2GBKA

Crystal structure of the 9-10 moad insertion mutant of ubiquitin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
b'MQIFVKTLTQVRELVGGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
molecule tags Protein binding
source organism Homo sapiens
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
total genus 23
structure length 82
sequence length 82
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbkA00
3PREA 2KX0A 4GXBA 5J17A 2LUEA 4KV2A 2DYBA 4FJYA 1D3ZA 2BWFA 4HDQA 3PLVA 4ICUA 3WAOA 2NVUI 4DK5A 3ZIMA 3NZUA 3QC8B 4CYEA 3VUYA 2LVOA 2D07B 4FLHA 5IA7A 2WX0A 2L76A 1P98A 2LGXA 3QK0A 2RGFA 4LDTD 3S2AA 4GDKB 2KMCA 3VUXA 1WZ3A 3GZNI 3UF8A 3I3TB 3QCAA 4EZKA 2L00B 4JLCA 4JQWC 2LRWA 2K6DB 3A4SC 3PHWB 3PZDA 4TQ1A 3DVNU 5CTRC 4TKNA 2V4LA 3HHMA 5KHOA 3DOWA 3HIZA 5CHVC 2GBRA 4AOFA 4NAWA 2NBVB 2XEWA 4BBNC 2NBUA 4URKA 4DXAB 1GG3A 1YJ1A 4ZRIA 3SU8X 2FAZA 3WIMA 2LWPA 2L7RA 5EDSA 2KXJA 5D7GA 2AEHA 1C1YB 2C5LC 1E7VA 1EUVB 2N7DA 1UZXB 2BYVE 2KWVB 3DDCB 4FJVB 1WMHA 2N1VA 1GC7A 4GDKA 1OQYA 4OVVA 5LXIB 1WJ6A 1WXAA 3MHSD 2K1FA 4KZCA 4KSKC 2ZPYA 3DQVA 3ECIA 4HXDA 2G3QB 3H7PA 2IO1B 3NS8A 1Q0WB 2JZZA 3BINA 1WH3A 4MM3A 1U4AA 4NAWB 2KX3A 3ENEA 3Q3JA 2K25A 3K9OB 3APFA 2EKEC 5G55A 3U8ZA 2MX2A 1K8RB 4IG7B 4WJOA 3BY4B 3KW5B 2XK5B 2KO3A 2PE9A 2N1WA 1WXSA 2WDTB 3A4RA 1UELA 2LRUA 4WJPA 3VTUA 4EFOA 3AULA 1J0GA 3OJ4B 1UBQA 2LXCA 4IWOA 2KDEB 1AARA 2ZEQA 3GOEA 4CHKA 5LXHA 5HKHA 3M3JA 3B08A 1SGHA 3L0WB 5DPSA 3ZTCA 4P7IA 1WXVA 1WGYA 2BWES 1R4NI 1V49A 2L0FA 3NY5A 5BO4B 2FCQA 2BYEA 1RAXA 2CS4A 4MGIE 2I1KA 2C60A 4NJ6A 1WM2A 3N32A 2IY0B 3R7QA 3P2BA 2DX5B 4EUTA 2D10A 2PJHA 4DHZB 1V2YA 3H7SA 1T0YA 1SIFA 1TGZB 2Y5BB 3MJWA 3RT3B 4OVUA 2BF8B 1Z2MA 3AXCA 3TL5A 3VVWB 1C3TA 4HDOA 3ZRFA 3AU4A 2KJRA 4W9JA 2KHWB 4GDLA 3CMMB 3TBLD 2JWZA 1G6JA 4LCDE 4ICVA 4DDID 4KSLC 2KZRA 2N9PC 1CMXB 2O6VA 4MGKE 2KKCA 3EFUA 2ASQA 4PYUA 4GIVA 3IBEA 3UGBB 2KDBA 4W9CA 1TBEA 1R4MI 2GBJA 3RYTA 2KWUB 2R2OA 2ZNVC 2ZVOA 4ASWC 1KJTA 3DBRI 4FHKA 3ZVVA 1SE9A 5D2MB 2J7QB 1KLVA 3DBSA 3PV1A 1S3SG 4AUQC 3VQIA 4MGYE 4PYZA 2LZ6A 2BGFA 4J6IA 1JRUA 1WR6E 1MG8A 2DAFA 4GDLB 1LQBA 4HLEA 1Z5SB 2GMIC 4EEWA 2CU1A 1VCBA 4G0NB 4GOCA 2BYFA 2LI5A 2BKFA 2N9EB 2J0JA 2KD0A 3ZKJC 1V9JA 2WWZA 1WYWB 2MCNB 2D2QA 2MP2B 4IWQA 4ANWA 4B6WA 2CR5A 4KZ0A 2FNJB 4I6LB 4ANXA 1VD2A 2GBNA 3APDA 2DZIA 4AJWA 2KN5A 3PTFC 4FBJB 5AEKB 4DDGD 2NBWB 2M0XA 3ZLZA 3CF6E 4BVUC 2GBMA 4BOZB 2C7HA 3N30A 1E8YA 1Y8RC 1KM7A 2LJ5A 4KVGB 2JT4B 1WZ0A 1EO6A 2KNBA 1ZW7A 1UD7A 2DYOA 4HVBA 1WJNA 3PGEA 3R66C 3OLMD 3PS6A 4YL8A 2HE7A 3PHXB 4II2B 3A9JB 2G4SA 2XK5A 2D3GA 2UYZB 5GMVA 1NBFC 1XQQA 4BKSA 1PQSA 2NCNA 2Z0EB 1OEYJ 1WGRA 3A1QB 1LM8B 4XX5A 3U30A 4KDIC 4EOYA 1XD3B 2IO0B 3UQBA 2MBOA 3ML8A 1RRBA 3KUDB 1FXTB 4LJOB 3X0WA 4F1SA 2QHOA 4XC2A 2LGYA 2MA9B 3QAQA 4M8MA 3ZW3A 4NJ7A 2JVCA 1L7YA 1RLFA 2JZ3B 2CKHB 3RUIB 2DZKA 4N9F4 4M0WB 3A9KB 3UINB 3SHQA 3PLUA 2MRPA 2KJ6A 1V6EA 4GGQA 2WYQA 4HPLB 4IM3A 4HWIB 1KOTA 5AZHA 3SD5A 2AL6A 3KYCD 3KUCB 3N3KB 4K7SA 2I1JA 2LVQA 2LVPA 2AL3A 3B0AA 2MP2A 2MBQA 2KTRB 2KVRA 2K8HA 4DWFA 4WAAA 2Z0DB 3PRPB 1E5WA 2HD5B 2RR9A 2JPHA 3L10B 4W9FA 2KLCA 1UBIA 1WRDB 4KIKB 2A4ZA 2MBHA 3W1SA 2V1YA 2ZJDA 4JL9A 4CO7A 3VTWA 2JF5A 3ZDTA 4TV3A 4FADA 4DBGA 1J8CA 3R3MA 4GSWA 2O6VB 4FULA 2B3AA 1ZGUB 3KUZA 2IY1B 2K6QA 3IVFA 4WWOA 2FCSA 3NOBA 2MWSB 3PSEB 3VUWA 5DPWA 1WX8A 2KANA 2KFJA 2MBEA 1E7UA 1V86A 1P9DU 2NR2A 4WJQA 3TIXA 1I35A 2KWCA 2K39A 1GNUA 1Q1OA 4AWJA 4NNJB 2DYMA 3U7DA 4GB9A 1WGDA 3R7RA 1NDDA 3TCAA 3OAWA 2M4NA 2M1MA 3DPDA 2C7MB 2DZMA 2KLGA 2FIFA 2OJRA 4HCNB 1WXMA 2IZVB 1WI0A 3HK0A 2YVCA 1E8XA 3RULA 2CHWA 1TTNA 3CSFA 3V60A 5JHBA 4MSMB 4K1RB 1Q5WB 4A3OA 4DHJD 3VAWA 3K9PB 2FIDA 5JH5C 1P1AA 3A9KA 2R2QA 3DVGY 2BPSA 1OEYA 1OTRB 2AWTA 2MQJA 2NPTA 3ALBA 3AU5A 2MBBB 5CHWA 3AI5A 2C9WB 3M62B 2REXA 2K8BA 3HM3A 4F7ZA 4MH0E 1V5OA 2C7NB 2IBIB 4BOSC 3LDZE 1L2NA 1WR1A 3QHTA 3V61A 2KFKB 3H1UA 4HCPB 4MELA 3VFKA 4EZLA 4MDKE 1X1MA 3A1QA 3JSVB 4K7UA 4ZYNA 3DBHI 2ZPNA 4NPNA 2M17A 2O6VD 3KVFB 2RD0A 4FA6A 1YIWA 1P0RA 2DAJA 3QWZB 4RMAA 3RZFA 1V80A 3WALA 3L13A 4WWNA 2MSED 1WMHB 4W9LA 2CHZA 2J0KA 1IPGA 4PS3A 1QZEA 5G2NA 4IC7B 1YX6B 5J18A 3H7PB 1WY8A 3JW0X 3TMPB 2IO3B 3IG3A 4NQKE 4ZRKA 3ZO5B 5J2RA 2K8CA 2DENB 5C1ZA 2KC2A 1V5TA 4WJNA 4ZRJA 4ANUA 4KDLB 5E6OA 4G50A 1WF9A 5LLIA 4HPMB 3EECA 1WGHA 2V3SA 1GC6A 2Z59B 4WQOB 3WANA 4LDTB 3VHTC 3QARA 2IYDB 4DHZE 2NS5A 3DVNV 4W9DA 1I42A 4EZJA 4K7WA 2FUHB 3PPAA 5AZFA 2PEAA 1NI2A 1RFAA 1EF5A 3O65B 2O2VA 3EHVA 1WGGA 4I6NB 2DHZA 3ZDMC 4MEMA 4B95A 2JXXA 4GMVA 3OJ3A 2HJ8A 1ISNA 4HK2A 2PE6B 4F8CB 1WE6A 5CX3A 1H8CA 4MJSB 1E8WA 1XT9B 4KIKA 3VTVA 2ZNVB 4JIOU 2JRIB 2G4DB 4I6PA 1S1QB 