2GBKA

Crystal structure of the 9-10 moad insertion mutant of ubiquitin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
MQIFVKTLTQVRELVGGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin
total genus 23
structure length 82
sequence length 82
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbkA00
2FIFA 5JH5C 2XBBC 5E6OA 3ZTCA 2KLGA 4AWJA 5CTRC 3W1YA 2KDEB 2JZ3B 1NDDA 2GBRA 2L00B 3W1SA 1TZ1A 4MGZE 4BKSA 2J0KA 4WJQA 4W9HA 5C23A 5KHQA 3DVNU 3DVGX 3EC8A 3MTNB 4XZ4A 2MA9B 2N1WA 5D7GA 1WR1A 3I3TB 4IM0A 3DPDA 2IBIB 1GUAB 1WJNA 3S2AA 5JHAA 4RM8A 2KX3A 2KHWB 1V80A 2L0TA 3EFUA 3MJWA 5DPWA 2MBQA 2LZ6A 3V6CB 2FCQA 3HM3A 4F1SA 2NPTB 1XT9B 2D07B 2CR5A 4EZJA 3APFA 3PHXB 4CO7A 3AU4A 1L7YA 2C5LC 2IY0B 2DHZA 2M0XA 4KDLB 1V81A 3PRMB 1V5TA 4JIOU 3PT2B 1U4AA 4LDTD 4DHJB 2MRPA 3AI5A 4GIVA 4EUTA 3TMPB 4NQKE 3VXWA 2MW5A 2LWPA 2L3ZA 5D2MB 3ZW3A 2LVQA 5C1ZA 4W9GA 5DPSA 2BYEA 1YJ1A 2WX0A 2HJ8A 2D3GA 2EMSA 3QC8B 2L8JA 3O65B 4BFRA 1P9DU 1E90A 3HHMA 2KWUB 4GMVA 1WRDB 1X1MA 3NHEB 2KFKA 2LVPA 4WWPA 2M4NA 3VH3B 3QK0A 1SE9A 1UD7A 3QARA 4GXBA 2R2QA 3R7QA 3TJPA 3TIXA 1WGRA 3VUYA 4GDKA 4MGYE 2K8HA 2KFKB 2FCNA 2CKHB 3PSEB 4G11A 2ZCCA 4IG7B 1S3SG 2CS4A 2K25A 4WWNA 4AJYB 2CHZA 2RPQA 4ZRIA 2PE6B 2FCMA 4HLEA 1I42A 1Q5WB 4TQ1A 2KO3A 4ANWA 3PHWB 4DDGD 1ZKHA 1WMHA 2AEHA 3A9JB 4NQLB 2Z0EB 1NI2A 2KLCA 4DXAB 4W9JA 4EOYA 4ZDVA 2N7EA 1WXSA 4DHJD 4M8NA 4ASWC 2NPTA 3IFWB 4FJYA 2AYOB 1WE6A 2MBOA 2NR2A 3OLMD 2JXXA 3QAQA 4F7ZA 4NPNA 1C1YB 4II2B 4EFOA 4W9DA 3ZNID 3A1QA 4ICUA 1QZEA 4P7IA 1EO6A 3RCZA 4W9EA 4MGKE 4MJSA 2DYOA 1KM7A 4LJOB 5IAAC 1Q0WB 3VUWA 3T8MA 2I1JA 2JRHA 4KVGB 3M62B 4W9FA 2LGYA 3U7DA 5JHBA 2WDTB 3A33B 2GBNA 4TV3A 2ZJDA 2C9WB 2D2QA 2L7RA 2KJRA 2JY6A 2FAZA 4FJVB 1P1AA 3KW5B 4NAWB 3JVZX 1S1QB 3KYDD 3A4SC 3QQ8B 3BY4B 4OVUA 3CF6E 3WIMA 4X57B 5HKHA 2KDFB 2XEWA 3NZSA 1GG3A 3ECIA 1GJZA 3M95A 1F9JA 5KHOA 4E3CA 2LVOA 2VRRB 2Z59B 3JYUA 1M94A 4GB9A 3VUXA 4BKGA 3DQVA 5J18A 3UQAA 2QHOA 4I6PA 5DPTA 5J2RA 3A9KA 3WAOA 4MM3A 2REXA 4NY0A 4HPLB 1P3QU 2KFJA 3H7PB 3ML8A 3VHTC 2BKFA 2IY1B 1MG8A 1OEYJ 2FUHB 4HVBA 2KJHB 3HM6X 3QA8A 4N9F4 3ZNHB 2GBKA 2MLBA 1E5WA 3H6NA 3IG3A 2KD0A 2KX0A 4MSMB 1VD2A 2LXCA 4KV2A 3IHPC 2KZRA 1V9JA 4NNJB 2D10A 2IO0B 4GDLB 4RM9A 2GMIC 1EF1A 1WXMA 3ONSA 4AUQC 3PREA 2MQJA 2N7DA 5DPRA 5L95C 1WR6E 2JUOA 2WX1A 3SHQA 4HXDA 1A5RA 3UIPB 3WA0A 1J8CA 2MSED 2ZCBA 4B9KA 1XQQA 1JRUA 2KQ7A 2DZKA 4JLCA 4WAAA 2BKRB 5D6JB 4II3B 4ANUA 2KN5A 1V2YA 3PRZA 2KK8A 2UYZB 2HE7A 1WYWB 4ZYNA 5LLIA 3ZUNA 1Z2MA 2DENB 2BWFA 1D3ZA 2PJHA 1TBEA 4W9CA 3PZDA 3A9JA 3UGBB 2NBWB 4HDQA 4IC7B 4PS3A 1WX7A 3VFKA 2FIDA 1LQBA 3WAMA 3HK0A 3U8ZA 2CHXA 2Z0DB 3V6EB 2EMTA 3RULA 5FR6A 2O6VD 5TR5A 1Q1OA 4EKUA 2OJRA 4KZCA 2K39A 3HIZA 3ZTDA 2N4FA 3QCAA 1IPGA 4PYZA 2LRWA 3PLVA 4W9IA 3APCA 3DBHI 3APDA 4ZRKA 4FLHA 1RLFA 1WY8A 3ZIMA 1GC7A 4MDKE 1YX5B 3RT3B 2O6VA 3SD5A 2ZNVC 3H7SA 1WGYA 1J0GA 1K8RB 2N9EB 2V1YA 4EEWA 2ASQA 1WXAA 2JF5A 3L0WB 2AL6A 1WGHA 2K8BA 5AZGA 3N30A 3H1UA 3IVFA 1WF9A 4I6LB 3VTVA 3CSFA 1TTNA 1RFAA 3VTWA 1WXVA 1EUVB 2O2VA 2MCNB 2KQSA 2DX5B 3L08A 3R66C 2KKCA 1R4NI 1WM2A 4FJZA 2AWTA 4K7UA 2KC1A 1P0RA 3NY5A 2RSUA 1WZ0A 1H4RA 3KH0A 2KXJA 4KDIC 5GMVA 2G4SA 3PV1A 1WH3A 4MJSB 5BO4B 2JZZA 3TL5A 3V60A 4DBGA 3OAWA 1V49A 1FXTB 2MX2A 3Q3FA 4GOCA 2A4ZA 3L16A 2HD5B 4WWOA 1V86A 4A3OA 3R3MA 3AXCA 1TGZB 3M63B 2RR9A 1OQYA 2JVCA 2KJ6A 3X23A 2JT4B 2CU1A 1WX9A 1XD3B 1GNUA 3H7PA 1KLVA 2PEAA 5CHVC 1LFDA 2LUEA 2JPHA 4DK5A 1E8XA 1NBFC 4M0WB 2O2VB 2NS5A 1SIFA 1SGHA 2WWZA 4HWIB 4JQWC 1PQSA 2OOBB 3PGEA 4KZ0A 2MBHA 4GGQA 2N9XA 4G50A 3DDCB 4CYEA 3KUCB 1RAXA 2Y5BB 4LCDE 4KIKA 2BF8B 4KIKB 2K8CA 2XK5A 4GSWA 4IWPA 2ZPNA 4BBNC 3JW0X 4GN1A 3ZNZB 4MSQB 2ZNVB 4JL9A 1UELA 2DYBA 3PRPB 4PS8A 2C60A 3WALA 2GOWA 1EF5A 3K9OB 4MGIE 4GDKB 3L54A 2MBBB 4J6IA 3PPAA 5CHWA 4E71A 4AP4C 5JZEB 3X0WA 1WGDA 4A20A 2J7QB 2KC2A 4ANXA 2KOXA 5G2NA 4HJKA 4GU2A 2DAFA 2N9PC 1V5OA 3V62A 4MEMA 3DOWA 4FHKA 3GZNI 3NS8A 3OJ4B 2M8SA 4E74A 4PS7A 1WM3A 5AEKB 4HPMB 1E8ZA 3UIOB 1I35A 1Y8RC 3PVLA 4EZLA 2BGFA 3B1LX 3ZRCA 2IZVB 3PS6A 2IYDB 2WYQA 1WJ6A 5E6PA 2W9NA 2NBVB 4BVUC 3UINB 3QHTA 2K6QA 2I1KA 4WJPA 1WJ4A 1VCBA 2IO2B 1YIWA 2CHWA 2KVRA 2KTRB 2LD9A 3KUZA 3LDZE 3QWZB 2KWVB 2RGFA 3QIJA 2O6VB 4M8MA 3RD2A 2KMAA 4AJWA 1LM8B 2UWQA 2YVCA 4B95A 4EZKA 2AL3A 2IO1B 3LJ3A 4AOFA 2DZJA 1ZGUB 1UH6A 3ML9A 3ZO5B 4G0NB 3ENEA 2ZPYA 3JSVA 2DYMA 3EECA 2L76A 4IM2A 2GBMA 2ZVOA 1KJTA 3AULA 3DBLI 4GDLA 4JGHB 2PPHA 2DZIA 3A4RA 2LASA 2IO3B 4XX5A 1WI0A 2G45B 1YX6B 2L05A 2EKEC 2LGDA 4FHJA 3ZKJC 5D94A 3PLUA 5LXIB 3MHSD 4XC2A 4BBNF 3A1QB 2NCNA 2LI5A 3RZFA 3CSTA 2HTHA 4MH0E 2BYFA 3N32A 3ZDMC 1IYFA 3BINA 3TBLD 2R2OA 1WIAA 3RZWC 3DCGA 2B3AA 3DVGY 1H8CA 1WZ3A 4TQ0A 3EHVA 3WAPA 3B08A 4FBJB 4TKNA 3ALBA 4BKTA 1LXDA 1R4MI 3L10B 2C7HA 2MBEA 4HDOA 1UZXB 1BT0A 3GOEA 3NZUA 2BPSA 4I6NB 2MP2B 1WMHB 3H9DA 3ZVVA 4F8CB 2K1FA 3Q3JA 3R7RA 4ANVA 1G6JA 1WGGA 2FCSA 5G55A 1OEYA 2NBUA 1P98A 4K1RB 4WJNA 4G3XB 2KTFA 4DWFA 5J17A 5EDSA 3AU5A 3KVFB 4BKSD 1J19A 4FULA 3ZNGC 2ZVNA 2KWCA 4NAWA 4URKA 3L17A 5DCNA 4HCPB 4TUUA 4RMAA 2V3SA 3KYCD 3OJ3A 2FNJB 3PTFC 4KSLC 3L13A 1YD8U 3CMMB 4ICVA 1AARA 5IA7A 4OVVA 1UBQA 2C7MB 2YLMA 3RUIB 3B0AA 2J0JA 3K9PB 2KDIA 2J0MA 1CMXB 1ZW7A 3P2BA 4NJ6A 4FA6A 4WQOB 5CHFA 2KNBA 3A9KB 3DBRI 4WJOA 5L83A 1OGWA 1IP9A 4BOSC 3WANA 2V4LA 2MP2A 4BOZB 4HK2A 2LXAA 3NOBA 2L0FA 4DHZB 1HE8A 2LGXA 2NVUI 1UGMA 1UBIA 4DDID 3KUDB 4YL8A 3RYTA 3IBEA 2LRUA 2M17A 3SDLC 3N3KB 3QJZA 4DHZE 1WX8A 2KMCA 4K7WA 1E8YA 2ZZPB 2D11A 2KDBA 2K6DB 3W1SC 3D32A 4KSKC 1YQBA 4FADA 1WE7A 3V61A 1WJUA 2M1MA 4NJ7A 4IW0A 3ZRFA 2DZMA 3VH4B 5E6NA 3UQBA 5CX3A 2BWES 3ZDTA 3C0RB 3DBSA 3TCAA 3VAWA 2DAJA 1C3TA 2C7NB 4K81A 4LJPB 3DVNV 4IWOA 4A3PA 4IWQA 1GC6A 3QX1A 2BYVE 3SU8X 3VDZA 3JSVB 2GBJA 4CHKA 1E8WA 2KANA 4PYUA 2N1VA 2JRIB 3VVWB 3UF8A 2JWZA 2G3QB 3VQIA 1E7VA 1L2NA 1ISNA 5AZHA 2LJ5A 3VTUA 1OTRB 3U30A 1V6EA 3M3JA 4B6WA 1E7UA 4ZRJA 5AZFA 3T9LA 2PE9A 4LDTB 3ZLZA 1Z5SB 1T0YA 4K7SA 2A5UA 4FN2A 1WFYA 5LXHA 2ZEQA 4IM3A 4HCNB 4MELA 2KTRA 1KOTA 2G4DB 2MWSB 2XK5B 2RD0A 4W9LA 4IUMB 4W9KA 1RRBA
chains in the Genus database with same CATH superfamily
