2GBKA

Crystal structure of the 9-10 moad insertion mutant of ubiquitin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
b'MQIFVKTLTQVRELVGGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 23
structure length 82
sequence length 82
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbkA00
3NS8A 1WGYA 4NJ6A 3V60A 3K9PB 4W9DA 3K9OB 1L2NA 4BKGA 2KQSA 5DCNA 4ANWA 4K7WA 1KLVA 5BO4B 1P0RA 2YLMA 2C9WB 4KDIC 2KJRA 1A5RA 2MX2A 2YVCA 1YIWA 2MSED 3HM6X 4JL9A 5J17A 4NQLB 1J8CA 1NBFC 4ANXA 2D10A 2L3ZA 2K25A 2M1MA 2GBRA 4HPLB 3QA8A 5DPWA 1TTNA 1F9JA 3ZO5B 2O6VB 3PGEA 2N9EB 4GDLB 3W1SA 3V61A 4HLEA 3TBLD 4NQKE 2C60A 4AJWA 2I1JA 2MP2B 3A9KA 2LGXA 2REXA 3A9JA 3PS6A 4LCDE 3B0AA 2J0JA 3X23A 1C1YB 3CSFA 2VRRB 2NR2A 1ZKHA 3A4RA 3IVFA 4GN1A 4EZLA 2V3SA 3NOBA 2WX0A 3M3JA 4MSQB 3DVGY 4CO7A 2KFKA 3BINA 4HJKA 2A5UA 2LVOA 2O2VA 4G11A 4HCPB 4F8CB 3IBEA 3OJ3A 1WJUA 2KN5A 3VTWA 3OAWA 5D2MB 1LQBA 3VH3B 3RD2A 1WGGA 2KLCA 3R3MA 2DAJA 2KX3A 2BYVE 4RM9A 3S2AA 1WFYA 4TQ1A 3U7DA 2K8BA 4YL8A 3WANA 3VHTC 2K8CA 3WAPA 4EFOA 3RT3B 2LGYA 1JRUA 2HTHA 3L16A 4FA6A 2J0MA 2OOBB 1RLFA 1WF9A 2IO0B 4X57B 3A9KB 5AZGA 2BKRB 4ZRKA 4EOYA 4FLHA 2BKFA 4FJZA 4DK5A 1WGDA 2KOXA 4F1SA 4HWIB 1WJ4A 2MBBB 4GIVA 1Q0WB 3L0WB 4EKUA 3QX1A 3TIXA 2JVCA 3ZNGC 5FR6A 4PS7A 2DX5B 2LXAA 3QC8B 2NBUA 5DPRA 2DYOA 3HIZA 2O2VB 4M0WB 4MM3A 1YD8U 4URKA 4G0NB 3VUYA 3P2BA 1WX7A 3IG3A 2DHZA 2KZRA 3L13A 4IM3A 3SHQA 2BF8B 2K1FA 4OVVA 4W9EA 3ZIMA 1UBIA 4BBNC 4IWOA 3PZDA 1KJTA 1XQQA 2N7EA 2KMAA 3I3TB 2LJ5A 2KDEB 2PPHA 4FN2A 2W9NA 5TR5A 2DENB 1YJ1A 3A1QB 4LDTD 2L76A 3PREA 4OVUA 2ZVOA 5CHFA 3HHMA 4EZKA 4IC7B 3PVLA 3AI5A 1WGRA 3PRMB 1IP9A 4WJOA 1T0YA 4MSMB 4GB9A 4IW0A 1E7UA 2KD0A 4K7SA 1WR1A 4DBGA 4AJYB 2NCNA 4W9IA 2N1VA 2KKCA 3RYTA 3V6CB 4HVBA 5D7GA 4ICUA 3GZNI 3H7SA 3LJ3A 5D6JB 3T9LA 2WX1A 4II3B 1WZ0A 2M17A 3L08A 3DBRI 4G50A 3WA0A 3JW0X 2ZEQA 2D2QA 3LDZE 5JHAA 2MP2A 4NY0A 4JIOU 1V49A 1WE6A 4NAWB 4MGYE 2DYBA 2ZNVB 2HD5B 2KMCA 4BKSA 4WJQA 4IWPA 4ANVA 4W9GA 4AP4C 2JZ3B 2KTRA 5JHBA 2G45B 4MGKE 2DZMA 2NS5A 2FIDA 3PPAA 3UIPB 2RGFA 4RM8A 3KUZA 3CSTA 1YQBA 3H7PA 3ZRFA 2KWVB 4DHJB 1NI2A 2EMSA 2XK5B 5E6OA 1IPGA 2KJHB 2C7HA 2OJRA 1AARA 2IO1B 5LLIA 1OTRB 2ASQA 3ZTDA 3ML8A 4TKNA 3ZNHB 4KZ0A 3QAQA 2PE6B 3SU8X 1G6JA 2D3GA 3RUIB 5E6NA 4I6PA 1WM2A 4W9LA 1WXVA 2JRHA 1VCBA 4FJYA 1R4MI 2KWCA 2L7RA 3ALBA 2MBQA 4I6LB 2Z59B 2IO2B 2D07B 3KYDD 2KVRA 4TUUA 4B9KA 2CU1A 4NPNA 5AZHA 3PHXB 2PJHA 2V1YA 3VUWA 3A33B 2KTRB 2AL6A 4GMVA 1RFAA 1U4AA 3RULA 2CHZA 2BGFA 2J0KA 3UINB 1P9DU 1S1QB 1VD2A 2CHXA 3H7PB 3AU4A 3N3KB 2M8SA 2RD0A 1WXMA 4G3XB 5HKHA 3APFA 3PLUA 2KK8A 3WAOA 4B6WA 3Q3FA 1Q1OA 2KFJA 2NVUI 4HXDA 3AXCA 4DHZB 3NY5A 5DPSA 4F7ZA 2JZZA 4W9CA 1WE7A 2KTFA 3VXWA 3DQVA 1P98A 3A1QA 2LXCA 3APCA 4B95A 4ZDVA 5AEKB 3UF8A 1I35A 2LRUA 4FHJA 4A20A 2KQ7A 3PSEB 5EDSA 2KLGA 4PS3A 4EEWA 1KOTA 1E90A 2GBKA 2MWSB 4IM2A 3V62A 2RR9A 4MEMA 2KXJA 3VFKA 4KVGB 2FIFA 3KYCD 3WAMA 4TV3A 2LWPA 2G4DB 2V4LA 3AU5A 5G55A 3HK0A 2GBNA 4AUQC 4HPMB 1OEYJ 1X1MA 4XC2A 3L17A 2K6QA 3A4SC 5C23A 3C0RB 3JVZX 1EO6A 2ZZPB 5D94A 2KO3A 2MBOA 4JLCA 1V5OA 4XX5A 2IYDB 2IZVB 2LGDA 3EC8A 3QQ8B 1E8WA 4GDKA 5KHQA 2G4SA 1OQYA 1P3QU 3APDA 4GU2A 1V6EA 2DZIA 3R7QA 1SGHA 2PEAA 1EF1A 1ISNA 2CHWA 4J6IA 3CF6E 2BPSA 2UYZB 2MRPA 3B08A 4NAWA 3O65B 3ECIA 2A4ZA 4NJ7A 4WWOA 2JWZA 4LJPB 3WALA 3N32A 2LVPA 3QWZB 3DVNU 2KNBA 2GMIC 4EZJA 4BBNF 3AULA 4K7UA 1UH6A 1M94A 2K39A 2LD9A 4WWPA 1XD3B 1WXSA 4W9HA 4ZYNA 1D3ZA 4MH0E 4FHKA 1SE9A 1KM7A 2J7QB 3IFWB 2M0XA 2PE9A 4GSWA 5L83A 1WI0A 2IBIB 2IY1B 3OLMD 1Q5WB 3M63B 2N9PC 2MW5A 2C7NB 2Z0DB 2AWTA 2JF5A 1CMXB 2G3QB 4GXBA 4NNJB 2KC1A 1WZ3A 4M8NA 4WJPA 1R4NI 2NPTA 2BYFA 2EMTA 3UQBA 2XK5A 4GDKB 2LUEA 4DXAB 3H1UA 1WMHA 2EKEC 4W9JA 2FCQA 1YX5B 3KVFB 3QARA 3OJ4B 3QK0A 1C3TA 3ZDTA 5CHVC 4P7IA 3ZKJC 2D11A 1WXAA 1TBEA 1ZGUB 4BKTA 5E6PA 2JRIB 1K8RB 3D32A 2LASA 1E5WA 3DBSA 1NDDA 1TZ1A 4RMAA 3PRZA 2HJ8A 3DDCB 3Q3JA 5GMVA 3ZUNA 3N30A 2BYEA 2KANA 1WX8A 2JUOA 2O6VD 1OEYA 3DVGX 1E8ZA 4LDTB 2LVQA 2L0FA 4IWQA 3RZWC 3TCAA 5LXHA 4ZRJA 2JPHA 3JSVA 1EF5A 2ZCCA 3QJZA 2R2QA 4XZ4A 1V9JA 4KSLC 3VH4B 1J19A 1BT0A 3R7RA 4ANUA 3W1YA 2NPTB 4JGHB 3WIMA 4HDQA 2MA9B 3UQAA 1WMHB 3X0WA 4ICVA 2FCSA 1WGHA 1V5TA 2GBJA 4W9KA 1E7VA 3U8ZA 2N1WA 1UGMA 4FADA 2WYQA 4KIKA 2KWUB 1XT9B 2FNJB 3TL5A 1E8XA 2IO3B 3ZNZB 4K81A 1FXTB 1UZXB 3PT2B 2GOWA 1UD7A 3W1SC 3PRPB 2R2OA 1LM8B 4HDOA 4FBJB 4LJOB 4N9F4 3DCGA 1P1AA 2Y5BB 2QHOA 3ZW3A 4DWFA 4FJVB 1WJNA 3VTUA 3DPDA 2DZJA 1Z5SB 1UELA 3JSVB 2MQJA 3L54A 4E71A 4MJSA 1WYWB 3JYUA 4PYZA 4ZRIA 2JY6A 5J18A 2KJ6A 4AOFA 2K8HA 3PTFC 3MJWA 2L0TA 5G2NA 4CHKA 4TQ0A 3M62B 5CTRC 4KDLB 2UWQA 3CMMB 1RAXA 4DHZE 1WR6E 2FCNA 3MTNB 3QHTA 4KIKB 5AZFA 4W9FA 2ZVNA 4MGZE 1LXDA 1I42A 3EECA 3ZLZA 4ASWC 1OGWA 1TGZB 2KDBA 2MBEA 2JT4B 3ML9A 1Y8RC 2JXXA 5CX3A 1H8CA 3GOEA 1V86A 5JH5C 2BWFA 3ZVVA 2DYMA 2I1KA 4GOCA 3UGBB 2LRWA 4EUTA 3DBLI 2GBMA 3NZSA 4IM0A 3M95A 4MJSB 3QCAA 5IAAC 1L7YA 3DOWA 2LZ6A 2ZPYA 3KH0A 2L8JA 1ZW7A 1QZEA 3ENEA 2MCNB 3EHVA 3VDZA 4II2B 3A9JB 3B1LX 3H9DA 2AEHA 3PHWB 1V80A 3H6NA 3KUDB 2K6DB 3ZTCA 2DZKA 3V6EB 2C5LC 4JQWC 4K1RB 2FCMA 1V2YA 1EUVB 4GGQA 4BOSC 4BVUC 3KW5B 4BFRA 2KFKB 2MBHA 2KHWB 1Z2MA 1GJZA 5DPTA 2N7DA 5JZEB 2C7MB 4KSKC 1WX9A 2N4FA 4AWJA 4MELA 3VVWB 4HCNB 1LFDA 1E8YA 2KDFB 2ZNVC 3EFUA 3ONSA 1PQSA 4MGIE 4WJNA 5C1ZA 4HK2A 1H4RA 2RPQA 2CKHB 2ZPNA 2NBWB 4E3CA 3R66C 4PYUA 4IG7B 3VAWA 1S3SG 1WY8A 1WJ6A 2WDTB 2M4NA 4KZCA 5CHWA 2WWZA 1GG3A 4FULA 3U30A 3UIOB 1SIFA 3VTVA 1J0GA 2AL3A 2HE7A 1GC7A 2B3AA 4BOZB 4DHJD 3TMPB 3ZDMC 3PLVA 2FUHB 4MDKE 4KV2A 2BWES 5KHOA 3T8MA 4WWNA 2L00B 3ZRCA 4E74A 2KDIA 4A3PA 1YX6B 4CYEA 3NHEB 2DAFA 4WQOB 3DVNV 1WRDB 3SD5A 3VQIA 4WAAA 3BY4B 5IA7A 4DDID 5L95C 3VUXA 1IYFA 1V81A 2XEWA 1MG8A 2AYOB 3TJPA 2FAZA 1GC6A 3L10B 4PS8A 4I6NB 3PV1A 4DDGD 4BKSD 2O6VA 2ZCBA 4GDLA 2CS4A 1RRBA 1UBQA 3RZFA 2KX0A 5J2RA 2XBBC 3IHPC 2LI5A 4M8MA 3SDLC 3HM3A 3MHSD 1GNUA 3ZNID 2KC2A 2MLBA 1WM3A 1WH3A 2RSUA 2CR5A 2N9XA 3QIJA 2L05A 5LXIB 2NBVB 3KUCB 3DBHI 1WIAA 4IUMB 2Z0EB 2IY0B 1HE8A 2ZJDA 1GUAB 4A3OA 3NZUA 3RCZA
chains in the Genus database with same CATH superfamily