3KYDD 4PS7A 3M63B 4XZ4A 3RZWC 2KMAA 2KOXA 1TZ1A 3ML9A 4IUMB 3NZSA 3M95A 5L83A 1WIAA 2LD9A 2O2VB 2KFKA 3T9LA 2L8JA 1HE8A 2FCMA 4NY0A 5AZGA 3D32A 1IP9A 2HTHA 2FCNA 2KK8A 5DCNA 4IM0A 2UWQA 3ZNGC 5JHAA 3QQ8B 2A5UA 4W9KA 4W9IA 3V6EB 3VH4B 3QA8A 3ZNZB 4HJKA 3Q3FA 2KC1A 4IWPA 1WFYA 5IAAC 2XBBC 2ZVNA 3W1YA 5E6PA 3WA0A 4MJSA 4BKGA 1P3QU 4M8NA 4FJZA 2KTFA 3VDZA 2L3ZA 4W9HA 4BBNF 4BFRA 3W1SC 2RPQA 3UQAA 2WX1A 3IHPC 2JRHA 3L54A 5E6NA 3UIOB 3VXWA 3LJ3A 1J19A 5CHFA 3JYUA 4G11A 2J0MA 1OGWA 4EKUA 3C0RB 2D11A 3ZTDA 2KQ7A 4W9GA 4FN2A 1GJZA 3T8MA 1YD8U 3H6NA 4MGZE 3V62A 5DPTA 4DHJB 1UGMA 5L95C 4G3XB 4II3B 3CSTA 4IM2A 2L0TA 1IYFA 2YLMA 3TJPA 1WJUA 4GU2A 3WAMA 1WJ4A 5DPRA 3ZRCA 4ZDVA 1H4RA 3KH0A 4X57B 3HM6X 3A33B 2M8SA 1E8ZA 3L16A 3MTNB 4ANVA 3EC8A 4AP4C 1A5RA 2GBKA 5D94A 3PRMB 2BKRB 4LJPB 1LFDA 2LXAA 2L05A 2VRRB 3PRZA 2DZJA 1M94A 2KDIA 1GUAB 5TR5A 3ZNHB 3QIJA 3IFWB 4BKSD 3V6CB 4E74A 5C23A 4TUUA 3WAPA 2MLBA 2N9XA 1WE7A 3UIPB 1WX7A 4WWPA 2KJHB 1WX9A 4JGHB 4BKTA 4RM8A 4A20A 5D6JB 4IW0A 4FHJA 3A9JA 1YQBA 2KTRA 3DVGX 5KHQA 3DBLI 4E3CA 2CHXA 3QJZA 4AJYB 1WM3A 4GN1A 2IO2B 2OOBB 2G45B 3ONSA 3ZNID 5JZEB 3APCA 2LASA 4NQLB 2NPTB 2JUOA 3QX1A 1YX5B 3RCZA 2KQSA 3PVLA 3L08A 3B1LX 3JVZX 2PPHA 3PT2B 2MW5A 4MSQB 1UH6A 2EMTA 2EMSA 3VH3B 1BT0A 2LGDA 4PS8A 2N4FA 2AYOB 4K81A 3NHEB 2RSUA 3RD2A 3ZUNA 4E71A 4RM9A 2ZCBA 4B9KA 1F9JA 5FR6A 3X23A 2W9NA 3SDLC 1LXDA 2N7EA 1E90A 2ZCCA 2ZZPB 3JSVA 3H9DA 4W9EA 2JY6A 4A3PA 2KDFB 3L17A 1EF1A 4TQ0A 1V81A 1ZKHA 2GOWA 3DCGA
chains in the Genus database with same CATH superfamily
2AQ2B 3PREA 4US8A 4GXBA 1XLOA 4FJYA 1D3ZA 3WAOA 3ZIMA 4JPSA 4CYEA 4P1CC 2VH1A 1ZXIA 2KMMA 3QK0A 1TYGB 3S2AA 4RFBA 2JX5A 3PZDA 3A4SC 3I9V1 4TQ1A 2D3AA 4TKNA 1E9MA 1N5WA 3HHMA 2PVGC 5KHOA 5CHVC 4AOFA 4NAWA 2NBUA 4URKA 1YJ1A 3HVDA 5EDSA 2L7RA 3DBLB 1EUVB 2N7DA 1UZXB 4ARCA 5LXIB 4EE2A 1WXAA 3ECIA 2JZZA 3AEEB 1WH3A 2KX3A 3BIID 2K25A 3APFA 2VH2A 2MX2A 1K8RB 5HHDG 2J52A 2KO3A 2WHIA 4JX1C 3A4RA 1UELA 2LRUA 5BMGA 3VR8B 3RNGC 2IJ0A 1UUPA 3AULA 3OJ4B 2N9LA 4IWOA 2KDEB 1R4NB 2GRIA 5HKHA 3B08A 1SGHA 3ZTCA 2BWES 1V97A 5C3JB 2PTLA 2CS4A 2C60A 3N32A 2IY0B 4P6VF 2JU6X 4EUTA 4OVUA 1Z2MA 1ROEA 4HDOA 1L0VB 3AU4A 2KJRA 4W9JA 3TBLD 4LCDE 3LXFA 2KZRA 1E10A 4GIVA 1C4CA 4MM3B 1DYQA 1TBEA 2GBJA 1FPYA 3ZVVA 4FHKA 1JW9D 1I4QA 1SE9A 3RNBC 3R8BA 1KLVA 4MGYE 5TSSA 5E6JA 1JRUA 1VZ7A 2WXGA 2DAFA 4GDLB 1LQBA 4HLEA 3ETRA 1QILA 1Z5SB 4G0NB 4GOCA 1WYWB 2D2QA 2MP2B 4KZ0A 1ZOYB 4ANXA 3APDA 2KN4A 4DDGD 3ZLZA 3CF6E 1NVID 3Q8CA 2LJ5A 4A90A 1WZ0A 1UD7A 2DYOA 1WJNA 1P7FA 1N61A 4H2AA 2UYZB 5GMVA 1NBFC 4BKSA 2NCNA 4XX5A 3BYTB 3U30A 2BS4B 2MBOA 1EU3A 2H89B 1FXTB 4F1SA 4PK1A 4XC2A 2MA9B 3QAQA 2BT6A 2JVCA 1ENFA 2CKHB 3W5VB 1XXGA 4GGQA 1MG4A 4HWIB 1KOTA 4YSZB 1YQ4B 5AZHA 3O13A 2I1JA 1T0QC 2AL3A 4DWFA 2Z0DB 3GE8C 1UBIA 1E7PB 2ZJDA 4LNIA 1YJJA 1SE4A 3ZDTA 5EE9A 1CQVA 2W54A 4DBGA 3R3MA 4WH4A 1SEBD 2MJ3A 4OZCA 2MWSB 5DPWA 2KFJA 1V86A 3RNCC 4WJQA 4NAMA 4AWJA 1K50A 3OAWA 2D5GA 4YTMB 2DZMA 1XEEA 1SE3A 2FBWB 3P4SB 4C7YA 1TTNA 3CSFA 1YNTE 1B1ZA 4RH6A 4DHJD 2QEJC 3VAWA 5JH5C 1P1AA 3A9KA 1VZ8A 5GXGB 3AE1B 5H8YE 3ALBA 3AU5A 3HRDD 4IDIA 1XLNA 2REXA 4F7ZA 4HJGE 4Q2JA 3QHTA 3V61A 2PLPA 4MDKE 4ZYNA 4K7UA 4NPNA 2PMVA 2N0SB 1YIWA 3NZ3A 3MC8A 1FRDA 1UGJA 1V80A 2FE8A 3RZFA 3L13A 4RGOS 1IPGA 1TKGA 1GB1A 5LNK1 5G2NA 4XYCA 4HPPA 3JW0X 1C4AA 2YEPB 1LGRA 2W82A 3GP7A 1N60A 2KC2A 2X8XX 5E6OA 2V3SA 3TUOA 3VHTC 2IYDB 4DHZE 3DVNV 1I42A 4EZJA 1L6UA 3PZ7A 2B76B 1RFAA 1T6BX 3RN9C 4MEMA 4CQNA 1I4XA 2JXXA 2MEKA 4F8CB 1Q10A 4O1NA 2G9HD 2WXIA 2WP9B 1HE8A 2UU7A 1EM7A 2EKIA 4NY0A 4HRSA 3D32A 2HTHA 3ZNGC 3QQ8B 4W9IA 2KC1A 2XBBC 2ZVNA 3I63C 2QDFA 5BYQA 3WA0A 4MJSA 4BKGA 1P3QU 4M8NA 4FJZA 4NZLB 2KTFA 3DHGC 3DBHB 4W9HA 4BBNF 2V4IB 1C78A 4ACFA 1SSNA 3L54A 3VXWA 1J19A 3JYUA 1NYRA 4G11A 2J0MA 1OGWA 2PKOA 3C0RB 2QC8A 4FN2A 2WXLA 4MGZE 2K3UA 5FK9C 4II3B 2BBCA 4IM2A 3IAS1 1WJUA 4GU2A 5DPRA 3FKYA 3MJ5A 4X57B 3H8HA 3A33B 2JYTA 2WXKA 1N6ZA 4LJPB 2BKRB 3FILA 2L05A 3PRZA 1M94A 2KDIA 1GUAB 3IFWB 4R3DA 3NJTA 1F2RC 2N9XA 4RGTA 4JGHB 3T3NA 4A20A 1FEHA 2ZW1A 3ZXVA 1HZ6A 5KHQA 1B9RA 4XE0A 3PVLA 3L08A 1F0ZA 2PPHA 1ACCA 2MW5A 4JWUC 4MSQB 1UWMA 4IOIE 1MHHE 2LGDA 4PS8A 3Q8EA 4K81A 4E71A 2Z8LA 4RM9A 2INPE 1KLUD 3SDLC 2N7EA 2ZCCA 2ZZPB 4W9EA 2RDBC 4A3PA 2KDFB 1EF1A 2GOWA 3J9CA 2LGSA 1FFUA 2LUMA 2DYBA 4HDQA 3IT6B 2MJDA 3FAHA 2D07B 2L76A 4BZAA 1WXQA 2RGFA 4LDTD 1RM6C 3GZNI 1JWAD 4EZKA 2L00B 4JQWC 2K6DB 3PHWB 1NEKB 2M0AA 1CJEA 3DOWA 5BMIA 2NBVB 4BBNC 4DXAB 1GG3A 3OWEB 3WIMA 2KXJA 2W3RA 1SXTA 3KWVA 2KWVB 3DDCB 1WMHA 4OVVA 5IOIA 4KSKC 4DQOC 1TIFA 3NS8A 1Q0WB 4M02A 3URYA 2LMCA 2TSSA 1U4AA 4NAWB 4WIPA 3ENEA 5G55A 3U8ZA 