3R8BA 1FM0D 1YN3A 2L00B 1TZ1A 2J0KA 3EC8A 2BB6A 1VLBA 2JXTA 5BMHA 2L32A 1GUAB 1WJNA 1ESFA 2KX3A 2L0TA 2J4XA 2MBQA 3N1YC 2FCQA 4LNIA 2NPTB 3FILA 1XT9B 2Y5PA 1MFWA 3AU4A 2C5LC 2IY0B 2L83A 2M0XA 3TEXA 1V81A 3PRMB 1I4PA 4LDTD 3AI5A 3RNFC 4NQKE 3TMPB 2MW5A 2LWPA 3N1ZC 2JX5A 2L3ZA 5D2MB 3ZW3A 5I4DA 5DPSA 2W82A 3AEAB 3Q14C 2WXLA 4BFRA 1P9DU 1E90A 2KWUB 4GMVA 4B0MA 2LVPA 4WWPA 4RGTA 3MFGA 1TJEA 4GXBA 3TIXA 3AE2B 4IG7B 2GI9A 2CHZA 4HLEA 2PE6B 4ZHPA 3FAHA 4MACA 2DNFA 2AEHA 4LLGM 1UUPA 4ZDVA 4M8NA 4ASWC 1WE6A 2NR2A 4F7ZA 2JXXA 3MC8A 3P4PB 4W9DA 5G5HA 1E0ZA 4MGKE 4MJSA 1Q0WB 3VUWA 1T0QC 2JRHA 4KVGB 2LGYA 3MJ5A 2VH2A 2B76B 1KTKA 1T6BX 3LB8C 2PW9A 1V1OA 1P1AA 4US8A 4GLSC 4L2YA 3CF6E 1ROEA 4K3BA 3ECIA 1GJZA 4DXGA 4E3CA 4AS1A 1JWAD 2Z59B 3VUXA 2PMVA 3DQVA 2YEPF 3IAM1 3A9KA 4JWUC 1WRIA 2JQRB 4NY0A 4HPLB 3Q6BA 2BW2A 2FUHB 2WNMA 3HM6X 3IG3A 2H89B 2KD0A 1C4CA 1B1ZA 4BAXA 3IHPC 4OVZA 3I57A 3V3XA 1SE4A 3I5JC 2MQJA 2N7DA 5DPRA 1ET9A 3DBHB 1J8CA 1XEEA 2MSED 1GB4A 3TUOA 4WAAA 4II3B 4C4VB 1V2YA 1SBBB 4C4VA 2HE7A 1WYWB 2N9LA 1Q10A 2BWFA 1J7CA 2V3PA 1CJEA 4L1BA 1K50A 1EU3A 3HK0A 3U8ZA 5EE0A 2EMTA 1VZ8A 5TR5A 5EE3A 3QCAA 1IPGA 3PLVA 4ZRKA 2XNAC 1WY8A 5LNK1 4MDKE 1YX5B 3H7SA 2K22A 2I2YA 1J0GA 2N9EB 2V1YA 3L0WB 1L0YB 1WGHA 4XWWA 5AZGA 4CQNA 1FEHA 1EUVB 2MCNB 2DX5B 4TSSA 2KWDA 2WXNA 1GB1A 2G4SA 1WH3A 2N9KA 3FKYA 2MX2A 3Q3FA 3Q8EA 1J7AA 2D3AA 2JVCA 3E9SA 3ETRA 3X23A 2INCC 3ZXVA 2LUEA 3RFZB 1JWMD 1SIFA 2WP9B 2OOBB 1OQQA 3PGEA 4GGQA 1I4XA 1I7HA 3MC0B 4BBNC 4GN1A 3T3OA 1UELA 2DYBA 3WALA 4MGIE 2ZW1A 4AP4C 2J7QB 2KC2A 4HJKA 1FCCC 3NVWA 1QOFA 3NS8A 4YT0B 2M8SA 3AB5A 1GAQB 5AEKB 2AQ3B 2N0SB 1V1PA 4QAYA 1I35A 1Y8RC 4EZLA 2MH7A 3B1LX 4WQMA 2IYDB 1WJ6A 3RMKC 5E6PA 2W9NA 2KVZA 2K6QA 2WXHA 3KUZA 2IO2B 2KVRA 4JX1C 3KLSX 2UWQA 4OZCA 3LJ3A 2DZJA 2JWUA 1KH0A 4G0NB 3ENEA 2BYTA 3EECA 1MI0A 2ZVOA 1C79A 2BB5A 2PPHA 1PUTA 3A4RA 2IO3B 1WI0A 1YX6B 3MHSD 4K3CA 4BBNF 2NCNA 3CSTA 2HTHA 3AEEB 1FFVA 1IYFA 2UU7A 3WAPA 4HDOA 4D2KA 1UZXB 3GOEA 2BPSA 2WU2B 4C00A 4I6NB 3ZVVA 1WMHB 4F8CB 3Q3JA 2NBUA 4LNKA 5J17A 1MJDA 5EDSA 1J19A 5C2TB 1XO3A 1YNTE 3LXFA 4C56C 1QOBA 3AE9B 1JCKB 3AN1A 4IKGA 1IGCA 1TT5B 2KN4A 1F2RI 1IP9A 4BOSC 2V4LA 1TYGB 2H88B 3DWMA 2LGXA 3EGRA 1UBIA 2DBYA 3I9V1 2KMCA 2RDHA 4K7WA 1FPYA 2KDBA 1JWBD 1TKYA 3W1SC 3D32A 4RFBA 4NJ7A 3ZRFA 4IW0A 2DZMA 4H2AA 1F1HA 4IWOA 1UF0A 1R4NB 4IWQA 1XF5L 1GC6A 2BYVE 5BMGA 2KANA 2N7JA 2N1VA 2JRIB 4EE2A 3DWGC 3VTUA 2OJWA 4B6WA 1E7UA 4ZRJA 4LDTB 4K7SA 4FN2A 4MELA 4IM3A 4HCNB 2IGDA 1MHXA 3RNCC 1QOAA 2XBBC 3AE5B 5E6OA 3VR9B 4AWJA 3W1YA 2JZ3B 4BKSA 4M0WA 5KHQA 2GB1A 3DVNU 3MTNB 4XZ4A 2MA9B 3BVZA 3W2DA 1WR1A 3I3TB 3S2AA 5JHAA 4RM8A 1ZXHA 4LNNA 1V80A 3N9YC 5BYRA 1TS2A 1Y56A 3DHIC 3OG5A 2MEKA 3APFA 3AMZA 3PHXB 1ENFA 2DHZA 1D5ZC 4KDLB 4LNFA 4DHJB 4EUTA 1DOYA 3VXWA 3LYYA 1PFDA 2WS3B 1V1PB 1C77A 1UNSA 2HJ8A 1OFFA 2EMSA 1C4AA 1UWXA 2E3TA 3NHEB 3R2IA 1FO4A 2M4NA 1DYQA 3VH3B 3QK0A 1XLOA 2R2QA 3R7QA 2LGSA 3TEWA 4GDKA 2KFKB 3NS1A 2PKOA 4WWNA 2BBCA 1SE2A 1I42A 1Q5WB 1YMHE 3BVMA 1FNUA 4TQ1A 1ZOYB 3PHWB 1WMHA 3A9JB 1NI2A 2VH1A 4EOYA 4JWSC 1YQ4B 2LHDA 3QAQA 2SAKA 4II2B 3ZNID 2Y5CA 4ICUA 1QZEA 5AUKA 1DOIA 4ZRQA 4W9EA 4LJOB 2VZKD 2JYTA 2WQYB 3T8MA 1YOVB 3M62B 4US9A 5JHBA 2WDTB 2GBNA 4TV3A 2L7RA 4XDCA 2KJRA 2JY6A 2IDYA 1RFKA 4WH4A 2KACA 3Q2AC 3A4SC 3GE3C 3BY4B 4X57B 2FBWB 3NZSA 2FUG1 1E9MA 3M95A 4PK1A 3JYUA 4GB9A 3Q3OC 1P7FA 2WXOA 1GOZA 2WXKA 5J2RA 1QOGA 1JROA 5DPTA 4WAFA 2REXA 3ABVB 2KFJA 3H7PB 1T0RC 3VHTC 2IY1B 2ICIA 1MG8A 4HVBA 3ZXRA 2KJHB 4N9F4 2GBKA 1E5WA 3H6NA 2BS2B 2V4IB 1WYGA 2IO0B 4GDLB 1N5WA 3AH7A 1WXMA 3ONSA 5JXVA 5T8IA 1C78A 2WX1A 1PDXA 5IOIA 1HZ5A 2WDRB 1XQQA 1R7SA 2BKRB 3H8HA 3AECB 4ZYNA 1UWMA 1Z2MA 2PJHA 1TBEA 2HDEA 4HDQA 5BYQA 1KF6B 4PS3A 2J42A 1WX7A 4HKZE 2LUMA 2CHXA 2WXIA 2Z0DB 1J7BA 1Q1OA 2M19A 4L23A 2VZKB 3EUB2 2K39A 3HIZA 3ZTDA 1UGJA 3BYTB 1FFUA 3APCA 3DBHI 3APDA 3C19A 1GC7A 2O6VA 1HEZE 1WGYA 5BMIA 4EEWA 2NTSA 2JF5A 1WXAA 2AL6A 2X8XX 3PZ7A 4J3OD 3VTVA 3VTWA 2V0GA 2KQSA 3L08A 3RI7C 1N5XA 1I4GA 1H4RA 2KXJA 3PV1A 4MJSB 1TY0A 2JZZA 3TL5A 1V49A 4GOCA 3L16A 5MPOA 1ACCA 1FXIA 4A3OA 3AXCA 1MVKA 2E6XA 5D3DA 2CU1A 1XD3B 1GNUA 1KLVA 3RNAC 3W5VB 3FC4A 2PEAA 3DBLB 5CHVC 2WXPA 2JPHA 1E8XA 1NBFC 2O2VB 4JQWC 2NS5A 1SGHA 3GZNB 4KZ0A 2N9XA 3AV8A 2WXQA 1RAXA 4KIKA 2K8CA 2XK5A 2ZPNA 2INPE 2ZNVB 3PRPB 4M00A 2C60A 2GOWA 1YN4A 3P42A 4GDKB 4J6IA 3PPAA 5CHWA 3X0WA 4ANXA 3CWIA 4MEMA 4KGRA 5C3JB 4KGSA 5HI1A 4FHKA 3GZNI 3OJ4B 1WM3A 4YSYB 2BGFA 1CQVA 3PS6A 3TSSA 4A6QA 3HVZA 4BVUC 5AUIA 3QHTA 4A55A 2WXMA 4WJPA 2LD9A 1YIWA 1QLBB 2CHWA 4AJWA 2YVCA 2AL3A 2IO1B 2PIAA 3Q69A 2ZPYA 3RPFC 2GBMA 4JGHB 2W3SA 4JE3B 2G45B 4RF1A 3ZKJC 3AEFB 3EFCA 3PLUA 1M4VA 3AE7B 2JZPA 4MH0E 3Q3MC 3DHGC 1E6EB 3N32A 1F2RC 3BINA 3RZWC 3DVGY 1WZ3A 3EHVA 3B08A 1FNWA 4TKNA 1IGDA 1LXDA 1R4MI 3L10B 2C7HA 3NZUA 2MP2B 3IT6B 4M02A 4ANVA 1G6JA 1WGGA 3W9CB 1TS4A 4K1RB 4WJNA 2KTFA 4DWFA 3AU5A 3KVFB 4BKSD 4FULA 3ZNGC 3TEYA 2KWCA 4N58A 4URKA 5GXGB 1JWSD 3PTFC 3L13A 1EWYC 3CMMB 4ICVA 5IA7A 4OVVA 4N6EB 2C7MB 2YLMA 1C9FA 4C80A 1ZPSA 4MM3B 5CHFA 5L83A 3DBRI 4WURA 2MP2A 2LXAA 3AEBB 4DHZB 2LEKA 2NVUI 3KUDB 4YL8A 3RYTA 3IBEA 3N3KB 2X38A 1WX8A 1E8YA 2M1MA 3AE3B 4XGAB 2MJEA 4YWGG 3AEGB 3DBSA 3VAWA 3KQ4A 3P4SB 3DVNV 4A3PA 1RYJA 1JALA 1SE3A 2Y3AA 1VZ7A 3V05A 1TIFA 3VVWB 3UF8A 2W55A 2G3QB 1L2NA 1R4MB 3U2SC 5AZHA 1OTRB 1V6EA 1XLQA 3M3JA 3ZLZA 1T0YA 1KRHA 2L1AA 4XDDA 2ZEQA 5LXHA 2KTRA 2MWSB 2V9HA 2XK5B 4W9LA 4IUMB 2FIFA 1QQRA 2KDEB 2PTLA 4RCOA 1NDDA 3W1SA 4MGZE 3U4EG 5C23A 3DVGX 4A90A 4ZRPA 1TKEA 3DPDA 3MJWA 5DPWA 2LZ6A 3HM3A 4F1SA 3B2FA 2K5PA 1SF0A 1XXGA 1RM6C 1V5TA 4JIOU 2W3RA 3PT2B 2MRPA 2NTTA 4GIVA 2YEPB 3BWUD 2LVQA 5C1ZA 2BYEA 1MPEA 2RDGA 4R3DA 3B2GA 2D3GA 3QC8B 2L8JA 4OZAA 4AQ7A 5EE1A 1WRDB 1X1MA 2WXJA 3IXSA 4BZAA 4XYCA 4OW0A 4XWTA 2MJDA 3VUYA 3I63C 4OZBA 4MGYE 2K8HA 4O1NA 5IO9A 2FCNA 3PSEB 5H92C 2PLPA 4G11A 2ZCCA 1S3SG 2WGSA 4HJGE 4AJYB 4A8XC 2FCMA 3VRBB 1K51A 4ANWA 3N20C 2Z0EB 4DHJD 4YTMB 1ZE3D 3SFEB 2AYOB 3BZDB 2MBOA 3OLMD 2G1EA 1VRAB 1I4QA 4OHJA 4EFOA 4P7IA 1EO6A 3RCZA 2DYOA 1KM7A 3UI3A 1MHHE 4W9FA 3A33B 2C9WB 2D2QA 3AE6B 5IN7A 2LFIA 1FD6A 3KW5B 4NAWB 1S1QB 3KYDD 1T0SC 3CIRB 4OVUA 3WIMA 2HJ1A 2HTME 5HKHA 1GG3A 5HG2A 1F9JA 5KHOA 2VRRB 1AYFA 1M94A 4P6VF 2MJ3A 4BKGA 5J18A 2QHOA 3WAOA 3AEDB 4MM3A 2ACZB 4WIPA 3QA8A 3ZNHB 2AQ2B 2KX0A 4A9AA 1VD2A 4KV2A 4NNJB 4RM9A 2GMIC 1EF1A 4AUQC 1N61A 1WR6E 2JUOA 1T3QA 2XN9C 1K52A 3WA0A 2ZCBA 4B9KA 2KAJA 1DGJA 2DZKA 5D6JB 4ANUA 4ACFA 2KN5A 3PRZA 1L6VA 2KK8A 2UYZB 1L5PA 3SEBA 3ZUNA 1T5XD 2DENB 3UGBB 3A9JA 4M01A 1VR9A 2WXFA 4HEA1 2D3BA 3WAMA 1LQBA 1HQRD 1SB3C 3V6EB 2BVCA 4EKUA 1ZP0B 2N4FA 1IUEA 4PYZA 4NJCA 2CJNA 4FLHA 2GRIA 3ZIMA 2FE8A 2BT6A 2Q5WD 1CZPA 2ASQA 4IDIA 2ZW0A 3IVFA 4ITKA 1WF9A 1TTNA 1RFAA 3T3NA 2KKCA 4MT5A 1R4NI 1WM2A 4FJZA 4K7UA 3NY5A 2RSUA 3BIID 3U52E 4YSZB 3GE8C 4KDIC 5GMVA 1FXAA 4WWOA 1V86A 3R3MA 3B9JA 3M63B 2KMMA 1E7PB 3H7PA 2QMTA 1A70A 2Z8LA 1LFDA 3EA6A 2V3NA 4M0WB 2CJOA 4HWIB 4RGNA 1PQSA 2MBHA 1D5XC 3DDCB 2L52A 1AN8A 2OHFA 2TSSA 3DBRB 4LCDE 1MG4A 4IWPA 3JW0X 3ZNZB 2QCZA 1L6UA 3K9OB 3L54A 4B0EA 4E71A 5JZEB 4HRSA 4A20A 3GP7A 2KOXA 1V5OA 2PVGC 3V62A 1ZUD2 1DOXA 3GS2A 4PS7A 2M0AA 2WXRA 4HPMB 1TKGA 1YJIA 3UIOB 3PVLA 1N6ZA 3ZRCA 4NAMA 4RGMA 2WYQA 2KQ4X 1C4PA 4UDUC 4S0RA 3LDZE 3L4PA 3QWZB 1XLPA 3MP9A 1ET6A 2O6VB 1SXTA 2KMAA 4B95A 4HROA 3NZ3A 2WU5B 5HHDG 4AOFA 4EZKA 1UH6A 1NYRA 2DLBA 3JSVA 3W5UB 1P7EA 2BQQA 1JMLA 4RNAA 3R2TA 4DXFA 1EM7A 3NJTA 4XX5A 4ARIA 2L05A 2EKEC 4FHJA 5D94A 4DQOC 2CU3A 3A1QB 2LI5A 4KGTA 2BYFA 5TSSA 3TBLD 1WIAA 3AE1B 3DCGA 1L4ZB 2RMMA 3ALBA 2ONQA 2RPVA 4Q2JA 1XCTL 3H9DA 5G55A 1OEYA 3NG0A 1VJKA 1P98A 1IBXB 4MH8A 1GPXA 4HCPB 3Q8FA 1JQ4A 3KYCD 2FNJB 2I38A 3TEZA 4N59A 4KSLC 1YD8U 1AARA 3B0AA 2J0JA 2J0MA 3NRZA 1CMXB 1ZW7A 4FA6A 4WQOB 1I4RA 2KNBA 2QC8A 3WANA 3KWVA 4HK2A 2QEJC 2IPKD 2L0FA 1UGMA 1WGKA 1V97A 3C8YA 2LRUA 3SDLC 1TS5A 3QJZA 4DHZE 1SJHD 2ZZPB 2D11A 3Q8BA 2K6DB 4KSKC 1YQBA 4FADA 3V61A 1QKZA 4LK0M 1JRPA 3ZDTA 1E10A 1F52A 3C0RB 2DAJA 1AWDA 3QX1A 2EKIA 2WHIA 3VDZA 4CHKA 1E8WA 1SJED 3NUHB 1XCQL 2LJ5A 3U30A 2SEBD 2D3CA 2BTEA 1Z5SB 