3C 4UT7H 2WVVA 5GXBB 4Z7UA 4KDTC 3EYOB 4QXWA 5J1AA 5BCAA 3TO4B 2EDFA 1MCOH 3QIUB 2Y3NA 4DO6A 3PL6A 4FXKC 1BJMA 1JZ7A 2EIBA 3MBXH 5EIVA 5CD3B 3ARGA 4N8CL 2EDMA 3MLTA 4PJ9C 2WXHA 3OF6D 5BNXD 5EU6D 2OR7A 1BEXA 4IU2A 2OCCB 2AQPA 3RWFB 1T89A 2VDOL 3CVCA 3ABKB 4OLWL 4JK0D 1IAKB 5GGQH 2QQLL 5E2VL 2GI7A 3PWNA 4IYKA 1O7DC 2XKUA 3HC3L 3RX9A 1TVHA 5EOTA 1NBYA 4LRNH 3OLIA 3DO7A 3TYGL 3FS9A 1VCBC 2OXGA 4YXHL 2Z0UA 4UV7H 2ORBL 1A64A 4LLMA 5DGRA 2Z91B 1BBDL 1UWYA 3MRMA 5DF0A 5EN2B 1YJDH 3OWEA 3BWUF 2FDBP 2QSTA 1U8HA 4WHDA 2VL4A 1DVFB 4XE0A 1TDQA 5F0MB 3WTTA 4HUVA 2CCLA 2IQ9L 3PABB 2YPLA 4K9EL 5DA0B 1ZLUH 4EJ1C 3PP4L 3X1BA 1NFIB 3QORA 4YHPB 4GINA 9CGTA 5D1QA 2EZ0C 5G4OA 4C83A 1XZ0A 4YE0A 4XWOC 4JY4B 1BM3L 3HMXA 4WHCA 2BY0A 3VVWA 4MNGE 4G9DB 2LU5A 2EDDA 4L8BB 1I7TA 4HXBH 5GGVY 4MRBA 3PWJB 3N43F 2WQUA 3MA9H 3EH3B 4NUGL 3WIHH 5IUSA 4WI4A 1BVKB 3ZSSA 4I0PC 1WC7A 2Q20A 1GW0A 1QZNA 4L8SA 5KVFL 1K4CB 3O0RL 3VGEA 3CFEB 2VQUA 3HZVA 4G6ML 3HFMH 4JO2H 2Z34A 4XVJH 4EVNA 4RFEB 1U3NA 5J3HD 5DJCB 1M6OA 1JXJA 4WUUA 4UIKH 3PWLA 5GS0C 2EVJA 3KBPA 2ZSVA 4WW2C 2YD5A 5EZIH 1XGTA 3AM8A 4JHBA 4IRZH 4Y19D 4X8JA 2RMNA 3V0WH 1E65A 4X5QA 2C3VA 1T66C 4Z7OE 1YEJL 1I3GL 1A0QL 2DRUA 2R2EA 1S5HA 3W2DH 5BOPA 4LKXA 2Z31C 1DVFA 1MSPA 4LEXH 4NAJA 4QPEA 5CXPA 3WXWL 3ZKMD 4AV0A 4DVBA 2WAQA 4DP4X 1T83C 2ADIB 3HC0A 1FE8L 2BFVH 3R7QA 2YJLA 1ASQA 1NJ9B 2H0FA 2DQTL 4A67A 5JZ7C 4PG9B 3T2QA 2COQA 4FQCH 1DQLL 3T8MA 2DV6A 3AQYA 4KTDH 3DO7B 3QWOB 3SCMB 3OMZA 4QTHA 5AZ2H 1SJEA 5DO2C 3EDKA 1HNYA 1L9NA 3HRZB 4LSUH 4ALAC 3RFZC 4MAZA 4Z78A 4N1HB 5DC2A 3IJ7A 2PTVA 4P2RE 4ZNEA 1QR1A 1CI5A 3S36H 3CH1A 4Y9FA 1YY9C 4AK2A 2DQMA 1FL3A 4P2YA 2CBMA 4U7MA 5D72L 3B4NA 2Y1AA 2DWSA 3NN8B 4LBEB 5JR1L 4MD5B 4NNXA 4G1MB 3V4PL 3K2UL 4W4NA 3WENA 3VXUD 4Y0GA 1H8NA 5AFAA 2XT1B 4E42B 1ZS8B 3B8YA 2NY0C 1CLCA 4HJIA 1LEKA 4RLDA 1HINL 1D7CA 4QRTA 4JGNA 3CPLB 1SMDA 4JRXA 1YY9D 1C08B 5IB3A 2HMID 4ZFGH 1QI5A 1YZZA 1ZHLB 4U3XA 2GJRA 3RVWD 6CGTA 5GSRA 3PDDA 1AS8A 2B8OT 5KVGH 5M94B 2F8XC 1H3TA 3HVDA 2K6YA 4WFHE 4DUVA 5L88H 5C2UB 1KGXA 1D9KD 1PLBA 1T2QL 3SBWA 1OGAD 2NYKA 2YEQA 3TP4A 1WICA 1HZHH 4G9FB 3VG0L 4G82A 2YXFA 4J3OD 1R34A 3KH3A 3O2WH 4M5YH 2CLZA 1MEXH 1TTAA 3IMUA 2HJLA 1A6AA 4FLOA 4XCNA 2GFBB 3UZQB 1NC2B 3KYKL 5FA3A 4K5MA 1BIIB 4WY7L 3VDCA 4AIZA 2VSMB 2IVFC 3VFUA 1EO8H 5DQ9B 1N9PA 3GBDA 25C8L 3EYOA 3PPSA 1BVZA 1U3YA 4AWJC 5D1XC 3KVPA 1WWWX 4ZK8A 4WENB 4XODA 3C6EA 1T1ZA 1ZANH 3IAQA 4R26H 1FDLH 2AGJL 2HRPL 1P4IH 1L3WA 3IYLW 1QR1B 1UURA 2MCPL 3TZVA 4PUBL 3BT0A 4YAQB 5I8EB 1L9OA 1U21A 2IIJA 4PV9B 4HU8A 2DN7A 2PCXA 5DZNA 4N8CH 4AL8C 2C3HA 4OZHF 3D39B 1MW0A 4ZAKB 1MQ8A 1P6AB 1AZBA 3KWVA 1E27B 4QOKE 2YQBA 2EE2A 4O58H 2CHWA 1A6PA 3BYTA 4TS6A 4UQ3A 3UAJA 4G8GE 1JZ3A 3IEAA 3KPNA 1TLKA 2BNUB 4KOBA 5EOTB 2UZYB 3NIGF 3R8QA 3T71A 4UU9B 5IVXF 1Q9LA 1S7TB 4F57L 5I82A 4GXFA 3VDAA 1ZIAA 5SX4I 3V6OC 2JLLA 1UZ8B 4X8JB 4RDQF 2OXHA 1AY1L 2N59A 5DD1L 4QYOB 4PYHA 3GBLA 4QOKD 4L29B 3UP6A 5DUBA 1MFCH 4G9FA 5ERWB 4GKSA 3P3UA 3PUUA 4PMEA 1WWAX 4FLRA 4MJ6B 5LCVH 1EZVX 3WO4B 5FDWA 2J88H 3TIEB 1HHKB 1KZQA 4H1LH 3F5WA 1U41A 2QVTA 2PCFA 5CGYD 2P8MB 2QQKL 5JQIB 3EZJB 3CWGA 4QWWD 2W65B 2VWEE 2DQEL 4FG4A 3DGCR 3G5YA 4FI7A 3CPUA 3ZTNH 4XPTH 3VH8A 4R8WH 4NN5B 3J2PA 2WLIB 3I74A 4LKCB 4R4ND 4S1RH 2J55A 4M48L 4BFKA 3NFSH 1EAPA 4M7ZB 5T1KA 4BZ1H 5EF3A 2XXGA 1GYWA 4N25A 3BE1L 1DZBA 4G7SB 3UPRB 3QFJE 4S1SL 5FAAA 3U1SL 1IM3D 3FQTA 1A1MB 4N8VG 1G9NH 1K8DB 4XAKE 4Z7AA 4GPVA 3DX3A 4X7SL 4BWTA 2AMUA 2X0UA 2XRAL 2BHUA 3NG5A 5C0FB 4N2KA 3RWDA 3RHWF 1W15A 4HDIB 5IVZA 2G4GA 1NTDA 3AXLA 5D1XE 4ANUA 1W0VA 5GPRA 3QHZH 4KKBC 1CCZA 4K23H 3M1CA 4KX7A 5D70H 5AW0B 3M7OA 2OMBA 1LP9A 1ZV5A 4N2CA 4Y19A 4LHUB 4ZFFA 2FH6A 3MFFA 2BZDA 3QYNA 2E7MA 4A2GA 2Q5BA 2IMNA 3M8OH 3GQFA 4WV1B 1ET7A 5EOCL 5FYJL 5HDLA 3T4AA 4ZPVB 3FUFA 4OZHB 4LPCA 4HOWA 1IB5A 5FYKU 5CJBA 4L3FA 4K9JA 1V05A 3BZDA 1VFAA 5AW1B 5T3XL 1Z3GL 4QO1B 5BUAA 