3BY4B 2XK5B 1WXSA 3CIRB 1ZXHA 1AARA 2JSVX 3LB8C 2ZEQA 4GLSC 3Q3OC 4P1BC 1TS5A 3L0WB 5DPSA 4P7IA 1WXVA 1WGYA 1QQRA 1V49A 5BO4B 2BYEA 2I1KA 1JALA 2WXQA 5IO9A 3DWGC 1DOYA 1T0YA 1TGZB 5T8IA 3AXCA 1C3TA 1JWBD 2ACZB 3AE4B 2KDMA 2O6VA 2KKCA 3DHIC 2ASQA 1V1PB 3IBEA 1R4MI 2ZVOA 2ZNVC 4ASWC 4ZHPA 1ZP0B 4OHJA 2J7QB 1GB4A 1E6EB 1S3SG 4AUQC 4PYZA 3E9SA 2BYFA 2BKFA 4IWQA 2CR5A 1KF6B 2FNJB 2LHDA 1VD2A 2DZIA 2KN5A 2M0XA 1J7BA 2GBMA 1TS2A 1YN3A 2M56B 2KNBA 3U2SC 2J4XA 2FUG1 3PGEA 2Q5WD 1IBXB 4N6EB 4II2B 3A9JB 2G4SA 2XK5A 2D3GA 1PQSA 2VZKB 2Z0EB 1WGRA 4M0WA 4RF0A 3UQBA 1N62A 1TS4A 1PGBA 1J7AA 3X0WA 2LGYA 4LNFA 1RLFA 3FILB 3IXSA 1KLGD 3MP9A 3SHQA 4M00A 2WYQA 4HPLB 4HEA1 3N1XC 4IM3A 4LLGM 5D3IB 2LVPA 2MBQA 2KTRB 2WXFA 2K8HA 4WAAA 2L52A 2HD5B 3L10B 3ZJVA 1WRDB 2A4ZA 2MBHA 2X38A 2JF5A 4FADA 4TV3A 2DBYA 1OQRA 2BB6A 4GSWA 1RWSA 4XWWA 2B3AA 1V1OA 3NVWA 2IY1B 2K6QA 3IVFA 3PSEB 3EA6A 2KANA 1TS3A 1QOGA 3TIXA 3Q14C 2KWCA 1Q1OA 1WGDA 4WURA 1CK1A 1AW7A 3EUB2 2M4NA 1ESFA 2C7MB 2KLGA 2OJRA 1WXMA 3HK0A 2YVCA 1E8XA 1HTOA 2CHWA 5JHBA 3V60A 4PT5A 4L23A 3K9PB 1TKEA 1L4ZB 1OEYA 2AWTA 2MQJA 1FD6A 5C2TB 2JYEA 3AM9A 2C9WB 3DBRB 3HM3A 4MH0E 1OQQA 2IBIB 4BOSC 1WR1A 2WU2B 3ZJUA 2KFKB 3JSVB 2ZW0A 4K3CA 2M17A 3KVFB 2RD0A 4FA6A 3EFCA 1XCTL 3WALA 1WMHB 4W9LA 2CHZA 2ICIA 4ZRPA 1YX6B 1PUTA 3TMPB 3IG3A 4ZRKA 2V3PA 2DENB 3Q3NC 1V5TA 4ANUA 4C56C 4KDLB 4K3BA 2IDYA 3EECA 4FXCA 2Z59B 3WANA 2WDVB 4LDTB 1ZE3D 3ZJTA 4W9DA 2RDHA 3BVZA 3PPAA 2D3BA 3EHVA 2DHZA 3BK1A 1AWDA 3ZDMC 4B95A 1ISNA 4HK2A 2PE6B 1WE6A 1NI3A 1T3QA 1JWUD 4MJSB 1E8WA 5I4DA 1XT9B 2ZNVB 4JIOU 3KWLA 2JXTA 3Q3MC 3T9LA 3AN1A 5AZGA 3Q6BA 3ZNZB 3VH4B 5EE0A 4HJKA 4IWPA 1ZPSA 1WFYA 1XLQA 5E6PA 2OJWA 3ZXRA 3Q8FA 5HFYA 2JWUA 2PIAA 3ZYYX 3LYYA 2N9KA 4BFRA 3UQAA 2RPQA 3IHPC 2JRHA 4NJCA 3UIOB 3LJ3A 1ZDVA 4P16A 5CHFA 3VRBB 2QMTA 4YSYB 1WRIA 2D11A 2KQ7A 1QKZA 3T8MA 1YD8U 5DPTA 1UGMA 1MPEA 4G3XB 3N20C 2L0TA 1IYFA 2YLMA 3TJPA 3WAMA 3SR6A 3ZRCA 4ZDVA 1YOVB 1H4RA 4RF1A 3PZ8A 4MACA 2M8SA 3L16A 1YMHE 3GS2A 4US9A 5D94A 1JMLA 2BS3B 1UF0A 2VRRB 3ZNHB 4KKIA 1M4VA 1BUIC 1PDXA 3UI3A 1MVKA 1WX7A 4RCOA 1QF6A 2KJHB 4BKTA 3C8YA 4IW0A 1VR9A 2HTME 1FCCC 2JZPA 2NMQA 3B9JA 4C4VA 3U52E 2IGDA 4NQLB 3QX1A 2WU5B 4B0EA 2DNFA 1N63A 1VDVA 3PT2B 1SIJA 4WQMA 4C00A 1UH6A 2EMTA 3OG5A 1BT0A 3N1ZC 5L83A 2AYOB 3RD2A 3NHEB 4JE3B 3W5UB 2ZCBA 4B9KA 4BAXA 1F9JA 1EWCA 3W9CB 1E90A 3JSVA 3Q69A 5H92C 2SEBD 3DCGA 1AN8A 1F1HA 1JWMD 1D5ZC 2WS3B 2KX0A 5J17A 4KV2A 2WXMA 2BWFA 2WXRA 3PLVA 4XDDA 4DK5A 3NZUA 3QC8B 3RNAC 1P98A 2Y3AA 1XLPA 1WZ3A 3UF8A 5G5HA 3AEDB 4JLCA 3RNEC 1DOXA 3SEBA 3E56A 2GBRA 1T0RC 4ZRIA 1MHXA 2QJLA 5D7GA 1C1YB 2C5LC 1E7VA 2BYVE 4FJVB 4GDKA 2N1VA 1I4RA 1GC7A 3RPFC 1WJ6A 3MHSD 4KZCA 4RGNA 3IAM1 4HXDA 1L0XB 1BMLC 3H7PA 3BINA 3WCQA 3AE8B 3KQ4A 3ABVB 1XF5L 4IG7B 3TSSA 4WJOA 3KW5B 4AS1A 2WDTB 4LTUA 3RI7C 4YT0B 1TY0A 2BTEA 1TT5B 1KFYB 4QAYA 1UBQA 5BMHA 5FKAC 3GOEA 5LXHA 1I7HA 5AUIA 1K53A 3AEBB 2LGIA 2L0FA 3NY5A 4KGTA 2E3TA 1RAXA 4MGIE 4NJ6A 1WM2A 5D3DA 3DWMA 3P4RB 3RNFC 1C9FA 1STEA 3R7QA 3P2BA 2DX5B 4XGAB 2D10A 2PJHA 1V2YA 3H7SA 3MJWA 1SIFA 3RT3B 4C80A 2BF8B 3TL5A 1ET6A 1E0ZA 3ZRFA 1FO4A 4GDLA 1G6JA 1C76A 4DDID 3KLSX 1CMXB 2KVZA 4MGKE 1HXYD 4MH8A 1TZOA 1EWYC 3UGBB 3P4QB 4W9CA 2KWUB 2JQRB 1D5MC 3TEYA 3PV1A 1TY2A 4C4VB 2LZ6A 4J6IA 1FXAA 1WR6E 1MG8A 3BK2A 2GMIC 5IP4D 4OW0A 1D6EC 2J0JA 1V9JA 4WWMA 2QCZA 2QILA 2MCNB 2WDRB 2N7JA 2GBNA 3P4PB 4AJWA 2LEKA 3PTFC 4FBJB 5AEKB 4ITKA 1QOBA 3N30A 2PW9A 1YQ3B 1Y8RC 1A70A 1KM7A 2JT4B 1FCLA 1ZW7A 4HVBA 4A6QA 3OLMD 3PS6A 4YL8A 2V0GA 3PHXB 3AE5B 1WWTA 5BYSA 2ONQA 1FXIA 1OEYJ 5EE3A 4EOYA 2IO0B 1JRPA 1RRBA 3U4EG 2CJOA 4OVZA 4M8MA 1MI0A 4NJ7A 1L7YA 3HUIA 3RUIB 2DZKA 2WQYB 4M0WB 3UINB 1PGXA 3PLUA 2MRPA 1V6EA 1QT9A 3MC9A 1NYQA 2AL6A 3KYCD 4KGRA 3N3KB 4K7SA 2LVQA 3B0AA 2MP2A 2KVRA 3B2FA 4TSSA 2L1AA 3PRPB 2KLCA 4KIKB 2V1YA 3NVZA 4KX6B 2O6VB 2CU3A 1SJED 1ZGUB 1YJIA 3KUZA 1V1PA 4WWOA 2FCSA 3VUWA 2MBEA 1E7UA 1P9DU 2IGGA 1I35A 2K39A 1GNUA 1I4GA 4NNJB 3U7DA 4UDUC 2RDGA 3NG0A 2G1EA 3DPDA 4HCNB 1KTKA 2IZVB 3RULA 3MFGA 3AB5A 4MSMB 1Q5WB 3MC0B 3FC4A 2R61A 1JQ4A 3IT4B 4REZA 3DVGY 2BPSA 3NRZA 2MBBB 1ET9A 1F52A 5AUKA 1PFDA 5CHWA 3TEXA 3AI5A 1V5OA 3LDZE 1I4HA 1L2NA 3H1UA 4MELA 3VFKA 4EZLA 1IBXA 2W55A 3QWZB 2KAJA 2J53A 1ZUD2 2DWQA 3BVMA 4WWNA 2LHEA 3I5JC 4IC7B 2NTTA 3P63A 1CZPA 4RGMA 3H7PB 3TEZA 3NVYA 2IO3B 4NQKE 3ZO5B 2K8CA 4OZAA 1QOAA 4WJNA 4ZRJA 4YTPB 1FIQA 4HPMB 1WGHA 3R2TA 1FFVA 4WQOB 3QARA 1Y56A 2NS5A 3GE3C 1HQRD 4K7WA 2FUHB 5AZFA 2PEAA 1EF5A 3VRAB 2HDEA 4GMVA 1H8CA 3VTVA 2JRIB 4XZ4A 4PS7A 3M63B 2KMAA 2XN9C 1TZ1A 4IUMB 2LD9A 4KGSA 1IP9A 5DCNA 2KK8A 2UWQA 2KT7A 1DGJA 3V6EB 3V05A 3Q3FA 