2K3UA 1N60A 2A5UA 4USAA 4W9KA 2KYWA 5JH5C 3ZTCA 2KLGA 1C76A 5CTRC 2GBRA 4WJQA 4W9HA 4YTNB 2N1WA 5D7GA 4IM0A 3AE4B 2IBIB 2KHWB 3EFUA 4ARCA 1VZ6A 3V6CB 3IT4B 2D07B 1I4HA 2K0PA 2CR5A 4EZJA 4CO7A 1L7YA 3PZ8A 1FNVA 4C7YA 3HUIA 1U4AA 4ZOHC 2KT7A 4ZHOA 4W9GA 1FIQA 1JW9D 1YJ1A 4TMAB 2RDBC 2WX0A 2AX5A 3O65B 3HHMA 5IP4D 2KFKA 1SE9A 3Q8CA 1UD7A 3QARA 3TJPA 3RNBC 3ZJUA 1WGRA 4IOIE 4YTPB 2K9XA 2CKHB 2CS4A 2K25A 2KDMA 2R61A 2RPQA 4ZRIA 2KO3A 2JU6X 5FR3A 1BMLC 4DDGD 1ZKHA 1SEBD 4KKIA 4NQLB 3ZJVA 1TS3A 1WWTA 2KLCA 4DXAB 4W9JA 1BUIC 2N7EA 1WXSA 2NPTA 2WDVB 3IFWB 3HRDD 4FJYA 4NZLB 4NPNA 1C1YB 1HXYD 3A1QA 2J52A 5IAAC 1OQRA 3MC9A 1SIJA 2I1JA 1CK1A 3U7DA 1VDVA 2QDFA 2ZJDA 4RGOS 5H8YE 1ZDVA 4ZYSA 2FAZA 1WXQA 1EWCA 4FJVB 3JVZX 3NVYA 3QQ8B 1QILA 2KDFB 2XEWA 1STEA 2LVOA 2IGHA 3OWEB 3UQAA 4I6PA 4HKQA 4FXCA 2INNE 1P3QU 3ML8A 2BKFA 1HTQA 5D3IB 4P1CC 1OEYJ 2MLBA 1KLUD 3IAS1 3P4QB 1YJJA 4MSMB 3N1XC 2LXCA 2AQ1B 2KZRA 1V9JA 1XLNA 2D10A 1LO5D 3PREA 2ON8A 5L95C 3RNGC 1RWSA 3SHQA 3P4RB 4HXDA 1A5RA 3UIPB 1JRUA 2KQ7A 4JLCA 1FCLA 5IKCM 3AM9A 1PGAA 1F0ZA 5LLIA 2D5GA 1PGXA 4W9CA 3RNEC 1D3ZA 3PZDA 2NBWB 4IC7B 5FKAC 3NVZA 2WLBA 2NMQA 3VFKA 2FIDA 3RULA 1AW7A 2O6VD 5FR6A 2OJRA 4KZCA 2DWQA 4W9IA 2LRWA 4P1BC 4JPSA 1RLFA 3BYYB 3GB1A 3RT3B 3SD5A 2ZNVC 3U7ZA 1K8RB 1SSNA 2LGIA 2LHEA 2EELA 1HTOA 2K8BA 3N30A 4YSXB 3H1UA 1HZ6A 4I6LB 1TZOA 3CSFA 4LNOA 1WXVA 2O2VA 3R66C 2AWTA 2KC1A 1P0RA 1WZ0A 3KH0A 4KX6B 5BO4B 3V60A 2OEDA 4DBGA 1ZDXA 3OAWA 1FXTB 2A4ZA 2QILA 2HD5B 1TGZB 2RR9A 1OQYA 3URYA 2KJ6A 3VRAB 1V8CA 2JT4B 1WX9A 5EE9A 4DK5A 1YQ3B 2WWZA 3MHZA 1PGBA 4G50A 3BK1A 1EU4A 4CYEA 3KUCB 2Y5BB 2BF8B 4KIKB 4GSWA 2W54A 4MSQB 4JL9A 4PS8A 1L4DB 1ZXIA 1EF5A 1L0VB 3FILB 2BS3B 2MBBB 2IGGA 1QF6A 1WGDA 5G2NA 4GU2A 2DAFA 2N9PC 4YXDB 3DOWA 1HA5A 1YN5A 1TY2A 4E74A 3PO0A 2QJLA 1FRRA 1E8ZA 4LTUA 1FRDA 2IZVB 2J53A 1L0XB 2NBVB 3UINB 4C7ZA 2WDQB 2I1KA 1WJ4A 1VCBA 3J9CA 3BVGA 2KTRB 2LMCA 2GLSA 2KWVB 2RGFA 3QIJA 4M8MA 3RD2A 1NEKB 1LM8B 2QSDA 3WCQA 3Q8AA 5E6JA 1ZGUB 2M56B 3ML9A 3ZO5B 1WSPA 2DYMA 3NVVA 2L76A 4IM2A 3AULA 4GDLA 1KJTA 3DBLI 3O13A 1PYWD 2DZIA 2LASA 5G5GA 2LGDA 2INDC 3BK2A 5LXIB 4XC2A 3RZFA 4P16A 1NVID 3ZDMC 4KKJA 3P1MA 1D4BA 3ZJTA 2R2OA 2B3AA 3SFDB 1H8CA 4TQ0A 4FBJB 2MHJA 4BKTA 2MBEA 1BT0A 1LGRA 2BS4B 2K1FA 3R7RA 2PVOD 2JYEA 2FCSA 4G3XB 3DHHC 3E56A 1KFYB 2ZVNA 4NAWA 3P63A 2IJ0A 2LJIA 3L17A 5DCNA 1D6EC 4TUUA 4RMAA 2QIEB 2V3SA 1B9RA 3OJ3A 3HVDA 1QT9A 1UBQA 3RUIB 1NYQA 3K9PB 2KDIA 3ZQ4A 1BXTA 5HFYA 3P2BA 4NJ6A 2G9HD 4WJOA 3A9KB 4HPPA 1OGWA 4BOZB 3ZYYX 4REZA 1D5MC 3NOBA 4S17A 1HE8A 1NENB 1N63A 4DDID 1FMAD 2M17A 1N62A 1WE7A 1WJUA 5FK9C 3VH4B 3KWLA 5E6NA 3UQBA 5CX3A 1JWUD 2BWES 5BYSA 4RF0A 3TCAA 1C3TA 2C7NB 4K81A 4LJPB 4WWMA 1K53A 3SU8X 3RN9C 3JSVB 2GBJA 4PYUA 1IBXA 1F77A 4XE0A 2WXGA 2JWZA 3VQIA 1E7VA 1ISNA 2JSVX 3ZGZA 3SR6A 5AZFA 3T9LA 2PE9A 1KLGD 3VR8B 4RH6A 1NI3A 4PT5A 1WFYA 3Q3NC 3AE8B 1KOTA 2G4DB 2RD0A 1RRBA
chains in the Genus database with same CATH topology
2FIFA 5JH5C 2XBBC 5E6OA 3ZTCA 2KLGA 4AWJA 5CTRC 3W1YA 2KDEB 2JZ3B 1NDDA 2GBRA 2L00B 3W1SA 1TZ1A 4MGZE 4BKSA 2J0KA 4WJQA 4W9HA 5C23A 5KHQA 3DVNU 3DVGX 3EC8A 3MTNB 4XZ4A 2MA9B 2N1WA 5D7GA 1WR1A 3I3TB 4IM0A 3DPDA 2IBIB 1GUAB 1WJNA 3S2AA 5JHAA 4RM8A 2KX3A 2KHWB 1V80A 2L0TA 3EFUA 3MJWA 5DPWA 2MBQA 2LZ6A 3V6CB 2FCQA 3HM3A 4F1SA 2NPTB 1XT9B 2D07B 2CR5A 4EZJA 3APFA 3PHXB 4CO7A 3AU4A 1L7YA 2C5LC 2IY0B 2DHZA 2M0XA 4KDLB 1V81A 3PRMB 1V5TA 4JIOU 3PT2B 1U4AA 4LDTD 4DHJB 2MRPA 3AI5A 4GIVA 4EUTA 3TMPB 4NQKE 3VXWA 2MW5A 2LWPA 2L3ZA 5D2MB 3ZW3A 2LVQA 5C1ZA 4W9GA 5DPSA 2BYEA 1YJ1A 2WX0A 2HJ8A 2D3GA 2EMSA 3QC8B 2L8JA 3O65B 4BFRA 1P9DU 1E90A 3HHMA 2KWUB 4GMVA 1WRDB 1X1MA 3NHEB 2KFKA 2LVPA 4WWPA 2M4NA 3VH3B 3QK0A 1SE9A 1UD7A 3QARA 4GXBA 2R2QA 3R7QA 3TJPA 3TIXA 1WGRA 3VUYA 4GDKA 4MGYE 2K8HA 2KFKB 2FCNA 2CKHB 3PSEB 4G11A 2ZCCA 4IG7B 1S3SG 2CS4A 2K25A 4WWNA 4AJYB 2CHZA 2RPQA 4ZRIA 2PE6B 2FCMA 4HLEA 1I42A 1Q5WB 4TQ1A 2KO3A 4ANWA 3PHWB 4DDGD 1ZKHA 1WMHA 2AEHA 3A9JB 4NQLB 2Z0EB 1NI2A 2KLCA 4DXAB 4W9JA 4EOYA 4ZDVA 2N7EA 1WXSA 4DHJD 4M8NA 4ASWC 2NPTA 3IFWB 4FJYA 2AYOB 1WE6A 2MBOA 2NR2A 3OLMD 2JXXA 3QAQA 4F7ZA 4NPNA 1C1YB 4II2B 4EFOA 4W9DA 3ZNID 3A1QA 4ICUA 1QZEA 4P7IA 1EO6A 3RCZA 4W9EA 4MGKE 4MJSA 2DYOA 1KM7A 4LJOB 5IAAC 1Q0WB 3VUWA 3T8MA 2I1JA 2JRHA 4KVGB 3M62B 4W9FA 2LGYA 3U7DA 5JHBA 2WDTB 3A33B 2GBNA 4TV3A 2ZJDA 2C9WB 2D2QA 2L7RA 2KJRA 2JY6A 2FAZA 4FJVB 1P1AA 3KW5B 4NAWB 3JVZX 1S1QB 3KYDD 3A4SC 3QQ8B 3BY4B 4OVUA 3CF6E 3WIMA 4X57B 5HKHA 2KDFB 2XEWA 3NZSA 1GG3A 3ECIA 1GJZA 3M95A 1F9JA 5KHOA 4E3CA 2LVOA 2VRRB 2Z59B 3JYUA 1M94A 4GB9A 3VUXA 4BKGA 3DQVA 5J18A 3UQAA 2QHOA 4I6PA 5DPTA 5J2RA 3A9KA 3WAOA 4MM3A 2REXA 4NY0A 4HPLB 1P3QU 2KFJA 3H7PB 3ML8A 3VHTC 2BKFA 2IY1B 1MG8A 1OEYJ 2FUHB 4HVBA 2KJHB 3HM6X 3QA8A 4N9F4 3ZNHB 2GBKA 2MLBA 1E5WA 3H6NA 3IG3A 2KD0A 2KX0A 4MSMB 1VD2A 2LXCA 4KV2A 3IHPC 2KZRA 1V9JA 4NNJB 2D10A 2IO0B 4GDLB 4RM9A 2GMIC 1EF1A 1WXMA 3ONSA 4AUQC 3PREA 2MQJA 2N7DA 5DPRA 5L95C 1WR6E 2JUOA 2WX1A 3SHQA 4HXDA 1A5RA 3UIPB 3WA0A 1J8CA 2MSED 2ZCBA 4B9KA 1XQQA 1JRUA 2KQ7A 2DZKA 4JLCA 4WAAA 2BKRB 5D6JB 4II3B 4ANUA 2KN5A 1V2YA 3PRZA 2KK8A 2UYZB 2HE7A 1WYWB 4ZYNA 5LLIA 3ZUNA 1Z2MA 2DENB 2BWFA 1D3ZA 2PJHA 1TBEA 4W9CA 3PZDA 3A9JA 3UGBB 2NBWB 4HDQA 4IC7B 4PS3A 1WX7A 3VFKA 2FIDA 1LQBA 3WAMA 3HK0A 3U8ZA 2CHXA 2Z0DB 3V6EB 2EMTA 3RULA 5FR6A 2O6VD 5TR5A 1Q1OA 4EKUA 2OJRA 4KZCA 2K39A 3HIZA 3ZTDA 2N4FA 3QCAA 1IPGA 4PYZA 2LRWA 3PLVA 4W9IA 3APCA 3DBHI 3APDA 4ZRKA 4FLHA 1RLFA 1WY8A 3ZIMA 1GC7A 4MDKE 1YX5B 3RT3B 2O6VA 3SD5A 2ZNVC 3H7SA 1WGYA 1J0GA 1K8RB 2N9EB 2V1YA 4EEWA 2ASQA 1WXAA 2JF5A 3L0WB 2AL6A 1WGHA 2K8BA 5AZGA 3N30A 3H1UA 3IVFA 1WF9A 4I6LB 3VTVA 3CSFA 1TTNA 1RFAA 3VTWA 1WXVA 1EUVB 2O2VA 2MCNB 2KQSA 2DX5B 3L08A 3R66C 2KKCA 1R4NI 1WM2A 4FJZA 2AWTA 4K7UA 2KC1A 1P0RA 3NY5A 2RSUA 1WZ0A 1H4RA 3KH0A 2KXJA 4KDIC 5GMVA 2G4SA 3PV1A 1WH3A 4MJSB 5BO4B 2JZZA 3TL5A 3V60A 4DBGA 3OAWA 1V49A 1FXTB 2MX2A 3Q3FA 4GOCA 2A4ZA 3L16A 2HD5B 4WWOA 1V86A 4A3OA 3R3MA 3AXCA 1TGZB 3M63B 2RR9A 1OQYA 2JVCA 2KJ6A 3X23A 2JT4B 2CU1A 1WX9A 1XD3B 1GNUA 3H7PA 1KLVA 2PEAA 5CHVC 1LFDA 2LUEA 2JPHA 4DK5A 1E8XA 1NBFC 4M0WB 2O2VB 2NS5A 1SIFA 1SGHA 2WWZA 4HWIB 4JQWC 1PQSA 2OOBB 3PGEA 4KZ0A 2MBHA 4GGQA 2N9XA 4G50A 3DDCB 4CYEA 3KUCB 1RAXA 2Y5BB 4LCDE 4KIKA 2BF8B 4KIKB 2K8CA 2XK5A 4GSWA 4IWPA 2ZPNA 4BBNC 3JW0X 4GN1A 3ZNZB 4MSQB 2ZNVB 4JL9A 1UELA 2DYBA 3PRPB 4PS8A 2C60A 3WALA 2GOWA 1EF5A 3K9OB 4MGIE 4GDKB 3L54A 2MBBB 4J6IA 3PPAA 5CHWA 4E71A 4AP4C 5JZEB 3X0WA 1WGDA 4A20A 2J7QB 2KC2A 4ANXA 2KOXA 5G2NA 4HJKA 4GU2A 2DAFA 2N9PC 1V5OA 3V62A 4MEMA 3DOWA 4FHKA 3GZNI 3NS8A 3OJ4B 2M8SA 4E74A 4PS7A 1WM3A 5AEKB 4HPMB 1E8ZA 3UIOB 1I35A 1Y8RC 3PVLA 4EZLA 2BGFA 3B1LX 3ZRCA 2IZVB 3PS6A 2IYDB 2WYQA 1WJ6A 5E6PA 2W9NA 2NBVB 4BVUC 3UINB 3QHTA 2K6QA 2I1KA 4WJPA 1WJ4A 1VCBA 2IO2B 1YIWA 2CHWA 2KVRA 2KTRB 2LD9A 3KUZA 3LDZE 3QWZB 2KWVB 2RGFA 3QIJA 2O6VB 4M8MA 3RD2A 2KMAA 4AJWA 1LM8B 2UWQA 2YVCA 4B95A 4EZKA 2AL3A 2IO1B 3LJ3A 4AOFA 2DZJA 1ZGUB 1UH6A 3ML9A 3ZO5B 4G0NB 3ENEA 2ZPYA 3JSVA 2DYMA 3EECA 2L76A 4IM2A 2GBMA 2ZVOA 1KJTA 3AULA 3DBLI 4GDLA 4JGHB 2PPHA 2DZIA 3A4RA 2LASA 