4W9DA 1DGJA 1L2NA 2JSVX 1NVID 5DCNA 1RFKA 5BO4B 1FD6A 3AEAB 1ET6A 3Q3OC 1J8CA 2D10A 1OFFA 2M1MA 3QA8A 3ZJVA 2N9EB 4NQKE 4AJWA 2EKIA 3T3NA 3A9JA 2W54A 4XWTA 3PS6A 3B0AA 2PVGC 1C1YB 4RGOS 3IVFA 1I4QA 4EZLA 2V3SA 1Y56A 4CO7A 1KLUD 3BINA 2A5UA 2O2VA 4G11A 4F8CB 1N5XA 3VTWA 3OAWA 3R3MA 4YL8A 3WAPA 3W2DA 3P42A 3CIRB 1JRUA 2R61A 2OOBB 1RLFA 5AZGA 3Q8AA 4EOYA 4FJZA 1BXTA 1PDXA 1WGDA 5C3JB 4HWIB 3QX1A 5FR3A 4A9AA 4ZOHC 3HIZA 2K22A 4G0NB 4IKGA 2UU7A 2KZRA 3RNFC 1UBIA 2IJ0A 4BBNC 1KRHA 3PZDA 1XCQL 1YJJA 3FILB 2CJNA 3I3TB 5CHFA 2ZVOA 4EZKA 3HHMA 2LEKA 4IC7B 4OZCA 2JQRB 1I7HA 5IN7A 2KQ4X 1IP9A 4C4VB 1T0YA 2QEJC 1ZUD2 2W3RA 4AJYB 2LUMA 5FK9C 2MJEA 4R3DA 4HVBA 5D7GA 3B2FA 3AV8A 3T9LA 4II3B 2ZEQA 2D2QA 2KN4A 4NY0A 3ZYYX 1C78A 2ZNVB 1E7PB 2J53A 4IWPA 1C76A 5JHBA 1XCTL 2G45B 4MGKE 2DZMA 4RM8A 2BYTA 3KUZA 4Q2JA 3CWIA 1JRPA 3ML8A 1FNUA 3ZNHB 3TEZA 3Q3NC 4C80A 1VCBA 1R4MI 5HG2A 4LNNA 2MBQA 4I6LB 4TUUA 2CU1A 3A33B 2KTRB 4L23A 1PGBA 1U4AA 1VZ7A 1P9DU 1S1QB 3AU4A 3EGRA 1SIJA 4G3XB 4P16A 2WXRA 3WAOA 3Q69A 4B6WA 3AMZA 2NVUI 3AXCA 2ICIA 3FKYA 2KTFA 3DQVA 4B95A 3UF8A 5I4DA 5EDSA 3LXFA 4C4VA 2RR9A 4A8XC 4QAYA 4TV3A 3RNBC 4AUQC 1OEYJ 4XC2A 3L17A 3C0RB 3JVZX 5D94A 1KTKA 3BIID 3IXSA 2CJOA 2KO3A 4H2AA 4GDKA 4P1BC 1YN4A 5KHQA 1P3QU 1SGHA 1EF1A 3DBHB 1PUTA 3T3OA 3B08A 3BK1A 4KGSA 1F2RC 3TUOA 2AQ1B 1UH6A 2K39A 4ITKA 1XD3B 4ZYNA 1D3ZA 4A90A 3IFWB 5L83A 1WI0A 4OZBA 1K50A 3AEGB 2N9PC 1CMXB 1MHXA 2RMMA 2NPTA 1JWUD 1PGAA 1I4XA 1C3TA 2FCQA 3ZDTA 2PKOA 3ZKJC 2JYTA 3D32A 1E5WA 3AECB 4RMAA 1TZ1A 2HJ8A 1SXTA 1K51A 2KANA 1WX8A 3IT6B 1OEYA 3BVGA 3RZWC 4ZRJA 1EF5A 2ZCCA 3L4PA 5H92C 3R7RA 1FFUA 2XN9C 1WMHB 1E7VA 5BMIA 2WYQA 1KF6B 3PT2B 2GOWA 1UD7A 3W1SC 4BAXA 1ZP0B 4WIPA 3DCGA 1P1AA 2Y5BB 1WJNA 1Z5SB 2NMQA 4E71A 2M0AA 4PYZA 4ZRIA 2JY6A 1VDVA 3MHZA 4CHKA 1UWMA 1JCKB 4KKJA 2UWQA 1RAXA 4DHZE 2FCNA 4XYCA 2N7JA 3N1YC 2K9XA 3QHTA 4KIKB 3RNAC 2GB1A 1WRIA 3EECA 1I42A 2BBCA 2KVZA 2KDBA 1QOFA 2JXXA 2KT7A 5JH5C 2BWFA 3ZVVA 3UGBB 1R4NB 1QOGA 1J7BA 2INCC 4MJSB 3QCAA 3TEYA 1XEEA 2W55A 2MCNB 4II2B 1V80A 2K6DB 1JALA 1SE3A 5BYSA 2QDFA 1V2YA 1I4RA 2KFKB 2MBHA 2KHWB 4XE0A 1SEBD 3EFUA 2KACA 1TS4A 1H4RA 2RPQA 2ZPNA 1UGJA 5AUKA 3FAHA 3R66C 1S3SG 4LLGM 1QQRA 2K5PA 2RDHA 3MC9A 1R4MB 4OHJA 1N63A 2DLBA 1QOBA 2WNMA 2INDC 3VTVA 2HE7A 2PMVA 1FMAD 4DHJD 1F0ZA 3OG5A 3ZRCA 4BZAA 3IAS1 2HTME 4YSXB 1YX6B 3NHEB 1WRDB 3VQIA 4WAAA 3NVWA 2BS2B 3BY4B 1EM7A 5IA7A 5L95C 1V81A 2V3PA 3AE7B 4DDGD 4NJCA 1D4BA 2WXKA 2XBBC 2LI5A 3ZNID 3HM3A 2D5GA 3MHSD 2KC2A 2MLBA 3QIJA 3KUCB 4IUMB 2Z0EB 2ZJDA 3RCZA 1WGYA 3V60A 1QILA 3K9OB 2IGHA 4K7WA 4JE3B 2YLMA 2MSED 1T0RC 3U52E 1NBFC 1I4PA 2WDVB 4HPLB 5DPWA 1TTNA 3ZO5B 3PGEA 3RNEC 2I1JA 2LGXA 2K0PA 2J0JA 4MACA 2VRRB 5EE3A 2WX0A 2WXQA 3DVGY 2KFKA 2NTSA 4HJKA 1HTOA 3P63A 4JWUC 1N6ZA 3AE9B 3I5JC 5D2MB 3RD2A 1C4AA 1XLPA 2K8BA 2L83A 4O1NA 3VHTC 2K8CA 5IP4D 3L16A 2J0MA 3AEDB 4FLHA 2BKFA 2KOXA 1WJ4A 1HXYD 1Q0WB 1NI3A 2W82A 3P4QB 4EKUA 1PYWD 5FR6A 2LXAA 3QC8B 3NS1A 2NBUA 5DPRA 5T8IA 2DYOA 2O2VB 4URKA 4JWSC 2BF8B 2K1FA 4W9EA 3ZIMA 1KJTA 2YEPB 2W9NA 1YJ1A 3GP7A 1N62A 1AN8A 3HRDD 3NJTA 3URYA 1WGRA 1YN3A 4ZRPA 5HFYA 4WJOA 2GLSA 2Q5WD 2V3NA 1WYGA 1EWYC 1E7UA 2KD0A 4K7SA 1MFWA 1TIFA 2NCNA 3Q8FA 2N1VA 4PT5A 1HA5A 2RPVA 3H7SA 4OZAA 1L6UA 3MC0B 1WZ0A 4G50A 2W3SA 3JW0X 1ZPSA 1V49A 4NAWB 4LNOA 4ANVA 3VR9B 4W9GA 2LHDA 2X38A 1F1HA 2NS5A 3H7PA 2KAJA 3ZRFA 2KWVB 4DHJB 2XK5B 1TT5B 5E6OA 2OJRA 1LO5D 1TKYA 2ASQA 4TKNA 4KZ0A 2PE6B 3NVZA 3SU8X 2D3GA 4C7ZA 4I6PA 1WM2A 2KWCA 2L7RA 3ALBA 1PFDA 3N1XC 1P7FA 2INNE 2J4XA 2IO2B 4WQMA 1XLNA 2D07B 4B9KA 1HEZE 2QMTA 4GMVA 3AE3B 1OQQA 3LYYA 2RD0A 1WXMA 3PLUA 2KK8A 4ZYSA 4YWGG 2KFJA 2Z8LA 3NY5A 1MI0A 1QLBB 4OW0A 2JZZA 3VXWA 1JW9D 1P98A 2LXCA 1I35A 4FHJA 1D5XC 1J7AA 1FXAA 2KQ7A 4N6EB 3MP9A 4PS3A 2RDBC 3U2SC 2MWSB 4DXFA 2KXJA 4KGRA 2AX5A 2LWPA 4HPMB 1X1MA 2LGIA 1CQVA 1VZ6A 4ZHOA 3DBRB 2XNAC 1WXQA 4HPPA 4XX5A 1VLBA 2LGDA 4CQNA 1YOVB 4XDCA 2TSSA 2G4SA 1OQYA 4GU2A 2DZIA 4J6IA 3NVVA 2BPSA 2Y3AA 3ETRA 4NAWA 4YTMB 4WWOA 1VJKA 3QWZB 4EZJA 2GMIC 1M94A 4ZRQA 3VRBB 4W9HA 1WXSA 2MEKA 4MH0E 2PVOD 1XXGA 2B76B 2IY1B 3OLMD 1Q5WB 2MW5A 2Z0DB 2G3QB 2D3AA 1R4NI 2XK5A 2M56B 4GDKB 1E10A 1D5ZC 3QK0A 2D11A 4BKTA 1K8RB 3AH7A 2LASA 1NDDA 1FIQA 3BWUD 2BW2A 3N30A 1YMHE 2BYEA 4FXCA 2JUOA 1B1ZA 3DVGX 3MFGA 2LVQA 1C79A 2L0FA 2JPHA 3JSVA 3QJZA 2R2QA 4XZ4A 1V9JA 3KWLA 1ZXHA 4XGAB 2NPTB 3WIMA 4HDQA 2MA9B 3X0WA 1E9MA 2FCSA 2WXPA 1LGRA 3U8ZA 3RI7C 3TL5A 4YTPB 4XWWA 1FXTB 3RFZB 3N9YC 3PRPB 2R2OA 1LM8B 4FBJB 4LJOB 1FM0D 1QT9A 3P1MA 3U4EG 1UELA 3L54A 3JYUA 3P4RB 5J18A 2FE8A 3MJWA 5G2NA 1MG4A 4TQ0A 1E0ZA 3M62B 1GAQB 4KDLB 1L4ZB 1WR6E 2LHEA 1FNWA 4MGZE 1LXDA 1R7SA 1OGWA 3ML9A 2JT4B 2WU2B 3GOEA 4GOCA 2JXTA 1UWXA 3DBLI 2GBMA 5IAAC 1FRRA 3HUIA 2IGGA 2LZ6A 2AQ2B 3KH0A 3UI3A 2L8JA 1NENB 3EHVA 2ZW0A 5BYRA 3PHWB 3TEXA 3ZTCA 2C5LC 4JQWC 4S17A 1IBXB 4K1RB 5AUIA 4ZHPA 4GGQA 4BVUC 2LFIA 1RYJA 4KX6B 5JZEB 2C7MB 4KSKC 4RGTA 2G1EA 4MELA 3VVWB 4HCNB 1LFDA 1E8YA 1K53A 2KDFB 2ZNVC 4WJNA 1YQ4B 2CKHB 2BB6A 2NBWB 4RGMA 3AM9A 1V8CA 2WXOA 3VAWA 2M4NA 1ZOYB 1SIFA 2D3BA 2AL3A 1GC7A 2B3AA 3ZDMC 5KHOA 4AQ7A 2L00B 1SE2A 4E74A 4WH4A 4A3PA 4CYEA 2BVCA 3DVNV 1EU3A 4NAMA 4RF1A 2KYWA 5JXVA 2AYOB 3MC8A 3PV1A 1CJEA 2O6VA 4GDLA 2CS4A 1UBQA 2WXGA 4HROA 5J2RA 3IHPC 3SDLC 5FKAC 1Q10A 2RSUA 1WM3A 1WH3A 2CR5A 2N9XA 4M02A 1N60A 3SFEB 2IY0B 2OEDA 3NS8A 4NJ6A 4WWMA 4BKGA 2KQSA 2KJRA 1A70A 2YVCA 1YIWA 3OWEB 2RDGA 1BUIC 3HM6X 5J17A 2L3ZA 3EA6A 4HKZE 3AEBB 3W1SA 3V61A 5LNK1 4HLEA 2IPKD 3V3XA 2MP2B 3A9KA 1C9FA 4LCDE 4REZA 2NR2A 1ZKHA 3A4RA 1IBXA 2WHIA 2I2YA 3R2IA 2BS4B 2LVOA 1CZPA 3OJ3A 3AE5B 2KN5A 3I57A 1T0QC 3VH3B 1WGGA 1SJED 1C4CA 4RM9A 3S2AA 1WFYA 3U7DA 2DNFA 3WANA 5HHDG 1JWSD 4EFOA 1IGCA 2LGYA 1QKZA 4X57B 1WF9A 2IO0B 2V4IB 4DK5A 1QF6A 2MBBB 2J42A 3L0WB 3NG0A 3TIXA 4IDIA 4M0WB 3VUYA 3P2BA 1WX7A 2DHZA 4IM3A 2H89B 4M01A 4RFBA 3SR6A 1SB3C 4IWOA 2BQQA 2N7EA 2LJ5A 2PPHA 4FN2A 5TR5A 1N5WA 2DENB 3A1QB 2L76A 2QCZA 3AN1A 2BTEA 3H8HA 3AI5A 3AE8B 1VR9A 4C00A 2G9HD 1WR1A 2ON8A 4DBGA 1WWTA 1K52A 3RYTA 2INPE 3V6CB 5BMGA 3E56A 1TJEA 3LJ3A 2WX1A 1I4GA 3L08A 4HKQA 3DBRI 5D3DA 3WA0A 2N0SB 3LDZE 1FCCC 5JHAA 2MP2A 4L2YA 4US9A 4JIOU 2JX5A 1WE6A 4MGYE 2DYBA 1F77A 2WP9B 2WXIA 2HD5B 2KMCA 4WJQA 4AP4C 3ZQ4A 3DBLB 2FIDA 3PPAA 3PZ7A 3UIPB 2RGFA 1L6VA 3CSTA 1YQBA 1ACCA 2KMMA 1NI2A 1MPEA 5LLIA 2IO1B 1OTRB 3ZTDA 5G5HA 3BVZA 2X8XX 2OHFA 3EFCA 5E6NA 1HQRD 4J3OD 1WXVA 4L1BA 5C2TB 3BZDB 2WLBA 2Z59B 4TSSA 3KYDD 2KVRA 2QJLA 4NPNA 1JWAD 4M00A 3PHXB 2PJHA 2V1YA 2AL6A 3RULA 2CHZA 4M0WA 3C8YA 2BGFA 3UINB 2CHXA 4LNKA 3H7PB 3N3KB 5HKHA 3Q3FA 1Q1OA 4DHZB 2YEPF 1SJHD 1F2RI 1WE7A 3A1QA 4ZDVA 5AEKB 1JQ4A 1VRAB 2LRUA 2KLGA 3AE2B 1DOXA 4EEWA 1KOTA 4IM2A 2GBKA 3V62A 4KVGB 3WAMA 3GB1A 1L0XB 2L1AA 5G55A 1D5MC 1F52A 3A4SC 1KLGD 3SEBA 4JLCA 1UNSA 2IYDB 3QQ8B 2WXJA 3EC8A 1E8WA 2V9HA 4B0MA 3HVZA 4GLSC 2PEAA 2WGSA 2ONQA 1ISNA 2CHWA 3CF6E 3ZGZA 2UYZB 2MRPA 2M19A 3DHHC 3O65B 3ECIA 4NJ7A 2JWZA 2LVPA 4WAFA 5EE1A 2KNBA 2QILA 1C4PA 4BBNF 3AULA 4WWPA 4KKIA 2VH2A 3KWVA 4FHKA 1SE9A 1KM7A 2M0XA 2IBIB 2C7NB 5EE9A 4GXBA 2KC1A 2MJDA 2EMTA 3UQBA 2BB5A 4DXAB 3H1UA 2EKEC 4MH8A 4W9JA 3QARA 1VZ8A 1IGDA 4P7IA 1WXAA 1TBEA 3GE3C 1ZGUB 5E6PA 2JRIB 2WXFA 3PO0A 1CK1A 5GMVA 3ZUNA 5HI1A 2O6VD 1ZDVA 1E8ZA 1SBBB 1TS5A 4IWQA 3TEWA 2H88B 3IT4B 3VH4B 2JZPA 1BT0A 4ANUA 3W1YA 4ARIA 3UQAA 1WGHA 1V5TA 1V1OA 1IUEA 2N1WA 2FNJB 1E8XA 2IO3B 5IOIA 1ET9A 3ZW3A 3MJ5A 4DWFA 3AE1B 2DBYA 2N9KA 1TY2A 1PGXA 2DZJA 3DPDA 3W5VB 3JSVB 2MQJA 1GPXA 1B9RA 4YTNB 2KJ6A 2WXLA 2K8HA 2L0TA 1WGKA 5AZFA 4EE2A 5EE0A 4LTUA 4ASWC 2MBEA 5CX3A 1ROEA 2DYMA 2I1KA 3Q8CA 4EUTA 3NZSA 2LGSA 1JMLA 4KGTA 5GXGB 1HZ5A 1L7YA 1L0VB 2ZPYA 4LK0M 1ZW7A 3ENEA 2SAKA 1YNTE 3VDZA 3B1LX 2AEHA 1T0SC 4RH6A 2DZKA 2WXMA 1GB4A 2NTTA 2VZKD 2FCMA 4BFRA 3KW5B 1TKGA 2L52A 1JWMD 4C7YA 5BMHA 2N7DA 1I4HA 2QIEB 4A55A 1WX9A 4AWJA 4MGIE 4S0RA 1PQSA 1YQ3B 4HK2A 3GS2A 1SE4A 1HTQA 1STEA 4PYUA 4IG7B 1WJ6A 5CHWA 2WWZA 1GG3A 4FULA 3UIOB 4LNIA 3C19A 3TMPB 3PLVA 4KV2A 3T8MA 4MM3B 1SF0A 1FO4A 3SD5A 4C56C 3R2TA 4DDID 2FAZA 3L10B 4I6NB 4LNFA 2ZCBA 2JYEA 3RZFA 2KX0A 1FNVA 4M8MA 1GNUA 5LXIB 