4ARIA 2L3ZA 3Q2AC 2LJIA 2L83A 5BYRA 1LO5D 3ZTDA 1GJZA 4WAFA 3V62A 3H6NA 4S17A 3GB1A 2E6XA 3Q8AA 5L95C 3CSTA 1TJEA 1SE2A 1WJ4A 3KH0A 3MTNB 2K0PA 1KRHA 1SF0A 3BZDB 1A5RA 1L0YB 1LFDA 2LXAA 4J3OD 2DZJA 3SFDB 3P1MA 2Y5CA 3QIJA 4ZYSA 1N5XA 5C23A 4TUUA 3AE9B 1WE7A 1FMAD 2WXHA 3N9YC 2AQ1B 5D6JB 2KTRA 5G5GA 3DVGX 3DBLI 4E3CA 2CHXA 3QJZA 4AJYB 4GN1A 5JZEB 2OOBB 3ZNID 3ONSA 1VLBA 2JUOA 3VR9B 1YX5B 2WXOA 3RCZA 1WSPA 1TKYA 2KQSA 4A55A 3B1LX 3AE2B 2EMSA 1V8CA 3AEFB 3VH3B 2N4FA 2RSUA 2W9NA 1LXDA 2MH7A 4HROA 4A9AA 3BVGA 2JY6A 4TQ0A 1ZKHA 2L32A 1IGDA 2LUEA 3DHHC 4LK0M 3AE6B 2RMMA 4ICUA 2NVUI 2Y5PA 1GPXA 4S0RA 3VUYA 2LVOA 4FLHA 5IA7A 1MJDA 2WX0A 3BWUD 1RYJA 2LGXA 4RNAA 4GDKB 2KMCA 3VUXA 4IKGA 1IGCA 3I3TB 3QCAA 5HG2A 1HTQA 2LRWA 5CTRC 3DVNU 2RPVA 2V4LA 3HIZA 1JCKB 2XEWA 3SU8X 1FRRA 2FAZA 2LWPA 2AEHA 1EU4A 1QLBB 1OQYA 2K1FA 2AX5A 1K52A 2ZPYA 3DQVA 2G3QB 2IO1B 2NTSA 2LFIA 4MM3A 3Q3JA 3Q8BA 3K9OB 2EKEC 2PE9A 3MHZA 2INDC 2N1WA 3VTUA 4WJPA 1GOZA 4EFOA 1J0GA 2LXCA 2AQ3B 1D5XC 1HZ5A 4CHKA 2EELA 3M3JA 5IKCM 2IPKD 1R4NI 2FCQA 2QIEB 4USAA 3C19A 1K51A 4L1BA 1F77A 4DHZB 2Y5BB 4XWTA 2WXNA 3VVWB 1L6VA 2I2YA 4ZOHC 2QSDA 1KH0A 3CWIA 3SFEB 2KHWB 5FR3A 3CMMB 2JWZA 4ICVA 4KSLC 2N9PC 3EFUA 3AE7B 4PYUA 2KACA 2KDBA 2CJNA 2HJ1A 3RYTA 1HA5A 2R2OA 1KJTA 3DBRI 5D2MB 3DBSA 3RMKC 3VQIA 4ZHOA 2ON8A 2BGFA 4OZBA 4EEWA 2CU1A 1VCBA 2J42A 2LI5A 2N9EB 2KD0A 3ZKJC 2WWZA 4ANWA 2H88B 4B6WA 4I6LB 2XNAC 2NBWB 4BVUC 4BOZB 2C7HA 1E8YA 4KVGB 1EO6A 4YWGG 3B2GA 3R66C 3L4PA 2HE7A 3GZNB 1QOFA 1XQQA 3NS1A 4M01A 3A1QB 1LM8B 4KDIC 1XD3B 3ML8A 2BS2B 1VJKA 3KUDB 4LJOB 2QHOA 3U7ZA 2V9HA 1J7CA 3ZW3A 2JZ3B 4N9F4 3A9KB 2MJEA 2KJ6A 2GLSA 1OFFA 1JROA 2INNE 5HI1A 4JWSC 3SD5A 3KUCB 2WXJA 2BW2A 2KYWA 2WXPA 2BB5A 1E5WA 2RR9A 4W9FA 2JPHA 3ZGZA 5JXVA 1VZ6A 1I4PA 3W1SA 4L2YA 4JL9A 2D3CA 3VTWA 2W3SA 4CO7A 1NENB 1J8CA 2IGHA 1L5PA 4FULA 4HKZE 3PO0A 1XO3A 3NOBA 4LNOA 1WX8A 2NR2A 4YSXB 1YN5A 2BVCA 2DYMA 4GB9A 3V3XA 3R7RA 1NDDA 3TCAA 2M1MA 3AEAB 4HKQA 2FIFA 1WI0A 2BQQA 3T3OA 2DLBA 4C7ZA 1MFWA 1R7SA 1C77A 4N59A 4A3OA 4K1RB 1R4MB 2FIDA 2R2QA 3NUHB 1XCQL 3R2IA 1OTRB 2NPTA 2GI9A 2I38A 3AE3B 3M62B 3W2DA 2K8BA 2C7NB 1PGAA 4B0MA 4HCPB 2WLBA 1X1MA 3A1QA 1L4DB 3DBHI 2ZPNA 1D4BA 2O6VD 4YTNB 4KKJA 2DAJA 1P0RA 4RMAA 3ZQ4A 1JWSD 1PYWD 2MSED 2J0KA 4PS3A 1QZEA 2WDQB 1T0SC 3AH7A 5J18A 3TEWA 1WY8A 1BXTA 2MHJA 5J2RA 5C1ZA 4G50A 1WF9A 5LLIA 4DXGA 1UNSA 1GC6A 1FNUA 1DOIA 2OHFA 4LNNA 1P7EA 1NI2A 3O65B 2O2VA 2GB1A 1WGGA 1IUEA 4I6NB 1C4PA 1C79A 3OJ3A 4A8XC 2HJ8A 1AYFA 2K5PA 2WNMA 5CX3A 1ZDXA 2KQ4X 4KIKA 2G4DB 4I6PA 1S1QB 3KYDD 3RZWC 2KOXA 1YN4A 3ML9A 3NZSA 3M95A 1WIAA 2O2VB 2KFKA 2L8JA 2FCMA 4N58A 2FCNA 4IM0A 5JHAA 2V3NA 4DXFA 2A5UA 4W9KA 3QA8A 5IAAC 2VZKD 3W1YA 4ZRQA 2YEPF 3VDZA 1VRAB 5MPOA 3W1SC 2WX1A 1SJHD 2OEDA 3P42A 1HEZE 3AMZA 5E6NA 2KWDA 3AV8A 4EKUA 4W9GA 3BYYB 4DHJB 2SAKA 4AQ7A 2BYTA 1FM0D 3NVVA 3HM6X 2INCC 1E8ZA 4ANVA 1RFKA 1SBBB 3EC8A 4AP4C 2GBKA 3PRMB 2M19A 2PVOD 5TR5A 1GAQB 4LNKA 4BKSD 3V6CB 4XDCA 4E74A 3WAPA 2MLBA 1F2RI 3UIPB 4WWPA 1WX9A 4RM8A 1FNVA 4FHJA 3A9JA 1YQBA 1WYGA 4D2KA 2WGSA 3HVZA 1WM3A 2IO2B 1WGKA 2G45B 3APCA 1SB3C 2LASA 2NPTB 3AECB 4MT5A 1UWXA 3JVZX 3N1YC 3AEGB 2K9XA 4TMAB 3ZUNA 3I57A 5FR6A 3X23A 5EE1A 1T5XD 2K22A 3H9DA 3EGRA 1FNWA 3RFZB 3L17A 5IN7A 1V81A 4YXDB
chains in the Genus database with same CATH topology
3PREA 2KX0A 4GXBA 5J17A 2LUEA 4KV2A 2DYBA 4FJYA 1D3ZA 2BWFA 4HDQA 3PLVA 4ICUA 3WAOA 2NVUI 4DK5A 3ZIMA 3NZUA 3QC8B 4CYEA 3VUYA 2LVOA 2D07B 4FLHA 5IA7A 2WX0A 2L76A 1P98A 2LGXA 3QK0A 2RGFA 4LDTD 3S2AA 4GDKB 2KMCA 3VUXA 1WZ3A 3GZNI 3UF8A 3I3TB 3QCAA 4EZKA 2L00B 4JLCA 4JQWC 2LRWA 2K6DB 3A4SC 3PHWB 3PZDA 4TQ1A 3DVNU 5CTRC 4TKNA 2V4LA 3HHMA 5KHOA 3DOWA 3HIZA 5CHVC 2GBRA 4AOFA 4NAWA 2NBVB 2XEWA 4BBNC 2NBUA 4URKA 4DXAB 1GG3A 1YJ1A 4ZRIA 3SU8X 2FAZA 3WIMA 2LWPA 2L7RA 5EDSA 2KXJA 5D7GA 2AEHA 1C1YB 2C5LC 1E7VA 1EUVB 2N7DA 1UZXB 2BYVE 2KWVB 3DDCB 4FJVB 1WMHA 2N1VA 1GC7A 4GDKA 1OQYA 4OVVA 5LXIB 1WJ6A 1WXAA 3MHSD 2K1FA 4KZCA 4KSKC 2ZPYA 3DQVA 3ECIA 4HXDA 2G3QB 3H7PA 2IO1B 3NS8A 1Q0WB 2JZZA 3BINA 1WH3A 4MM3A 1U4AA 4NAWB 2KX3A 3ENEA 3Q3JA 2K25A 3K9OB 3APFA 2EKEC 5G55A 3U8ZA 2MX2A 1K8RB 4IG7B 4WJOA 3BY4B 3KW5B 2XK5B 2KO3A 2PE9A 2N1WA 1WXSA 2WDTB 3A4RA 1UELA 2LRUA 4WJPA 3VTUA 4EFOA 3AULA 1J0GA 3OJ4B 1UBQA 2LXCA 4IWOA 2KDEB 1AARA 2ZEQA 3GOEA 4CHKA 5LXHA 5HKHA 3M3JA 3B08A 1SGHA 3L0WB 5DPSA 3ZTCA 4P7IA 1WXVA 1WGYA 2BWES 1R4NI 1V49A 2L0FA 3NY5A 5BO4B 2FCQA 2BYEA 1RAXA 2CS4A 4MGIE 2I1KA 2C60A 4NJ6A 1WM2A 3N32A 2IY0B 3R7QA 3P2BA 2DX5B 4EUTA 2D10A 2PJHA 4DHZB 1V2YA 3H7SA 1T0YA 1SIFA 1TGZB 2Y5BB 3MJWA 3RT3B 4OVUA 2BF8B 1Z2MA 3AXCA 3TL5A 3VVWB 1C3TA 4HDOA 3ZRFA 3AU4A 