2IO3B 4XX5A 1WI0A 2G45B 1YX6B 2L05A 2EKEC 2LGDA 4FHJA 3ZKJC 5D94A 3PLUA 5LXIB 3MHSD 4XC2A 4BBNF 3A1QB 2NCNA 2LI5A 3RZFA 3CSTA 2HTHA 4MH0E 2BYFA 3N32A 3ZDMC 1IYFA 3BINA 3TBLD 2R2OA 1WIAA 3RZWC 3DCGA 2B3AA 3DVGY 1H8CA 1WZ3A 4TQ0A 3EHVA 3WAPA 3B08A 4FBJB 4TKNA 3ALBA 4BKTA 1LXDA 1R4MI 3L10B 2C7HA 2MBEA 4HDOA 1UZXB 1BT0A 3GOEA 3NZUA 2BPSA 4I6NB 2MP2B 1WMHB 3H9DA 3ZVVA 4F8CB 2K1FA 3Q3JA 3R7RA 4ANVA 1G6JA 1WGGA 2FCSA 5G55A 1OEYA 2NBUA 1P98A 4K1RB 4WJNA 4G3XB 2KTFA 4DWFA 5J17A 5EDSA 3AU5A 3KVFB 4BKSD 1J19A 4FULA 3ZNGC 2ZVNA 2KWCA 4NAWA 4URKA 3L17A 5DCNA 4HCPB 4TUUA 4RMAA 2V3SA 3KYCD 3OJ3A 2FNJB 3PTFC 4KSLC 3L13A 1YD8U 3CMMB 4ICVA 1AARA 5IA7A 4OVVA 1UBQA 2C7MB 2YLMA 3RUIB 3B0AA 2J0JA 3K9PB 2KDIA 2J0MA 1CMXB 1ZW7A 3P2BA 4NJ6A 4FA6A 4WQOB 5CHFA 2KNBA 3A9KB 3DBRI 4WJOA 5L83A 1OGWA 1IP9A 4BOSC 3WANA 2V4LA 2MP2A 4BOZB 4HK2A 2LXAA 3NOBA 2L0FA 4DHZB 1HE8A 2LGXA 2NVUI 1UGMA 1UBIA 4DDID 3KUDB 4YL8A 3RYTA 3IBEA 2LRUA 2M17A 3SDLC 3N3KB 3QJZA 4DHZE 1WX8A 2KMCA 4K7WA 1E8YA 2ZZPB 2D11A 2KDBA 2K6DB 3W1SC 3D32A 4KSKC 1YQBA 4FADA 1WE7A 3V61A 1WJUA 2M1MA 4NJ7A 4IW0A 3ZRFA 2DZMA 3VH4B 5E6NA 3UQBA 5CX3A 2BWES 3ZDTA 3C0RB 3DBSA 3TCAA 3VAWA 2DAJA 1C3TA 2C7NB 4K81A 4LJPB 3DVNV 4IWOA 4A3PA 4IWQA 1GC6A 3QX1A 2BYVE 3SU8X 3VDZA 3JSVB 2GBJA 4CHKA 1E8WA 2KANA 4PYUA 2N1VA 2JRIB 3VVWB 3UF8A 2JWZA 2G3QB 3VQIA 1E7VA 1L2NA 1ISNA 5AZHA 2LJ5A 3VTUA 1OTRB 3U30A 1V6EA 3M3JA 4B6WA 1E7UA 4ZRJA 5AZFA 3T9LA 2PE9A 4LDTB 3ZLZA 1Z5SB 1T0YA 4K7SA 2A5UA 4FN2A 1WFYA 5LXHA 2ZEQA 4IM3A 4HCNB 4MELA 2KTRA 1KOTA 2G4DB 2MWSB 2XK5B 2RD0A 4W9LA 4IUMB 4W9KA 1RRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIF A;  5JH5 C;  2XBB C;  5E6O A;  3ZTC A;  2KLG A;  4AWJ A;  5CTR C;  3W1Y A;  2KDE B;  2JZ3 B;  1NDD A;  2GBR A;  2L00 B;  3W1S A;  1TZ1 A;  4MGZ E;  4BKS A;  2J0K A;  4WJQ A;  4W9H A;  5C23 A;  5KHQ A;  3DVN U;  3DVG X;  3EC8 A;  3MTN B;  4XZ4 A;  2MA9 B;  2N1W A;  5D7G A;  1WR1 A;  3I3T B;  4IM0 A;  3DPD A;  2IBI B;  1GUA B;  1WJN A;  3S2A A;  5JHA A;  4RM8 A;  2KX3 A;  2KHW B;  1V80 A;  2L0T A;  3EFU A;  3MJW A;  5DPW A;  2MBQ A;  2LZ6 A;  3V6C B;  2FCQ A;  3HM3 A;  4F1S A;  2NPT B;  1XT9 B;  2D07 B;  2CR5 A;  4EZJ A;  3APF A;  3PHX B;  4CO7 A;  3AU4 A;  1L7Y A;  2C5L C;  2IY0 B;  2DHZ A;  2M0X A;  4KDL B;  1V81 A;  3PRM B;  1V5T A;  4JIO U;  3PT2 B;  1U4A A;  4LDT D;  4DHJ B;  2MRP A;  3AI5 A;  4GIV A;  4EUT A;  3TMP B;  4NQK E;  3VXW A;  2MW5 A;  2LWP A;  2L3Z A;  5D2M B;  3ZW3 A;  2LVQ A;  5C1Z A;  4W9G A;  5DPS A;  2BYE A;  1YJ1 A;  2WX0 A;  2HJ8 A;  2D3G A;  2EMS A;  3QC8 B;  2L8J A;  3O65 B;  4BFR A;  1P9D U;  1E90 A;  3HHM A;  2KWU B;  4GMV A;  1WRD B;  1X1M A;  3NHE B;  2KFK A;  2LVP A;  4WWP A;  2M4N A;  3VH3 B;  3QK0 A;  1SE9 A;  1UD7 A;  3QAR A;  4GXB A;  2R2Q A;  3R7Q A;  3TJP A;  3TIX A;  1WGR A;  3VUY A;  4GDK A;  4MGY E;  2K8H A;  2KFK B;  2FCN A;  2CKH B;  3PSE B;  4G11 A;  2ZCC A;  4IG7 B;  1S3S G;  2CS4 A;  2K25 A;  4WWN A;  4AJY B;  2CHZ A;  2RPQ A;  4ZRI A;  2PE6 B;  2FCM A;  4HLE A;  1I42 A;  1Q5W B;  4TQ1 A;  2KO3 A;  4ANW A;  3PHW B;  4DDG D;  1ZKH A;  1WMH A;  2AEH A;  3A9J B;  4NQL B;  2Z0E B;  1NI2 A;  2KLC A;  4DXA B;  4W9J A;  4EOY A;  4ZDV A;  2N7E A;  1WXS A;  4DHJ D;  4M8N A;  4ASW C;  2NPT A;  3IFW B;  4FJY A;  2AYO B;  1WE6 A;  2MBO A;  2NR2 A;  3OLM D;  2JXX A;  3QAQ A;  4F7Z A;  4NPN A;  1C1Y B;  4II2 B;  4EFO A;  4W9D A;  3ZNI D;  3A1Q A;  4ICU A;  1QZE A;  4P7I A;  1EO6 A;  3RCZ A;  4W9E A;  4MGK E;  4MJS A;  2DYO A;  1KM7 A;  4LJO B;  5IAA C;  1Q0W B;  3VUW A;  3T8M A;  2I1J A;  2JRH A;  4KVG B;  3M62 B;  4W9F A;  2LGY A;  3U7D A;  5JHB A;  2WDT B;  3A33 B;  2GBN A;  4TV3 A;  2ZJD A;  2C9W B;  2D2Q A;  2L7R A;  2KJR A;  2JY6 A;  2FAZ A;  4FJV B;  1P1A A;  3KW5 B;  4NAW B;  3JVZ X;  1S1Q B;  3KYD D;  3A4S C;  3QQ8 B;  3BY4 B;  4OVU A;  3CF6 E;  3WIM A;  4X57 B;  5HKH A;  2KDF B;  2XEW A;  3NZS A;  1GG3 A;  3ECI A;  1GJZ A;  3M95 A;  1F9J A;  5KHO A;  4E3C A;  2LVO A;  2VRR B;  2Z59 B;  3JYU A;  1M94 A;  4GB9 A;  3VUX A;  4BKG A;  3DQV A;  5J18 A;  3UQA A;  2QHO A;  4I6P A;  5DPT A;  5J2R A;  3A9K A;  3WAO A;  4MM3 A;  2REX A;  4NY0 A;  4HPL B;  1P3Q U;  2KFJ A;  3H7P B;  3ML8 A;  3VHT C;  2BKF A;  2IY1 B;  1MG8 A;  1OEY J;  2FUH B;  4HVB A;  2KJH B;  3HM6 X;  3QA8 A;  4N9F 4;  3ZNH B;  2GBK A;  2MLB A;  1E5W A;  3H6N A;  3IG3 A;  2KD0 A;  2KX0 A;  4MSM B;  1VD2 A;  2LXC A;  4KV2 A;  3IHP C;  2KZR A;  1V9J A;  4NNJ B;  2D10 A;  2IO0 B;  4GDL B;  4RM9 A;  2GMI C;  1EF1 A;  1WXM A;  3ONS A;  4AUQ C;  3PRE A;  2MQJ A;  2N7D A;  5DPR A;  5L95 C;  1WR6 E;  2JUO A;  2WX1 A;  3SHQ A;  4HXD A;  1A5R A;  3UIP B;  3WA0 A;  1J8C A;  2MSE D;  2ZCB A;  4B9K A;  1XQQ A;  1JRU A;  2KQ7 A;  2DZK A;  4JLC A;  4WAA A;  2BKR B;  5D6J B;  4II3 B;  4ANU A;  2KN5 A;  1V2Y A;  3PRZ A;  2KK8 A;  2UYZ B;  2HE7 A;  1WYW B;  4ZYN A;  5LLI A;  3ZUN A;  1Z2M A;  2DEN B;  2BWF A;  1D3Z A;  2PJH A;  1TBE A;  4W9C A;  3PZD A;  3A9J A;  3UGB B;  2NBW B;  4HDQ A;  4IC7 B;  4PS3 A;  1WX7 A;  3VFK A;  2FID A;  1LQB A;  3WAM A;  3HK0 A;  3U8Z A;  2CHX A;  2Z0D B;  3V6E B;  2EMT A;  3RUL A;  5FR6 A;  2O6V D;  5TR5 A;  1Q1O A;  4EKU A;  2OJR A;  4KZC A;  2K39 A;  3HIZ A;  3ZTD A;  2N4F A;  3QCA A;  1IPG A;  4PYZ A;  2LRW A;  3PLV A;  4W9I A;  3APC A;  3DBH I;  3APD A;  4ZRK A;  4FLH A;  1RLF A;  1WY8 A;  3ZIM A;  1GC7 A;  4MDK E;  1YX5 B;  3RT3 B;  2O6V A;  3SD5 A;  2ZNV C;  3H7S A;  1WGY A;  1J0G A;  1K8R B;  2N9E B;  2V1Y A;  4EEW A;  2ASQ A;  1WXA A;  2JF5 A;  3L0W B;  2AL6 A;  1WGH A;  2K8B A;  5AZG A;  3N30 A;  3H1U A;  3IVF A;  1WF9 A;  4I6L B;  3VTV A;  3CSF A;  1TTN A;  1RFA A;  3VTW A;  1WXV A;  1EUV B;  2O2V A;  2MCN B;  2KQS A;  2DX5 B;  3L08 A;  3R66 C;  2KKC A;  1R4N I;  1WM2 A;  4FJZ A;  2AWT A;  4K7U A;  2KC1 A;  1P0R A;  3NY5 A;  2RSU A;  1WZ0 A;  1H4R A;  3KH0 A;  2KXJ A;  4KDI C;  5GMV A;  2G4S A;  3PV1 A;  1WH3 A;  4MJS B;  5BO4 B;  2JZZ A;  3TL5 A;  3V60 A;  4DBG A;  3OAW A;  1V49 A;  1FXT B;  2MX2 A;  3Q3F A;  4GOC A;  2A4Z A;  3L16 A;  2HD5 B;  4WWO A;  1V86 A;  4A3O A;  3R3M A;  3AXC A;  1TGZ B;  3M63 B;  2RR9 A;  1OQY A;  2JVC A;  2KJ6 A;  3X23 A;  2JT4 B;  2CU1 A;  1WX9 A;  1XD3 B;  1GNU A;  3H7P A;  1KLV A;  2PEA A;  5CHV C;  1LFD A;  2LUE A;  2JPH A;  4DK5 A;  1E8X A;  1NBF C;  4M0W B;  2O2V B;  2NS5 A;  1SIF A;  1SGH A;  2WWZ A;  4HWI B;  4JQW C;  1PQS A;  2OOB B;  3PGE A;  4KZ0 A;  2MBH A;  4GGQ A;  2N9X A;  4G50 A;  3DDC B;  4CYE A;  3KUC B;  1RAX A;  2Y5B B;  4LCD E;  4KIK A;  2BF8 B;  4KIK B;  2K8C A;  2XK5 A;  4GSW A;  4IWP A;  2ZPN A;  4BBN C;  3JW0 X;  4GN1 A;  3ZNZ B;  4MSQ B;  2ZNV B;  4JL9 A;  1UEL A;  2DYB A;  3PRP B;  4PS8 A;  2C60 A;  3WAL A;  2GOW A;  1EF5 A;  3K9O B;  4MGI E;  4GDK B;  3L54 A;  2MBB B;  4J6I A;  3PPA A;  5CHW A;  4E71 A;  4AP4 C;  5JZE B;  3X0W A;  1WGD A;  4A20 A;  2J7Q B;  2KC2 A;  4ANX A;  2KOX A;  5G2N A;  4HJK A;  4GU2 A;  2DAF A;  2N9P C;  1V5O A;  3V62 A;  4MEM A;  3DOW A;  4FHK A;  3GZN I;  3NS8 A;  3OJ4 B;  2M8S A;  4E74 A;  4PS7 A;  1WM3 