2C1OA 2K6ZA 2X6UA 4Y1SA 4EI5B 4LOUD 1R17A 4N2LA 3ZR6A 1RZGB 4M6OH 3VXUA 4LVNB 2GVYA 1GGBH 3APMA 5CZKA 4NKDB 2VDOH 1NCAL 3MRBA 3OR7B 3TZVB 1AIZA 3K6OA 1RZIA 2C7UA 2O6EA 3WY2A 1KG0B 5CZXC 3ARGD 2VDQH 3TEWA 3HC3H 2EC9U 4JFOB 1O9VA 3VACA 4L29A 3O6FB 2DZEA 2XPGA 1HXYB 2BIHA 3S37L 3L3HA 5HDBE 1YO4A 2H2PC 3F12B 4I18B 3T08A 2H32A 4AIZB 3ECWA 3IRZA 4OW6A 1N3NA 4HXAH 1CYWA 2BX5A 3OKDB 4JFWA 2VYRE 3KPRA 1OLZA 4WWKB 2I60L 3M7FB 1VEOA 3AS0A 5AZEL 1XZWA 1OCCB 4E9YA 1VACA 2ZOKB 3KPMA 3PP4H 3ZMNA 1ZE3H 1UACL 5I2IB 4QHLB 1EO8L 1N70A 1J86A 2O30A 2KPWA 2FEDC 4J39A 3FOLB 1JZ5A 6FABH 3L95B 2F74A 3IPEA 1RFDL 2A77L 2VLJB 3L3OB 1MVUA 4JREB 2YKLL 3A6CL 2AEIT 5DRXA 4TVPD 1P4IL 3UBXI 3SGKA 4R3SA 2X2YA 2YPKA 1EDHA 2BSRB 2FWUA 2HG5A 4M8RA 4R2GD 1OSZB 3EG9A 3S36X 5EB9A 1CN4A 2BWDA 1UEMA 1WWCA 1UCBL 2WLNA 4JO2L 1ITBB 4YDKH 2AAVA 1BQ5A 3GZQA 2MQ3A 3NRFA 1XGYL 1YNLL 1H5BC 1F41A 4UBDD 3TO4A 4HWEL 4APQD 4BM7A 5BMFL 1FHGA 3DBSA 1M71B 3IDYB 5F0JB 2KKQA 4PW9A 4X6CB 4LOVA 4PJ6A 5DK2B 3MLSH 3KPSE 3LYRA 4C55A 3L48A 4F58H 4EUPH 1VGEH 1S7RB 3IN2A 4CVZA 1N7ML 1W6LA 4MQ7B 3AB0C 4LOEA 4OBSA 1ZWIA 3SDAD 1CGVA 5I23A 3AT0A 1B0GA 4I0PB 5DHVB 3OGOE 5JORA 1A2YA 3GPEA 4TOYL 3CX5K 3FSZA 4P05A 1LK2B 4CN4A 1H3XA 4H0LC 4Y4FD 2EICA 4Y5VA 2VCOA 2AITA 3A0OA 2L7JA 5DU7A 2IGFL 1M1SA 5E6ZA 4Y89A 4JPSA 3K4DA 3Q2NA 2KPNA 3U2IA 3UMTA 1H15A 2HT3C 3UGXA 1M56B 2P52A 5F1NA 4IKNA 3VMNA 1XBDA 1JZHA 1L0PA 3QJHA 1GGIL 1WFIA 4LIQH 4OGXL 5EPMB 1WITA 2CKBA 1R3HB 5I5JA 4F8TA 2VUKA 1E5YA 1NUFA 2Q3XA 1PY4A 3MGOA 2G5UA 5E1GA 1BZQK 3SKUD 5F3BA 3DOSB 4JO8A 4R8WL 1UEYA 3S3CB 4PJXF 3LKOB 1A47A 3ULSB 3QO0B 4ZJ9A 3ABZA 5KBDA 2F8OA 1MVFA 3OGCB 3RE0A 3EYVB 5AOZA 3L7FA 5H37G 3HBGA 2JNZA 3KCWA 4L8SB 2RFXB 4RMQA 3U1SH 1HL8A 1Z0NA 1NLBH 4HC1H 3O4LA 2I26N 4K71B 2AW2A 1Y0LB 1XB3A 3BKML 4FX5A 4AT6B 1A4KA 2Y2YA 3WJJC 3V4VH 4EOWH 4PGCA 2W9DH 3OHXC 2YGVA 3UYOD 2P5EE 4OQ1A 3FT0A 43CAA 5BS0D 1T6BX 3JWDL 4L2YA 1KCVL 4U1NA 5ACZB 5JW3H 2TSBA 3ARPA 3C8KB 1N18A 4QTFA 1P7HL 1JNNH 2AXJA 2EO9A 2P4AB 3BZ4A 3LH8A 4ZFZA 4I18C 5AW9B 3UH8A 1XSOA 3N44B 4N22A 4P5MA 4PHZA 3VI3A 4YHPA 5B1BB 4BFFA 1QASA 3F7VB 3K2IA 4N8PA 1NINA 2ZAHA 2D7NA 4JRYA 4MMZB 3RWIB 4ZW8A 1KGUA 2JCCB 2H2PD 5AUMB 4ZW6A 1YEWA 3C5XA 1HSAA 3KWTA 2QR0B 2A4ZA 2Z91A 5CEYA 1GH7A 2J8UF 2WJ7A 3L3KB 4XGZB 3GLAA 2PPFA 3TGXA 4YBHA 1A6VL 4HK3N 3RDTD 2DS4A 5BQDA 1GPOL 1KPRA 4GXUM 3F7YA 1RULH 3Q2CA 1INDH 1NAMA 2J8OA 4R96B 3RY4A 5C0EA 3QRLA 1DVYA 3HZVB 3C09C 4NHUB 2YJQA 4OJEH 4TF4A 3MR9A 3DO3A 1V3MA 1SPDA 4RGOL 3QGVA 4N0FB 3ZXAC 3RI5F 3L2LA 4CU7A 3RWGB 4EI5C 1XB8A 2IOMA 2EDTA 1WWBX 3SO3B 3UC2A 2OMZB 1E5AA 3BKCL 4M8QB 2Y9RT 3T0EE 4NQEE 3ESMA 4FQXA 4YX2L 2C4FT 2KHAA 4M6AA 4OT1H 3SDDD 3V8CA 1YNKL 4AV4A 1GAFH 3KVDD 1U2YA 2E46A 4Y2OA 4D9LH 4P9HC 3AREC 4X0KB 1OAYL 1Z6JT 2BP0A 2NT1A 2LOEA 2F19L 2NY5L 3QI9D 4LSPL 4PLKC 3RKPA 4XMPL 2BNQD 3NJLA 4N20A 4PSRA 4AZ8B 2J6EL 3QR2A 4MDRA 1AC0A 3V0AC 3GMPB 5CCJA 4GQRA 1KBPA 2H6PA 4O9HL 3OAUH 5ICZA 1KDJA 1TPXC 2Y69B 3NGBB 4Y2DB 3FZUD 2OJZL 3GBEA 1PG7L 4X6BA 1INEL 5EMYA 3JV5A 4TSAH 3OPZH 5SWSE 1E4HA 5D7JA 2QSQA 4CILA 1TQCC 2CXGA 3GTNA 1JPST 3CZFB 3WNLA 3HVNA 2OTUA 2NZ9C 1U8PA 3MX0B 1N0LB 4PRPA 4BFJA 2J88L 4QOKA 3BEVA 5F7HA 4XMTA 2LVEA 2KLTA 3OLEA 5FYKD 4XI5C 3OMNB 2QR0A 4OFPA 4XP9L 1I1YB 5DLLA 3Q8CA 2WV3A 3UTTA 3PS6A 4AGMA 4HKZB 5AUMA 1CG9A 1MCPL 2DL2A 1NCUA 1J9SA 3BP4A 5KVMC 2AEOA 4JX0A 2QV4A 3TBVB 1FI8C 3PDOA 1OGPA 5L6YL 2WBWB 4U0RC 3WY3A 4HPOH 5I6MA 1OO2A 4JLRA 4NQSB 2J5WA 3F83A 5CS7A 1WHOA 4M48H 4BSWA 4MRCA 8FABB 1C8PA 2RA1A 3VXSB 2NNAB 4NO3A 1KBWA 5BOJA 3KLAB 4AEIH 4WWNA 4TQ8A 1ONQB 2CIKB 3DETD 4YDLB 1C5DA 2J73A 4KJQD 3U7AA 4LCCB 3CZGA 3ARBD 4D94A 3ULVF 3BGFC 4OGAC 3LXBA 1RMFH 2DF3A 5CMAB 4OF6A 4E9LA 4U0QB 5KYYB 4JPKL 4B9FA 4NUPA 4IMKA 3FN9A 2V3FA 4KJYA 3K8MA 1U8OA 3SHSA 4M7LH 1B90A 1NC4A 2WK2A 4BFRA 5IJKA 3ROLB 2ENPA 2C9PA 3GSOA 3UJJL 1AHWC 1KXHA 4X42A 4F7EA 1GYVA 1RI8A 4JFSA 1D2PA 