2KJRA 4W9JA 2KHWB 4GDLA 3CMMB 3TBLD 2JWZA 1G6JA 4LCDE 4ICVA 4DDID 4KSLC 2KZRA 2N9PC 1CMXB 2O6VA 4MGKE 2KKCA 3EFUA 2ASQA 4PYUA 4GIVA 3IBEA 3UGBB 2KDBA 4W9CA 1TBEA 1R4MI 2GBJA 3RYTA 2KWUB 2R2OA 2ZNVC 2ZVOA 4ASWC 1KJTA 3DBRI 4FHKA 3ZVVA 1SE9A 5D2MB 2J7QB 1KLVA 3DBSA 3PV1A 1S3SG 4AUQC 3VQIA 4MGYE 4PYZA 2LZ6A 2BGFA 4J6IA 1JRUA 1WR6E 1MG8A 2DAFA 4GDLB 1LQBA 4HLEA 1Z5SB 2GMIC 4EEWA 2CU1A 1VCBA 4G0NB 4GOCA 2BYFA 2LI5A 2BKFA 2N9EB 2J0JA 2KD0A 3ZKJC 1V9JA 2WWZA 1WYWB 2MCNB 2D2QA 2MP2B 4IWQA 4ANWA 4B6WA 2CR5A 4KZ0A 2FNJB 4I6LB 4ANXA 1VD2A 2GBNA 3APDA 2DZIA 4AJWA 2KN5A 3PTFC 4FBJB 5AEKB 4DDGD 2NBWB 2M0XA 3ZLZA 3CF6E 4BVUC 2GBMA 4BOZB 2C7HA 3N30A 1E8YA 1Y8RC 1KM7A 2LJ5A 4KVGB 2JT4B 1WZ0A 1EO6A 2KNBA 1ZW7A 1UD7A 2DYOA 4HVBA 1WJNA 3PGEA 3R66C 3OLMD 3PS6A 4YL8A 2HE7A 3PHXB 4II2B 3A9JB 2G4SA 2XK5A 2D3GA 2UYZB 5GMVA 1NBFC 1XQQA 4BKSA 1PQSA 2NCNA 2Z0EB 1OEYJ 1WGRA 3A1QB 1LM8B 4XX5A 3U30A 4KDIC 4EOYA 1XD3B 2IO0B 3UQBA 2MBOA 3ML8A 1RRBA 3KUDB 1FXTB 4LJOB 3X0WA 4F1SA 2QHOA 4XC2A 2LGYA 2MA9B 3QAQA 4M8MA 3ZW3A 4NJ7A 2JVCA 1L7YA 1RLFA 2JZ3B 2CKHB 3RUIB 2DZKA 4N9F4 4M0WB 3A9KB 3UINB 3SHQA 3PLUA 2MRPA 2KJ6A 1V6EA 4GGQA 2WYQA 4HPLB 4IM3A 4HWIB 1KOTA 5AZHA 3SD5A 2AL6A 3KYCD 3KUCB 3N3KB 4K7SA 2I1JA 2LVQA 2LVPA 2AL3A 3B0AA 2MP2A 2MBQA 2KTRB 2KVRA 2K8HA 4DWFA 4WAAA 2Z0DB 3PRPB 1E5WA 2HD5B 2RR9A 2JPHA 3L10B 4W9FA 2KLCA 1UBIA 1WRDB 4KIKB 2A4ZA 2MBHA 3W1SA 2V1YA 2ZJDA 4JL9A 4CO7A 3VTWA 2JF5A 3ZDTA 4TV3A 4FADA 4DBGA 1J8CA 3R3MA 4GSWA 2O6VB 4FULA 2B3AA 1ZGUB 3KUZA 2IY1B 2K6QA 3IVFA 4WWOA 2FCSA 3NOBA 2MWSB 3PSEB 3VUWA 5DPWA 1WX8A 2KANA 2KFJA 2MBEA 1E7UA 1V86A 1P9DU 2NR2A 4WJQA 3TIXA 1I35A 2KWCA 2K39A 1GNUA 1Q1OA 4AWJA 4NNJB 2DYMA 3U7DA 4GB9A 1WGDA 3R7RA 1NDDA 3TCAA 3OAWA 2M4NA 2M1MA 3DPDA 2C7MB 2DZMA 2KLGA 2FIFA 2OJRA 4HCNB 1WXMA 2IZVB 1WI0A 3HK0A 2YVCA 1E8XA 3RULA 2CHWA 1TTNA 3CSFA 3V60A 5JHBA 4MSMB 4K1RB 1Q5WB 4A3OA 4DHJD 3VAWA 3K9PB 2FIDA 5JH5C 1P1AA 3A9KA 2R2QA 3DVGY 2BPSA 1OEYA 1OTRB 2AWTA 2MQJA 2NPTA 3ALBA 3AU5A 2MBBB 5CHWA 3AI5A 2C9WB 3M62B 2REXA 2K8BA 3HM3A 4F7ZA 4MH0E 1V5OA 2C7NB 2IBIB 4BOSC 3LDZE 1L2NA 1WR1A 3QHTA 3V61A 2KFKB 3H1UA 4HCPB 4MELA 3VFKA 4EZLA 4MDKE 1X1MA 3A1QA 3JSVB 4K7UA 4ZYNA 3DBHI 2ZPNA 4NPNA 2M17A 2O6VD 3KVFB 2RD0A 4FA6A 1YIWA 1P0RA 2DAJA 3QWZB 4RMAA 3RZFA 1V80A 3WALA 3L13A 4WWNA 2MSED 1WMHB 4W9LA 2CHZA 2J0KA 1IPGA 4PS3A 1QZEA 5G2NA 4IC7B 1YX6B 5J18A 3H7PB 1WY8A 3JW0X 3TMPB 2IO3B 3IG3A 4NQKE 4ZRKA 3ZO5B 5J2RA 2K8CA 2DENB 5C1ZA 2KC2A 1V5TA 4WJNA 4ZRJA 4ANUA 4KDLB 5E6OA 4G50A 1WF9A 5LLIA 4HPMB 3EECA 1WGHA 2V3SA 1GC6A 2Z59B 4WQOB 3WANA 4LDTB 3VHTC 3QARA 2IYDB 4DHZE 2NS5A 3DVNV 4W9DA 1I42A 4EZJA 4K7WA 2FUHB 3PPAA 5AZFA 2PEAA 1NI2A 1RFAA 1EF5A 3O65B 2O2VA 3EHVA 1WGGA 4I6NB 2DHZA 3ZDMC 4MEMA 4B95A 2JXXA 4GMVA 3OJ3A 2HJ8A 1ISNA 4HK2A 2PE6B 4F8CB 1WE6A 5CX3A 1H8CA 4MJSB 1E8WA 1XT9B 4KIKA 3VTVA 2ZNVB 4JIOU 2JRIB 2G4DB 4I6PA 1S1QB 3KYDD 4PS7A 3M63B 4XZ4A 3RZWC 2KMAA 2KOXA 1TZ1A 3ML9A 4IUMB 3NZSA 3M95A 5L83A 1WIAA 2LD9A 2O2VB 2KFKA 3T9LA 2L8JA 1HE8A 2FCMA 4NY0A 5AZGA 3D32A 1IP9A 2HTHA 2FCNA 2KK8A 5DCNA 4IM0A 2UWQA 3ZNGC 5JHAA 3QQ8B 2A5UA 4W9KA 4W9IA 3V6EB 3VH4B 3QA8A 3ZNZB 4HJKA 3Q3FA 2KC1A 4IWPA 1WFYA 5IAAC 2XBBC 2ZVNA 3W1YA 5E6PA 3WA0A 4MJSA 4BKGA 1P3QU 4M8NA 4FJZA 2KTFA 3VDZA 2L3ZA 4W9HA 4BBNF 4BFRA 3W1SC 2RPQA 3UQAA 2WX1A 3IHPC 2JRHA 3L54A 5E6NA 3UIOB 3VXWA 3LJ3A 1J19A 5CHFA 3JYUA 4G11A 2J0MA 1OGWA 4EKUA 3C0RB 2D11A 3ZTDA 2KQ7A 4W9GA 4FN2A 1GJZA 3T8MA 1YD8U 3H6NA 4MGZE 3V62A 5DPTA 4DHJB 1UGMA 5L95C 4G3XB 4II3B 3CSTA 4IM2A 2L0TA 1IYFA 2YLMA 3TJPA 1WJUA 4GU2A 3WAMA 1WJ4A 5DPRA 3ZRCA 4ZDVA 1H4RA 3KH0A 4X57B 3HM6X 3A33B 2M8SA 1E8ZA 3L16A 3MTNB 4ANVA 3EC8A 4AP4C 1A5RA 2GBKA 5D94A 3PRMB 2BKRB 4LJPB 1LFDA 2LXAA 2L05A 2VRRB 3PRZA 2DZJA 1M94A 2KDIA 1GUAB 5TR5A 3ZNHB 3QIJA 3IFWB 4BKSD 3V6CB 4E74A 5C23A 4TUUA 3WAPA 2MLBA 2N9XA 1WE7A 3UIPB 1WX7A 4WWPA 2KJHB 1WX9A 4JGHB 4BKTA 4RM8A 4A20A 5D6JB 4IW0A 4FHJA 3A9JA 1YQBA 2KTRA 3DVGX 5KHQA 3DBLI 4E3CA 2CHXA 3QJZA 4AJYB 1WM3A 4GN1A 2IO2B 2OOBB 2G45B 3ONSA 3ZNID 5JZEB 3APCA 2LASA 4NQLB 2NPTB 2JUOA 3QX1A 1YX5B 3RCZA 2KQSA 3PVLA 3L08A 3B1LX 3JVZX 2PPHA 3PT2B 2MW5A 4MSQB 1UH6A 2EMTA 2EMSA 3VH3B 1BT0A 2LGDA 4PS8A 2N4FA 2AYOB 4K81A 3NHEB 2RSUA 3RD2A 3ZUNA 4E71A 4RM9A 2ZCBA 4B9KA 1F9JA 5FR6A 3X23A 2W9NA 3SDLC 1LXDA 2N7EA 1E90A 2ZCCA 2ZZPB 3JSVA 3H9DA 4W9EA 2JY6A 4A3PA 2KDFB 3L17A 1EF1A 4TQ0A 1V81A 1ZKHA 2GOWA 3DCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRE A;  2KX0 A;  4GXB A;  5J17 A;  2LUE A;  4KV2 A;  2DYB A;  4FJY A;  1D3Z A;  2BWF A;  4HDQ A;  3PLV A;  4ICU A;  3WAO A;  2NVU I;  4DK5 A;  3ZIM A;  3NZU A;  3QC8 B;  4CYE A;  3VUY A;  2LVO A;  