A;  5AEK B;  4HPM B;  1E8Z A;  3UIO B;  1I35 A;  1Y8R C;  3PVL A;  4EZL A;  2BGF A;  3B1L X;  3ZRC A;  2IZV B;  3PS6 A;  2IYD B;  2WYQ A;  1WJ6 A;  5E6P A;  2W9N A;  2NBV B;  4BVU C;  3UIN B;  3QHT A;  2K6Q A;  2I1K A;  4WJP A;  1WJ4 A;  1VCB A;  2IO2 B;  1YIW A;  2CHW A;  2KVR A;  2KTR B;  2LD9 A;  3KUZ A;  3LDZ E;  3QWZ B;  2KWV B;  2RGF A;  3QIJ A;  2O6V B;  4M8M A;  3RD2 A;  2KMA A;  4AJW A;  1LM8 B;  2UWQ A;  2YVC A;  4B95 A;  4EZK A;  2AL3 A;  2IO1 B;  3LJ3 A;  4AOF A;  2DZJ A;  1ZGU B;  1UH6 A;  3ML9 A;  3ZO5 B;  4G0N B;  3ENE A;  2ZPY A;  3JSV A;  2DYM A;  3EEC A;  2L76 A;  4IM2 A;  2GBM A;  2ZVO A;  1KJT A;  3AUL A;  3DBL I;  4GDL A;  4JGH B;  2PPH A;  2DZI A;  3A4R A;  2LAS A;  2IO3 B;  4XX5 A;  1WI0 A;  2G45 B;  1YX6 B;  2L05 A;  2EKE C;  2LGD A;  4FHJ A;  3ZKJ C;  5D94 A;  3PLU A;  5LXI B;  3MHS D;  4XC2 A;  4BBN F;  3A1Q B;  2NCN A;  2LI5 A;  3RZF A;  3CST A;  2HTH A;  4MH0 E;  2BYF A;  3N32 A;  3ZDM C;  1IYF A;  3BIN A;  3TBL D;  2R2O A;  1WIA A;  3RZW C;  3DCG A;  2B3A A;  3DVG Y;  1H8C A;  1WZ3 A;  4TQ0 A;  3EHV A;  3WAP A;  3B08 A;  4FBJ B;  4TKN A;  3ALB A;  4BKT A;  1LXD A;  1R4M I;  3L10 B;  2C7H A;  2MBE A;  4HDO A;  1UZX B;  1BT0 A;  3GOE A;  3NZU A;  2BPS A;  4I6N B;  2MP2 B;  1WMH B;  3H9D A;  3ZVV A;  4F8C B;  2K1F A;  3Q3J A;  3R7R A;  4ANV A;  1G6J A;  1WGG A;  2FCS A;  5G55 A;  1OEY A;  2NBU A;  1P98 A;  4K1R B;  4WJN A;  4G3X B;  2KTF A;  4DWF A;  5J17 A;  5EDS A;  3AU5 A;  3KVF B;  4BKS D;  1J19 A;  4FUL A;  3ZNG C;  2ZVN A;  2KWC A;  4NAW A;  4URK A;  3L17 A;  5DCN A;  4HCP B;  4TUU A;  4RMA A;  2V3S A;  3KYC D;  3OJ3 A;  2FNJ B;  3PTF C;  4KSL C;  3L13 A;  1YD8 U;  3CMM B;  4ICV A;  1AAR A;  5IA7 A;  4OVV A;  1UBQ A;  2C7M B;  2YLM A;  3RUI B;  3B0A A;  2J0J A;  3K9P B;  2KDI A;  2J0M A;  1CMX B;  1ZW7 A;  3P2B A;  4NJ6 A;  4FA6 A;  4WQO B;  5CHF A;  2KNB A;  3A9K B;  3DBR I;  4WJO A;  5L83 A;  1OGW A;  1IP9 A;  4BOS C;  3WAN A;  2V4L A;  2MP2 A;  4BOZ B;  4HK2 A;  2LXA A;  3NOB A;  2L0F A;  4DHZ B;  1HE8 A;  2LGX A;  2NVU I;  1UGM A;  1UBI A;  4DDI D;  3KUD B;  4YL8 A;  3RYT A;  3IBE A;  2LRU A;  2M17 A;  3SDL C;  3N3K B;  3QJZ A;  4DHZ E;  1WX8 A;  2KMC A;  4K7W A;  1E8Y A;  2ZZP B;  2D11 A;  2KDB A;  2K6D B;  3W1S C;  3D32 A;  4KSK C;  1YQB A;  4FAD A;  1WE7 A;  3V61 A;  1WJU A;  2M1M A;  4NJ7 A;  4IW0 A;  3ZRF A;  2DZM A;  3VH4 B;  5E6N A;  3UQB A;  5CX3 A;  2BWE S;  3ZDT A;  3C0R B;  3DBS A;  3TCA A;  3VAW A;  2DAJ A;  1C3T A;  2C7N B;  4K81 A;  4LJP B;  3DVN V;  4IWO A;  4A3P A;  4IWQ A;  1GC6 A;  3QX1 A;  2BYV E;  3SU8 X;  3VDZ A;  3JSV B;  2GBJ A;  4CHK A;  1E8W A;  2KAN A;  4PYU A;  2N1V A;  2JRI B;  3VVW B;  3UF8 A;  2JWZ A;  2G3Q B;  3VQI A;  1E7V A;  1L2N A;  1ISN A;  5AZH A;  2LJ5 A;  3VTU A;  1OTR B;  3U30 A;  1V6E A;  3M3J A;  4B6W A;  1E7U A;  4ZRJ A;  5AZF A;  3T9L A;  2PE9 A;  4LDT B;  3ZLZ A;  1Z5S B;  1T0Y A;  4K7S A;  2A5U A;  4FN2 A;  1WFY A;  5LXH A;  2ZEQ A;  4IM3 A;  4HCN B;  4MEL A;  2KTR A;  1KOT A;  2G4D B;  2MWS B;  2XK5 B;  2RD0 A;  4W9L A;  4IUM B;  4W9K A;  1RRB A; 
#chains in the Genus database with same CATH topology
 3R8B A;  1FM0 D;  1YN3 A;  2L00 B;  1TZ1 A;  2J0K A;  3EC8 A;  2BB6 A;  1VLB A;  2JXT A;  5BMH A;  2L32 A;  1GUA B;  1WJN A;  1ESF A;  2KX3 A;  2L0T A;  2J4X A;  2MBQ A;  3N1Y C;  2FCQ A;  4LNI A;  2NPT B;  3FIL A;  1XT9 B;  2Y5P A;  1MFW A;  3AU4 A;  2C5L C;  2IY0 B;  2L83 A;  2M0X A;  3TEX A;  1V81 A;  3PRM B;  1I4P A;  4LDT D;  3AI5 A;  3RNF C;  4NQK E;  3TMP B;  2MW5 A;  2LWP A;  3N1Z C;  2JX5 A;  2L3Z A;  5D2M B;  3ZW3 A;  5I4D A;  5DPS A;  2W82 A;  3AEA B;  3Q14 C;  2WXL A;  4BFR A;  1P9D U;  1E90 A;  2KWU B;  4GMV A;  4B0M A;  2LVP A;  4WWP A;  4RGT A;  3MFG A;  1TJE A;  4GXB A;  3TIX A;  3AE2 B;  4IG7 B;  2GI9 A;  2CHZ A;  4HLE A;  2PE6 B;  4ZHP A;  3FAH A;  4MAC A;  2DNF A;  2AEH A;  4LLG M;  1UUP A;  4ZDV A;  4M8N A;  4ASW C;  1WE6 A;  2NR2 A;  4F7Z A;  2JXX A;  3MC8 A;  3P4P B;  4W9D A;  5G5H A;  1E0Z A;  4MGK E;  4MJS A;  1Q0W B;  3VUW A;  1T0Q C;  2JRH A;  4KVG B;  2LGY A;  3MJ5 A;  2VH2 A;  2B76 B;  1KTK A;  1T6B X;  3LB8 C;  2PW9 A;  1V1O A;  1P1A A;  4US8 A;  4GLS C;  4L2Y A;  3CF6 E;  1ROE A;  4K3B A;  3ECI A;  1GJZ A;  4DXG A;  4E3C A;  4AS1 A;  1JWA D;  2Z59 B;  3VUX A;  2PMV A;  3DQV A;  2YEP F;  3IAM 1;  3A9K A;  4JWU C;  1WRI A;  2JQR B;  4NY0 A;  4HPL B;  3Q6B A;  2BW2 A;  2FUH B;  2WNM A;  3HM6 X;  3IG3 A;  2H89 B;  2KD0 A;  1C4C A;  1B1Z A;  4BAX A;  3IHP C;  4OVZ A;  3I57 A;  3V3X A;  1SE4 A;  3I5J C;  2MQJ A;  2N7D A;  5DPR A;  1ET9 A;  3DBH B;  1J8C A;  1XEE A;  2MSE D;  1GB4 A;  3TUO A;  4WAA A;  4II3 B;  4C4V B;  1V2Y A;  1SBB B;  4C4V A;  2HE7 A;  1WYW B;  2N9L A;  1Q10 A;  2BWF A;  1J7C A;  2V3P A;  1CJE A;  4L1B A;  1K50 A;  1EU3 A;  3HK0 A;  3U8Z A;  5EE0 A;  2EMT A;  1VZ8 A;  5TR5 A;  5EE3 A;  3QCA A;  1IPG A;  3PLV A;  4ZRK A;  2XNA C;  1WY8 A;  5LNK 1;  4MDK E;  1YX5 B;  3H7S A;  2K22 A;  2I2Y A;  1J0G A;  2N9E B;  2V1Y A;  3L0W B;  1L0Y B;  1WGH A;  4XWW A;  5AZG A;  4CQN A;  1FEH A;  1EUV B;  2MCN B;  2DX5 B;  4TSS A;  2KWD A;  2WXN A;  1GB1 A;  2G4S A;  1WH3 A;  2N9K A;  3FKY A;  2MX2 A;  3Q3F A;  3Q8E A;  1J7A A;  2D3A A;  2JVC A;  3E9S A;  3ETR A;  3X23 A;  2INC C;  3ZXV A;  2LUE A;  3RFZ B;  1JWM D;  1SIF A;  2WP9 B;  2OOB B;  1OQQ A;  3PGE A;  4GGQ A;  1I4X A;  1I7H A;  3MC0 B;  4BBN C;  4GN1 A;  3T3O A;  1UEL A;  2DYB A;  3WAL A;  4MGI E;  2ZW1 A;  4AP4 C;  2J7Q B;  2KC2 A;  4HJK A;  1FCC C;  3NVW A;  1QOF A;  3NS8 A;  4YT0 B;  2M8S A;  3AB5 A;  1GAQ B;  5AEK B;  2AQ3 B;  2N0S B;  1V1P A;  4QAY A;  1I35 A;  1Y8R C;  4EZL A;  2MH7 A;  3B1L X;  4WQM A;  2IYD B;  1WJ6 A;  3RMK C;  5E6P A;  2W9N A;  2KVZ A;  2K6Q A;  2WXH A;  3KUZ A;  2IO2 B;  2KVR A;  4JX1 C;  3KLS X;  2UWQ A;  4OZC A;  3LJ3 A;  2DZJ A;  2JWU A;  1KH0 A;  4G0N B;  3ENE A;  2BYT A;  3EEC A;  1MI0 A;  2ZVO A;  1C79 A;  2BB5 A;  2PPH A;  1PUT A;  3A4R A;  2IO3 B;  1WI0 A;  1YX6 B;  3MHS D;  4K3C A;  4BBN F;  2NCN A;  3CST A;  2HTH A;  3AEE B;  1FFV A;  1IYF A;  2UU7 A;  3WAP A;  4HDO A;  4D2K A;  1UZX B;  3GOE A;  2BPS A;  2WU2 B;  4C00 A;  4I6N B;  3ZVV A;  1WMH B;  4F8C B;  3Q3J A;  2NBU A;  4LNK A;  5J17 A;  1MJD A;  5EDS A;  1J19 A;  5C2T B;  1XO3 A;  1YNT E;  3LXF A;  4C56 C;  1QOB A;  3AE9 B;  1JCK B;  3AN1 A;  4IKG A;  1IGC A;  1TT5 B;  2KN4 A;  1F2R I;  1IP9 A;  4BOS C;  2V4L A;  1TYG B;  2H88 B;  3DWM A;  2LGX A;  3EGR A;  1UBI A;  2DBY A;  3I9V 1;  2KMC A;  2RDH A;  4K7W A;  1FPY A;  2KDB A;  1JWB D;  1TKY A;  3W1S C;  3D32 A;  4RFB A;  4NJ7 A;  3ZRF A;  4IW0 A;  2DZM A;  4H2A A;  1F1H A;  4IWO A;  1UF0 A;  1R4N B;  4IWQ A;  1XF5 L;  1GC6 A;  2BYV E;  5BMG A;  2KAN A;  2N7J A;  2N1V A;  2JRI B;  4EE2 A;  3DWG C;  3VTU A;  2OJW A;  4B6W A;  1E7U A;  4ZRJ A;  4LDT B;  4K7S A;  4FN2 A;  4MEL A;  4IM3 A;  4HCN B;  2IGD A;  1MHX A;  3RNC C;  1QOA A;  2XBB C;  3AE5 B;  5E6O A;  3VR9 B;  4AWJ A;  3W1Y A;  2JZ3 B;  4BKS A;  4M0W A;  5KHQ A;  2GB1 A;  3DVN U;  3MTN