3LNGA 3RNQA 2GJ6E 2MFNA 1QKZH 2IGFH 5C09E 4RX4D 3T9WA 5I1HL 2WLZA 3L9EA 3RKDD 1F4XL 5T3ZH 1EPFA 2UWEF 4MNQE 1WG3A 4N5ED 4OIIH 4O2EA 4LIQL 2OV0A 5AYUL 4JQXC 4JW3A 2EYTB 2Y1YA 4MB3A 3E8UL 4RMUA 1LK2A 5T3ZE 2DBLH 1HXMA 3BFWA 4YXLH 3GKZA 1J87A 4LLWA 5I75B 1K5WA 3V0IA 2AK4B 4QXTA 4HHWA 1I1AA 3DMMD 4G8EA 3CLFH 3IDNA 3F7VA 1S7SA 1A21A 1OQXA 1ZHBB 4G71B 5C6PB 3I9PA 3WUWB 2NZ1A 2W07A 4FJYA 1ACXA 3TH4T 3WEAA 3HHMA 2APFA 3S3SA 4E36A 1G94A 2BIPA 3B3IA 3IJSA 4AM0Q 1S7UB 5KANG 4AX3A 4IRJC 1MAJA 4JO1L 4FQQA 1G9EA 5E6IA 1G4RA 3U46B 3K1KC 3QQ4B 1M05B 2EADA 3ZKQD 1PZSA 2MHAB 2GSIB 1DQDL 2HJKA 1NBCA 4OLYL 1OWWA 4KZEL 2F9BT 3OD3A 2WSPA 2Y23A 4LSVL 2QKIA 4K5NA 4UOZA 1JPFA 3BHBB 1UJ3C 1L9MA 1FLRL 2WUBL 1RZKC 2DJ4A 4JMXA 4NIYE 5DVKA 4XMKH 2EO7A 1WZ1H 1WAEA 5HY9A 4BCYA 3QDGB 2K9FB 1MJJA 1IM9A 4H88H 1FO0H 4MB1A 3IGUA 4F3FA 4GQZA 4N5EC 3CFBB 3NJMA 4OV5B 4R96A 2K6WA 2CDEB 3ZTJG 4KXCA 3K7UA 2B4CC 4J3SA 5CM1A 5CBEA 3Q5YA 3PWPB 3MLXH 4HK0A 4MGXA 1MNUH 2YKLH 3A6CH 1S7SB 1J11A 5GGRB 4O2FA 3TT3L 3B2UC 4ETQB 4UM9B 3BP7B 3EO1A 1I53A 2BHYA 5C0BA 2PO6A 1LDPH 4JPIB 4NZUH 4F20A 4F1ZA 4IIQB 2OK0L 3EDDA 1WDAA 2EDEA 3U7WH 3GI9H 3ZPDA 3D39E 3L3HB 3Q2VA 4CN1A 4PVMA 1AD0A 2QVFB 2BVYA 2GT9A 5BMFH 5C97A 1MCWW 4GKZB 1GRWA 5DEFB 3N06B 2VMDA 4MSWA 3QUYD 2DJSA 1IGFH 1I9JL 1OAYH 4LSPH 3AY2A 3RFZB 3L45A 4PGEA 1HEZA 4XMPH 4NRYA 4YDJA 3IDXL 4G3YH 5FKAA 3VXUB 5T1LB 2MQ0A 4JVPA 2FL5B 3RY6A 4FFZL 4NENB 4M02A 1TXKA 4MS8D 5K39B 3T1FA 4KROD 4XBGA 3PHOB 5E9DE 5CJOL 4AGLA 1J1PL 5BVPL 2YHGA 5FM4A 5BRZA 1SJVA 3U7YH 4WI3A 4ZXBC 4TKWA 4ZTOH 4I3RH 1ZDSA 2WLMA 3UTTD 3QQXA 4DGVL 3GLZA 5I24A 3ZHFA 4WK2B 3S8GB 2I24N 3ZKMC 3QRGL 1IC5H 4GI9A 1UXWA 1J0IA 3GT6A 4GAJL 4OLVL 4FHJA 1F97A 1AFVL 3MRMB 1FNGB 2NY5C 3DOHA 2Z9TA 3E7JA 3VX1A 2XWTA 5C0CA 1HNGA 3ECVA 4XXWC 1Q0XH 2OMVA 2HLFD 4OGXH 4CAGA 5IMMB 2VXSH 3EOAA 3UZVA 3LTVA 4MZIA 4NQEA 3S3PA 1ORQB 2VXVL 3CIQA 3T6VA 4B7IA 2Q1EA 4G5ZL 3U82B 1RH8A 4QDGA 1IAKA 4PY8I 3H55A 5G4NA 4F7MA 4RFOL 2PYEA 2OYKA 2ENJA 4JM2B 3QWRD 4XR8C 1BD2E 1MKFA 3BUYB 1U91B 2P48B 1E0OB 2V0AA 5F9JB 2LFEA 3FJTA 3FT2A 2FGWH 2DYSB 2QMKA 4ZS6C 3O3DB 1XCXA 3FU6A 1JWMB 3RL2B 5KVDE 4LLDB 1IJ9A 2PXYB 3V4VL 5E7BA 4UT6H 1VIWA 1ZJAA 3SZ6A 4Z0XB 2BY3A 1B9KA 1E40A 3A3YB 1FFTB 5KVDH 1NSNL 2ZX9A 1FGNL 4N2OA 4OUOA 3GMLA 2X10A 3SE6A 2XVBA 3ME0A 2X2IA 1CR9H 3HR5B 4NJAL 3G6JE 3C6LD 4P5TA 3WDIA 3BPNB 1XX9C 1KTLB 1QHPA 3VD5A 4BQCA 5I6KA 4ZUUB 4WDIA 3N3EA 3RU8L 2XN1A 2YPKB 4HWBH 4QHUB 1DR9A 2YXMA 3NEOA 4HUUB 4NCDA 2GJJA 3D18A 1CXIA 2DWXA 3VWKA 1FAIL 1KLUA 4HV8B 2WHVA 3VRJA 3QRBA 1GPOH 3O4LE 3VTTA 3VRLE 3CMGA 1X9LA 3DARA 3V0VB 1E7UA 1SBSH 2PP7A 4MXQD 3ZOAA 5LNEA 4XP5L 2L7QA 3ARDD 2SEBA 5J7CC 1UXSA 3G6JF 4JY5H 4HJTA 4YDIL 4MAYB 2NCEA 3KWUA 4UQ2A 3IB4A 1G7HA 4W9KC 2WKOF 2C1PA 4AIEA 4E9TA 4Z3EA 4E41A 3T77B 4BRVA 1AOHA 4M5ZL 4APXA 4TTDD 4X7DC 4OZIA 2LU4A 4IBWA 3MV9D 2B0SH 1U92A 3FSWA 3QZLA 5DD5H 4HKXA 3HNSH 2ZX7A 5HVGB 4W81A 3WIHA 2FT8A 4DN3L 2BHZA 1UA3A 4E9WA 3DHMA 3ECQA 3DIVA 4H8VA 1PGRB 4A2MA 1UD2A 4F33B 1K6QL 2XWXA 2DDQH 1QFHA 1DP0A 4IBLT 4JFDA 4PR5B 3RWHB 2NUPB 2ROYA 4L0YA 5C09B 1GGCL 1IKFL 3ZT6A 1QFWL 1JGDA 2GJ6B 4OF3A 1FN4A 1MHHB 3IMRA 3ULVD 5HHMB 2YFNA 3ZGIA 4N0CD 3D8MA 4BGLA 5J12B 3GMOA 4K3EH 4XMKL 3ZKXB 2IH3B 5IFAL 1GCFA 5GISL 3ULUC 3MV7E 4WVRA 5DJ6A 4HZ1A 1JRHH 3VFVB 4E9XA 2R69H 4M9PA 1GMEA 5IB2B 2Z1PA 1FV1A 5EO9B 4NFBA 3DOIA 3FDWA 3W57A 1R5VB 4YL4A 2FR4B 2QFRA 1TKWB 3CZLA 2V6HA 1BX2B 4N68A 4POZD 2BY1A 1QPKA 2AFNA 4HUWB 3QORC 4FQ1H 4P2OB 4V2CB 5D1ZI 4XWGL 2HJLB 2YUVA 1OKEA 2ZNWA 1KGCD 3UZEA 1DLHA 1EHXA 4DJMA 3SYAA 5KJ4A 1RK1B 4D8PB 1OY3B 5L6YH 3UAJD 1KTDA 2YWYA 1INQB 1F3JA 2GYSA 4X9GA 1E4KC 1E4KA 1MWAB 1UFGA 3DJSA 3B2PA 1OP3H 1FVEB 4AG4L 4EIUA 3WEXA 2BP3A 3QDMD 4PJHF 5GZND 3BP7A 3DUUB 2V2WB 3EO1B 4MD4B 2BVPB 5F96H 3ZBMA 1RP9A 4FTVE 3L1OH 4PCSA 1KIRB 2VL5B 5F6IC 3GMRB 4H8PA 1LO4H 2WOYA 4OLZL 4NQCD 4RIRB 5IEKB 4E0RA 1G7QB 4QRUA 4OLUH 5IMMA 