2D07 B;  4FLH A;  5IA7 A;  2WX0 A;  2L76 A;  1P98 A;  2LGX A;  3QK0 A;  2RGF A;  4LDT D;  3S2A A;  4GDK B;  2KMC A;  3VUX A;  1WZ3 A;  3GZN I;  3UF8 A;  3I3T B;  3QCA A;  4EZK A;  2L00 B;  4JLC A;  4JQW C;  2LRW A;  2K6D B;  3A4S C;  3PHW B;  3PZD A;  4TQ1 A;  3DVN U;  5CTR C;  4TKN A;  2V4L A;  3HHM A;  5KHO A;  3DOW A;  3HIZ A;  5CHV C;  2GBR A;  4AOF A;  4NAW A;  2NBV B;  2XEW A;  4BBN C;  2NBU A;  4URK A;  4DXA B;  1GG3 A;  1YJ1 A;  4ZRI A;  3SU8 X;  2FAZ A;  3WIM A;  2LWP A;  2L7R A;  5EDS A;  2KXJ A;  5D7G A;  2AEH A;  1C1Y B;  2C5L C;  1E7V A;  1EUV B;  2N7D A;  1UZX B;  2BYV E;  2KWV B;  3DDC B;  4FJV B;  1WMH A;  2N1V A;  1GC7 A;  4GDK A;  1OQY A;  4OVV A;  5LXI B;  1WJ6 A;  1WXA A;  3MHS D;  2K1F A;  4KZC A;  4KSK C;  2ZPY A;  3DQV A;  3ECI A;  4HXD A;  2G3Q B;  3H7P A;  2IO1 B;  3NS8 A;  1Q0W B;  2JZZ A;  3BIN A;  1WH3 A;  4MM3 A;  1U4A A;  4NAW B;  2KX3 A;  3ENE A;  3Q3J A;  2K25 A;  3K9O B;  3APF A;  2EKE C;  5G55 A;  3U8Z A;  2MX2 A;  1K8R B;  4IG7 B;  4WJO A;  3BY4 B;  3KW5 B;  2XK5 B;  2KO3 A;  2PE9 A;  2N1W A;  1WXS A;  2WDT B;  3A4R A;  1UEL A;  2LRU A;  4WJP A;  3VTU A;  4EFO A;  3AUL A;  1J0G A;  3OJ4 B;  1UBQ A;  2LXC A;  4IWO A;  2KDE B;  1AAR A;  2ZEQ A;  3GOE A;  4CHK A;  5LXH A;  5HKH A;  3M3J A;  3B08 A;  1SGH A;  3L0W B;  5DPS A;  3ZTC A;  4P7I A;  1WXV A;  1WGY A;  2BWE S;  1R4N I;  1V49 A;  2L0F A;  3NY5 A;  5BO4 B;  2FCQ A;  2BYE A;  1RAX A;  2CS4 A;  4MGI E;  2I1K A;  2C60 A;  4NJ6 A;  1WM2 A;  3N32 A;  2IY0 B;  3R7Q A;  3P2B A;  2DX5 B;  4EUT A;  2D10 A;  2PJH A;  4DHZ B;  1V2Y A;  3H7S A;  1T0Y A;  1SIF A;  1TGZ B;  2Y5B B;  3MJW A;  3RT3 B;  4OVU A;  2BF8 B;  1Z2M A;  3AXC A;  3TL5 A;  3VVW B;  1C3T A;  4HDO A;  3ZRF A;  3AU4 A;  2KJR A;  4W9J A;  2KHW B;  4GDL A;  3CMM B;  3TBL D;  2JWZ A;  1G6J A;  4LCD E;  4ICV A;  4DDI D;  4KSL C;  2KZR A;  2N9P C;  1CMX B;  2O6V A;  4MGK E;  2KKC A;  3EFU A;  2ASQ A;  4PYU A;  4GIV A;  3IBE A;  3UGB B;  2KDB A;  4W9C A;  1TBE A;  1R4M I;  2GBJ A;  3RYT A;  2KWU B;  2R2O A;  2ZNV C;  2ZVO A;  4ASW C;  1KJT A;  3DBR I;  4FHK A;  3ZVV A;  1SE9 A;  5D2M B;  2J7Q B;  1KLV A;  3DBS A;  3PV1 A;  1S3S G;  4AUQ C;  3VQI A;  4MGY E;  4PYZ A;  2LZ6 A;  2BGF A;  4J6I A;  1JRU A;  1WR6 E;  1MG8 A;  2DAF A;  4GDL B;  1LQB A;  4HLE A;  1Z5S B;  2GMI C;  4EEW A;  2CU1 A;  1VCB A;  4G0N B;  4GOC A;  2BYF A;  2LI5 A;  2BKF A;  2N9E B;  2J0J A;  2KD0 A;  3ZKJ C;  1V9J A;  2WWZ A;  1WYW B;  2MCN B;  2D2Q A;  2MP2 B;  4IWQ A;  4ANW A;  4B6W A;  2CR5 A;  4KZ0 A;  2FNJ B;  4I6L B;  4ANX A;  1VD2 A;  2GBN A;  3APD A;  2DZI A;  4AJW A;  2KN5 A;  3PTF C;  4FBJ B;  5AEK B;  4DDG D;  2NBW B;  2M0X A;  3ZLZ A;  3CF6 E;  4BVU C;  2GBM A;  4BOZ B;  2C7H A;  3N30 A;  1E8Y A;  1Y8R C;  1KM7 A;  2LJ5 A;  4KVG B;  2JT4 B;  1WZ0 A;  1EO6 A;  2KNB A;  1ZW7 A;  1UD7 A;  2DYO A;  4HVB A;  1WJN A;  3PGE A;  3R66 C;  3OLM D;  3PS6 A;  4YL8 A;  2HE7 A;  3PHX B;  4II2 B;  3A9J B;  2G4S A;  2XK5 A;  2D3G A;  2UYZ B;  5GMV A;  1NBF C;  1XQQ A;  4BKS A;  1PQS A;  2NCN A;  2Z0E B;  1OEY J;  1WGR A;  3A1Q B;  1LM8 B;  4XX5 A;  3U30 A;  4KDI C;  4EOY A;  1XD3 B;  2IO0 B;  3UQB A;  2MBO A;  3ML8 A;  1RRB A;  3KUD B;  1FXT B;  4LJO B;  3X0W A;  4F1S A;  2QHO A;  4XC2 A;  2LGY A;  2MA9 B;  3QAQ A;  4M8M A;  3ZW3 A;  4NJ7 A;  2JVC A;  1L7Y A;  1RLF A;  2JZ3 B;  2CKH B;  3RUI B;  2DZK A;  4N9F 4;  4M0W B;  3A9K B;  3UIN B;  3SHQ A;  3PLU A;  2MRP A;  2KJ6 A;  1V6E A;  4GGQ A;  2WYQ A;  4HPL B;  4IM3 A;  4HWI B;  1KOT A;  5AZH A;  3SD5 A;  2AL6 A;  3KYC D;  3KUC B;  3N3K B;  4K7S A;  2I1J A;  2LVQ A;  2LVP A;  2AL3 A;  3B0A A;  2MP2 A;  2MBQ A;  2KTR B;  2KVR A;  2K8H A;  4DWF A;  4WAA A;  2Z0D B;  3PRP B;  1E5W A;  2HD5 B;  2RR9 A;  2JPH A;  3L10 B;  4W9F A;  2KLC A;  1UBI A;  1WRD B;  4KIK B;  2A4Z A;  2MBH A;  3W1S A;  2V1Y A;  2ZJD A;  4JL9 A;  4CO7 A;  3VTW A;  2JF5 A;  3ZDT A;  4TV3 A;  4FAD A;  4DBG A;  1J8C A;  3R3M A;  4GSW A;  2O6V B;  4FUL A;  2B3A A;  1ZGU B;  3KUZ A;  2IY1 B;  2K6Q A;  3IVF A;  4WWO A;  2FCS A;  3NOB A;  2MWS B;  3PSE B;  3VUW A;  5DPW A;  1WX8 A;  2KAN A;  2KFJ A;  2MBE A;  1E7U A;  1V86 A;  1P9D U;  2NR2 A;  4WJQ A;  3TIX A;  1I35 A;  2KWC A;  2K39 A;  1GNU A;  1Q1O A;  4AWJ A;  4NNJ B;  2DYM A;  3U7D A;  4GB9 A;  1WGD A;  3R7R A;  1NDD A;  3TCA A;  3OAW A;  2M4N A;  2M1M A;  3DPD A;  2C7M B;  2DZM A;  2KLG A;  2FIF A;  2OJR A;  4HCN B;  1WXM A;  2IZV B;  1WI0 A;  3HK0 A;  2YVC A;  1E8X A;  3RUL A;  2CHW A;  1TTN A;  3CSF A;  3V60 A;  5JHB A;  4MSM B;  4K1R B;  1Q5W B;  4A3O A;  4DHJ D;  3VAW A;  3K9P B;  2FID A;  