B;  4XZ4 A;  2MA9 B;  3BVZ A;  3W2D A;  1WR1 A;  3I3T B;  3S2A A;  5JHA A;  4RM8 A;  1ZXH A;  4LNN A;  1V80 A;  3N9Y C;  5BYR A;  1TS2 A;  1Y56 A;  3DHI C;  3OG5 A;  2MEK A;  3APF A;  3AMZ A;  3PHX B;  1ENF A;  2DHZ A;  1D5Z C;  4KDL B;  4LNF A;  4DHJ B;  4EUT A;  1DOY A;  3VXW A;  3LYY A;  1PFD A;  2WS3 B;  1V1P B;  1C77 A;  1UNS A;  2HJ8 A;  1OFF A;  2EMS A;  1C4A A;  1UWX A;  2E3T A;  3NHE B;  3R2I A;  1FO4 A;  2M4N A;  1DYQ A;  3VH3 B;  3QK0 A;  1XLO A;  2R2Q A;  3R7Q A;  2LGS A;  3TEW A;  4GDK A;  2KFK B;  3NS1 A;  2PKO A;  4WWN A;  2BBC A;  1SE2 A;  1I42 A;  1Q5W B;  1YMH E;  3BVM A;  1FNU A;  4TQ1 A;  1ZOY B;  3PHW B;  1WMH A;  3A9J B;  1NI2 A;  2VH1 A;  4EOY A;  4JWS C;  1YQ4 B;  2LHD A;  3QAQ A;  2SAK A;  4II2 B;  3ZNI D;  2Y5C A;  4ICU A;  1QZE A;  5AUK A;  1DOI A;  4ZRQ A;  4W9E A;  4LJO B;  2VZK D;  2JYT A;  2WQY B;  3T8M A;  1YOV B;  3M62 B;  4US9 A;  5JHB A;  2WDT B;  2GBN A;  4TV3 A;  2L7R A;  4XDC A;  2KJR A;  2JY6 A;  2IDY A;  1RFK A;  4WH4 A;  2KAC A;  3Q2A C;  3A4S C;  3GE3 C;  3BY4 B;  4X57 B;  2FBW B;  3NZS A;  2FUG 1;  1E9M A;  3M95 A;  4PK1 A;  3JYU A;  4GB9 A;  3Q3O C;  1P7F A;  2WXO A;  1GOZ A;  2WXK A;  5J2R A;  1QOG A;  1JRO A;  5DPT A;  4WAF A;  2REX A;  3ABV B;  2KFJ A;  3H7P B;  1T0R C;  3VHT C;  2IY1 B;  2ICI A;  1MG8 A;  4HVB A;  3ZXR A;  2KJH B;  4N9F 4;  2GBK A;  1E5W A;  3H6N A;  2BS2 B;  2V4I B;  1WYG A;  2IO0 B;  4GDL B;  1N5W A;  3AH7 A;  1WXM A;  3ONS A;  5JXV A;  5T8I A;  1C78 A;  2WX1 A;  1PDX A;  5IOI A;  1HZ5 A;  2WDR B;  1XQQ A;  1R7S A;  2BKR B;  3H8H A;  3AEC B;  4ZYN A;  1UWM A;  1Z2M A;  2PJH A;  1TBE A;  2HDE A;  4HDQ A;  5BYQ A;  1KF6 B;  4PS3 A;  2J42 A;  1WX7 A;  4HKZ E;  2LUM A;  2CHX A;  2WXI A;  2Z0D B;  1J7B A;  1Q1O A;  2M19 A;  4L23 A;  2VZK B;  3EUB 2;  2K39 A;  3HIZ A;  3ZTD A;  1UGJ A;  3BYT B;  1FFU A;  3APC A;  3DBH I;  3APD A;  3C19 A;  1GC7 A;  2O6V A;  1HEZ E;  1WGY A;  5BMI A;  4EEW A;  2NTS A;  2JF5 A;  1WXA A;  2AL6 A;  2X8X X;  3PZ7 A;  4J3O D;  3VTV A;  3VTW A;  2V0G A;  2KQS A;  3L08 A;  3RI7 C;  1N5X A;  1I4G A;  1H4R A;  2KXJ A;  3PV1 A;  4MJS B;  1TY0 A;  2JZZ A;  3TL5 A;  1V49 A;  4GOC A;  3L16 A;  5MPO A;  1ACC A;  1FXI A;  4A3O A;  3AXC A;  1MVK A;  2E6X A;  5D3D A;  2CU1 A;  1XD3 B;  1GNU A;  1KLV A;  3RNA C;  3W5V B;  3FC4 A;  2PEA A;  3DBL B;  5CHV C;  2WXP A;  2JPH A;  1E8X A;  1NBF C;  2O2V B;  4JQW C;  2NS5 A;  1SGH A;  3GZN B;  4KZ0 A;  2N9X A;  3AV8 A;  2WXQ A;  1RAX A;  4KIK A;  2K8C A;  2XK5 A;  2ZPN A;  2INP E;  2ZNV B;  3PRP B;  4M00 A;  2C60 A;  2GOW A;  1YN4 A;  3P42 A;  4GDK B;  4J6I A;  3PPA A;  5CHW A;  3X0W A;  4ANX A;  3CWI A;  4MEM A;  4KGR A;  5C3J B;  4KGS A;  5HI1 A;  4FHK A;  3GZN I;  3OJ4 B;  1WM3 A;  4YSY B;  2BGF A;  1CQV A;  3PS6 A;  3TSS A;  4A6Q A;  3HVZ A;  4BVU C;  5AUI A;  3QHT A;  4A55 A;  2WXM A;  4WJP A;  2LD9 A;  1YIW A;  1QLB B;  2CHW A;  4AJW A;  2YVC A;  2AL3 A;  2IO1 B;  2PIA A;  3Q69 A;  2ZPY A;  3RPF C;  2GBM A;  4JGH B;  2W3S A;  4JE3 B;  2G45 B;  4RF1 A;  3ZKJ C;  3AEF B;  3EFC A;  3PLU A;  1M4V A;  3AE7 B;  2JZP A;  4MH0 E;  3Q3M C;  3DHG C;  1E6E B;  3N32 A;  1F2R C;  3BIN A;  3RZW C;  3DVG Y;  1WZ3 A;  3EHV A;  3B08 A;  1FNW A;  4TKN A;  1IGD A;  1LXD A;  1R4M I;  3L10 B;  2C7H A;  3NZU A;  2MP2 B;  3IT6 B;  4M02 A;  4ANV A;  1G6J A;  1WGG A;  3W9C B;  1TS4 A;  4K1R B;  4WJN A;  2KTF A;  4DWF A;  3AU5 A;  3KVF B;  4BKS D;  4FUL A;  3ZNG C;  3TEY A;  2KWC A;  4N58 A;  4URK A;  5GXG B;  1JWS D;  3PTF C;  3L13 A;  1EWY C;  3CMM B;  4ICV A;  5IA7 A;  4OVV A;  4N6E B;  2C7M B;  2YLM A;  1C9F A;  4C80 A;  1ZPS A;  4MM3 B;  5CHF A;  5L83 A;  3DBR I;  4WUR A;  2MP2 A;  2LXA A;  3AEB B;  4DHZ B;  2LEK A;  2NVU I;  3KUD B;  4YL8 A;  3RYT A;  3IBE A;  3N3K B;  2X38 A;  1WX8 A;  1E8Y A;  2M1M A;  3AE3 B;  4XGA B;  2MJE A;  4YWG G;  3AEG B;  3DBS A;  3VAW A;  3KQ4 A;  3P4S B;  3DVN V;  4A3P A;  1RYJ A;  1JAL A;  1SE3 A;  2Y3A A;  1VZ7 A;  3V05 A;  1TIF A;  3VVW B;  3UF8 A;  2W55 A;  2G3Q B;  1L2N A;  1R4M B;  3U2S C;  5AZH A;  1OTR B;  1V6E A;  1XLQ A;  3M3J A;  3ZLZ A;  1T0Y A;  1KRH A;  2L1A A;  4XDD A;  2ZEQ A;  5LXH A;  2KTR A;  2MWS B;  2V9H A;  2XK5 B;  4W9L A;  4IUM B;  2FIF A;  1QQR A;  2KDE B;  2PTL A;  4RCO A;  1NDD A;  3W1S A;  4MGZ E;  3U4E G;  5C23 A;  3DVG X;  4A90 A;  4ZRP A;  1TKE A;  3DPD A;  3MJW A;  5DPW A;  2LZ6 A;  3HM3 A;  4F1S A;  3B2F A;  2K5P A;  1SF0 A;  1XXG A;  1RM6 C;  1V5T A;  4JIO U;  2W3R A;  3PT2 B;  2MRP A;  2NTT A;  4GIV A;  2YEP B;  3BWU D;  2LVQ A;  5C1Z A;  2BYE A;  1MPE A;  2RDG A;  4R3D A;  3B2G A;  2D3G A;  3QC8 B;  2L8J A;  4OZA A;  4AQ7 A;  5EE1 A;  1WRD B;  1X1M A;  2WXJ A;  3IXS A;  4BZA A;  4XYC A;  4OW0 A;  4XWT A;  2MJD A;  3VUY A;  3I63 C;  4OZB A;  4MGY E;  2K8H A;  4O1N A;  5IO9 A;  2FCN A;  3PSE B;  5H92 C;  2PLP A;  4G11 A;  2ZCC A;  1S3S G;  2WGS A;  4HJG E;  4AJY B;  4A8X C;  2FCM A;  3VRB B;  1K51 A;  4ANW A;  3N20 C;  2Z0E B;  4DHJ D;  4YTM B;  1ZE3 D;  3SFE B;  2AYO B;  3BZD B;  2MBO A;  3OLM D;  2G1E A;  1VRA B;  1I4Q A;  4OHJ A;  4EFO A;  4P7I A;  1EO6 A;  3RCZ A;  2DYO A;  1KM7 A;  3UI3 A;  1MHH E;  4W9F A;  3A33 B;  2C9W B;  2D2Q A;  3AE6 B;  5IN7 A;  2LFI A;  1FD6 A;  3KW5 B;  4NAW B;  1S1Q B;  3KYD D;  1T0S C;  3CIR B;  4OVU A;  3WIM A;  2HJ1 A;  2HTM E;  5HKH A;  1GG3 A;  5HG2 A;  1F9J A;  5KHO A;  2VRR B;  1AYF A;  1M94 A;  4P6V F;  2MJ3 A;  4BKG A;  5J18 A;  2QHO A;  3WAO A;  3AED B;  4MM3 A;  2ACZ B;  4WIP A;  3QA8 A;  3ZNH B;  2AQ2 B;  2KX0 A;  4A9A A;  1VD2 A;  4KV2 A;  4NNJ B;  4RM9 A;  2GMI C;  1EF1 A;  4AUQ C;  1N61 A;  1WR6 E;  2JUO A;  1T3Q A;  2XN9 C;  1K52 A;  3WA0 A;  2ZCB A;  4B9K A;  2KAJ A;  1DGJ A;  2DZK A;  5D6J B;  4ANU A;  4ACF A;  2KN5 A;  3PRZ A;  1L6V A;  2KK8 A;  2UYZ B;  1L5P A;  3SEB A;  3ZUN A;  1T5X D;  2DEN B;  3UGB B;  3A9J A;  4M01 A;  1VR9 A;  2WXF A;  4HEA 1;  2D3B A;  3WAM A;  1LQB A;  1HQR D;  1SB3 C;  3V6E B;  2BVC A;  4EKU A;  1ZP0 B;  2N4F A;  1IUE A;  4PYZ A;  4NJC A;  2CJN A;  4FLH A;  2GRI A;  3ZIM A;  2FE8 A;  2BT6 A;  2Q5W D;  1CZP A;  2ASQ A;  4IDI A;  2ZW0 A;  3IVF A;  4ITK A;  1WF9 A;  1TTN A;  1RFA A;  3T3N A;  2KKC A;  4MT5 A;  1R4N I;  1WM2 A;  4FJZ A;  4K7U A;  3NY5 A;  2RSU A;  3BII D;  3U52 E;  4YSZ B;  3GE8 C;  4KDI C;  5GMV A;  1FXA A;  4WWO A;  1V86 A;  3R3M A;  3B9J A;  3M63 B;  2KMM A;  1E7P B;  3H7P A;  2QMT A;  1A70 A;  2Z8L A;  1LFD A;  3EA6 A;  2V3N A;  4M0W B;  2CJO A;  4HWI B;  4RGN A;  1PQS A;  2MBH A;  1D5X C;  3DDC B;  2L52 A;  1AN8 A;  2OHF A;  2TSS A;  3DBR B;  4LCD E;  1MG4 A;  4IWP A;  3JW0 X;  3ZNZ B;  2QCZ A;  1L6U A;  3K9O B;  3L54 A;  4B0E A;  4E71 A;  5JZE B;  4HRS A;  4A20 A;  3GP7 A;  2KOX A;  1V5O A;  2PVG C;  3V62 A;  1ZUD 2;  1DOX A;  3GS2 A;  4PS7 A;  2M0A A;  2WXR A;  4HPM B;  1TKG A;  1YJI A;  3UIO B;  3PVL A;  1N6Z A;  3ZRC A;  4NAM A;  4RGM A;  2WYQ A;  2KQ4 X;  1C4P A;  4UDU C;  4S0R A;  3LDZ E;  3L4P A;  3QWZ B;  1XLP A;  3MP9 A;  1ET6 A;  2O6V B;  1SXT A;  2KMA A;  4B95 A;  4HRO A;  3NZ3 A;  