5CKGA 3L3OC 5T1KB 1BMGA 5DJAB 1J8HA 3P02A 3FB5A 1YSOA 3VO0A 3UTSD 1QATA 8FABA 2B3IA 3DV4A 1G87A 2CO2A 4D9RD 1M2VB 2WANA 5BJTA 3D33A 3DX2A 3DHJA 4MCNA 3ZYJA 3BO8B 2KZWA 2DWEA 1XGPB 2GBAA 4CC0A 3L81A 1O9WA 2XWJB 3QPQC 3W9DB 5BW7A 3A4FA 3BRDA 2PPAA 4HMCA 4ZMTA 3CSYB 4HKJB 3IMBA 3BUDA 4AMKH 3DPDA 2ROXA 3K8KA 4JO4H 2ZE0A 3HZMB 5TE6L 1D7DA 4TULL 2B9AA 2DBLL 1BYPA 1MFBH 2HRHA 4PRHD 4QRQB 1FVCB 4QYOA 4NX0A 4YSAA 2ITCB 1U36A 3B7YA 3BUPA 1FF5A 3BQUC 3PXHA 4GRLC 3S5LG 3US0A 1EJFA 4KO9A 1M42A 1EEYA 1S7XA 2F54D 3KPPA 4BKTC 5EV7A 4S2SB 4JM2A 2OMWA 5EO0A 1WQVT 2G3XA 1HQ4B 2D3NA 2FRGP 4QRPD 5KEZA 4I48B 1DO5A 3NCFB 3IDMB 3QARA 4RSYA 2IG2L 1ET8A 5D2NC 2C34A 3WEOA 3QYMA 1SVBA 5DA4A 1HVXA 4KZEH 1AHWA 5C08D 3RUGF 2DWDB 3SO3C 2HJFB 1AGBB 2G9HB 4QNPF 5C0DB 4JN1H 1XSKA 4PJAA 5EU5A 4DEWA 1CF8L 3WNMA 5BPPA 3II3A 3SCMC 3ARFC 2WIIB 4PWFA 4Y7MA 3NDYE 4GFTB 4BSJA 2D31A 1XF3B 2UWEE 2FBOJ 3H53A 3PWJA 3Q6FA 3X14A 4N6RB 1NC4B 2IANB 5AL8A 3ARZA 3MRBB 3R18A 2VXQA 2WD0A 4KK9D 1LNUB 2VLKA 5GRUH 5FO9B 4H26A 2NDFA 3DIFB 2NMSA 1MNUL 3WNPA 4FA7B 1AYOA 4YSPA 3QORB 4ZSOA 4XP5H 2I27N 3LEVL 1XXFC 5F72S 3KXFB 5BZWA 4FDWA 3C6LC 1PY0A 4OFKA 4FXKB 3Q6GH 3OMAB 4LOFA 4DSYA 1KMGA 1MPAH 1P7QB 4PBDA 4X4MA 1V5JA 1DBKL 1KCRL 1CXLA 1X6LA 3D85A 4KQ4L 2Y7OA 4JN2B 3U6RA 2DIJA 2XQBL 1YEDB 4GIOA 4WFFE 3JUYA 1OGTA 3WE1A 3UOAB 5DD5L 2D7OA 2Y1VA 2H47C 2EH7L 3QNXA 5EZOH 5B8CB 3KPPB 2SODB 4QF1B 2J6EA 3PQYD 5DD0H 4TUUA 4MWFB 2GTWA 2EIEA 4PB9L 3O4OB 4LFHD 2FECI 1GGCH 2WXOA 2ZKWA 3GI8H 4OFIA 2FD6L 2NUTA 3VGDA 4U3SA 2AQ3A 3NYKA 3FCTB 4F37K 3OZ9L 1L9QA 5I5IA 4E41D 4PGDB 1A4JA 1HTYA 1FFOA 1W8NA 5CJOH 3W9DA 2Y7MA 1MELA 5GIRA 2FL5A 3EDEA 3MREB 4GO6B 4CMHC 1FBIH 3PWPE 3RIAF 5EIIG 1PKQA 4DEPB 1G6VK 4FFYA 3SYQA 4AY0A 4CVUA 4IRSD 2DQCL 3VA2C 2X4RA 4N2IA 5TE7L 3TC9A 2NXZD 5DGQA 4Z78B 4DAGH 3HG2A 1VFOA 3OLDA 4UTBA 3QWQB 2BVEA 3MRFA 5F1SA 5LVEA 5ICUA 6TAAA 3ULUL 3EW3B 2NLJB 4NN7B 4UYPA 1Z5LB 2DQHL 4YH6A 2EXYD 3IETB 1X5FA 2DM4A 3TN0C 2YAHA 1VERA 3TASA 1J8RA 1ZEAL 1NJ9A 2H26B 1GJUA 4RZCB 4YSRA 5DT1H 2EJ1A 4AJWA 5BQ7B 4XN7A 5ECJE 1UENA 3P2TA 5KYNA 5AKSA 2VR5A 2HN7B 3GSUB 2BSSA 1XSIA 5KVGE 1VB9A 3QUXC 2D4FA 3ZQWA 2VAAB 5IBUG 1CXHA 3HUJF 2KS0A 4P5KA 3ZUNC 5LGYA 3NRQA 4LARH 3CSTA 2BZ7A 3CDGB 1FFOB 4TSCL 1SXCA 4D8PA 4TNWF 3RZWA 4KV5F 1NZRA 1DHKA 1S9XA 4HALA 3HHSB 1PLAA 1ZT1B 2XBDA 1DQTA 4I9WD 3MN8A 12E8H 3B2XA 4J3OG 5JZ7D 4AYEC 3LDBC 1EHLL 5F3HA 5IR1A 3DPBB 1U4FA 1JXFA 1BYOA 2GSIA 2MHAA 4ORZC 1CD9B 2P5PA 1MJUH 1IRAY 3MROA 3BZ4B 2GUOB 4ZFZB 1U8CA 3FRPB 3TPUA 4W4OC 3EO0B 3I50L 2ZONA 1FORL 3IJYA 1KCLA 4JQVA 5T3XD 3O9WA 3D39A 4JZJA 3QCTH 4PRAA 3ISWA 4UI2A 2E86A 5C9JB 1JYVA 3OKKB 3VXRB 3QIBB 5LDUA 4KFMA 3REWA 3DSFL 3T65A 1SVCP 4JY5L 2VISB 3FFCB 3GS4A 1P69B 3ILQD 2GEQA 5I6LA 1RU9L 3NACL 5KBLA 2YC1B 3Q8FA 5D1ZA 5I0VA 2VLKB 1HIML 2XUWA 4YDVA 5EZLA 4HZAA 4AIOA 3MGTB 3T2NL 1TETL 4L4VD 3UEQA 2DEYX 4W6WB 3GMNB 2HSIA 4BINA 1PSKH 4MMXC 3HNSL 1TTGA 4TRPL 4IM8A 3TBVA 3ZYIA 3OXRB 1JZDC 3LH9A 4IIZA 5IROD 3JQOB 2OJEA 3N5AA 4G8FA 5E8EB 4G11A 4YLCA 4NM8L 2NT0A 2YARA 1KCWA 1VHPA 5BS0A 1MHPL 1M1XB 1XCQB 2BW5A 3C5JA 3X1EA 5IB1B 4XMXA 1Z9SA 2GY5A 1AZUA 5FYLH 2OX5A 5C08A 1XF4A 2NY3B 5ANMB 3FTUA 1WIOA 1UHVA 4FNLL 3ULVH 1VADB 2NZIA 3HLKA 2VR4A 3HG1A 2NR6A 1P5UB 3GZPA 2WYZA 3OG6B 2I32A 2R69L 4JL2A 4QKTA 4KUCF 2A7BA 2QPFA 4HWZB 4ODHH 4YR6B 4MQXC 2C9XA 1KTLA 3NAAL 4JG0L 4KPHH 1NWPA 4P5MB 5SWSB 5IZ7A 5FYJD 4XAWH 4GT7A 4PJBA 3HI6L 4FQ1L 5T3ZD 2ATKA 3NIFE 2FX9L 4XMUA 43CAB 1FYTB 2P7TA 4HUMB 5FFOA 1J8HD 5AVSB 1BD2B 4H0HB 4JDVA 4JM4L 4YFEA 5GS0L 1CICA 1G1OA 4B60A 4JRYD 2ZP8A 2ZWZA 4CUCA 1C1EH 3TPKA 1LMIA 1Q72H 2FBJH 2XSKA 5CHNA 4BRJA 1I1YA 5IK3A 3NSYA 4CMMB 2OYPA 1M1XA 3DETC 3PGDA 4YSQA 2K8QA 4OUUB 4JFVA 5GZOC 4H7VA 3MFGB 4FQXD 3P9WB 1LXMA 4XP4H 3LQAC 3EBAA 4MNGA 4P2AA 1QVOA 4L1BA 2DQJH 5C0EB 1A4JB 1EEZB 2ADJB 4UAHA 1A7NL 1SMAA 4XP6H 2UVEA 3U9PL 4EXPX 3NCCB 4X6BB 3QDMA 3FL7A 3MRIA 