5JH5 C;  1P1A A;  3A9K A;  2R2Q A;  3DVG Y;  2BPS A;  1OEY A;  1OTR B;  2AWT A;  2MQJ A;  2NPT A;  3ALB A;  3AU5 A;  2MBB B;  5CHW A;  3AI5 A;  2C9W B;  3M62 B;  2REX A;  2K8B A;  3HM3 A;  4F7Z A;  4MH0 E;  1V5O A;  2C7N B;  2IBI B;  4BOS C;  3LDZ E;  1L2N A;  1WR1 A;  3QHT A;  3V61 A;  2KFK B;  3H1U A;  4HCP B;  4MEL A;  3VFK A;  4EZL A;  4MDK E;  1X1M A;  3A1Q A;  3JSV B;  4K7U A;  4ZYN A;  3DBH I;  2ZPN A;  4NPN A;  2M17 A;  2O6V D;  3KVF B;  2RD0 A;  4FA6 A;  1YIW A;  1P0R A;  2DAJ A;  3QWZ B;  4RMA A;  3RZF A;  1V80 A;  3WAL A;  3L13 A;  4WWN A;  2MSE D;  1WMH B;  4W9L A;  2CHZ A;  2J0K A;  1IPG A;  4PS3 A;  1QZE A;  5G2N A;  4IC7 B;  1YX6 B;  5J18 A;  3H7P B;  1WY8 A;  3JW0 X;  3TMP B;  2IO3 B;  3IG3 A;  4NQK E;  4ZRK A;  3ZO5 B;  5J2R A;  2K8C A;  2DEN B;  5C1Z A;  2KC2 A;  1V5T A;  4WJN A;  4ZRJ A;  4ANU A;  4KDL B;  5E6O A;  4G50 A;  1WF9 A;  5LLI A;  4HPM B;  3EEC A;  1WGH A;  2V3S A;  1GC6 A;  2Z59 B;  4WQO B;  3WAN A;  4LDT B;  3VHT C;  3QAR A;  2IYD B;  4DHZ E;  2NS5 A;  3DVN V;  4W9D A;  1I42 A;  4EZJ A;  4K7W A;  2FUH B;  3PPA A;  5AZF A;  2PEA A;  1NI2 A;  1RFA A;  1EF5 A;  3O65 B;  2O2V A;  3EHV A;  1WGG A;  4I6N B;  2DHZ A;  3ZDM C;  4MEM A;  4B95 A;  2JXX A;  4GMV A;  3OJ3 A;  2HJ8 A;  1ISN A;  4HK2 A;  2PE6 B;  4F8C B;  1WE6 A;  5CX3 A;  1H8C A;  4MJS B;  1E8W A;  1XT9 B;  4KIK A;  3VTV A;  2ZNV B;  4JIO U;  2JRI B;  2G4D B;  4I6P A;  1S1Q B;  3KYD D;  4PS7 A;  3M63 B;  4XZ4 A;  3RZW C;  2KMA A;  2KOX A;  1TZ1 A;  3ML9 A;  4IUM B;  3NZS A;  3M95 A;  5L83 A;  1WIA A;  2LD9 A;  2O2V B;  2KFK A;  3T9L A;  2L8J A;  1HE8 A;  2FCM A;  4NY0 A;  5AZG A;  3D32 A;  1IP9 A;  2HTH A;  2FCN A;  2KK8 A;  5DCN A;  4IM0 A;  2UWQ A;  3ZNG C;  5JHA A;  3QQ8 B;  2A5U A;  4W9K A;  4W9I A;  3V6E B;  3VH4 B;  3QA8 A;  3ZNZ B;  4HJK A;  3Q3F A;  2KC1 A;  4IWP A;  1WFY A;  5IAA C;  2XBB C;  2ZVN A;  3W1Y A;  5E6P A;  3WA0 A;  4MJS A;  4BKG A;  1P3Q U;  4M8N A;  4FJZ A;  2KTF A;  3VDZ A;  2L3Z A;  4W9H A;  4BBN F;  4BFR A;  3W1S C;  2RPQ A;  3UQA A;  2WX1 A;  3IHP C;  2JRH A;  3L54 A;  5E6N A;  3UIO B;  3VXW A;  3LJ3 A;  1J19 A;  5CHF A;  3JYU A;  4G11 A;  2J0M A;  1OGW A;  4EKU A;  3C0R B;  2D11 A;  3ZTD A;  2KQ7 A;  4W9G A;  4FN2 A;  1GJZ A;  3T8M A;  1YD8 U;  3H6N A;  4MGZ E;  3V62 A;  5DPT A;  4DHJ B;  1UGM A;  5L95 C;  4G3X B;  4II3 B;  3CST A;  4IM2 A;  2L0T A;  1IYF A;  2YLM A;  3TJP A;  1WJU A;  4GU2 A;  3WAM A;  1WJ4 A;  5DPR A;  3ZRC A;  4ZDV A;  1H4R A;  3KH0 A;  4X57 B;  3HM6 X;  3A33 B;  2M8S A;  1E8Z A;  3L16 A;  3MTN B;  4ANV A;  3EC8 A;  4AP4 C;  1A5R A;  2GBK A;  5D94 A;  3PRM B;  2BKR B;  4LJP B;  1LFD A;  2LXA A;  2L05 A;  2VRR B;  3PRZ A;  2DZJ A;  1M94 A;  2KDI A;  1GUA B;  5TR5 A;  3ZNH B;  3QIJ A;  3IFW B;  4BKS D;  3V6C B;  4E74 A;  5C23 A;  4TUU A;  3WAP A;  2MLB A;  2N9X A;  1WE7 A;  3UIP B;  1WX7 A;  4WWP A;  2KJH B;  1WX9 A;  4JGH B;  4BKT A;  4RM8 A;  4A20 A;  5D6J B;  4IW0 A;  4FHJ A;  3A9J A;  1YQB A;  2KTR A;  3DVG X;  5KHQ A;  3DBL I;  4E3C A;  2CHX A;  3QJZ A;  4AJY B;  1WM3 A;  4GN1 A;  2IO2 B;  2OOB B;  2G45 B;  3ONS A;  3ZNI D;  5JZE B;  3APC A;  2LAS A;  4NQL B;  2NPT B;  2JUO A;  3QX1 A;  1YX5 B;  3RCZ A;  2KQS A;  3PVL A;  3L08 A;  3B1L X;  3JVZ X;  2PPH A;  3PT2 B;  2MW5 A;  4MSQ B;  1UH6 A;  2EMT A;  2EMS A;  3VH3 B;  1BT0 A;  2LGD A;  4PS8 A;  2N4F A;  2AYO B;  4K81 A;  3NHE B;  2RSU A;  3RD2 A;  3ZUN A;  4E71 A;  4RM9 A;  2ZCB A;  4B9K A;  1F9J A;  5FR6 A;  3X23 A;  2W9N A;  3SDL C;  1LXD A;  2N7E A;  1E90 A;  2ZCC A;  2ZZP B;  3JSV A;  3H9D A;  4W9E A;  2JY6 A;  4A3P A;  2KDF B;  3L17 A;  1EF1 A;  4TQ0 A;  1V81 A;  1ZKH A;  2GOW A;  3DCG A; 
#chains in the Genus database with same CATH topology
 2AQ2 B;  3PRE A;  4US8 A;  4GXB A;  1XLO A;  4FJY A;  1D3Z A;  3WAO A;  3ZIM A;  4JPS A;  4CYE A;  4P1C C;  2VH1 A;  1ZXI A;  2KMM A;  3QK0 A;  1TYG B;  3S2A A;  4RFB A;  2JX5 A;  3PZD A;  3A4S C;  3I9V 1;  4TQ1 A;  2D3A A;  4TKN A;  1E9M A;  1N5W A;  3HHM A;  2PVG C;  5KHO A;  5CHV C;  4AOF A;  4NAW A;  2NBU A;  4URK A;  1YJ1 A;  3HVD A;  5EDS A;  2L7R A;  3DBL B;  1EUV B;  2N7D A;  1UZX B;  4ARC A;  5LXI B;  4EE2 A;  1WXA A;  3ECI A;  2JZZ A;  3AEE B;  1WH3 A;  2KX3 A;  3BII D;  2K25 A;  3APF A;  2VH2 A;  2MX2 A;  1K8R B;  5HHD G;  2J52 A;  2KO3 A;  2WHI A;  4JX1 C;  3A4R A;  1UEL A;  2LRU A;  5BMG A;  3VR8 B;  3RNG C;  2IJ0 A;  1UUP A;  3AUL A;  3OJ4 B;  2N9L A;  4IWO A;  2KDE B;  1R4N B;  2GRI A;  5HKH A;  3B08 A;  1SGH A;  3ZTC A;  2BWE S;  1V97 A;  5C3J B;  2PTL A;  2CS4 A;  2C60 A;  3N32 A;  2IY0 B;  4P6V F;  2JU6 X;  4EUT A;  