1XF5L 1WIAA 4A3OA 1GUAB 3NZUA 3DWMA 3K9PB 4ANWA 1KLVA 1P0RA 3W5UB 1N61A 2C9WB 4KDIC 1A5RA 1ZXIA 2MX2A 3U7ZA 4JL9A 4NQLB 4ANXA 3NVYA 2PTLA 2K25A 2GBRA 1F9JA 2O6VB 3RNGC 2D3CA 2MHJA 4GDLB 3TBLD 1V97A 3HVDA 2C60A 3NRZA 1JWBD 2REXA 2FUG1 3X23A 2BS3B 2E3TA 1TZOA 3CSFA 4D2KA 4GN1A 3NOBA 2L32A 3M3JA 4MSQB 1AYFA 4HCPB 1KH0A 3IBEA 3N20C 1WJUA 1LQBA 2KLCA 2DAJA 2KX3A 2BYVE 4TQ1A 3FILA 2CU3A 2WXNA 3NZ3A 3RT3B 2HTHA 4FA6A 3DHIC 5TSSA 3A9KB 2BKRB 4ZRKA 4RGNA 4F1SA 1UF0A 4GIVA 1V1PB 2JVCA 3ZNGC 4PS7A 2DX5B 4JX1C 4N58A 2N9LA 4MM3A 3VR8B 4P6VF 1YD8U 3O13A 3RN9C 3IG3A 2QC8A 3L13A 3SHQA 4OVVA 1FEHA 1GB1A 1XQQA 2OJWA 2KMAA 4HJGE 1FXIA 2KDEB 4LDTD 3PREA 4OVUA 1XO3A 1XLOA 3PVLA 1ESFA 2I38A 3PRMB 3BVMA 1FPYA 4WURA 4MSMB 4GB9A 4IW0A 1TS3A 5H8YE 4ARCA 1BMLC 4W9IA 2VZKB 2KKCA 3E9SA 4ICUA 3Q6BA 3GZNI 5D6JB 3ZJTA 4AS1A 2M17A 1FRDA 4XDDA 4BKSA 1EU4A 3ABVB 3ZJUA 4IOIE 2E6XA 2JZ3B 2KTRA 3DHGC 1ZDXA 1NEKB 2PW9A 1T6BX 3PZ8A 2EMSA 3GE8C 1IPGA 2KJHB 2C7HA 1AARA 1T5XD 2Y5CA 3EUB2 3QAQA 4YXDB 4DXGA 4K3CA 1G6JA 4TMAB 3RUIB 2KDMA 3P4SB 2GI9A 4W9LA 2JRHA 3BYYB 4FJYA 4USAA 3J9CA 1GOZA 5IO9A 3AE6B 1XLQA 1V1PA 2V0GA 5AZHA 3R8BA 3VUWA 3ZXRA 3AEFB 4RCOA 1MVKA 1HZ6A 1RFAA 3W9CB 3VRAB 1L0YB 2J0KA 1VD2A 4OVZA 3B2GA 2M8SA 3APFA 2LMCA 1TKEA 1MHHE 4HXDA 5DPSA 4F7ZA 3SFDB 4W9CA 2JU6X 3APCA 2LJIA 1JROA 4A20A 3PSEB 1E90A 2SEBD 4MEMA 3VFKA 2FIFA 1OQRA 3KYCD 4N59A 2ACZB 4RF0A 2G4DB 2V4LA 3AU5A 3HK0A 2GBNA 2K6QA 5C23A 1TYGB 2IGDA 1EO6A 2ZZPB 2MBOA 1V5OA 2IZVB 3APDA 3R7QA 1V6EA 3P4PB 2J52A 2WDRB 1ZE3D 2IDYA 1YN5A 2A4ZA 4HRSA 4LJPB 3WALA 3N32A 3I9V1 3DVNU 2PLPA 1L4DB 4HEA1 4K7UA 1YJIA 2LD9A 1L5PA 2MJ3A 2J7QB 4GSWA 2PE9A 3BK2A 3AE4B 3M63B 5E6JA 2AWTA 2JF5A 4NNJB 1WZ3A 4MT5A 4M8NA 4WJPA 2WXHA 4PK1A 2BYFA 3Q8EA 3RNCC 3IAM1 2LUEA 1WMHA 1YX5B 3KVFB 3OJ4B 5CHVC 4US8A 1T3QA 4NZLB 2JWUA 2MH7A 3LB8C 2WS3B 3DBSA 3PRZA 1FCLA 3DDCB 3Q8BA 1FFVA 3Q3JA 1ENFA 4LDTB 2WQYB 3TCAA 5LXHA 3RMKC 2Y5PA 4A6QA 1DYQA 4KSLC 1J19A 3N1ZC 4JGHB 2HJ1A 3FC4A 1EWCA 4ICVA 2GBJA 4W9KA 2FBWB 1UGMA 1M4VA 1WSPA 4KIKA 4FADA 2KWUB 1XT9B 3ZNZB 4K81A 1UZXB 4HDOA 2ZW1A 4N9F4 2QHOA 4P1CC 4FJVB 2AQ3B 3VTUA 2BT6A 5D3IB 4MJSA 1WYWB 5BYQA 4AOFA 3PTFC 5CTRC 2QSDA 4JPSA 3CMMB 3MTNB 3V05A 3Q14C 3AB5A 4W9FA 2ZVNA 2EELA 2KWDA 1DOYA 5G5GA 3ZLZA 3ZXVA 1TGZB 1H8CA 1Y8RC 4YT0B 1V86A 2LRWA 3DWGC 3B9JA 4IM0A 3GZNB 3M95A 3DOWA 4B0EA 2GRIA 1TY0A 1QZEA 1UUPA 3A9JB 3H9DA 1AWDA 3KUDB 3H6NA 3Q2AC 3V6EB 2K3UA 3I63C 1EUVB 4BOSC 1Z2MA 1GJZA 2DWQA 2HDEA 5DPTA 4UDUC 1C77A 5IKCM 2N4FA 2WU5B 3BYTB 3ONSA 4RNAA 1RM6C 5C1ZA 1D6EC 1MJDA 4E3CA 1WY8A 2WDTB 4KZCA 4ACFA 1RWSA 3KQ4A 3AEEB 3U30A 3WCQA 3NUHB 1E6EB 1J0GA 4BOZB 2FUHB 3KLSX 4MDKE 2BWES 4WWNA 4DQOC 1TS2A 2KDIA 1NYRA 2PIAA 2DAFA 4K3BA 1KFYB 2VH1A 4WQOB 1SSNA 3VUXA 1AW7A 1IYFA 2XEWA 3RPFC 1MG8A 3TJPA 2WDQB 1J7CA 1GC6A 4PS8A 1NYQA 4BKSD 1RRBA 1QOAA 3TSSA 4YSYB 1P7EA 1DOIA 2L05A 2NBVB 3DBHI 3Q3MC 4YSZB 1HE8A 5MPOA
chains in the Genus database with same CATH topology
3NS8A 1WGYA 4NJ6A 3V60A 3K9PB 4W9DA 3K9OB 1L2NA 4BKGA 2KQSA 5DCNA 4ANWA 4K7WA 1KLVA 5BO4B 1P0RA 2YLMA 2C9WB 4KDIC 2KJRA 1A5RA 2MX2A 2YVCA 1YIWA 2MSED 3HM6X 4JL9A 5J17A 4NQLB 1J8CA 1NBFC 4ANXA 2D10A 2L3ZA 2K25A 2M1MA 2GBRA 4HPLB 3QA8A 5DPWA 1TTNA 1F9JA 3ZO5B 2O6VB 3PGEA 2N9EB 4GDLB 3W1SA 3V61A 4HLEA 3TBLD 4NQKE 2C60A 4AJWA 2I1JA 2MP2B 3A9KA 2LGXA 2REXA 3A9JA 3PS6A 4LCDE 3B0AA 2J0JA 3X23A 1C1YB 3CSFA 2VRRB 2NR2A 1ZKHA 3A4RA 3IVFA 4GN1A 4EZLA 2V3SA 3NOBA 2WX0A 3M3JA 4MSQB 3DVGY 4CO7A 2KFKA 3BINA 4HJKA 2A5UA 2LVOA 2O2VA 4G11A 4HCPB 4F8CB 3IBEA 3OJ3A 1WJUA 2KN5A 3VTWA 3OAWA 5D2MB 1LQBA 3VH3B 3RD2A 1WGGA 2KLCA 3R3MA 2DAJA 2KX3A 2BYVE 4RM9A 3S2AA 1WFYA 4TQ1A 3U7DA 2K8BA 4YL8A 3WANA 3VHTC 2K8CA 3WAPA 4EFOA 3RT3B 2LGYA 1JRUA 2HTHA 3L16A 4FA6A 2J0MA 2OOBB 1RLFA 1WF9A 2IO0B 4X57B 3A9KB 5AZGA 2BKRB 4ZRKA 4EOYA 4FLHA 2BKFA 4FJZA 4DK5A 1WGDA 2KOXA 4F1SA 4HWIB 1WJ4A 2MBBB 4GIVA 1Q0WB 3L0WB 4EKUA 3QX1A 3TIXA 2JVCA 3ZNGC 5FR6A 4PS7A 2DX5B 2LXAA 3QC8B 2NBUA 5DPRA 2DYOA 3HIZA 2O2VB 4M0WB 4MM3A 1YD8U 4URKA 4G0NB 3VUYA 3P2BA 1WX7A 3IG3A 2DHZA 2KZRA 3L13A 4IM3A 3SHQA 2BF8B 2K1FA 4OVVA 4W9EA 3ZIMA 1UBIA 4BBNC 4IWOA 3PZDA 1KJTA 1XQQA 2N7EA 2KMAA 3I3TB 2LJ5A 2KDEB 2PPHA 4FN2A 2W9NA 5TR5A 2DENB 1YJ1A 3A1QB 4LDTD 2L76A 3PREA 4OVUA 2ZVOA 5CHFA 3HHMA 4EZKA 4IC7B 3PVLA 3AI5A 1WGRA 3PRMB 1IP9A 4WJOA 1T0YA 4MSMB 4GB9A 4IW0A 1E7UA 2KD0A 4K7SA 1WR1A 4DBGA 4AJYB 2NCNA 4W9IA 2N1VA 2KKCA 3RYTA 3V6CB 4HVBA 5D7GA 4ICUA 3GZNI 3H7SA 3LJ3A 5D6JB 3T9LA 2WX1A 4II3B 1WZ0A 2M17A 3L08A 3DBRI 4G50A 3WA0A 3JW0X 2ZEQA 2D2QA 3LDZE 5JHAA 2MP2A 4NY0A 4JIOU 1V49A 1WE6A 4NAWB 4MGYE 2DYBA 2ZNVB 2HD5B 2KMCA 4BKSA 4WJQA 4IWPA 4ANVA 4W9GA 4AP4C 2JZ3B 2KTRA 5JHBA 2G45B 4MGKE 2DZMA 2NS5A 2FIDA 3PPAA 3UIPB 2RGFA 4RM8A 3KUZA 3CSTA 1YQBA 3H7PA 3ZRFA 2KWVB 4DHJB 1NI2A 2EMSA 2XK5B 5E6OA 1IPGA 2KJHB 2C7HA 2OJRA 1AARA 2IO1B 5LLIA 1OTRB 2ASQA 3ZTDA 3ML8A 4TKNA 3ZNHB 4KZ0A 3QAQA 2PE6B 3SU8X 1G6JA 2D3GA 3RUIB 5E6NA 4I6PA 1WM2A 4W9LA 1WXVA 2JRHA 1VCBA 4FJYA 1R4MI 2KWCA 2L7RA 3ALBA 2MBQA 4I6LB 2Z59B 2IO2B 2D07B 3KYDD 2KVRA 4TUUA 4B9KA 2CU1A 4NPNA 5AZHA 3PHXB 2PJHA 2V1YA 3VUWA 3A33B 2KTRB 2AL6A 4GMVA 1RFAA 1U4AA 3RULA 2CHZA 2BGFA 2J0KA 3UINB 1P9DU 1S1QB 1VD2A 2CHXA 3H7PB 3AU4A 3N3KB 2M8SA 2RD0A 1WXMA 4G3XB 5HKHA 3APFA 3PLUA 2KK8A 3WAOA 4B6WA 3Q3FA 1Q1OA 2KFJA 2NVUI 4HXDA 3AXCA 4DHZB 3NY5A 5DPSA 4F7ZA 2JZZA 4W9CA 1WE7A 2KTFA 3VXWA 3DQVA 1P98A 3A1QA 2LXCA 3APCA 4B95A 4ZDVA 5AEKB 3UF8A 1I35A 2LRUA 4FHJA 4A20A 2KQ7A 3PSEB 5EDSA 2KLGA 4PS3A 4EEWA 1KOTA 1E90A 2GBKA 2MWSB 4IM2A 3V62A 2RR9A 4MEMA 2KXJA 3VFKA 4KVGB 2FIFA 3KYCD 3WAMA 4TV3A 2LWPA 2G4DB 2V4LA 3AU5A 5G55A 3HK0A 2GBNA 4AUQC 4HPMB 1OEYJ 1X1MA 4XC2A 3L17A 2K6QA 3A4SC 5C23A 3C0RB 3JVZX 1EO6A 2ZZPB 5D94A 2KO3A 2MBOA 4JLCA 1V5OA 4XX5A 2IYDB 2IZVB 2LGDA 3EC8A 3QQ8B 1E8WA 4GDKA 5KHQA 2G4SA 1OQYA 1P3QU 3APDA 4GU2A 1V6EA 2DZIA 3R7QA 1SGHA 2PEAA 1EF1A 1ISNA 2CHWA 4J6IA 3CF6E 2BPSA 2UYZB 2MRPA 3B08A 4NAWA 3O65B 3ECIA 2A4ZA 4NJ7A 4WWOA 2JWZA 4LJPB 3WALA 3N32A 2LVPA 3QWZB 3DVNU 2KNBA 2GMIC 4EZJA 4BBNF 3AULA 4K7UA 1UH6A 1M94A 2K39A 2LD9A 4WWPA 1XD3B 1WXSA 4W9HA 4ZYNA 1D3ZA 4MH0E 4FHKA 1SE9A 1KM7A 2J7QB 3IFWB 2M0XA 2PE9A 4GSWA 5L83A 1WI0A 2IBIB 2IY1B 3OLMD 1Q5WB 3M63B 2N9PC 2MW5A 2C7NB 2Z0DB 2AWTA 2JF5A 1CMXB 2G3QB 4GXBA 4NNJB 2KC1A 1WZ3A 4M8NA 4WJPA 1R4NI 2NPTA 2BYFA 2EMTA 3UQBA 2XK5A 4GDKB 2LUEA 4DXAB 3H1UA 1WMHA 2EKEC 4W9JA 2FCQA 1YX5B 3KVFB 3QARA 3OJ4B 3QK0A 1C3TA 3ZDTA 5CHVC 4P7IA 3ZKJC 2D11A 1WXAA 1TBEA 1ZGUB 4BKTA 5E6PA 2JRIB 1K8RB 3D32A 2LASA 1E5WA 3DBSA 1NDDA 1TZ1A 4RMAA 3PRZA 2HJ8A 3DDCB 3Q3JA 5GMVA 3ZUNA 3N30A 2BYEA 2KANA 1WX8A 2JUOA 2O6VD 1OEYA 3DVGX 1E8ZA 4LDTB 2LVQA 2L0FA 4IWQA 3RZWC 3TCAA 5LXHA 4ZRJA 2JPHA 3JSVA 1EF5A 2ZCCA 3QJZA 2R2QA 4XZ4A 1V9JA 4KSLC 3VH4B 1J19A 1BT0A 3R7RA 4ANUA 3W1YA 2NPTB 4JGHB 3WIMA 4HDQA 2MA9B 3UQAA 1WMHB 3X0WA 4ICVA 2FCSA 1WGHA 1V5TA 2GBJA 4W9KA 1E7VA 3U8ZA 2N1WA 1UGMA 4FADA 2WYQA 4KIKA 2KWUB 1XT9B 2FNJB 3TL5A 1E8XA 2IO3B 3ZNZB 4K81A 1FXTB 1UZXB 3PT2B 2GOWA 1UD7A 3W1SC 3PRPB 2R2OA 1LM8B 4HDOA 4FBJB 4LJOB 4N9F4 3DCGA 1P1AA 2Y5BB 2QHOA 3ZW3A 4DWFA 4FJVB 1WJNA 3VTUA 