2WU5 B;  5HHD G;  4AOF A;  4EZK A;  1UH6 A;  1NYR A;  2DLB A;  3JSV A;  3W5U B;  1P7E A;  2BQQ A;  1JML A;  4RNA A;  3R2T A;  4DXF A;  1EM7 A;  3NJT A;  4XX5 A;  4ARI A;  2L05 A;  2EKE C;  4FHJ A;  5D94 A;  4DQO C;  2CU3 A;  3A1Q B;  2LI5 A;  4KGT A;  2BYF A;  5TSS A;  3TBL D;  1WIA A;  3AE1 B;  3DCG A;  1L4Z B;  2RMM A;  3ALB A;  2ONQ A;  2RPV A;  4Q2J A;  1XCT L;  3H9D A;  5G55 A;  1OEY A;  3NG0 A;  1VJK A;  1P98 A;  1IBX B;  4MH8 A;  1GPX A;  4HCP B;  3Q8F A;  1JQ4 A;  3KYC D;  2FNJ B;  2I38 A;  3TEZ A;  4N59 A;  4KSL C;  1YD8 U;  1AAR A;  3B0A A;  2J0J A;  2J0M A;  3NRZ A;  1CMX B;  1ZW7 A;  4FA6 A;  4WQO B;  1I4R A;  2KNB A;  2QC8 A;  3WAN A;  3KWV A;  4HK2 A;  2QEJ C;  2IPK D;  2L0F A;  1UGM A;  1WGK A;  1V97 A;  3C8Y A;  2LRU A;  3SDL C;  1TS5 A;  3QJZ A;  4DHZ E;  1SJH D;  2ZZP B;  2D11 A;  3Q8B A;  2K6D B;  4KSK C;  1YQB A;  4FAD A;  3V61 A;  1QKZ A;  4LK0 M;  1JRP A;  3ZDT A;  1E10 A;  1F52 A;  3C0R B;  2DAJ A;  1AWD A;  3QX1 A;  2EKI A;  2WHI A;  3VDZ A;  4CHK A;  1E8W A;  1SJE D;  3NUH B;  1XCQ L;  2LJ5 A;  3U30 A;  2SEB D;  2D3C A;  2BTE A;  1Z5S B;  2K3U A;  1N60 A;  2A5U A;  4USA A;  4W9K A;  2KYW A;  5JH5 C;  3ZTC A;  2KLG A;  1C76 A;  5CTR C;  2GBR A;  4WJQ A;  4W9H A;  4YTN B;  2N1W A;  5D7G A;  4IM0 A;  3AE4 B;  2IBI B;  2KHW B;  3EFU A;  4ARC A;  1VZ6 A;  3V6C B;  3IT4 B;  2D07 B;  1I4H A;  2K0P A;  2CR5 A;  4EZJ A;  4CO7 A;  1L7Y A;  3PZ8 A;  1FNV A;  4C7Y A;  3HUI A;  1U4A A;  4ZOH C;  2KT7 A;  4ZHO A;  4W9G A;  1FIQ A;  1JW9 D;  1YJ1 A;  4TMA B;  2RDB C;  2WX0 A;  2AX5 A;  3O65 B;  3HHM A;  5IP4 D;  2KFK A;  1SE9 A;  3Q8C A;  1UD7 A;  3QAR A;  3TJP A;  3RNB C;  3ZJU A;  1WGR A;  4IOI E;  4YTP B;  2K9X A;  2CKH B;  2CS4 A;  2K25 A;  2KDM A;  2R61 A;  2RPQ A;  4ZRI A;  2KO3 A;  2JU6 X;  5FR3 A;  1BML C;  4DDG D;  1ZKH A;  1SEB D;  4KKI A;  4NQL B;  3ZJV A;  1TS3 A;  1WWT A;  2KLC A;  4DXA B;  4W9J A;  1BUI C;  2N7E A;  1WXS A;  2NPT A;  2WDV B;  3IFW B;  3HRD D;  4FJY A;  4NZL B;  4NPN A;  1C1Y B;  1HXY D;  3A1Q A;  2J52 A;  5IAA C;  1OQR A;  3MC9 A;  1SIJ A;  2I1J A;  1CK1 A;  3U7D A;  1VDV A;  2QDF A;  2ZJD A;  4RGO S;  5H8Y E;  1ZDV A;  4ZYS A;  2FAZ A;  1WXQ A;  1EWC A;  4FJV B;  3JVZ X;  3NVY A;  3QQ8 B;  1QIL A;  2KDF B;  2XEW A;  1STE A;  2LVO A;  2IGH A;  3OWE B;  3UQA A;  4I6P A;  4HKQ A;  4FXC A;  2INN E;  1P3Q U;  3ML8 A;  2BKF A;  1HTQ A;  5D3I B;  4P1C C;  1OEY J;  2MLB A;  1KLU D;  3IAS 1;  3P4Q B;  1YJJ A;  4MSM B;  3N1X C;  2LXC A;  2AQ1 B;  2KZR A;  1V9J A;  1XLN A;  2D10 A;  1LO5 D;  3PRE A;  2ON8 A;  5L95 C;  3RNG C;  1RWS A;  3SHQ A;  3P4R B;  4HXD A;  1A5R A;  3UIP B;  1JRU A;  2KQ7 A;  4JLC A;  1FCL A;  5IKC M;  3AM9 A;  1PGA A;  1F0Z A;  5LLI A;  2D5G A;  1PGX A;  4W9C A;  3RNE C;  1D3Z A;  3PZD A;  2NBW B;  4IC7 B;  5FKA C;  3NVZ A;  2WLB A;  2NMQ A;  3VFK A;  2FID A;  3RUL A;  1AW7 A;  2O6V D;  5FR6 A;  2OJR A;  4KZC A;  2DWQ A;  4W9I A;  2LRW A;  4P1B C;  4JPS A;  1RLF A;  3BYY B;  3GB1 A;  3RT3 B;  3SD5 A;  2ZNV C;  3U7Z A;  1K8R B;  1SSN A;  2LGI A;  2LHE A;  2EEL A;  1HTO A;  2K8B A;  3N30 A;  4YSX B;  3H1U A;  1HZ6 A;  4I6L B;  1TZO A;  3CSF A;  4LNO A;  1WXV A;  2O2V A;  3R66 C;  2AWT A;  2KC1 A;  1P0R A;  1WZ0 A;  3KH0 A;  4KX6 B;  5BO4 B;  3V60 A;  2OED A;  4DBG A;  1ZDX A;  3OAW A;  1FXT B;  2A4Z A;  2QIL A;  2HD5 B;  1TGZ B;  2RR9 A;  1OQY A;  3URY A;  2KJ6 A;  3VRA B;  1V8C A;  2JT4 B;  1WX9 A;  5EE9 A;  4DK5 A;  1YQ3 B;  2WWZ A;  3MHZ A;  1PGB A;  4G50 A;  3BK1 A;  1EU4 A;  4CYE A;  3KUC B;  2Y5B B;  2BF8 B;  4KIK B;  4GSW A;  2W54 A;  4MSQ B;  4JL9 A;  4PS8 A;  1L4D B;  1ZXI A;  1EF5 A;  1L0V B;  3FIL B;  2BS3 B;  2MBB B;  2IGG A;  1QF6 A;  1WGD A;  5G2N A;  4GU2 A;  2DAF A;  2N9P C;  4YXD B;  3DOW A;  1HA5 A;  1YN5 A;  1TY2 A;  4E74 A;  3PO0 A;  2QJL A;  1FRR A;  1E8Z A;  4LTU A;  1FRD A;  2IZV B;  2J53 A;  1L0X B;  2NBV B;  3UIN B;  4C7Z A;  2WDQ B;  2I1K A;  1WJ4 A;  1VCB A;  3J9C A;  3BVG A;  2KTR B;  2LMC A;  2GLS A;  2KWV B;  2RGF A;  3QIJ A;  4M8M A;  3RD2 A;  1NEK B;  1LM8 B;  2QSD A;  3WCQ A;  3Q8A A;  5E6J A;  1ZGU B;  2M56 B;  3ML9 A;  3ZO5 B;  1WSP A;  2DYM A;  3NVV A;  2L76 A;  4IM2 A;  3AUL A;  4GDL A;  1KJT A;  3DBL I;  3O13 A;  1PYW D;  2DZI A;  2LAS A;  5G5G A;  2LGD A;  2IND C;  3BK2 A;  5LXI B;  4XC2 A;  3RZF A;  4P16 A;  1NVI D;  3ZDM C;  4KKJ A;  3P1M A;  1D4B A;  3ZJT A;  2R2O A;  2B3A A;  3SFD B;  1H8C A;  4TQ0 A;  4FBJ B;  2MHJ A;  4BKT A;  2MBE A;  1BT0 A;  1LGR A;  2BS4 B;  2K1F A;  3R7R A;  2PVO D;  2JYE A;  2FCS A;  4G3X B;  3DHH C;  3E56 A;  1KFY B;  2ZVN A;  4NAW A;  3P63 A;  2IJ0 A;  2LJI A;  3L17 A;  5DCN A;  1D6E C;  4TUU A;  4RMA A;  2QIE B;  2V3S A;  1B9R A;  3OJ3 A;  3HVD A;  1QT9 A;  1UBQ A;  3RUI B;  1NYQ A;  3K9P B;  2KDI A;  3ZQ4 A;  1BXT A;  5HFY A;  3P2B A;  4NJ6 A;  2G9H D;  4WJO A;  3A9K B;  4HPP A;  1OGW A;  4BOZ B;  3ZYY X;  4REZ A;  1D5M C;  3NOB A;  4S17 A;  1HE8 A;  1NEN B;  1N63 A;  4DDI D;  1FMA D;  2M17 A;  1N62 A;  1WE7 A;  1WJU A;  5FK9 C;  3VH4 B;  3KWL A;  5E6N A;  3UQB A;  5CX3 A;  1JWU D;  2BWE S;  5BYS A;  4RF0 A;  3TCA A;  1C3T A;  2C7N B;  4K81 A;  4LJP B;  4WWM A;  1K53 A;  3SU8 X;  3RN9 C;  3JSV B;  2GBJ A;  4PYU A;  1IBX A;  1F77 A;  4XE0 A;  2WXG A;  2JWZ A;  3VQI A;  1E7V A;  1ISN A;  2JSV X;  3ZGZ A;  3SR6 A;  5AZF A;  3T9L A;  2PE9 A;  1KLG D;  3VR8 B;  4RH6 A;  1NI3 A;  4PT5 A;  1WFY A;  3Q3N C;  3AE8 B;  1KOT A;  2G4D B;  2RD0 A;  1RRB A; 
#chains in the Genus database with same CATH homology
 2FIF A;  5JH5 C;  2XBB C;  5E6O A;  3ZTC A;  2KLG A;  4AWJ A;  5CTR C;  3W1Y A;  2KDE B;  2JZ3 B;  1NDD A;  2GBR A;  2L00 B;  3W1S A;  1TZ1 A;  4MGZ E;  4BKS A;  2J0K A;  4WJQ A;  4W9H A;  5C23 A;  5KHQ A;  3DVN U;  3DVG X;  3EC8 A;  3MTN B;  4XZ4 A;  2MA9 B;  2N1W A;  5D7G A;  1WR1 A;  3I3T B;  4IM0 A;  3DPD A;  2IBI B;  1GUA B;  1WJN A;  3S2A A;  5JHA A;  4RM8 A;  2KX3 A;  2KHW B;  1V80 A;  2L0T A;  3EFU A;  3MJW A;  5DPW A;  2MBQ A;  2LZ6 A;  3V6C B;  2FCQ A;  3HM3 A;  4F1S A;  2NPT B;  1XT9 B;  2D07 B;  2CR5 A;  4EZJ A;  3APF A;  3PHX B;  4CO7 A;  3AU4 A;  1L7Y A;  2C5L C;  2IY0 B;  2DHZ A;  2M0X A;  4KDL B;  1V81 A;  3PRM B;  1V5T A;  4JIO U;  3PT2 B;  1U4A A;  4LDT D;  4DHJ B;  2MRP A;  3AI5 A;  4GIV A;  4EUT A;  3TMP B;  4NQK E;  3VXW A;  2MW5 A;  2LWP A;  2L3Z A;  5D2M B;  3ZW3 A;  2LVQ A;  5C1Z A;  4W9G A;  5DPS A;  2BYE A;  1YJ1 A;  2WX0 A;  2HJ8 A;  2D3G A;  2EMS A;  3QC8 B;  2L8J A;  3O65 B;  4BFR A;  1P9D U;  1E90 A;  3HHM A;  2KWU B;  4GMV A;  1WRD B;  1X1M A;  3NHE B;  2KFK A;  2LVP A;  4WWP A;  2M4N A;  3VH3 B;  3QK0 A;  1SE9 A;  1UD7 A;  3QAR A;  4GXB A;  2R2Q A;  3R7Q A;  3TJP A;  3TIX A;  1WGR A;  3VUY A;  4GDK A;  4MGY E;  2K8H A;  2KFK B;  2FCN A;  2CKH B;  3PSE B;  4G11 A;  2ZCC A;  4IG7 B;  1S3S G;  2CS4 A;  2K25 A;  4WWN A;  4AJY B;  2CHZ A;  2RPQ A;  4ZRI A;  2PE6 B;  2FCM A;  4HLE A;  1I42 A;  1Q5W B;  4TQ1 A;  2KO3 A;  4ANW A;  3PHW B;  4DDG D;  1ZKH A;  1WMH A;  2AEH A;  3A9J B;  4NQL B;  2Z0E B;  1NI2 A;  