3GMNA 5TFSH 1OGTB 2YPLE 4B0MM 5EU7E 1CDYA 4NRZA 3ZDYB 4H8QA 1IFHL 4L4TA 1FRGH 3N41B 5DURB 3RAJH 4L5FE 1IFRA 4WTZA 5IJVB 1RUQL 3EGXB 2H26A 3G6DH 3AVEA 1FSKC 3DLQR 3JTSB 4FG2A 4XVTL 3KM2A 4JHAH 3WEXB 3L3GA 3DDGA 4LSDA 4KVCH 4MAUL 1HHJB 1HKLL 4LCVA 3DGGA 2R0WL 1UWXH 3QNYB 5AW8B 1F3JB 1A6TA 5EU3B 4HMEA 1TFPA 3QDHA 2A0LD 4AMKL 4ZXBA 4QLWA 3EH1A 4UT6A 3W0WB 1AMXA 1KPUB 1ZVHA 4J23A 2OMZA 3RB5A 3SDCC 3HLAA 3U83A 2H8PB 1KYAA 5C0GB 1YMMD 1QUNA 2JCWA 1RZKL 5A43C 1XR9B 1G1YA 5FF6B 5A16B 1BX2A 3NCJL 1RUMH 1P4BL 1TTUA 4OJFH 4P57A 2H3KA 4NM4L 5JOPD 3RA7H 5EU7C 2R4SH 1U3HB 4ANWA 4Q6IC 1NEZG 5I0ZA 1TZIB 4JY4A 4OD1L 1R3KA 2BP5M 2BIOA 1SMOA 1N8ZA 2DBJA 3OMIB 4TNWK 5JDSA 5JOFB 4ZZFA 3MMEA 1UQSB 4HUCA 2AK1H 3F58L 1VFAB 4L8CB 3TVMC 3U2JA 1NFIA 3BAYA 3LPGA 1DBAL 3QJFA 3CDGA 4Z7WB 4XVSH 3VQMA 3GB7B 5KYWB 5JHDB 2P8LA 2HN7A 1PJWA 4LLMB 1BCIA 4PJFA 1NAML 3P11H 1TJGH 3ATFA 1CDJA 1AIFA 2ZUVA 3BX7C 2NYYC 2UUDH 5HHVH 1ADWA 2NY2D 5J6SA 3BUTA 1MJUL 4M7JL 4C54A 1EGJA 1YC7A 1KF9B 5F7KC 4GG6A 3FXIC 1A7OH 2ZXGA 4GXVL 1UUNA 3QXAB 1DLHB 2JQAA 4HJSA 1NCCH 3VB9A 5EEUA 1LP9E 3L4WA 1SY6H 2VM9A 5HYJD 1E90A 5F7DA 2Z65C 5IB4B 1FNSH 5DEGB 2ZX8A 5DD6B 4EIBA 2Y36L 3FO0L 3BCDA 5C7ZA 4U33A 4D0BA 5JTWA 5KSVA 1H6FA 1NFAA 4FQPA 4CJ1A 3SPHA 2CJSA 3LV3B 3NH7H 4ERSH 2HKFH 2ZKMX 1EHKB 4QRPE 5DJAA 4HCFA 1EUTA 4PTUA 3VQ1C 3D4GA 5GZNC 1QSFE 4DQAA 4HVBA 1FYTA 2P7TB 4AQ1A 2MPVA 4GW5B 1M3JA 2BSRA 3VSUA 2VITA 5SWSA 1MJ8L 2A6IA 4M43L 1FHNA 5EBMB 1HXMB 3POCA 3HG1D 4A7GA 5A7BA 3MZGB 1FVEA 2OW7A 2P45B 4I48A 5DLMH 1E6JL 1TTCA 4HS6B 3WKPA 5BZDA 5TPWL 2N7SA 2X70A 4XNYH 5BUGA 1SBBA 1LO3H 2UXGA 4FNLH 2OQJB 4PJIB 2ITEA 5ISZD 2ZWSA 4WKZA 2CK0L 4HBCH 3K46A 4LMQI 4HLEA 4POZC 2HRLA 4WJ5A 4MD4A 2UY6B 3QEUB 4OKVA 5F0LB 4B3VA 3LQAL 1SN0A 3HNTL 2Q6WB 4FXTA 3BLKA 1FVCA 5MEND 3U4EA 1T2JA 4RGNE 4H25A 3ARED 4YE4H 3NAAH 4V1DB 2J71A 3S96B 1BHGA 1TJIH 3L5WA 3MO1B 4Y4FC 3J27A 3D52A 4F7MB 5EIIB 2XA8H 3ZK0A 1L3NA 5F9OH 3CSPA 4KROC 4QHKI 2GJPA 1CFSB 2VIRA 1CWVA 3GSXA 1JHLH 4M62H 3JV0A 1XGPA 5IB5B 3VFMB 4U1LA 5HYSG 4Z1PA 4KKQA 4PRDB 4WI0A 3GIZH 3OKLB 1L7IL 4WF7A 1F4WH 1KULA 1QPXA 2WSKA 2ZYIA 3SGDI 2EUZA 1FNGA 3DYOA 3Q7JA 4QXGL 4PW4A 1MCRA 5EC1A 2WZPD 4KX8A 5IVXE 5DT1L 4DGYL 3WIFB 4M5TA 1UD3A 1BM7A 3QFDA 2ICEB 3IU3B 3ZRSA 4P9HL 3QCVH 2FJFB 2CBQA 1OAJA 1V10A 3MODL 3QWNA 4I4WA 4I2XA 2VLRD 2C9AA 3PHOA 3ILPB 1IARB 4GAGL 4LDOB 3SGDH 4ONGL 1SHWA 3IGAB 1GZHC 1KUMA 1DLFL 4YFLF 5C0BD 1H9DA 3AWEA 4GAAA 1TJMA 3EFDL 3MCYA 3ISRA 2CR6A 3ARVA 3LIZH 2EIKB 4RNRA 4OI8A 1MFVA 1XV8A 2VC2B 4KI1A 1F3DH 3W81A 1DJSA 1QI4A 4QNPE 2LW3A 2GBVA 3GLDA 2XLLA 4F2ME 2FSDA 4JHAL 3CX5J 1F4YL 2NY1D 2OZ4H 3V4PA 1AC6A 4WRLA 4KVCL 4MAUH 5D6DC 5I71C 1E6OL 2KZ1B 2WKGA 3IFOB 4AOFA 2BNQE 4L1SA 1WZMA 4KRPB 4UDUB 4WJKB 4U1SA 4Z3HA 1KB5L 1CE1H 2NY2C 5FUCE 3T77A 1N64L 1QSFB 3TBTB 1JPGA 1RZGA 4IDJL 1NBZA 2VDRB 1S7TA 3C09B 4LNVA 4YHZL 2ATPB 2OLDA 4QHUA 3B9EA 1RZKH 1J5HA 3LRKA 4PJGA 4AQ1B 3QIWA 4U6HA 1YLBB 4UQ3B 1UXWB 3GEWB 1VA9A 4Q6KA 3ZHKA 2EUWA 1V54B 2RACA 2AQQA 2H6UA 1I8AA 3MJ9H 4Z7WA 2D7QA 1SDAB 1UA6H 2O6DA 3UBHA 4PG2C 5AW7B 1SYVB 2XJKA 4AVKA 2F18A 3QFJB 4NQVA 5HVHC 3KL0A 4U1GC 2FWOB 1F3RB 1NPJA 2C3WA 2XZCL 5ADPL 4TRPH 3M86A 2JF1A 3F58H 4WV1A 5DEGA 1ZLUK 5IB4A 3L3JA 3SBRA 1SUJA 3C2AL 2V7HB 1RUPL 4FQJH 3MJ7A 2GITA 1CLZH 2MIZA 1DQQB 3GWJA 1L5GB 4NT6A 3FB6B 4LL9A 2P43B 1OXYA 2QHRL 3TT1H 2XTLA 4A38A 4D2NA 4RGNC 1LE9A 2E5EA 4E9VA 3BVDB 2HKHL 1M9SA 3ENEA 3UO8B 3WJMB 3MNDA 1XF5B 3CVDA 4KRLB 3VWJD 2ZXQA 2ID5A 5K1JA 4F92B 2BSBA 2RH0A 1GR7A 1EZUA 2SEBB 2WN3A 1TZAA 5AVYB 4ICXA 1TMQA 2C9QA 2YA2A 3FFDB 4GKLA 2NTFA 5E4AA 1OAQL 2V9QA 5FYLD 1VZGA 4XAWL 4DP1X 2EXWD 5IM7A 2CBTA 3FO2A 1AKPA 4LCWA 2A6DB 1TJHH 1PEWA 1ID5I 3DDFA 2VLRE 2YLHA 4X0NA 4HUUA 5IQ7H 5SV4A 2X1XR 4I2XB 3UAJC 3VH8B 3LIUA 4NFDA 1I8KA 2RIKA 3RVTC 3HBZA 5ENWB 2IC2A 3SDYL 2XZZA 1BLIA 2DMBA 3KYMA 2ED7A 3MRDB 3HS0C 1MCDA 4HIQA 4WHTB 5CINH 4ONFL 3SKNB 3IF1A 