3DPDA 2DZJA 1Z5SB 1UELA 3JSVB 2MQJA 3L54A 4E71A 4MJSA 1WYWB 3JYUA 4PYZA 4ZRIA 2JY6A 5J18A 2KJ6A 4AOFA 2K8HA 3PTFC 3MJWA 2L0TA 5G2NA 4CHKA 4TQ0A 3M62B 5CTRC 4KDLB 2UWQA 3CMMB 1RAXA 4DHZE 1WR6E 2FCNA 3MTNB 3QHTA 4KIKB 5AZFA 4W9FA 2ZVNA 4MGZE 1LXDA 1I42A 3EECA 3ZLZA 4ASWC 1OGWA 1TGZB 2KDBA 2MBEA 2JT4B 3ML9A 1Y8RC 2JXXA 5CX3A 1H8CA 3GOEA 1V86A 5JH5C 2BWFA 3ZVVA 2DYMA 2I1KA 4GOCA 3UGBB 2LRWA 4EUTA 3DBLI 2GBMA 3NZSA 4IM0A 3M95A 4MJSB 3QCAA 5IAAC 1L7YA 3DOWA 2LZ6A 2ZPYA 3KH0A 2L8JA 1ZW7A 1QZEA 3ENEA 2MCNB 3EHVA 3VDZA 4II2B 3A9JB 3B1LX 3H9DA 2AEHA 3PHWB 1V80A 3H6NA 3KUDB 2K6DB 3ZTCA 2DZKA 3V6EB 2C5LC 4JQWC 4K1RB 2FCMA 1V2YA 1EUVB 4GGQA 4BOSC 4BVUC 3KW5B 4BFRA 2KFKB 2MBHA 2KHWB 1Z2MA 1GJZA 5DPTA 2N7DA 5JZEB 2C7MB 4KSKC 1WX9A 2N4FA 4AWJA 4MELA 3VVWB 4HCNB 1LFDA 1E8YA 2KDFB 2ZNVC 3EFUA 3ONSA 1PQSA 4MGIE 4WJNA 5C1ZA 4HK2A 1H4RA 2RPQA 2CKHB 2ZPNA 2NBWB 4E3CA 3R66C 4PYUA 4IG7B 3VAWA 1S3SG 1WY8A 1WJ6A 2WDTB 2M4NA 4KZCA 5CHWA 2WWZA 1GG3A 4FULA 3U30A 3UIOB 1SIFA 3VTVA 1J0GA 2AL3A 2HE7A 1GC7A 2B3AA 4BOZB 4DHJD 3TMPB 3ZDMC 3PLVA 2FUHB 4MDKE 4KV2A 2BWES 5KHOA 3T8MA 4WWNA 2L00B 3ZRCA 4E74A 2KDIA 4A3PA 1YX6B 4CYEA 3NHEB 2DAFA 4WQOB 3DVNV 1WRDB 3SD5A 3VQIA 4WAAA 3BY4B 5IA7A 4DDID 5L95C 3VUXA 1IYFA 1V81A 2XEWA 1MG8A 2AYOB 3TJPA 2FAZA 1GC6A 3L10B 4PS8A 4I6NB 3PV1A 4DDGD 4BKSD 2O6VA 2ZCBA 4GDLA 2CS4A 1RRBA 1UBQA 3RZFA 2KX0A 5J2RA 2XBBC 3IHPC 2LI5A 4M8MA 3SDLC 3HM3A 3MHSD 1GNUA 3ZNID 2KC2A 2MLBA 1WM3A 1WH3A 2RSUA 2CR5A 2N9XA 3QIJA 2L05A 5LXIB 2NBVB 3KUCB 3DBHI 1WIAA 4IUMB 2Z0EB 2IY0B 1HE8A 2ZJDA 1GUAB 4A3OA 3NZUA 3RCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NS8 A;  1WGY A;  4NJ6 A;  3V60 A;  3K9P B;  4W9D A;  3K9O B;  1L2N A;  4BKG A;  2KQS A;  5DCN A;  4ANW A;  4K7W A;  1KLV A;  5BO4 B;  1P0R A;  2YLM A;  2C9W B;  4KDI C;  2KJR A;  1A5R A;  2MX2 A;  2YVC A;  1YIW A;  2MSE D;  3HM6 X;  4JL9 A;  5J17 A;  4NQL B;  1J8C A;  1NBF C;  4ANX A;  2D10 A;  2L3Z A;  2K25 A;  2M1M A;  2GBR A;  4HPL B;  3QA8 A;  5DPW A;  1TTN A;  1F9J A;  3ZO5 B;  2O6V B;  3PGE A;  2N9E B;  4GDL B;  3W1S A;  3V61 A;  4HLE A;  3TBL D;  4NQK E;  2C60 A;  4AJW A;  2I1J A;  2MP2 B;  3A9K A;  2LGX A;  2REX A;  3A9J A;  3PS6 A;  4LCD E;  3B0A A;  2J0J A;  3X23 A;  1C1Y B;  3CSF A;  2VRR B;  2NR2 A;  1ZKH A;  3A4R A;  3IVF A;  4GN1 A;  4EZL A;  2V3S A;  3NOB A;  2WX0 A;  3M3J A;  4MSQ B;  3DVG Y;  4CO7 A;  2KFK A;  3BIN A;  4HJK A;  2A5U A;  2LVO A;  2O2V A;  4G11 A;  4HCP B;  4F8C B;  3IBE A;  3OJ3 A;  1WJU A;  2KN5 A;  3VTW A;  3OAW A;  5D2M B;  1LQB A;  3VH3 B;  3RD2 A;  1WGG A;  2KLC A;  3R3M A;  2DAJ A;  2KX3 A;  2BYV E;  4RM9 A;  3S2A A;  1WFY A;  4TQ1 A;  3U7D A;  2K8B A;  4YL8 A;  3WAN A;  3VHT C;  2K8C A;  3WAP A;  4EFO A;  3RT3 B;  2LGY A;  1JRU A;  2HTH A;  3L16 A;  4FA6 A;  2J0M A;  2OOB B;  1RLF A;  1WF9 A;  2IO0 B;  4X57 B;  3A9K B;  5AZG A;  2BKR B;  4ZRK A;  4EOY A;  4FLH A;  2BKF A;  4FJZ A;  4DK5 A;  1WGD A;  2KOX A;  4F1S A;  4HWI B;  1WJ4 A;  2MBB B;  4GIV A;  1Q0W B;  3L0W B;  4EKU A;  3QX1 A;  3TIX A;  2JVC A;  3ZNG C;  5FR6 A;  4PS7 A;  2DX5 B;  2LXA A;  3QC8 B;  2NBU A;  5DPR A;  2DYO A;  3HIZ A;  2O2V B;  4M0W B;  4MM3 A;  1YD8 U;  4URK A;  4G0N B;  3VUY A;  3P2B A;  1WX7 A;  3IG3 A;  2DHZ A;  2KZR A;  3L13 A;  4IM3 A;  3SHQ A;  2BF8 B;  2K1F A;  4OVV A;  4W9E A;  3ZIM A;  1UBI A;  4BBN C;  4IWO A;  3PZD A;  1KJT A;  1XQQ A;  2N7E A;  2KMA A;  3I3T B;  2LJ5 A;  2KDE B;  2PPH A;  4FN2 A;  2W9N A;  5TR5 A;  2DEN B;  1YJ1 A;  3A1Q B;  4LDT D;  2L76 A;  3PRE A;  4OVU A;  2ZVO A;  5CHF A;  3HHM A;  4EZK A;  4IC7 B;  3PVL A;  3AI5 A;  1WGR A;  3PRM B;  1IP9 A;  4WJO A;  1T0Y A;  4MSM B;  4GB9 A;  4IW0 A;  1E7U A;  2KD0 A;  4K7S A;  1WR1 A;  4DBG A;  4AJY B;  2NCN A;  4W9I A;  2N1V A;  2KKC A;  3RYT A;  3V6C B;  4HVB A;  5D7G A;  4ICU A;  3GZN I;  3H7S A;  3LJ3 A;  5D6J B;  3T9L A;  2WX1 A;  4II3 B;  1WZ0 A;  2M17 A;  3L08 A;  3DBR I;  4G50 A;  3WA0 A;  3JW0 X;  2ZEQ A;  2D2Q A;  3LDZ E;  5JHA A;  2MP2 A;  4NY0 A;  4JIO U;  1V49 A;  1WE6 A;  4NAW B;  4MGY E;  2DYB A;  2ZNV B;  2HD5 B;  2KMC A;  4BKS A;  4WJQ A;  4IWP A;  4ANV A;  4W9G A;  4AP4 C;  2JZ3 B;  2KTR A;  5JHB A;  2G45 B;  4MGK E;  2DZM A;  2NS5 A;  2FID A;  3PPA A;  3UIP B;  2RGF A;  4RM8 A;  3KUZ A;  3CST A;  1YQB A;  3H7P A;  3ZRF A;  2KWV B;  4DHJ B;  1NI2 A;  2EMS A;  2XK5 B;  5E6O A;  1IPG A;  2KJH B;  2C7H A;  2OJR A;  1AAR A;  2IO1 B;  5LLI A;  1OTR B;  2ASQ A;  3ZTD A;  3ML8 A;  4TKN A;  3ZNH B;  4KZ0 A;  3QAQ A;  2PE6 B;  3SU8 X;  1G6J A;  2D3G A;  3RUI B;  5E6N A;  4I6P A;  1WM2 A;  4W9L A;  1WXV A;  2JRH A;  1VCB A;  4FJY A;  1R4M I;  2KWC A;  2L7R A;  3ALB A;  2MBQ A;  4I6L B;  2Z59 B;  2IO2 B;  2D07 B;  3KYD D;  2KVR A;  4TUU A;  4B9K A;  2CU1 A;  4NPN A;  5AZH A;  3PHX B;  2PJH A;  2V1Y A;  3VUW A;  3A33 B;  2KTR B;  2AL6 A;  4GMV A;  1RFA A;  1U4A A;  3RUL A;  2CHZ A;  2BGF A;  2J0K A;  3UIN B;  1P9D U;  1S1Q B;  1VD2 A;  2CHX A;  3H7P B;  3AU4 A;  3N3K B;  2M8S A;  2RD0 A;  1WXM A;  4G3X B;  5HKH A;  3APF A;  3PLU A;  2KK8 A;  3WAO A;  4B6W A;  3Q3F A;  1Q1O A;  2KFJ A;  2NVU I;  4HXD A;  3AXC A;  4DHZ B;  3NY5 A;  5DPS A;  4F7Z A;  2JZZ A;  4W9C A;  1WE7 A;  2KTF A;  3VXW A;  3DQV A;  1P98 A;  3A1Q A;  2LXC A;  3APC A;  4B95 A;  4ZDV A;  5AEK B;  3UF8 A;  1I35 A;  2LRU A;  4FHJ A;  4A20 A;  2KQ7 A;  3PSE B;  5EDS A;  2KLG A;  4PS3 A;  4EEW A;  1KOT A;  1E90 A;  2GBK A;  2MWS B;  4IM2 A;  3V62 A;  2RR9 A;  4MEM A;  2KXJ A;  3VFK A;  4KVG B;  2FIF A;  3KYC D;  3WAM A;  4TV3 A;  2LWP A;  2G4D B;  2V4L A;  3AU5 A;  5G55 A;  3HK0 A;  2GBN A;  4AUQ C;  4HPM B;  1OEY J;  1X1M A;  4XC2 A;  3L17 A;  2K6Q A;  3A4S C;  5C23 A;  3C0R B;  3JVZ X;  1EO6 A;  2ZZP B;  5D94 A;  2KO3 A;  2MBO A;  4JLC A;  1V5O A;  4XX5 A;  2IYD B;  2IZV B;  2LGD A;  3EC8 A;  3QQ8 B;  1E8W A;  4GDK A;  5KHQ A;  2G4S A;  1OQY A;  1P3Q U;  3APD A;  4GU2 A;  1V6E A;  2DZI A;  3R7Q A;  1SGH A;  2PEA A;  1EF1 A;  1ISN A;  2CHW A;  4J6I A;  3CF6 E;  2BPS A;  2UYZ B;  2MRP A;  3B08 A;  4NAW A;  3O65 B;  3ECI A;  2A4Z A;  4NJ7 A;  4WWO A;  2JWZ A;  4LJP B;  3WAL A;  3N32 A;  2LVP A;  3QWZ B;  3DVN U;  2KNB A;  2GMI C;  4EZJ A;  4BBN F;  3AUL A;  4K7U A;  1UH6 A;  1M94 A;  2K39 A;  2LD9 A;  4WWP A;  1XD3 B;  1WXS A;  4W9H A;  4ZYN A;  1D3Z A;  4MH0 E;  4FHK A;  1SE9 A;  1KM7 A;  2J7Q B;  3IFW B;  2M0X A;  2PE9 A;  4GSW A;  5L83 A;  1WI0 A;  2IBI B;  2IY1 B;  3OLM D;  1Q5W B;  3M63 B;  2N9P C;  2MW5 A;  2C7N B;  2Z0D B;  2AWT A;  2JF5 A;  1CMX B;  2G3Q B;  4GXB A;  4NNJ B;  2KC1 A;  1WZ3 A;  4M8N A;  4WJP A;  1R4N I;  2NPT A;  2BYF A;  2EMT A;  3UQB A;  2XK5 A;  4GDK B;  2LUE A;  4DXA B;  3H1U A;  1WMH A;  2EKE C;  4W9J A;  2FCQ A;  1YX5 B;  3KVF B;  3QAR A;  3OJ4 B;  3QK0 A;  1C3T A;  3ZDT A;  5CHV C;  4P7I A;  3ZKJ C;  2D11 A;  1WXA A;  1TBE A;  1ZGU B;  4BKT A;  5E6P A;  2JRI B;  1K8R B;  3D32 A;  2LAS A;  1E5W A;  3DBS A;  1NDD A;  1TZ1 A;  4RMA A;  3PRZ A;  2HJ8 A;  3DDC B;  3Q3J A;  5GMV A;  3ZUN A;  3N30 A;  2BYE A;  2KAN A;  1WX8 A;  2JUO A;  