2KLC A;  4DXA B;  4W9J A;  4EOY A;  4ZDV A;  2N7E A;  1WXS A;  4DHJ D;  4M8N A;  4ASW C;  2NPT A;  3IFW B;  4FJY A;  2AYO B;  1WE6 A;  2MBO A;  2NR2 A;  3OLM D;  2JXX A;  3QAQ A;  4F7Z A;  4NPN A;  1C1Y B;  4II2 B;  4EFO A;  4W9D A;  3ZNI D;  3A1Q A;  4ICU A;  1QZE A;  4P7I A;  1EO6 A;  3RCZ A;  4W9E A;  4MGK E;  4MJS A;  2DYO A;  1KM7 A;  4LJO B;  5IAA C;  1Q0W B;  3VUW A;  3T8M A;  2I1J A;  2JRH A;  4KVG B;  3M62 B;  4W9F A;  2LGY A;  3U7D A;  5JHB A;  2WDT B;  3A33 B;  2GBN A;  4TV3 A;  2ZJD A;  2C9W B;  2D2Q A;  2L7R A;  2KJR A;  2JY6 A;  2FAZ A;  4FJV B;  1P1A A;  3KW5 B;  4NAW B;  3JVZ X;  1S1Q B;  3KYD D;  3A4S C;  3QQ8 B;  3BY4 B;  4OVU A;  3CF6 E;  3WIM A;  4X57 B;  5HKH A;  2KDF B;  2XEW A;  3NZS A;  1GG3 A;  3ECI A;  1GJZ A;  3M95 A;  1F9J A;  5KHO A;  4E3C A;  2LVO A;  2VRR B;  2Z59 B;  3JYU A;  1M94 A;  4GB9 A;  3VUX A;  4BKG A;  3DQV A;  5J18 A;  3UQA A;  2QHO A;  4I6P A;  5DPT A;  5J2R A;  3A9K A;  3WAO A;  4MM3 A;  2REX A;  4NY0 A;  4HPL B;  1P3Q U;  2KFJ A;  3H7P B;  3ML8 A;  3VHT C;  2BKF A;  2IY1 B;  1MG8 A;  1OEY J;  2FUH B;  4HVB A;  2KJH B;  3HM6 X;  3QA8 A;  4N9F 4;  3ZNH B;  2GBK A;  2MLB A;  1E5W A;  3H6N A;  3IG3 A;  2KD0 A;  2KX0 A;  4MSM B;  1VD2 A;  2LXC A;  4KV2 A;  3IHP C;  2KZR A;  1V9J A;  4NNJ B;  2D10 A;  2IO0 B;  4GDL B;  4RM9 A;  2GMI C;  1EF1 A;  1WXM A;  3ONS A;  4AUQ C;  3PRE A;  2MQJ A;  2N7D A;  5DPR A;  5L95 C;  1WR6 E;  2JUO A;  2WX1 A;  3SHQ A;  4HXD A;  1A5R A;  3UIP B;  3WA0 A;  1J8C A;  2MSE D;  2ZCB A;  4B9K A;  1XQQ A;  1JRU A;  2KQ7 A;  2DZK A;  4JLC A;  4WAA A;  2BKR B;  5D6J B;  4II3 B;  4ANU A;  2KN5 A;  1V2Y A;  3PRZ A;  2KK8 A;  2UYZ B;  2HE7 A;  1WYW B;  4ZYN A;  5LLI A;  3ZUN A;  1Z2M A;  2DEN B;  2BWF A;  1D3Z A;  2PJH A;  1TBE A;  4W9C A;  3PZD A;  3A9J A;  3UGB B;  2NBW B;  4HDQ A;  4IC7 B;  4PS3 A;  1WX7 A;  3VFK A;  2FID A;  1LQB A;  3WAM A;  3HK0 A;  3U8Z A;  2CHX A;  2Z0D B;  3V6E B;  2EMT A;  3RUL A;  5FR6 A;  2O6V D;  5TR5 A;  1Q1O A;  4EKU A;  2OJR A;  4KZC A;  2K39 A;  3HIZ A;  3ZTD A;  2N4F A;  3QCA A;  1IPG A;  4PYZ A;  2LRW A;  3PLV A;  4W9I A;  3APC A;  3DBH I;  3APD A;  4ZRK A;  4FLH A;  1RLF A;  1WY8 A;  3ZIM A;  1GC7 A;  4MDK E;  1YX5 B;  3RT3 B;  2O6V A;  3SD5 A;  2ZNV C;  3H7S A;  1WGY A;  1J0G A;  1K8R B;  2N9E B;  2V1Y A;  4EEW A;  2ASQ A;  1WXA A;  2JF5 A;  3L0W B;  2AL6 A;  1WGH A;  2K8B A;  5AZG A;  3N30 A;  3H1U A;  3IVF A;  1WF9 A;  4I6L B;  3VTV A;  3CSF A;  1TTN A;  1RFA A;  3VTW A;  1WXV A;  1EUV B;  2O2V A;  2MCN B;  2KQS A;  2DX5 B;  3L08 A;  3R66 C;  2KKC A;  1R4N I;  1WM2 A;  4FJZ A;  2AWT A;  4K7U A;  2KC1 A;  1P0R A;  3NY5 A;  2RSU A;  1WZ0 A;  1H4R A;  3KH0 A;  2KXJ A;  4KDI C;  5GMV A;  2G4S A;  3PV1 A;  1WH3 A;  4MJS B;  5BO4 B;  2JZZ A;  3TL5 A;  3V60 A;  4DBG A;  3OAW A;  1V49 A;  1FXT B;  2MX2 A;  3Q3F A;  4GOC A;  2A4Z A;  3L16 A;  2HD5 B;  4WWO A;  1V86 A;  4A3O A;  3R3M A;  3AXC A;  1TGZ B;  3M63 B;  2RR9 A;  1OQY A;  2JVC A;  2KJ6 A;  3X23 A;  2JT4 B;  2CU1 A;  1WX9 A;  1XD3 B;  1GNU A;  3H7P A;  1KLV A;  2PEA A;  5CHV C;  1LFD A;  2LUE A;  2JPH A;  4DK5 A;  1E8X A;  1NBF C;  4M0W B;  2O2V B;  2NS5 A;  1SIF A;  1SGH A;  2WWZ A;  4HWI B;  4JQW C;  1PQS A;  2OOB B;  3PGE A;  4KZ0 A;  2MBH A;  4GGQ A;  2N9X A;  4G50 A;  3DDC B;  4CYE A;  3KUC B;  1RAX A;  2Y5B B;  4LCD E;  4KIK A;  2BF8 B;  4KIK B;  2K8C A;  2XK5 A;  4GSW A;  4IWP A;  2ZPN A;  4BBN C;  3JW0 X;  4GN1 A;  3ZNZ B;  4MSQ B;  2ZNV B;  4JL9 A;  1UEL A;  2DYB A;  3PRP B;  4PS8 A;  2C60 A;  3WAL A;  2GOW A;  1EF5 A;  3K9O B;  4MGI E;  4GDK B;  3L54 A;  2MBB B;  4J6I A;  3PPA A;  5CHW A;  4E71 A;  4AP4 C;  5JZE B;  3X0W A;  1WGD A;  4A20 A;  2J7Q B;  2KC2 A;  4ANX A;  2KOX A;  5G2N A;  4HJK A;  4GU2 A;  2DAF A;  2N9P C;  1V5O A;  3V62 A;  4MEM A;  3DOW A;  4FHK A;  3GZN I;  3NS8 A;  3OJ4 B;  2M8S A;  4E74 A;  4PS7 A;  1WM3 A;  5AEK B;  4HPM B;  1E8Z A;  3UIO B;  1I35 A;  1Y8R C;  3PVL A;  4EZL A;  2BGF A;  3B1L X;  3ZRC A;  2IZV B;  3PS6 A;  2IYD B;  2WYQ A;  1WJ6 A;  5E6P A;  2W9N A;  2NBV B;  4BVU C;  3UIN B;  3QHT A;  2K6Q A;  2I1K A;  4WJP A;  1WJ4 A;  1VCB A;  2IO2 B;  1YIW A;  2CHW A;  2KVR A;  2KTR B;  2LD9 A;  3KUZ A;  3LDZ E;  3QWZ B;  2KWV B;  2RGF A;  3QIJ A;  2O6V B;  4M8M A;  3RD2 A;  2KMA A;  4AJW A;  1LM8 B;  2UWQ A;  2YVC A;  4B95 A;  4EZK A;  2AL3 A;  2IO1 B;  3LJ3 A;  4AOF A;  2DZJ A;  1ZGU B;  1UH6 A;  3ML9 A;  3ZO5 B;  4G0N B;  3ENE A;  2ZPY A;  3JSV A;  2DYM A;  3EEC A;  2L76 A;  4IM2 A;  2GBM A;  2ZVO A;  1KJT A;  3AUL A;  3DBL I;  4GDL A;  4JGH B;  2PPH A;  2DZI A;  3A4R A;  2LAS A;  2IO3 B;  4XX5 A;  1WI0 A;  2G45 B;  1YX6 B;  2L05 A;  2EKE C;  2LGD A;  4FHJ A;  3ZKJ C;  5D94 A;  3PLU A;  5LXI B;  3MHS D;  4XC2 A;  4BBN F;  3A1Q B;  2NCN A;  2LI5 A;  3RZF A;  3CST A;  2HTH A;  4MH0 E;  2BYF A;  3N32 A;  3ZDM C;  1IYF A;  3BIN A;  3TBL D;  2R2O A;  1WIA A;  3RZW C;  3DCG A;  2B3A A;  3DVG Y;  1H8C A;  1WZ3 A;  4TQ0 A;  3EHV A;  3WAP A;  3B08 A;  4FBJ B;  4TKN A;  3ALB A;  4BKT A;  1LXD A;  1R4M I;  3L10 B;  2C7H A;  2MBE A;  4HDO A;  1UZX B;  1BT0 A;  3GOE A;  3NZU A;  2BPS A;  4I6N B;  2MP2 B;  1WMH B;  3H9D A;  3ZVV A;  4F8C B;  2K1F A;  3Q3J A;  3R7R A;  4ANV A;  1G6J A;  1WGG A;  2FCS A;  5G55 A;  1OEY A;  2NBU A;  1P98 A;  4K1R B;  4WJN A;  4G3X B;  2KTF A;  4DWF A;  5J17 A;  5EDS A;  3AU5 A;  3KVF B;  4BKS D;  1J19 A;  4FUL A;  3ZNG C;  2ZVN A;  2KWC A;  4NAW A;  4URK A;  3L17 A;  5DCN A;  4HCP B;  4TUU A;  4RMA A;  2V3S A;  3KYC D;  3OJ3 A;  2FNJ B;  3PTF C;  4KSL C;  3L13 A;  1YD8 U;  3CMM B;  4ICV A;  1AAR A;  5IA7 A;  4OVV A;  1UBQ A;  2C7M B;  2YLM A;  3RUI B;  3B0A A;  2J0J A;  3K9P B;  2KDI A;  2J0M A;  1CMX B;  1ZW7 A;  3P2B A;  4NJ6 A;  4FA6 A;  4WQO B;  5CHF A;  2KNB A;  3A9K B;  3DBR I;  4WJO A;  5L83 A;  1OGW A;  1IP9 A;  4BOS C;  3WAN A;  2V4L A;  2MP2 A;  4BOZ B;  4HK2 A;  2LXA A;  3NOB A;  2L0F A;  4DHZ B;  1HE8 A;  2LGX A;  2NVU I;  1UGM A;  1UBI A;  4DDI D;  3KUD B;  4YL8 A;  3RYT A;  3IBE A;  2LRU A;  2M17 A;  3SDL C;  3N3K B;  3QJZ A;  4DHZ E;  1WX8 A;  2KMC A;  4K7W A;  1E8Y A;  2ZZP B;  2D11 A;  2KDB A;  2K6D B;  3W1S C;  3D32 A;  4KSK C;  1YQB A;  4FAD A;  1WE7 A;  3V61 A;  1WJU A;  2M1M A;  4NJ7 A;  4IW0 A;  3ZRF A;  2DZM A;  3VH4 B;  5E6N A;  3UQB A;  5CX3 A;  2BWE S;  3ZDT A;  3C0R B;  3DBS A;  3TCA A;  3VAW A;  2DAJ A;  1C3T A;  2C7N B;  4K81 A;  4LJP B;  3DVN V;  4IWO A;  4A3P A;  4IWQ A;  1GC6 A;  3QX1 A;  2BYV E;  3SU8 X;  3VDZ A;  3JSV B;  2GBJ A;  4CHK A;  1E8W A;  2KAN A;  4PYU A;  2N1V A;  2JRI B;  3VVW B;  3UF8 A;  2JWZ A;  2G3Q B;  3VQI A;  1E7V A;  1L2N A;  1ISN A;  5AZH A;  2LJ5 A;  3VTU A;  1OTR B;  3U30 A;  1V6E A;  3M3J A;  4B6W A;  1E7U A;  4ZRJ A;  5AZF A;  3T9L A;  2PE9 A;  4LDT B;  3ZLZ A;  1Z5S B;  1T0Y A;  4K7S A;  2A5U A;  4FN2 A;  1WFY A;  5LXH A;  2ZEQ A;  4IM3 A;  4HCN B;  4MEL A;  2KTR A;  1KOT A;  2G4D B;  2MWS B;  2XK5 B;  2RD0 A;  4W9L A;  4IUM B;  4W9K A;  1RRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...