4D9QE 4HS3A 1RZJL 1JPEA 3FTSA 2FEEI 4CSPA 1BVKA 3OKLA 4WI0B 2HLEB 4Z7QB 5D1QC 2FO1A 1YC8A 5CHNB 5EU4A 5CEZD 3N1MC 4P2QD 4OM0H 1NAKL 4BZ2A 1GVIA 1SFDA 3KPRE 4RWYH 4FYRA 1CDBA 2B1HL 3GDBA 1K4DA 2DWYA 1VF5C 2VR8A 1YUHA 1DBBH 1IFHH 2GIXA 4HBCL 3DNKA 2NXZC 3DTUB 1H3PL 2X4OA 1OSEA 5DDHB 5LAXB 5CSGA 3ZT7A 5C2BL 5MHSE 2NQDA 1SYSB 2BIQA 4FYQA 5F3FA 5D5MA 3ZR5A 1A6UH 1J5OL 4MYPA 4WZ9A 4GW4B 4KRPC 1I1AB 4GJTB 1ZA6A 5IG7B 3KR3L 2JI3A 2X70B 5AYTA 3WNJA 3IFLH 3MOAH 4U1HA 2ZCKL 3T0XA 4KI5C 2IDUA 3CVHA 1QYGL 3DJZA 3G04A 3GKWL 4P23B 5K9OA 2CBOA 1DVFC 4GKNB 4A2FA 3NSJA 4P04A 4PJXA 1OT2A 2A9BA 1FAKT 4D0DB 1LHZA 2VZTA 1NIBA 1RSFA 5HGAA 1D6VH 3EXLA 5E4EB 3V0EA 1MH5A 4WEEA 3J07A 1FH5H 1SEQH 1DL7H 2Q7NA 2VXQL 4H2AA 4JAMA 2Y3AA 3TXAA 4C4KT 5BW7C 2FJHA 4PQXA 5AVXB 3A23A 1CICB 2JKNA 3RIKA 4DGWC 3ASOB 5L4JA 3DRTB 4A7TA 5LO7A 3X11B 1A7QH 4A04A 5JW5A 1U3JA 3EG9B 2HTKC 4N4YB 1DBAH 5CCGE 3CQQA 3BP5B 1TTFA 3CH1B 3EJYC 1AQ8A 1QWNA 4R3SB 4LLYB 2CRIA 5DRXB 3LIZL 5ISZE 1EWHA 2UZXA 5AENA 1NGZB 1UH4A 3UBXG 3MUUA 4U6XB 3DV4B 1MW3A 3FFOA 4MVBC 1ZY9A 3E80A 5F21B 1PZ3A 5A2KH 1EQWA 1UWFA 2JKWA 2W0FA 3ZX1A 3FMGH 4U2ZA 2EYTA 4ABUA 3G6AA 2J8UE 1I8MA 5ANMA 2VZ1A 5JXEC 5TK4A 3LZLA 3N2JA 1BLNA 3F00A 4N90D 2DM3A 2EC8A 3C5JB 5BVJA 5EEVA 1FUNA 1R3JB 3L2MA 4BE5A 3KHQA 3WGUB 5E2TL 3PWPA 5E95B 1QLEB 2E76C 3D0VA 3FCGA 5I1EH 3LHPH 2O61A 4OIFA 5J1SC 2RCSL 1MRDL 2EKJA 4N2GA 3WKQA 2VDLL 3U0PA 5FV2A 4CMMA 3BP6A 1SDYA 4WI8A 3QUXA 3OPUA 3HRZC 5JQHC 5DI8B 5I17B 2UYLA 3ARXA 4R7VA 1V3JA 4Z7OB 3RL1A 3FU9A 2AZAA 5DZ9A 5ADPH 1OARL 1YUKB 2XNAA 3QEHA 4XHQA 4ZTPH 5EUOF 4GG6E 4PRIB 4LVHC 2V7NB 5GS3A 3IXTB 2NY6D 3LKQB 1JNLL 5CP7B 1W91A 3N85L 4CDHA 4YDZA 4G43B 2F0CA 2DLFH 4G72B 3K6NA 3BJLA 5TDNA 4A6YB 5KW9H 3S3DB 4BELD 3DUSA 2VNCA 2A6JB 3PWUB 4K5LA 2ZNXA 5L8KB 3IDGA 2J56A 1MHCB 5MI0C 2AQRA 4HH8A 5D7SL 2BNRE 4PSPA 5IUCA 5KS9A 1K3IA 4WWPA 3HPLB 7PAZA 4UANA 2XICA 4OCSL 3FO2B 1HHIB 1H19A 3HNTH 1CYGA 2WBJB 1PZCA 2G4EA 3EGXA 4IRSC 2Z31B 2A5UA 4GO9A 4B9IA 2VZVA 1P6WA 2H0JA 1NGQL 5K93A 4UNVA 3MV7B 1V3LA 4KDWA 5JIIA 4X6DF 1EXUB 3T2PA 4P9ML 1MZZA 4YPGA 1I3RA 1SDDB 1E9PA 4WWOA 3U0TB 1Z3RA 3WE6B 4OZFG 4POUB 4XT1C 5G2NA 5LNGA 1KIQA 1P7BA 4J3WA 1N2RA 4PJBE 5F2FA 1RZJC 1I9RH 3H7BB 4YHLL 4ONFH 1AE6L 5T5NF 2V8LA 2NY7L 4IS6B 1MFEL 1RIUL 4OF7A 1CZ8H 2Y2WA 2ESVE 4DKEH 1CQYA 3L5XH 1XSJA 2DLIA 2UUDK 1SOQA 3BISA 5DZVA 2DM2A 4EXKA 3D09A 5HSFA 1JL8A 3SE9H 3CBJB 3JUZA 4B6ZA 4U6XA 1QRNA 4OF5A 5ACLA 4OZGA 2JE8A 3ESUF 1A7RL 4WU5B 2X44D 1IC4H 4O02H 4I9WE 1CLYL 1H6UA 4FQHB 3H9ZA 1A8ZA 1CXFA 3RWGA 1T0MB 5IIEA 3CDZB 1S7VB 4M6MH 4MTMA 4NQSA 4BXVA 2OZNA 3STZB 4GLRH 1DO6A 3P3YA 5JHBA 2OZ4L 5E2WH 1TQCB 1OT4A 1Z9PA 4JFFB 4ODBD 2XC8A 4XP1L 4B95C 3HHSA 2AJZB 2QGCA 1JGVL 2YK1H 4M8QA 4XBEL 5DQJA 3LEYH 1CE1L 4O00A 4PJ7A 2JLPA 1UZ8A 3G6JB 1GL4B 4AEEA 4BSVB 2E9WA 3UTQA 2Y6SD 1WSST 2X38A 4PPTA 1RJLA 3L54A 2BVOA 4DZ8A 4KTGA 2KLRA 1MIEH 1OZUA 1JTTA 1DUYA 1CTMA 5HDBF 3WJLC 2D03L 2KUTA 1BLNB 3PFUA 4RWHA 4L9LB 5TH2A 1NANH 1JERA 1D5RA 3ECUA 4L4VE 1UA6L 1YEHL 2HVJB 1KGWA 3E38A 4ODSL 5JPNA 4BFOA 2IDFA 4BUQA 2HFEB 5HHOD 2XZCH 5AQ0A 4TTDC 2HYMA 4U6YB 1NGZA 2IF7A 1N3NB 5HI4D 4CU8A 1RUPH 4FQJL 4D7PA 4XH2B 3DYMA 1E42A 4L3CA 1BVNP 3TS8A 3MDJA 1AQKL 2JK5B 4J27A 3VXSA 1S8DA 4EN3A 3NFPA 1QWHA 3K5SA 5LCVA 5D9SA 3UBGA 4FADA 2AQNA 3FRPA 5IHWA 5H8DA 2VW6A 3LZQA 3K3QA 2ZYHA 1IBGL 2ARJB 1IVTA 1KG0A 2H1LM 2VW7A 3VD2A 2R15A 2W0LA 3G5ZA 4MKTA 4P3CL 4GMSH 3UYRH 3UGEA 2FB4H 4GAYA 2MPAL 3FMGL 3T3PF 3WFBL 5AW4B 1MRFH 1IZKA 2P28B 4WQOA 4PBVC 3VWJC 2CG9X 3N1QC 2GPZA 1IAIH 4NDMA 1XIWD 4LEOA 4YNYB 1OE2A 3ZDYE 4ZG1A 5FOBB 3ELAT 5GRZA 3GSVA 3L4YA 1JS4A 2GT9B 1B6UA 1F4HA 1TCRA 4KX9A 4CKVX 3W37A 3RVXC 5ABZA 1EJ8A 2F68X 5DHDA 2RTTA 4P5KB 5IM7B 3V52H 5IEKA 1IGJA 4B0MB 1FL6B 3SDYH 3KPSB 4P99A 3MRHA 3MKGA 4OBRA 1KEGL 4LSQL 4ETQA 4ZPTB 1G1CA 4B5ZA 4B9PA 2KBGA 1WBZA 2C9RA 4JRXD 3C9NA 2WNWA 1ZLWK 4FKKA 4XWOD 1M7XA 3FW6A 