2O6V D;  1OEY A;  3DVG X;  1E8Z A;  4LDT B;  2LVQ A;  2L0F A;  4IWQ A;  3RZW C;  3TCA A;  5LXH A;  4ZRJ A;  2JPH A;  3JSV A;  1EF5 A;  2ZCC A;  3QJZ A;  2R2Q A;  4XZ4 A;  1V9J A;  4KSL C;  3VH4 B;  1J19 A;  1BT0 A;  3R7R A;  4ANU A;  3W1Y A;  2NPT B;  4JGH B;  3WIM A;  4HDQ A;  2MA9 B;  3UQA A;  1WMH B;  3X0W A;  4ICV A;  2FCS A;  1WGH A;  1V5T A;  2GBJ A;  4W9K A;  1E7V A;  3U8Z A;  2N1W A;  1UGM A;  4FAD A;  2WYQ A;  4KIK A;  2KWU B;  1XT9 B;  2FNJ B;  3TL5 A;  1E8X A;  2IO3 B;  3ZNZ B;  4K81 A;  1FXT B;  1UZX B;  3PT2 B;  2GOW A;  1UD7 A;  3W1S C;  3PRP B;  2R2O A;  1LM8 B;  4HDO A;  4FBJ B;  4LJO B;  4N9F 4;  3DCG A;  1P1A A;  2Y5B B;  2QHO A;  3ZW3 A;  4DWF A;  4FJV B;  1WJN A;  3VTU A;  3DPD A;  2DZJ A;  1Z5S B;  1UEL A;  3JSV B;  2MQJ A;  3L54 A;  4E71 A;  4MJS A;  1WYW B;  3JYU A;  4PYZ A;  4ZRI A;  2JY6 A;  5J18 A;  2KJ6 A;  4AOF A;  2K8H A;  3PTF C;  3MJW A;  2L0T A;  5G2N A;  4CHK A;  4TQ0 A;  3M62 B;  5CTR C;  4KDL B;  2UWQ A;  3CMM B;  1RAX A;  4DHZ E;  1WR6 E;  2FCN A;  3MTN B;  3QHT A;  4KIK B;  5AZF A;  4W9F A;  2ZVN A;  4MGZ E;  1LXD A;  1I42 A;  3EEC A;  3ZLZ A;  4ASW C;  1OGW A;  1TGZ B;  2KDB A;  2MBE A;  2JT4 B;  3ML9 A;  1Y8R C;  2JXX A;  5CX3 A;  1H8C A;  3GOE A;  1V86 A;  5JH5 C;  2BWF A;  3ZVV A;  2DYM A;  2I1K A;  4GOC A;  3UGB B;  2LRW A;  4EUT A;  3DBL I;  2GBM A;  3NZS A;  4IM0 A;  3M95 A;  4MJS B;  3QCA A;  5IAA C;  1L7Y A;  3DOW A;  2LZ6 A;  2ZPY A;  3KH0 A;  2L8J A;  1ZW7 A;  1QZE A;  3ENE A;  2MCN B;  3EHV A;  3VDZ A;  4II2 B;  3A9J B;  3B1L X;  3H9D A;  2AEH A;  3PHW B;  1V80 A;  3H6N A;  3KUD B;  2K6D B;  3ZTC A;  2DZK A;  3V6E B;  2C5L C;  4JQW C;  4K1R B;  2FCM A;  1V2Y A;  1EUV B;  4GGQ A;  4BOS C;  4BVU C;  3KW5 B;  4BFR A;  2KFK B;  2MBH A;  2KHW B;  1Z2M A;  1GJZ A;  5DPT A;  2N7D A;  5JZE B;  2C7M B;  4KSK C;  1WX9 A;  2N4F A;  4AWJ A;  4MEL A;  3VVW B;  4HCN B;  1LFD A;  1E8Y A;  2KDF B;  2ZNV C;  3EFU A;  3ONS A;  1PQS A;  4MGI E;  4WJN A;  5C1Z A;  4HK2 A;  1H4R A;  2RPQ A;  2CKH B;  2ZPN A;  2NBW B;  4E3C A;  3R66 C;  4PYU A;  4IG7 B;  3VAW A;  1S3S G;  1WY8 A;  1WJ6 A;  2WDT B;  2M4N A;  4KZC A;  5CHW A;  2WWZ A;  1GG3 A;  4FUL A;  3U30 A;  3UIO B;  1SIF A;  3VTV A;  1J0G A;  2AL3 A;  2HE7 A;  1GC7 A;  2B3A A;  4BOZ B;  4DHJ D;  3TMP B;  3ZDM C;  3PLV A;  2FUH B;  4MDK E;  4KV2 A;  2BWE S;  5KHO A;  3T8M A;  4WWN A;  2L00 B;  3ZRC A;  4E74 A;  2KDI A;  4A3P A;  1YX6 B;  4CYE A;  3NHE B;  2DAF A;  4WQO B;  3DVN V;  1WRD B;  3SD5 A;  3VQI A;  4WAA A;  3BY4 B;  5IA7 A;  4DDI D;  5L95 C;  3VUX A;  1IYF A;  1V81 A;  2XEW A;  1MG8 A;  2AYO B;  3TJP A;  2FAZ A;  1GC6 A;  3L10 B;  4PS8 A;  4I6N B;  3PV1 A;  4DDG D;  4BKS D;  2O6V A;  2ZCB A;  4GDL A;  2CS4 A;  1RRB A;  1UBQ A;  3RZF A;  2KX0 A;  5J2R A;  2XBB C;  3IHP C;  2LI5 A;  4M8M A;  3SDL C;  3HM3 A;  3MHS D;  1GNU A;  3ZNI D;  2KC2 A;  2MLB A;  1WM3 A;  1WH3 A;  2RSU A;  2CR5 A;  2N9X A;  3QIJ A;  2L05 A;  5LXI B;  2NBV B;  3KUC B;  3DBH I;  1WIA A;  4IUM B;  2Z0E B;  2IY0 B;  1HE8 A;  2ZJD A;  1GUA B;  4A3O A;  3NZU A;  3RCZ A; 
#chains in the Genus database with same CATH topology
 4W9D A;  1DGJ A;  1L2N A;  2JSV X;  1NVI D;  5DCN A;  1RFK A;  5BO4 B;  1FD6 A;  3AEA B;  1ET6 A;  3Q3O C;  1J8C A;  2D10 A;  1OFF A;  2M1M A;  3QA8 A;  3ZJV A;  2N9E B;  4NQK E;  4AJW A;  2EKI A;  3T3N A;  3A9J A;  2W54 A;  4XWT A;  3PS6 A;  3B0A A;  2PVG C;  1C1Y B;  4RGO S;  3IVF A;  1I4Q A;  4EZL A;  2V3S A;  1Y56 A;  4CO7 A;  1KLU D;  3BIN A;  2A5U A;  2O2V A;  4G11 A;  4F8C B;  1N5X A;  3VTW A;  3OAW A;  3R3M A;  4YL8 A;  3WAP A;  3W2D A;  3P42 A;  3CIR B;  1JRU A;  2R61 A;  2OOB B;  1RLF A;  5AZG A;  3Q8A A;  4EOY A;  4FJZ A;  1BXT A;  1PDX A;  1WGD A;  5C3J B;  4HWI B;  3QX1 A;  5FR3 A;  4A9A A;  4ZOH C;  3HIZ A;  2K22 A;  4G0N B;  4IKG A;  2UU7 A;  2KZR A;  3RNF C;  1UBI A;  2IJ0 A;  4BBN C;  1KRH A;  3PZD A;  1XCQ L;  1YJJ A;  3FIL B;  2CJN A;  3I3T B;  5CHF A;  2ZVO A;  4EZK A;  3HHM A;  2LEK A;  4IC7 B;  4OZC A;  2JQR B;  1I7H A;  5IN7 A;  2KQ4 X;  1IP9 A;  4C4V B;  1T0Y A;  2QEJ C;  1ZUD 2;  2W3R A;  4AJY B;  2LUM A;  5FK9 C;  2MJE A;  4R3D A;  4HVB A;  5D7G A;  3B2F A;  3AV8 A;  3T9L A;  4II3 B;  2ZEQ A;  2D2Q A;  2KN4 A;  4NY0 A;  3ZYY X;  1C78 A;  2ZNV B;  1E7P B;  2J53 A;  4IWP A;  1C76 A;  5JHB A;  1XCT L;  2G45 B;  4MGK E;  2DZM A;  4RM8 A;  2BYT A;  3KUZ A;  4Q2J A;  3CWI A;  1JRP A;  3ML8 A;  1FNU A;  3ZNH B;  3TEZ A;  3Q3N C;  4C80 A;  1VCB A;  1R4M I;  5HG2 A;  4LNN A;  2MBQ A;  4I6L B;  4TUU A;  2CU1 A;  3A33 B;  2KTR B;  4L23 A;  1PGB A;  1U4A A;  1VZ7 A;  1P9D U;  1S1Q B;  3AU4 A;  3EGR A;  1SIJ A;  4G3X B;  4P16 A;  2WXR A;  3WAO A;  3Q69 A;  4B6W A;  3AMZ A;  2NVU I;  3AXC A;  2ICI A;  3FKY A;  2KTF A;  3DQV A;  4B95 A;  3UF8 A;  5I4D A;  5EDS A;  3LXF A;  4C4V A;  2RR9 A;  4A8X C;  4QAY A;  4TV3 A;  3RNB C;  4AUQ C;  1OEY J;  4XC2 A;  3L17 A;  3C0R B;  3JVZ X;  5D94 A;  1KTK A;  3BII D;  3IXS A;  2CJO A;  2KO3 A;  4H2A A;  4GDK A;  4P1B C;  1YN4 A;  5KHQ A;  1P3Q U;  1SGH A;  1EF1 A;  3DBH B;  1PUT A;  3T3O A;  3B08 A;  3BK1 A;  4KGS A;  1F2R C;  3TUO A;  2AQ1 B;  1UH6 A;  2K39 A;  4ITK A;  1XD3 B;  4ZYN A;  1D3Z A;  4A90 A;  3IFW B;  5L83 A;  1WI0 A;  4OZB A;  1K50 A;  3AEG B;  2N9P C;  1CMX B;  1MHX A;  2RMM A;  2NPT A;  1JWU D;  1PGA A;  1I4X A;  1C3T A;  2FCQ A;  3ZDT A;  2PKO A;  3ZKJ C;  2JYT A;  3D32 A;  1E5W A;  3AEC B;  4RMA A;  1TZ1 A;  2HJ8 A;  1SXT A;  1K51 A;  2KAN A;  1WX8 A;  3IT6 B;  1OEY A;  3BVG A;  3RZW C;  4ZRJ A;  1EF5 A;  2ZCC A;  3L4P A;  5H92 C;  3R7R A;  1FFU A;  2XN9 C;  1WMH B;  1E7V A;  5BMI A;  2WYQ A;  1KF6 B;  3PT2 B;  2GOW A;  1UD7 A;  3W1S C;  4BAX A;  1ZP0 B;  4WIP A;  3DCG A;  1P1A A;  2Y5B B;  1WJN A;  1Z5S B;  2NMQ A;  4E71 A;  2M0A A;  4PYZ A;  4ZRI A;  2JY6 A;  1VDV A;  3MHZ A;  4CHK A;  1UWM A;  1JCK B;  4KKJ A;  2UWQ A;  1RAX A;  4DHZ E;  2FCN A;  4XYC A;  2N7J A;  3N1Y C;  2K9X A;  3QHT A;  4KIK B;  3RNA C;  2GB1 A;  1WRI A;  3EEC A;  1I42 A;  2BBC A;  2KVZ A;  2KDB A;  1QOF A;  2JXX A;  2KT7 A;  5JH5 C;  2BWF A;  3ZVV A;  3UGB B;  1R4N B;  1QOG A;  1J7B A;  2INC C;  4MJS B;  3QCA A;  3TEY A;  1XEE A;  2W55 A;  2MCN B;  4II2 B;  1V80 A;  2K6D B;  1JAL A;  1SE3 A;  5BYS A;  2QDF A;  1V2Y A;  1I4R A;  2KFK B;  2MBH A;  2KHW B;  4XE0 A;  1SEB D;  3EFU A;  2KAC A;  1TS4 A;  1H4R A;  2RPQ A;  2ZPN A;  1UGJ A;  5AUK A;  3FAH A;  3R66 C;  1S3S G;  4LLG M;  1QQR A;  2K5P A;  2RDH A;  3MC9 A;  1R4M B;  4OHJ A;  1N63 A;  2DLB A;  1QOB A;  2WNM A;  2IND C;  3VTV A;  2HE7 A;  2PMV A;  1FMA D;  4DHJ D;  1F0Z A;  3OG5 A;  3ZRC A;  4BZA A;  3IAS 1;  2HTM E;  4YSX B;  1YX6 B;  3NHE B;  1WRD B;  3VQI A;  4WAA A;  3NVW A;  2BS2 B;  3BY4 B;  1EM7 A;  5IA7 A;  5L95 C;  1V81 A;  2V3P A;  3AE7 B;  4DDG D;  4NJC A;  1D4B A;  2WXK A;  2XBB C;  2LI5 A;  3ZNI D;  3HM3 A;  2D5G A;  3MHS D;  2KC2 A;  2MLB A;  3QIJ A;  3KUC B;  4IUM B;  2Z0E B;  2ZJD A;  3RCZ A;  1WGY A;  3V60 A;  1QIL A;  3K9O B;  2IGH A;  4K7W A;  4JE3 B;  2YLM A;  