3FULA 3VGFA 6PAZA 1HL9A 2IAAC 3GXNA 3ULUF 4MJ5B 4FFYH 4NHCL 3CLEL 4PJEF 4Q9RH 5E6ID 1CURA 1P84J 2VRKA 4UNTA 3Q5OA 2YD8A 1EVTC 4KU1A 5CP3H 4N0CC 1TSHA 2ZP0T 5DS2A 3ZKND 4XBMA 4N0UE 5DWPA 3OR7A 1OTTC 2NY4C 4K73A 4P4KA 1BQLL 1QNZL 4X6CA 3F7KA 4DGIL 4NO0D 2NR6D 5L9DH 2MOQA 4YBQD 1B88A 3ETTA 4H5SA 3T0VA 1R19A 1SLWA 3IK2A 1J5OH 4DFIA 1QPPA 2IH1B 5I1CH 4RVBA 4GFXA 1HH9A 5L4MA 3ETBF 5E99H 3RVUC 1KIUA 2EEAA 4EDXA 3WMPA 1NGWA 4EUPB 5J6HA 1JWUB 5KAQG 2ENYA 5A6LA 1FCCA 3GKWH 1T7ZA 4GLRI 4QRRB 1X6NA 2W07B 4C4UA 3L08A 4ZMVA 4Z7NB 1NCDL 3MBWA 5D7EA 5EA0H 2ESVB 1ZHBA 4B9CA 4G6MH 4IOFC 3TYFA 5A2BA 5E5UB 3TBTA 1D3CA 3FB7A 3CV5A 4X7TA 4YVNA 2EDQA 1CZ8L 4PJ8A 4JREC 4IRZL 1A6WH 2B4CL 3V0WL 5HI3D 3WJLA 5J9PA 5F89B 5FUZL 2X4UA 5GGSA 4MQ7A 5ID0A 4MJIA 2Q7YA 4UNIA 1GS6X 1BYNA 1TO4A 3VXRE 4AEHH 3QUYA 1DJIA 5E51A 1OAUH 2YQ2A 1TVBB 4JG1L 1VPOL 1A7RH 3F01A 4F7TB 5KSAB 4HMDA 3T3PB 3TWYA 1A22B 3X1GA 5IOPB 5JW4N 1XDTT 3OAZK 1OAXL 3WS6A 5MENE 2E7DA 1IC4L 3U36A 5EZJB 3VWKC 4F8PA 1CF1A 3MBEA 3NP4A 2AEQH 1A1MA 5IT2L 2XU9A 3IGLA 4LO9A 1S3KH 3I02B 4PI0A 2CAKA 3IMTA 4L4TD 4RGMC 5LG6A 3IXAB 3BZEA 2CQVA 4ZO8A 3WN5A 2AMGA 4XBPA 5SWZE 4R97C 1PAZA 4ZXBB 5KBPA 2NW3B 1L9PA 1U8QB 4KZCA 5C0CE 3IMWA 5E4EC 1UT1A 2RB8A 5C07A 4MVBD 1PYWA 2VZ3A 2XN9E 3JZ7A 3LEXB 3QG7L 4IKKA 1AGBA 3JV6A 3A67H 2ITDB 4ZUUA 1X5JA 2IALB 2CHNA 3B6SB 4Y16B 5SX4H 4F15C 5JNYA 4N3TA 5HGDB 4JFZH 7TAAA 2RAMA 4X4ME 2R2HB 5MP6H 4DUWA 1HHGB 5D7LE 1J8KA 3SZKC 3HMWH 5JPNB 1Y18A 4NRZB 3TIEA 1MCJA 5GRVL 3QQ3A 4HIJB 1YQ2A 2PABA 3CVIH 4NQDD 3DO4A 1CLOL 5EEWA 2D3JA 1GGUA 5DQ9A 4K0OA 4QXUH 3K80A 4N9GB 3ZQXA 1DJWA 3GM0A 5D1ZD 5FHBH 1GCYA 4UQ2B 3U0WL 1JPSH 2H1PH 1OTUC 2AV1A 1TZHB 4BZ2L 2FX8L 4HFWB 1UVQA 2WO2B 4PRHE 3OF6A 1MCFA 4N24A 2X4QA 1JNLH 1MCNA 1G6RL 2XX0A 4UV7L 4LSRH 3FPYA 2CXKA 2YS4A 4NKDA 4RMRA 3P3TA 2BNUA 3IVKB 5D7JB 5KZCD 2B20A 4WCYL 3PYCA 2CBPA 2OMTB 3S7GA 4EBQL 3S8WA 2BVQA 4W93A 1UM6H 1E27A 4FRWA 4WDIB 3TEZA 1I1CA 2NY6B 2NXYB 3WFBH 3CXHK 3AG1B 2K7PA 4MA3A 4C56E 1PNCA 4GQ9L 3VCLA 4AQ8C 3C75A 1XEUA 5CJQL 1SOXA 4PJHE 4LP5A 3NMEA 5JPMA 3IDYC 2F7OA 1PW3A 1KWKA 4PR5A 3Q3GB 2CA4A 1LO0H 2VABA 1N6QH 1RJZB 3GRWL 4P46B 1F11A 1WISA 3FU8A 5T5FH 1JJUA 4LLDA 1H3WM 2XOTA 3MFFB 3KPTA 2PYFA 3WO3B 2YAOA 3MO1A 2UV3A 3HFML 1U91A 3FO9A 4AGQA 1VCAA 2B77A 4PS3A 1I9RL 3H54A 3PV6A 4MJ6A 5FDWB 5DQDL 4MB5A 3FUHA 3WE6A 2X9XA 5AALA 2B5IB 5C9KA 5AZUA 4C56A 1YCSA 4R4BA 4X9FA 3RVTD 4PJIA 1IT9H 4NHCH 3QG6B 4LE8A 2F8VA 3LKNB 3NTCL 2VR7A 2NX5B 3FB7B 4PIRF 1MLCA 3PJLA 4UT9L 4RQQA 5JXEA 1MI5E 3OX8A 4LEBA 2D8KA 5AVVB 4Q97A 4O02L 5JOEA 1F5WA 5T1JA 2N01B 2C3VB 4UV4H 3ILPA 3VXRA 5L9DL 3VNYA 1X5XA 3L5IA 4GG8B 4R83A 4FTVA 1DANT 3ZHNA 4ES8A 2DTML 3PWLB 4MNQA 5CWSA 2NW2A 3QJUB 4GQPH 5TDOB 2QKIC 2WOBA 3LMJH 1JGVH 2WY3B 3B34A 3MBEB 2W81C 3T4AB 1IUZA 3K81A 3II1A 1DVXA 1PQZB 3ES6A 4OFVA 4B7LA 1P7KB 5DWUH 3CN3A 5H2BA 3MQIA 1FNEA 1KJMB 1ZLEA 3DMMC 4MS6A 4Y5XA 4PB0L 1R4XA 3QJXA 3V4UH 1I7TB 3WU1A 1T1WA 1FYHB 1ZT1A 4G6JL 1W72L 1U92B 1OQOA 3O8XA 3ZZQA 2WZPA 4FERA 3EH5B 2PETA 1XIWC 2RBLA 4GIAA 1AKJD 2JKJA 2A0LC 5DZAA 3TBWA 1EJOL 4IBUA 4M8VA 3JTSA 4KXZH 5IB3B 3JWOH 1XH1A 2ZKYA 3OR6A 4HFUL 5L2KD 5FO8B 4KVPA 3REVA 4H13C 2PR4L 4FE9A 3WNKA 3L3DA 5KSAC 3MACL 1ZAGA 4YSDA 2QVMA 4DVBB 1FG2B 2EE9A 5DJ8A 2BCKA 1DJYA 4A6YL 1VRSA 3CXDH 2WXJA 3MLWL 5DJYB 1S5HB 4P23C 3FTYA 3SYCA 1S46A 2RQ8A 1Q9KB 3JWDC 2CDEA 4KUCD 3D51A 4ELDA 3N6YA 2JIXD 4MD5A 4F7CA 3ZYOA 4OZFH 4HKBB 1AANA 3R0MA 3MNMA 4LAQH 1WBYB 4QHNB 4UINL 1J5IA 3FN0H 4G6KH 4K5PA 1OP3K 4DKFL 3BUBA 4RFEA 4AYSA 2YD3A 4A39A 3VDBA 5AOIA 5DO2D 3RFRA 1RVFH 1LEIA 1BECA 4P57B 3CSBA 1A65A 4E5XA 3NSDA 4WIQA 3ALWA 2QKSA 1S9KC 1DSFL 2HRPH 4ZDHA 1T80A 1WFNA 3C5ZC 3FHAA 4ZD3H 3GSOB 1SFHA 1Z3GH 3BMVA 3WIAA 1H3UA 1F6AA 1YPZF 1O7DE 3AT9A 2IDTA 2CKBL 3BDXA 4DESA 4N85A 3B5GA 4K3DL 1DQML 5C8JA 1I9IH 4X8CA 3AC0A 5CLYA 4KAQL 1U3HC 1U33A 1H0DB 4B9YA 1IBYA 3EJZC 3OKEA 4MCYA 4N8UA 