2MSE D;  1T0R C;  3U52 E;  1NBF C;  1I4P A;  2WDV B;  4HPL B;  5DPW A;  1TTN A;  3ZO5 B;  3PGE A;  3RNE C;  2I1J A;  2LGX A;  2K0P A;  2J0J A;  4MAC A;  2VRR B;  5EE3 A;  2WX0 A;  2WXQ A;  3DVG Y;  2KFK A;  2NTS A;  4HJK A;  1HTO A;  3P63 A;  4JWU C;  1N6Z A;  3AE9 B;  3I5J C;  5D2M B;  3RD2 A;  1C4A A;  1XLP A;  2K8B A;  2L83 A;  4O1N A;  3VHT C;  2K8C A;  5IP4 D;  3L16 A;  2J0M A;  3AED B;  4FLH A;  2BKF A;  2KOX A;  1WJ4 A;  1HXY D;  1Q0W B;  1NI3 A;  2W82 A;  3P4Q B;  4EKU A;  1PYW D;  5FR6 A;  2LXA A;  3QC8 B;  3NS1 A;  2NBU A;  5DPR A;  5T8I A;  2DYO A;  2O2V B;  4URK A;  4JWS C;  2BF8 B;  2K1F A;  4W9E A;  3ZIM A;  1KJT A;  2YEP B;  2W9N A;  1YJ1 A;  3GP7 A;  1N62 A;  1AN8 A;  3HRD D;  3NJT A;  3URY A;  1WGR A;  1YN3 A;  4ZRP A;  5HFY A;  4WJO A;  2GLS A;  2Q5W D;  2V3N A;  1WYG A;  1EWY C;  1E7U A;  2KD0 A;  4K7S A;  1MFW A;  1TIF A;  2NCN A;  3Q8F A;  2N1V A;  4PT5 A;  1HA5 A;  2RPV A;  3H7S A;  4OZA A;  1L6U A;  3MC0 B;  1WZ0 A;  4G50 A;  2W3S A;  3JW0 X;  1ZPS A;  1V49 A;  4NAW B;  4LNO A;  4ANV A;  3VR9 B;  4W9G A;  2LHD A;  2X38 A;  1F1H A;  2NS5 A;  3H7P A;  2KAJ A;  3ZRF A;  2KWV B;  4DHJ B;  2XK5 B;  1TT5 B;  5E6O A;  2OJR A;  1LO5 D;  1TKY A;  2ASQ A;  4TKN A;  4KZ0 A;  2PE6 B;  3NVZ A;  3SU8 X;  2D3G A;  4C7Z A;  4I6P A;  1WM2 A;  2KWC A;  2L7R A;  3ALB A;  1PFD A;  3N1X C;  1P7F A;  2INN E;  2J4X A;  2IO2 B;  4WQM A;  1XLN A;  2D07 B;  4B9K A;  1HEZ E;  2QMT A;  4GMV A;  3AE3 B;  1OQQ A;  3LYY A;  2RD0 A;  1WXM A;  3PLU A;  2KK8 A;  4ZYS A;  4YWG G;  2KFJ A;  2Z8L A;  3NY5 A;  1MI0 A;  1QLB B;  4OW0 A;  2JZZ A;  3VXW A;  1JW9 D;  1P98 A;  2LXC A;  1I35 A;  4FHJ A;  1D5X C;  1J7A A;  1FXA A;  2KQ7 A;  4N6E B;  3MP9 A;  4PS3 A;  2RDB C;  3U2S C;  2MWS B;  4DXF A;  2KXJ A;  4KGR A;  2AX5 A;  2LWP A;  4HPM B;  1X1M A;  2LGI A;  1CQV A;  1VZ6 A;  4ZHO A;  3DBR B;  2XNA C;  1WXQ A;  4HPP A;  4XX5 A;  1VLB A;  2LGD A;  4CQN A;  1YOV B;  4XDC A;  2TSS A;  2G4S A;  1OQY A;  4GU2 A;  2DZI A;  4J6I A;  3NVV A;  2BPS A;  2Y3A A;  3ETR A;  4NAW A;  4YTM B;  4WWO A;  1VJK A;  3QWZ B;  4EZJ A;  2GMI C;  1M94 A;  4ZRQ A;  3VRB B;  4W9H A;  1WXS A;  2MEK A;  4MH0 E;  2PVO D;  1XXG A;  2B76 B;  2IY1 B;  3OLM D;  1Q5W B;  2MW5 A;  2Z0D B;  2G3Q B;  2D3A A;  1R4N I;  2XK5 A;  2M56 B;  4GDK B;  1E10 A;  1D5Z C;  3QK0 A;  2D11 A;  4BKT A;  1K8R B;  3AH7 A;  2LAS A;  1NDD A;  1FIQ A;  3BWU D;  2BW2 A;  3N30 A;  1YMH E;  2BYE A;  4FXC A;  2JUO A;  1B1Z A;  3DVG X;  3MFG A;  2LVQ A;  1C79 A;  2L0F A;  2JPH A;  3JSV A;  3QJZ A;  2R2Q A;  4XZ4 A;  1V9J A;  3KWL A;  1ZXH A;  4XGA B;  2NPT B;  3WIM A;  4HDQ A;  2MA9 B;  3X0W A;  1E9M A;  2FCS A;  2WXP A;  1LGR A;  3U8Z A;  3RI7 C;  3TL5 A;  4YTP B;  4XWW A;  1FXT B;  3RFZ B;  3N9Y C;  3PRP B;  2R2O A;  1LM8 B;  4FBJ B;  4LJO B;  1FM0 D;  1QT9 A;  3P1M A;  3U4E G;  1UEL A;  3L54 A;  3JYU A;  3P4R B;  5J18 A;  2FE8 A;  3MJW A;  5G2N A;  1MG4 A;  4TQ0 A;  1E0Z A;  3M62 B;  1GAQ B;  4KDL B;  1L4Z B;  1WR6 E;  2LHE A;  1FNW A;  4MGZ E;  1LXD A;  1R7S A;  1OGW A;  3ML9 A;  2JT4 B;  2WU2 B;  3GOE A;  4GOC A;  2JXT A;  1UWX A;  3DBL I;  2GBM A;  5IAA C;  1FRR A;  3HUI A;  2IGG A;  2LZ6 A;  2AQ2 B;  3KH0 A;  3UI3 A;  2L8J A;  1NEN B;  3EHV A;  2ZW0 A;  5BYR A;  3PHW B;  3TEX A;  3ZTC A;  2C5L C;  4JQW C;  4S17 A;  1IBX B;  4K1R B;  5AUI A;  4ZHP A;  4GGQ A;  4BVU C;  2LFI A;  1RYJ A;  4KX6 B;  5JZE B;  2C7M B;  4KSK C;  4RGT A;  2G1E A;  4MEL A;  3VVW B;  4HCN B;  1LFD A;  1E8Y A;  1K53 A;  2KDF B;  2ZNV C;  4WJN A;  1YQ4 B;  2CKH B;  2BB6 A;  2NBW B;  4RGM A;  3AM9 A;  1V8C A;  2WXO A;  3VAW A;  2M4N A;  1ZOY B;  1SIF A;  2D3B A;  2AL3 A;  1GC7 A;  2B3A A;  3ZDM C;  5KHO A;  4AQ7 A;  2L00 B;  1SE2 A;  4E74 A;  4WH4 A;  4A3P A;  4CYE A;  2BVC A;  3DVN V;  1EU3 A;  4NAM A;  4RF1 A;  2KYW A;  5JXV A;  2AYO B;  3MC8 A;  3PV1 A;  1CJE A;  2O6V A;  4GDL A;  2CS4 A;  1UBQ A;  2WXG A;  4HRO A;  5J2R A;  3IHP C;  3SDL C;  5FKA C;  1Q10 A;  2RSU A;  1WM3 A;  1WH3 A;  2CR5 A;  2N9X A;  4M02 A;  1N60 A;  3SFE B;  2IY0 B;  2OED A;  3NS8 A;  4NJ6 A;  4WWM A;  4BKG A;  2KQS A;  2KJR A;  1A70 A;  2YVC A;  1YIW A;  3OWE B;  2RDG A;  1BUI C;  3HM6 X;  5J17 A;  2L3Z A;  3EA6 A;  4HKZ E;  3AEB B;  3W1S A;  3V61 A;  5LNK 1;  4HLE A;  2IPK D;  3V3X A;  2MP2 B;  3A9K A;  1C9F A;  4LCD E;  4REZ A;  2NR2 A;  1ZKH A;  3A4R A;  1IBX A;  2WHI A;  2I2Y A;  3R2I A;  2BS4 B;  2LVO A;  1CZP A;  3OJ3 A;  3AE5 B;  2KN5 A;  3I57 A;  1T0Q C;  3VH3 B;  1WGG A;  1SJE D;  1C4C A;  4RM9 A;  3S2A A;  1WFY A;  3U7D A;  2DNF A;  3WAN A;  5HHD G;  1JWS D;  4EFO A;  1IGC A;  2LGY A;  1QKZ A;  4X57 B;  1WF9 A;  2IO0 B;  2V4I B;  4DK5 A;  1QF6 A;  2MBB B;  2J42 A;  3L0W B;  3NG0 A;  3TIX A;  4IDI A;  4M0W B;  3VUY A;  3P2B A;  1WX7 A;  2DHZ A;  4IM3 A;  2H89 B;  4M01 A;  4RFB A;  3SR6 A;  1SB3 C;  4IWO A;  2BQQ A;  2N7E A;  2LJ5 A;  2PPH A;  4FN2 A;  5TR5 A;  1N5W A;  2DEN B;  3A1Q B;  2L76 A;  2QCZ A;  3AN1 A;  2BTE A;  3H8H A;  3AI5 A;  3AE8 B;  1VR9 A;  4C00 A;  2G9H D;  1WR1 A;  2ON8 A;  4DBG A;  1WWT A;  1K52 A;  3RYT A;  2INP E;  3V6C B;  5BMG A;  3E56 A;  1TJE A;  3LJ3 A;  2WX1 A;  1I4G A;  3L08 A;  4HKQ A;  3DBR I;  5D3D A;  3WA0 A;  2N0S B;  3LDZ E;  1FCC C;  5JHA A;  2MP2 A;  4L2Y A;  4US9 A;  4JIO U;  2JX5 A;  1WE6 A;  4MGY E;  2DYB A;  1F77 A;  2WP9 B;  2WXI A;  2HD5 B;  2KMC A;  4WJQ A;  4AP4 C;  3ZQ4 A;  3DBL B;  2FID A;  3PPA A;  3PZ7 A;  3UIP B;  2RGF A;  1L6V A;  3CST A;  1YQB A;  1ACC A;  2KMM A;  1NI2 A;  1MPE A;  5LLI A;  2IO1 B;  1OTR B;  3ZTD A;  5G5H A;  3BVZ A;  2X8X X;  2OHF A;  3EFC A;  5E6N A;  1HQR D;  4J3O D;  1WXV A;  4L1B A;  5C2T B;  3BZD B;  2WLB A;  2Z59 B;  4TSS A;  3KYD D;  2KVR A;  2QJL A;  4NPN A;  1JWA D;  4M00 A;  3PHX B;  2PJH A;  2V1Y A;  2AL6 A;  3RUL A;  2CHZ A;  4M0W A;  3C8Y A;  2BGF A;  3UIN B;  2CHX A;  4LNK A;  3H7P B;  3N3K B;  5HKH A;  3Q3F A;  1Q1O A;  4DHZ B;  2YEP F;  1SJH D;  1F2R I;  1WE7 A;  3A1Q A;  4ZDV A;  5AEK B;  1JQ4 A;  1VRA B;  2LRU A;  2KLG A;  3AE2 B;  1DOX A;  4EEW A;  1KOT A;  4IM2 A;  2GBK A;  3V62 A;  4KVG B;  3WAM A;  3GB1 A;  1L0X B;  2L1A A;  5G55 A;  1D5M C;  1F52 A;  3A4S C;  1KLG D;  3SEB A;  4JLC A;  1UNS A;  2IYD B;  3QQ8 B;  2WXJ A;  3EC8 A;  1E8W A;  2V9H A;  4B0M A;  3HVZ A;  4GLS C;  2PEA A;  2WGS A;  2ONQ A;  1ISN A;  2CHW A;  3CF6 E;  3ZGZ A;  2UYZ B;  2MRP A;  2M19 A;  3DHH C;  3O65 B;  3ECI A;  4NJ7 A;  2JWZ A;  2LVP A;  4WAF A;  5EE1 A;  2KNB A;  2QIL A;  1C4P A;  4BBN F;  3AUL A;  4WWP A;  4KKI A;  2VH2 A;  3KWV A;  4FHK A;  1SE9 A;  1KM7 A;  2M0X A;  2IBI B;  2C7N B;  5EE9 A;  4GXB A;  2KC1 A;  2MJD A;  2EMT A;  3UQB A;  2BB5 A;  4DXA B;  3H1U A;  2EKE C;  4MH8 A;  4W9J A;  3QAR A;  1VZ8 A;  1IGD A;  4P7I A;  1WXA A;  1TBE A;  3GE3 C;  1ZGU B;  5E6P A;  2JRI B;  2WXF A;  3PO0 A;  1CK1 A;  5GMV A;  3ZUN A;  5HI1 A;  2O6V D;  1ZDV A;  1E8Z A;  1SBB B;  1TS5 A;  4IWQ A;  3TEW A;  2H88 B;  3IT4 B;  3VH4 B;  2JZP A;  1BT0 A;  4ANU A;  3W1Y A;  4ARI A;  3UQA A;  1WGH A;  1V5T A;  1V1O