2ZCHL 2WBKA 1UGKA 3T8VA 2FX8H 1IEBA 2BY2A 3ZJAA 4K8RC 3CGTA 1AG0A 4NZJA 3VWJB 3MOBL 1OK8A 1DSYA 3PJSA 3TWCH 4U0RB 3GBNL 4LB8A 2XG4B 1N59B 1BBJB 2VAJA 2FO8A 2W9EH 3VU1A 2YUXA 1P7QA 4OV5A 3LH2H 5D2LB 1NIFA 1UWEH 1YN7B 3GJFB 2PPCA 5LXGL 3BKJH 1V7NH 4IRJB 3FAXA 3OKMB 4K3JH 5FR3A 4ZSOB 2H32B 1BXVA 1OIOA 2BSDA 2XYBA 4Z9KB 1TSRA 1QTPA 2DQFB 3WLWD 1BOGA 5CR1A 1K4DB 4J3VA 5EFIA 43C9A 1VZHA 4XBGB 1WLHA 5E9DD 2WXRA 6FABL 1KYOK 3QXVA 3QFJD 1T1WB 1G9HA 2FJGA 4U2YA 5E99L 4K07A 3P0VH 4HYTB 2HFTA 3FTGA 4LVHB 2OL3B 2R2CA 5GS0D 3Q3GA 3CHXA 1R5IA 3SDCB 1CE6A 2DQEH 3HE7C 1NPNA 4EI6A 1BWMA 3S5LB 2GFBA 3K2KA 2XXMB 4KUZL 3UZQA 4P3DB 3VI3E 3E3QC 3ZHLA 4EAEA 1LEIB 4NPYB 4LFHG 1DJXA 3EJUA 3VFGL 1WZKA 1LDSA 1BJ1H 3ZKXC 3SIKA 5DQDH 4JHUA 5EU3A 2UXFA 2YRPA 4L9LA 5TH2B 2YMXH 5F7MC 3AU1A 4YSUA 2OL3L 4MQSB 1NCBL 3CFMA 4MASA 1BXXA 1RLBA 4JFED 4LCWB 1KLGA 2QHLA 4AEHL 4LP4A 5KANI 4Q2ZA 4GRLD 4TNVF 3QJRB 5BUPA 2OI9B 4D3CL 1IL1A 2WLKA 1C5BL 2NOYA 3ARDA 3ARDC 5TDPA 1FLTX 5KYXA 4M1GL 4NWTH 4KMQA 4UZUA 5DUMH 4DTGH 2WXQA 4PV8A 4MXVF 2AEQL 3HHRB 2YXVA 4BD4A 1Q1JH 4K15A 1RHFA 4KGLA 4F9PA 2VR6A 4NWUL 3QIUA 2HUHA 3HI5H 4E68A 3ARFB 4HA1A 5DHYA 2AXFA 2FEDD 1K8IA 4AE1A 3UTSE 1CK0H 1U8MA 3ZKSD 3DROA 4TUJA 4IRSA 5JHDE 2FEEL 1J9QA 3V0DA 4UIMA 1IE4A 2LFGA 4NCC2 4NO5A 4QHMA 3BVVA 2RD0A 3D69B 1O7VA 3MCLH 1FZMB 2NY0D 5ALBH 1WA2X 1XTLA 3RDJA 2IEPA 1NCWL 2XY2A 2WP3T 1XL4A 3Q8AA 1QR4A 3QUMH 4M5SA 2XN9D 4W9ZA 1EAPB 3RY5A 4RRPG 2HRGA 3V95A 5F7WC 3GSWA 3VD9A 3APNA 3MUZ1 4PWIA 1OALA 1WYJA 3ATAA 5M7QA 1UADC 4JDEA 1VFMA 2IQAA 5T8IA 5SX5K 4GUQA 3VFTA 3U4AA 3I6LD 3KPSA 5E9AA 3FUMA 1RERA 4EI6B 3P30L 3BP4B 1OGSA 1T5WA 3GBML 3ECBA 4NHUA 3QQ9C 1P5UA 2XYCA 4V33A 3V5HA 3CAFA 5D7KE 4PHXA 3MACH 1AS7A 1IGCH 3U9UA 5HTSA 1CGYA 4MJIB 4CSSA 4YUEH 2XQYG 3KGTA 3MLTB 3U2SB 2BS71 4TNGA 1Z1WA 4ZMQA 5C3IA 2DQGL 2V5MA 5AOJA 2YMOA 4XCCH 1MAMH 4IQHA 3GSUA 1E9QB 3NSXA 1S9VA 3ULVE 1J0ZA 2ZXCA 2I5YL 1N59A 3ET9F 1IO4C 4AQEA 4HISA 2G5RA 2CNZA 2AEPH 4MA8H 3DUSB 3TOPA 4RA3A 4G9DA 4G8AC 1NPUA 2WO3B 1KTCA 3E0GA 4M3JA 1FV1B 1JZEA 1WFMA 4F2MA 2BSCA 3CZJA 3GRWH 3MRGB 1NGWB 5DJ6B 3PNWA 1MCOL 3NFNA 3TBCA 3TTYA 1WEJL 2C4XA 3RRQA 4PG2A 3CFCL 3QFDB 4ZO9A 3BIAX 1I7ZA 3VGHA 3NVQA 1KB5B 4Z5RA 2UYLB 2AJUH 2HFFB 4FZEL 3VM7A 3DBXB 3CN4A 1EDYA 4U1LB 4DQOL 5GGQL 3QEQB 4G2AA 5E2VH 2CH8A 3MROB 1OPOA 4KZDH 3RDTC 3GSXB 3CBRA 1R3LB 4GMTL 1FYTE 3TYGH 5K9KA 1Z9NA 1DUZA 4YEEA 4TLSA 4F58L 3CN2A 2O61B 2GW5A 3TWCL 5AB9A 3CFIC 2JKXA 3L4TA 2Y6SC 3R4RA 2OP4L 4UTAL 2G5BA 3EUUA 2APTA 2X4SA 3INUH 5C6TL 4DK5A 1A7PL 5DFAA 4FEMA 3MNZA 3WFCL 4WNSA 2BC4B 5ETUB 4G70B 3S48A 3WN6A 5B38A 1DBJL 2X4UB 1F8TH 2NQ3A 5GGSB 5JW4M 3QDGE 3CX2A 2VLJA 4XC1H 4XN5A 5B22A 2P8PA 3FB8B 1YNTB 5LNDA 1I7UB 4X80L 5DJ2B 4QHLA 3V6ZA 2VZOA 1PZUB 3B83A 4FQHA 1HHGA 5BXFB 4PS4L 4AL8L 1VEMA 4JZNA 4L8DB 1GGIH 3FQUA 4G9FE 3OHXA 2OMUA 3MHZA 3RDTA 1NBVH 1MCHA 1EAJA 4XO5A 3KL5A 2FSEB 4DPCX 1EA9C 1Z2KA 4Q0XL 1PYWB 4IRZA 3DXAB 2OM5A 3HE6A 3NESA 4XPAH 1E8ZA 4X5RA 1BFTA 4HUNB 3S0PA 2R83A 2LAAA 3QO0A 1CBVL 4ZOAA 5CZXD 5E08L 4OSUH 2BO0A 3VI4B 5CBAB 4WW1B 1OF0A 3G5XB 4JFUA 1OSZA 1UG9A 4TNVK 1YEJH 4R4FL 5D5ME 1N6UA 2J1WA 4NFCA 4TSBL 3SO5A 2P5WD 3F3HA 3UJIL 3O6FC 3WXWH 1I7ZB 2AK4E 4PJCA 2R56L 4JKLA 1I3RB 4RISH 3IJEA 2YQGA 2Y5TA 1UJ3B 3HE7D 4IBQA 1V7MH 3VVVA 5IW1B 5TQ2L 4A6YH 4MDIB 2QZQA 1U95A 4GIPD 4GUOA 3HI5L 4RCAA 5T5NG 2HTLC 3SE3C 1A2YB 1RY7B 1WP6A 3VXTA 3RWIA 3CK0L 3FF8A 1B0GB 1U8JA 3ZMEA 5EO0B 4Z95L 1DQJA 1FFRA 1JDDA 4MMXA 1JK8A 1ETJA 4NO0B 2W9LA 1FZOA 1NDGB 1QFUL 3UC0H 3T0EA 2EKSB 1NOFA 2D4DA 2EDWA 4HC1A 1WFTA 3BEWA 3X13A 4YN3A 3G6JA 4KNSA 3EYQD 2XQ0A 4ZD3L 4EZLA 2K78A 2HKAA 3DHPA 5ALCL 4Z7VE 1K85A 5JR1H 5C0RL 2VOTA 3TA3B 5JDSB 3WS3A 1NICA 3HRPA 4Q9QL 2PN5A 1F13A 1CL7I 5K39A 5HPMA 5J89A 4LCWE 5FYKL 5IW6B 1KEMH 5I0XA 3IFNH 3O2VH 2YZ8A 4S0HA 4CA4A 2WGNB 2PYFB 1AVAA 5EOCJ 5FKAB 1X9RA 3K0WA 4MJJA 1EXGA 4NP4H 2X9WA 5T1MA 1BJ1J 4QRRE 1R46A