A;  1IUE A;  2N1W A;  2FNJ B;  1E8X A;  2IO3 B;  5IOI A;  1ET9 A;  3ZW3 A;  3MJ5 A;  4DWF A;  3AE1 B;  2DBY A;  2N9K A;  1TY2 A;  1PGX A;  2DZJ A;  3DPD A;  3W5V B;  3JSV B;  2MQJ A;  1GPX A;  1B9R A;  4YTN B;  2KJ6 A;  2WXL A;  2K8H A;  2L0T A;  1WGK A;  5AZF A;  4EE2 A;  5EE0 A;  4LTU A;  4ASW C;  2MBE A;  5CX3 A;  1ROE A;  2DYM A;  2I1K A;  3Q8C A;  4EUT A;  3NZS A;  2LGS A;  1JML A;  4KGT A;  5GXG B;  1HZ5 A;  1L7Y A;  1L0V B;  2ZPY A;  4LK0 M;  1ZW7 A;  3ENE A;  2SAK A;  1YNT E;  3VDZ A;  3B1L X;  2AEH A;  1T0S C;  4RH6 A;  2DZK A;  2WXM A;  1GB4 A;  2NTT A;  2VZK D;  2FCM A;  4BFR A;  3KW5 B;  1TKG A;  2L52 A;  1JWM D;  4C7Y A;  5BMH A;  2N7D A;  1I4H A;  2QIE B;  4A55 A;  1WX9 A;  4AWJ A;  4MGI E;  4S0R A;  1PQS A;  1YQ3 B;  4HK2 A;  3GS2 A;  1SE4 A;  1HTQ A;  1STE A;  4PYU A;  4IG7 B;  1WJ6 A;  5CHW A;  2WWZ A;  1GG3 A;  4FUL A;  3UIO B;  4LNI A;  3C19 A;  3TMP B;  3PLV A;  4KV2 A;  3T8M A;  4MM3 B;  1SF0 A;  1FO4 A;  3SD5 A;  4C56 C;  3R2T A;  4DDI D;  2FAZ A;  3L10 B;  4I6N B;  4LNF A;  2ZCB A;  2JYE A;  3RZF A;  2KX0 A;  1FNV A;  4M8M A;  1GNU A;  5LXI B;  1XF5 L;  1WIA A;  4A3O A;  1GUA B;  3NZU A;  3DWM A;  3K9P B;  4ANW A;  1KLV A;  1P0R A;  3W5U B;  1N61 A;  2C9W B;  4KDI C;  1A5R A;  1ZXI A;  2MX2 A;  3U7Z A;  4JL9 A;  4NQL B;  4ANX A;  3NVY A;  2PTL A;  2K25 A;  2GBR A;  1F9J A;  2O6V B;  3RNG C;  2D3C A;  2MHJ A;  4GDL B;  3TBL D;  1V97 A;  3HVD A;  2C60 A;  3NRZ A;  1JWB D;  2REX A;  2FUG 1;  3X23 A;  2BS3 B;  2E3T A;  1TZO A;  3CSF A;  4D2K A;  4GN1 A;  3NOB A;  2L32 A;  3M3J A;  4MSQ B;  1AYF A;  4HCP B;  1KH0 A;  3IBE A;  3N20 C;  1WJU A;  1LQB A;  2KLC A;  2DAJ A;  2KX3 A;  2BYV E;  4TQ1 A;  3FIL A;  2CU3 A;  2WXN A;  3NZ3 A;  3RT3 B;  2HTH A;  4FA6 A;  3DHI C;  5TSS A;  3A9K B;  2BKR B;  4ZRK A;  4RGN A;  4F1S A;  1UF0 A;  4GIV A;  1V1P B;  2JVC A;  3ZNG C;  4PS7 A;  2DX5 B;  4JX1 C;  4N58 A;  2N9L A;  4MM3 A;  3VR8 B;  4P6V F;  1YD8 U;  3O13 A;  3RN9 C;  3IG3 A;  2QC8 A;  3L13 A;  3SHQ A;  4OVV A;  1FEH A;  1GB1 A;  1XQQ A;  2OJW A;  2KMA A;  4HJG E;  1FXI A;  2KDE B;  4LDT D;  3PRE A;  4OVU A;  1XO3 A;  1XLO A;  3PVL A;  1ESF A;  2I38 A;  3PRM B;  3BVM A;  1FPY A;  4WUR A;  4MSM B;  4GB9 A;  4IW0 A;  1TS3 A;  5H8Y E;  4ARC A;  1BML C;  4W9I A;  2VZK B;  2KKC A;  3E9S A;  4ICU A;  3Q6B A;  3GZN I;  5D6J B;  3ZJT A;  4AS1 A;  2M17 A;  1FRD A;  4XDD A;  4BKS A;  1EU4 A;  3ABV B;  3ZJU A;  4IOI E;  2E6X A;  2JZ3 B;  2KTR A;  3DHG C;  1ZDX A;  1NEK B;  2PW9 A;  1T6B X;  3PZ8 A;  2EMS A;  3GE8 C;  1IPG A;  2KJH B;  2C7H A;  1AAR A;  1T5X D;  2Y5C A;  3EUB 2;  3QAQ A;  4YXD B;  4DXG A;  4K3C A;  1G6J A;  4TMA B;  3RUI B;  2KDM A;  3P4S B;  2GI9 A;  4W9L A;  2JRH A;  3BYY B;  4FJY A;  4USA A;  3J9C A;  1GOZ A;  5IO9 A;  3AE6 B;  1XLQ A;  1V1P A;  2V0G A;  5AZH A;  3R8B A;  3VUW A;  3ZXR A;  3AEF B;  4RCO A;  1MVK A;  1HZ6 A;  1RFA A;  3W9C B;  3VRA B;  1L0Y B;  2J0K A;  1VD2 A;  4OVZ A;  3B2G A;  2M8S A;  3APF A;  2LMC A;  1TKE A;  1MHH E;  4HXD A;  5DPS A;  4F7Z A;  3SFD B;  4W9C A;  2JU6 X;  3APC A;  2LJI A;  1JRO A;  4A20 A;  3PSE B;  1E90 A;  2SEB D;  4MEM A;  3VFK A;  2FIF A;  1OQR A;  3KYC D;  4N59 A;  2ACZ B;  4RF0 A;  2G4D B;  2V4L A;  3AU5 A;  3HK0 A;  2GBN A;  2K6Q A;  5C23 A;  1TYG B;  2IGD A;  1EO6 A;  2ZZP B;  2MBO A;  1V5O A;  2IZV B;  3APD A;  3R7Q A;  1V6E A;  3P4P B;  2J52 A;  2WDR B;  1ZE3 D;  2IDY A;  1YN5 A;  2A4Z A;  4HRS A;  4LJP B;  3WAL A;  3N32 A;  3I9V 1;  3DVN U;  2PLP A;  1L4D B;  4HEA 1;  4K7U A;  1YJI A;  2LD9 A;  1L5P A;  2MJ3 A;  2J7Q B;  4GSW A;  2PE9 A;  3BK2 A;  3AE4 B;  3M63 B;  5E6J A;  2AWT A;  2JF5 A;  4NNJ B;  1WZ3 A;  4MT5 A;  4M8N A;  4WJP A;  2WXH A;  4PK1 A;  2BYF A;  3Q8E A;  3RNC C;  3IAM 1;  2LUE A;  1WMH A;  1YX5 B;  3KVF B;  3OJ4 B;  5CHV C;  4US8 A;  1T3Q A;  4NZL B;  2JWU A;  2MH7 A;  3LB8 C;  2WS3 B;  3DBS A;  3PRZ A;  1FCL A;  3DDC B;  3Q8B A;  1FFV A;  3Q3J A;  1ENF A;  4LDT B;  2WQY B;  3TCA A;  5LXH A;  3RMK C;  2Y5P A;  4A6Q A;  1DYQ A;  4KSL C;  1J19 A;  3N1Z C;  4JGH B;  2HJ1 A;  3FC4 A;  1EWC A;  4ICV A;  2GBJ A;  4W9K A;  2FBW B;  1UGM A;  1M4V A;  1WSP A;  4KIK A;  4FAD A;  2KWU B;  1XT9 B;  3ZNZ B;  4K81 A;  1UZX B;  4HDO A;  2ZW1 A;  4N9F 4;  2QHO A;  4P1C C;  4FJV B;  2AQ3 B;  3VTU A;  2BT6 A;  5D3I B;  4MJS A;  1WYW B;  5BYQ A;  4AOF A;  3PTF C;  5CTR C;  2QSD A;  4JPS A;  3CMM B;  3MTN B;  3V05 A;  3Q14 C;  3AB5 A;  4W9F A;  2ZVN A;  2EEL A;  2KWD A;  1DOY A;  5G5G A;  3ZLZ A;  3ZXV A;  1TGZ B;  1H8C A;  1Y8R C;  4YT0 B;  1V86 A;  2LRW A;  3DWG C;  3B9J A;  4IM0 A;  3GZN B;  3M95 A;  3DOW A;  4B0E A;  2GRI A;  1TY0 A;  1QZE A;  1UUP A;  3A9J B;  3H9D A;  1AWD A;  3KUD B;  3H6N A;  3Q2A C;  3V6E B;  2K3U A;  3I63 C;  1EUV B;  4BOS C;  1Z2M A;  1GJZ A;  2DWQ A;  2HDE A;  5DPT A;  4UDU C;  1C77 A;  5IKC M;  2N4F A;  2WU5 B;  3BYT B;  3ONS A;  4RNA A;  1RM6 C;  5C1Z A;  1D6E C;  1MJD A;  4E3C A;  1WY8 A;  2WDT B;  4KZC A;  4ACF A;  1RWS A;  3KQ4 A;  3AEE B;  3U30 A;  3WCQ A;  3NUH B;  1E6E B;  1J0G A;  4BOZ B;  2FUH B;  3KLS X;  4MDK E;  2BWE S;  4WWN A;  4DQO C;  1TS2 A;  2KDI A;  1NYR A;  2PIA A;  2DAF A;  4K3B A;  1KFY B;  2VH1 A;  4WQO B;  1SSN A;  3VUX A;  1AW7 A;  1IYF A;  2XEW A;  3RPF C;  1MG8 A;  3TJP A;  2WDQ B;  1J7C A;  1GC6 A;  4PS8 A;  1NYQ A;  4BKS D;  1RRB A;  1QOA A;  3TSS A;  4YSY B;  1P7E A;  1DOI A;  2L05 A;  2NBV B;  3DBH I;  3Q3M C;  4YSZ B;  1HE8 A;  5MPO A; 
#chains in the Genus database with same CATH homology
 3NS8 A;  1WGY A;  4NJ6 A;  3V60 A;  3K9P B;  4W9D A;  3K9O B;  1L2N A;  4BKG A;  2KQS A;  5DCN A;  4ANW A;  4K7W A;  1KLV A;  5BO4 B;  1P0R A;  2YLM A;  2C9W B;  4KDI C;  2KJR A;  1A5R A;  2MX2 A;  2YVC A;  1YIW A;  2MSE D;  3HM6 X;  4JL9 A;  5J17 A;  4NQL B;  1J8C A;  1NBF C;  4ANX A;  2D10 A;  2L3Z A;  2K25 A;  2M1M A;  2GBR A;  4HPL B;  3QA8 A;  5DPW A;  1TTN A;  1F9J A;  3ZO5 B;  2O6V B;  3PGE A;  2N9E B;  4GDL B;  3W1S A;  3V61 A;  4HLE A;  3TBL D;  4NQK E;  2C60 A;  4AJW A;  2I1J A;  2MP2 B;  3A9K A;  2LGX A;  2REX A;  3A9J A;  3PS6 A;  4LCD E;  3B0A A;  2J0J A;  3X23 A;  1C1Y B;  3CSF A;  2VRR B;  2NR2 A;  1ZKH A;  3A4R A;  3IVF A;  4GN1 A;  4EZL A;  2V3S A;  3NOB A;  2WX0 A;  3M3J A;  4MSQ B;  3DVG Y;  4CO7 A;  2KFK A;  3BIN A;  4HJK A;  2A5U A;  2LVO A;  2O2V A;  4G11 A;  4HCP B;  4F8C B;  3IBE A;  3OJ3 A;  1WJU A;  2KN5 A;  3VTW A;  3OAW A;  5D2M B;  1LQB A;  3VH3 B;  3RD2 A;  1WGG A;  2KLC A;  3R3M A;  2DAJ A;  2KX3 A;  2BYV E;  4RM9 A;  3S2A A;  1WFY A;  4TQ1 A;  3U7D A;  2K8B A;  4YL8 A;  3WAN A;  3VHT C;  2K8C A;  3WAP A;  4EFO A;  3RT3 B;  2LGY A;  1JRU A;  2HTH A;  3L16 A;  4FA6 A;  2J0M A;  2OOB B;  1RLF A;  1WF9 A;  2IO0 B;  4X57 B;  3A9K B;  5AZG A;  2BKR B;  4ZRK A;  4EOY A;  4FLH A;  2BKF A;  4FJZ A;  4DK5 A;  1WGD A;  2KOX A;  4F1S A;  4HWI B;  1WJ4 A;  2MBB B;  4GIV A;  1Q0W B;  3L0W B;  4EKU A;  3QX1 A;  3TIX A;  2JVC A;  3ZNG C;  5FR6 A;  4PS7 A;  2DX5 B;  2LXA A;  3QC8 B;  2NBU A;  5DPR A;  2DYO A;  3HIZ A;  2O2V B;  4M0W B;  4MM3 A;  1YD8 U;  4URK A;  4G0N B;  3VUY A;  3P2B A;  1WX7 A;  3IG3 A;  2DHZ A;  2KZR A;  3L13 A;  4IM3 A;  3SHQ A;  2BF8 B;  2K1F A;  4OVV A;  4W9E A;  3ZIM A;  1UBI A;  4BBN C;  4IWO A;  3PZD A;  1KJT A;  1XQQ A;  2N7E A;  2KMA A;  3I3T B;  2LJ5 A;  2KDE B;  2PPH A;  4FN2 A;  2W9N A;  5TR5 A;  2DEN B;  1YJ1 A;  3A1Q B;  4LDT D;  2L76 A;  3PRE A;  4OVU A;  2ZVO A;  5CHF A;  3HHM A;  4EZK A;  4IC7 B;  3PVL A;  3AI5 A;  1WGR A;  3PRM B;  1IP9 A;  4WJO A;  1T0Y A;  4MSM B;  4GB9 A;  4IW0 A;  1E7U A;  2KD0 A;  4K7S A;  1WR1 A;  4DBG A;  4AJY B;  2NCN A;  4W9I A;  2N1V A;  2KKC A;  3RYT A;  3V6C B;  4HVB A;  5D7G A;  4ICU A;  3GZN I;  3H7S A;  3LJ3 A;  5D6J B;  3T9L A;  2WX1 A;  4II3 B;  1WZ0 A;  2M17 A;  3L08 A;  3DBR I;  4G50 A;  3WA0 A;  3JW0 X;  2ZEQ A;  2D2Q A;  3LDZ E;  5JHA A;  2MP2 A;  4NY0 A;  4JIO U;  1V49 A;  1WE6 A;  4NAW B;  4MGY E;  2DYB A;  2ZNV B;  2HD5 B;  2KMC A;  4BKS A;  4WJQ A;  4IWP A;  4ANV A;  4W9G A;  4AP4 C;  2JZ3 B;  2KTR A;  5JHB A;  2G45 B;  4MGK E;  2DZM A;  2NS5 A;  2FID A;  3PPA A;  3UIP B;  2RGF A;  4RM8 A;  3KUZ A;  3CST A;  1YQB A;  3H7P A;  3ZRF A;  2KWV B;  4DHJ B;  1NI2 A;  2EMS A;  2XK5 B;  5E6O A;  1IPG A;  2KJH B;  2C7H A;  2OJR A;  1AAR A;  2IO1 B;  5LLI A;  1OTR B;  2ASQ A;  3ZTD A;  3ML8 A;  4TKN A;  3ZNH B;  4KZ0 A;  3QAQ A;  2PE6 B;  3SU8 X;  1G6J A;  2D3G A;  3RUI B;  5E6N A;  4I6P A;  1WM2 A;  4W9L A;  1WXV A;  2JRH A;  1VCB A;  4FJY A;  1R4M I;  2KWC A;  2L7R A;  3ALB A;  2MBQ A;  4I6L B;  2Z59 B;  2IO2 B;  2D07 B;  3KYD D;  2KVR A;  4TUU A;  4B9K A;  2CU1 A;  4NPN A;  5AZH A;  3PHX B;  2PJH A;  2V1Y A;  3VUW A;  3A33 B;  2KTR B;  2AL6 A;  4GMV A;  1RFA A;  1U4A A;  3RUL A;  2CHZ A;  2BGF A;  2J0K A;  3UIN B;  1P9D U;  1S1Q B;  1VD2 A;  2CHX A;  3H7P B;  3AU4 A;  3N3K B;  2M8S A;  2RD0 A;  1WXM A;  4G3X B;  5HKH A;  3APF A;  3PLU A;  2KK8 A;  3WAO A;  4B6W A;  3Q3F A;  1Q1O A;  2KFJ A;  2NVU I;  4HXD A;  3AXC A;  4DHZ B;  3NY5 A;  5DPS A;  4F7Z A;  2JZZ A;  4W9C A;  1WE7 A;  2KTF A;  3VXW A;  3DQV A;  1P98 A;  3A1Q A;  2LXC A;  3APC A;  4B95 A;  4ZDV A;  5AEK B;  3UF8 A;  1I35 A;  2LRU A;  4FHJ A;  4A20 A;  2KQ7 A;  3PSE B;  5EDS A;  2KLG A;  4PS3 A;  4EEW A;  1KOT A;  1E90 A;  2GBK A;  2MWS B;  4IM2 A;  3V62 A;  2RR9 A;  4MEM A;  2KXJ A;  3VFK A;  4KVG B;  2FIF A;  3KYC D;  3WAM A;  4TV3 A;  2LWP A;  2G4D B;  2V4L A;  3AU5 A;  5G55 A;  3HK0 A;  2GBN A;  4AUQ C;  4HPM B;  1OEY J;  1X1M A;  4XC2 A;  3L17 A;  2K6Q A;  3A4S C;  5C23 A;  3C0R B;  3JVZ X;  1EO6 A;  2ZZP B;  5D94 A;  2KO3 A;  2MBO A;  4JLC A;  1V5O A;  4XX5 A;  2IYD B;  2IZV B;  2LGD A;  3EC8 A;  3QQ8 B;  1E8W A;  4GDK A;  5KHQ A;  2G4S A;  1OQY A;  1P3Q U;  3APD A;  4GU2 A;  1V6E A;  2DZI A;  3R7Q A;  1SGH A;  2PEA A;  1EF1 A;  1ISN A;  2CHW A;  4J6I A;  3CF6 E;  2BPS A;  2UYZ B;  2MRP A;  3B08 A;  4NAW A;  3O65 B;  3ECI A;  2A4Z A;  4NJ7 A;  4WWO A;  2JWZ A;  4LJP B;  3WAL A;  3N32 A;  2LVP A;  3QWZ B;  3DVN U;  2KNB A;  2GMI C;  4EZJ A;  4BBN F;  3AUL A;  4K7U A;  1UH6 A;  1M94 A;  2K39 A;  2LD9 A;  4WWP A;  1XD3 B;  1WXS A;  4W9H A;  4ZYN A;  1D3Z A;  4MH0 E;  4FHK A;  1SE9 A;  1KM7 A;  2J7Q B;  3IFW B;  2M0X A;  2PE9 A;  4GSW A;  5L83 A;  1WI0 A;  2IBI B;  2IY1 B;  3OLM D;  1Q5W B;  3M63 B;  2N9P C;  2MW5 A;  2C7N B;  2Z0D B;  2AWT A;  2JF5 A;  1CMX B;  2G3Q B;  4GXB A;  4NNJ B;  2KC1 A;  1WZ3 A;  4M8N A;  4WJP A;  1R4N I;  2NPT A;  2BYF A;  2EMT A;  3UQB A;  2XK5 A;  4GDK B;  2LUE A;  4DXA B;  3H1U A;  1WMH A;  2EKE C;  4W9J A;  2FCQ A;  1YX5 B;  3KVF B;  3QAR A;  3OJ4 B;  3QK0 A;  1C3T A;  3ZDT A;  5CHV C;  4P7I A;  3ZKJ C;  2D11 A;  1WXA A;  1TBE A;  1ZGU B;  4BKT A;  5E6P A;  2JRI B;  1K8R B;  3D32 A;  2LAS A;  1E5W A;  3DBS A;  1NDD A;  1TZ1 A;  4RMA A;  3PRZ A;  2HJ8 A;  3DDC B;  3Q3J A;  5GMV A;  3ZUN A;  3N30 A;  2BYE A;  2KAN A;  1WX8 A;  2JUO A;  2O6V D;  1OEY A;  3DVG X;  1E8Z A;  4LDT B;  2LVQ A;  2L0F A;  4IWQ A;  3RZW C;  3TCA A;  5LXH A;  4ZRJ A;  2JPH A;  3JSV A;  1EF5 A;  2ZCC A;  3QJZ A;  2R2Q A;  4XZ4 A;  1V9J A;  4KSL C;  3VH4 B;  1J19 A;  1BT0 A;  3R7R A;  4ANU A;  3W1Y A;  2NPT B;  4JGH B;  3WIM A;  4HDQ A;  2MA9 B;  3UQA A;  1WMH B;  3X0W A;  4ICV A;  2FCS A;  1WGH A;  1V5T A;  2GBJ A;  4W9K A;  1E7V A;  3U8Z A;  2N1W A;  1UGM A;  4FAD A;  2WYQ A;  4KIK A;  2KWU B;  1XT9 B;  2FNJ B;  3TL5 A;  1E8X A;  2IO3 B;  3ZNZ B;  4K81 A;  1FXT B;  1UZX B;  3PT2 B;  2GOW A;  1UD7 A;  3W1S C;  3PRP B;  2R2O A;  1LM8 B;  4HDO A;  4FBJ B;  4LJO B;  4N9F 4;  3DCG A;  1P1A A;  2Y5B B;  2QHO A;  3ZW3 A;  4DWF A;  4FJV B;  1WJN A;  3VTU A;  3DPD A;  2DZJ A;  1Z5S B;  1UEL A;  3JSV B;  2MQJ A;  3L54 A;  4E71 A;  4MJS A;  1WYW B;  3JYU A;  4PYZ A;  4ZRI A;  2JY6 A;  5J18 A;  2KJ6 A;  4AOF A;  2K8H A;  3PTF C;  3MJW A;  2L0T A;  5G2N A;  4CHK A;  4TQ0 A;  3M62 B;  5CTR C;  4KDL B;  2UWQ A;  3CMM B;  1RAX A;  4DHZ E;  1WR6 E;  2FCN A;  3MTN B;  3QHT A;  4KIK B;  5AZF A;  4W9F A;  2ZVN A;  4MGZ E;  1LXD A;  1I42 A;  3EEC A;  3ZLZ A;  4ASW C;  1OGW A;  1TGZ B;  2KDB A;  2MBE A;  2JT4 B;  3ML9 A;  1Y8R C;  2JXX A;  5CX3 A;  1H8C A;  3GOE A;  1V86 A;  5JH5 C;  2BWF A;  3ZVV A;  2DYM A;  2I1K A;  4GOC A;  3UGB B;  2LRW A;  4EUT A;  3DBL I;  2GBM A;  3NZS A;  4IM0 A;  3M95 A;  4MJS B;  3QCA A;  5IAA C;  1L7Y A;  3DOW A;  2LZ6 A;  2ZPY A;  3KH0 A;  2L8J A;  1ZW7 A;  1QZE A;  3ENE A;  2MCN B;  3EHV A;  3VDZ A;  4II2 B;  3A9J B;  3B1L X;  3H9D A;  2AEH A;  3PHW B;  1V80 A;  3H6N A;  3KUD B;  2K6D B;  3ZTC A;  2DZK A;  3V6E B;  2C5L C;  4JQW C;  4K1R B;  2FCM A;  1V2Y A;  1EUV B;  4GGQ A;  4BOS C;  4BVU C;  3KW5 B;  4BFR A;  2KFK B;  2MBH A;  2KHW B;  1Z2M A;  1GJZ A;  5DPT A;  2N7D A;  5JZE B;  2C7M B;  4KSK C;  1WX9 A;  2N4F A;  4AWJ A;  4MEL A;  3VVW B;  4HCN B;  1LFD A;  1E8Y A;  2KDF B;  2ZNV C;  3EFU A;  3ONS A;  1PQS A;  4MGI E;  4WJN A;  5C1Z A;  4HK2 A;  1H4R A;  2RPQ A;  2CKH B;  2ZPN A;  2NBW B;  4E3C A;  3R66 C;  4PYU A;  4IG7 B;  3VAW A;  1S3S G;  1WY8 A;  1WJ6 A;  2WDT B;  2M4N A;  4KZC A;  5CHW A;  2WWZ A;  1GG3 A;  4FUL A;  3U30 A;  3UIO B;  1SIF A;  3VTV A;  1J0G A;  2AL3 A;  2HE7 A;  1GC7 A;  2B3A A;  4BOZ B;  4DHJ D;  3TMP B;  3ZDM C;  3PLV A;  2FUH B;  4MDK E;  4KV2 A;  2BWE S;  5KHO A;  3T8M A;  4WWN A;  2L00 B;  3ZRC A;  4E74 A;  2KDI A;  4A3P A;  1YX6 B;  4CYE A;  3NHE B;  2DAF A;  4WQO B;  3DVN V;  1WRD B;  3SD5 A;  3VQI A;  4WAA A;  3BY4 B;  5IA7 A;  4DDI D;  5L95 C;  3VUX A;  1IYF A;  1V81 A;  2XEW A;  1MG8 A;  2AYO B;  3TJP A;  2FAZ A;  1GC6 A;  3L10 B;  4PS8 A;  4I6N B;  3PV1 A;  4DDG D;  4BKS D;  2O6V A;  2ZCB A;  4GDL A;  2CS4 A;  1RRB A;  1UBQ A;  3RZF A;  2KX0 A;  5J2R A;  2XBB C;  3IHP C;  2LI5 A;  4M8M A;  3SDL C;  3HM3 A;  3MHS D;  1GNU A;  3ZNI D;  2KC2 A;  2MLB A;  1WM3 A;  1WH3 A;  2RSU A;  2CR5 A;  2N9X A;  3QIJ A;  2L05 A;  5LXI B;  2NBV B;  3KUC B;  3DBH I;  1WIA A;  4IUM B;  2Z0E B;  2IY0 B;  1HE8 A;  2ZJD A;  1GUA B;  4A3O A;  3NZU A;  3RCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...