4OVU A;  1Z2M A;  1ROE A;  4HDO A;  1L0V B;  3AU4 A;  2KJR A;  4W9J A;  3TBL D;  4LCD E;  3LXF A;  2KZR A;  1E10 A;  4GIV A;  1C4C A;  4MM3 B;  1DYQ A;  1TBE A;  2GBJ A;  1FPY A;  3ZVV A;  4FHK A;  1JW9 D;  1I4Q A;  1SE9 A;  3RNB C;  3R8B A;  1KLV A;  4MGY E;  5TSS A;  5E6J A;  1JRU A;  1VZ7 A;  2WXG A;  2DAF A;  4GDL B;  1LQB A;  4HLE A;  3ETR A;  1QIL A;  1Z5S B;  4G0N B;  4GOC A;  1WYW B;  2D2Q A;  2MP2 B;  4KZ0 A;  1ZOY B;  4ANX A;  3APD A;  2KN4 A;  4DDG D;  3ZLZ A;  3CF6 E;  1NVI D;  3Q8C A;  2LJ5 A;  4A90 A;  1WZ0 A;  1UD7 A;  2DYO A;  1WJN A;  1P7F A;  1N61 A;  4H2A A;  2UYZ B;  5GMV A;  1NBF C;  4BKS A;  2NCN A;  4XX5 A;  3BYT B;  3U30 A;  2BS4 B;  2MBO A;  1EU3 A;  2H89 B;  1FXT B;  4F1S A;  4PK1 A;  4XC2 A;  2MA9 B;  3QAQ A;  2BT6 A;  2JVC A;  1ENF A;  2CKH B;  3W5V B;  1XXG A;  4GGQ A;  1MG4 A;  4HWI B;  1KOT A;  4YSZ B;  1YQ4 B;  5AZH A;  3O13 A;  2I1J A;  1T0Q C;  2AL3 A;  4DWF A;  2Z0D B;  3GE8 C;  1UBI A;  1E7P B;  2ZJD A;  4LNI A;  1YJJ A;  1SE4 A;  3ZDT A;  5EE9 A;  1CQV A;  2W54 A;  4DBG A;  3R3M A;  4WH4 A;  1SEB D;  2MJ3 A;  4OZC A;  2MWS B;  5DPW A;  2KFJ A;  1V86 A;  3RNC C;  4WJQ A;  4NAM A;  4AWJ A;  1K50 A;  3OAW A;  2D5G A;  4YTM B;  2DZM A;  1XEE A;  1SE3 A;  2FBW B;  3P4S B;  4C7Y A;  1TTN A;  3CSF A;  1YNT E;  1B1Z A;  4RH6 A;  4DHJ D;  2QEJ C;  3VAW A;  5JH5 C;  1P1A A;  3A9K A;  1VZ8 A;  5GXG B;  3AE1 B;  5H8Y E;  3ALB A;  3AU5 A;  3HRD D;  4IDI A;  1XLN A;  2REX A;  4F7Z A;  4HJG E;  4Q2J A;  3QHT A;  3V61 A;  2PLP A;  4MDK E;  4ZYN A;  4K7U A;  4NPN A;  2PMV A;  2N0S B;  1YIW A;  3NZ3 A;  3MC8 A;  1FRD A;  1UGJ A;  1V80 A;  2FE8 A;  3RZF A;  3L13 A;  4RGO S;  1IPG A;  1TKG A;  1GB1 A;  5LNK 1;  5G2N A;  4XYC A;  4HPP A;  3JW0 X;  1C4A A;  2YEP B;  1LGR A;  2W82 A;  3GP7 A;  1N60 A;  2KC2 A;  2X8X X;  5E6O A;  2V3S A;  3TUO A;  3VHT C;  2IYD B;  4DHZ E;  3DVN V;  1I42 A;  4EZJ A;  1L6U A;  3PZ7 A;  2B76 B;  1RFA A;  1T6B X;  3RN9 C;  4MEM A;  4CQN A;  1I4X A;  2JXX A;  2MEK A;  4F8C B;  1Q10 A;  4O1N A;  2G9H D;  2WXI A;  2WP9 B;  1HE8 A;  2UU7 A;  1EM7 A;  2EKI A;  4NY0 A;  4HRS A;  3D32 A;  2HTH A;  3ZNG C;  3QQ8 B;  4W9I A;  2KC1 A;  2XBB C;  2ZVN A;  3I63 C;  2QDF A;  5BYQ A;  3WA0 A;  4MJS A;  4BKG A;  1P3Q U;  4M8N A;  4FJZ A;  4NZL B;  2KTF A;  3DHG C;  3DBH B;  4W9H A;  4BBN F;  2V4I B;  1C78 A;  4ACF A;  1SSN A;  3L54 A;  3VXW A;  1J19 A;  3JYU A;  1NYR A;  4G11 A;  2J0M A;  1OGW A;  2PKO A;  3C0R B;  2QC8 A;  4FN2 A;  2WXL A;  4MGZ E;  2K3U A;  5FK9 C;  4II3 B;  2BBC A;  4IM2 A;  3IAS 1;  1WJU A;  4GU2 A;  5DPR A;  3FKY A;  3MJ5 A;  4X57 B;  3H8H A;  3A33 B;  2JYT A;  2WXK A;  1N6Z A;  4LJP B;  2BKR B;  3FIL A;  2L05 A;  3PRZ A;  1M94 A;  2KDI A;  1GUA B;  3IFW B;  4R3D A;  3NJT A;  1F2R C;  2N9X A;  4RGT A;  4JGH B;  3T3N A;  4A20 A;  1FEH A;  2ZW1 A;  3ZXV A;  1HZ6 A;  5KHQ A;  1B9R A;  4XE0 A;  3PVL A;  3L08 A;  1F0Z A;  2PPH A;  1ACC A;  2MW5 A;  4JWU C;  4MSQ B;  1UWM A;  4IOI E;  1MHH E;  2LGD A;  4PS8 A;  3Q8E A;  4K81 A;  4E71 A;  2Z8L A;  4RM9 A;  2INP E;  1KLU D;  3SDL C;  2N7E A;  2ZCC A;  2ZZP B;  4W9E A;  2RDB C;  4A3P A;  2KDF B;  1EF1 A;  2GOW A;  3J9C A;  2LGS A;  1FFU A;  2LUM A;  2DYB A;  4HDQ A;  3IT6 B;  2MJD A;  3FAH A;  2D07 B;  2L76 A;  4BZA A;  1WXQ A;  2RGF A;  4LDT D;  1RM6 C;  3GZN I;  1JWA D;  4EZK A;  2L00 B;  4JQW C;  2K6D B;  3PHW B;  1NEK B;  2M0A A;  1CJE A;  3DOW A;  5BMI A;  2NBV B;  4BBN C;  4DXA B;  1GG3 A;  3OWE B;  3WIM A;  2KXJ A;  2W3R A;  1SXT A;  3KWV A;  2KWV B;  3DDC B;  1WMH A;  4OVV A;  5IOI A;  4KSK C;  4DQO C;  1TIF A;  3NS8 A;  1Q0W B;  4M02 A;  3URY A;  2LMC A;  2TSS A;  1U4A A;  4NAW B;  4WIP A;  3ENE A;  5G55 A;  3U8Z A;  3BY4 B;  2XK5 B;  1WXS A;  3CIR B;  1ZXH A;  1AAR A;  2JSV X;  3LB8 C;  2ZEQ A;  4GLS C;  3Q3O C;  4P1B C;  1TS5 A;  3L0W B;  5DPS A;  4P7I A;  1WXV A;  1WGY A;  1QQR A;  1V49 A;  5BO4 B;  2BYE A;  2I1K A;  1JAL A;  2WXQ A;  5IO9 A;  3DWG C;  1DOY A;  1T0Y A;  1TGZ B;  5T8I A;  3AXC A;  1C3T A;  1JWB D;  2ACZ B;  3AE4 B;  2KDM A;  2O6V A;  2KKC A;  3DHI C;  2ASQ A;  1V1P B;  3IBE A;  1R4M I;  2ZVO A;  2ZNV C;  4ASW C;  4ZHP A;  1ZP0 B;  4OHJ A;  2J7Q B;  1GB4 A;  1E6E B;  1S3S G;  4AUQ C;  4PYZ A;  3E9S A;  2BYF A;  2BKF A;  4IWQ A;  2CR5 A;  1KF6 B;  2FNJ B;  2LHD A;  1VD2 A;  2DZI A;  2KN5 A;  2M0X A;  1J7B A;  2GBM A;  1TS2 A;  1YN3 A;  2M56 B;  2KNB A;  3U2S C;  2J4X A;  2FUG 1;  3PGE A;  2Q5W D;  1IBX B;  4N6E B;  4II2 B;  3A9J B;  2G4S A;  2XK5 A;  2D3G A;  1PQS A;  2VZK B;  2Z0E B;  1WGR A;  4M0W A;  4RF0 A;  3UQB A;  1N62 A;  1TS4 A;  1PGB A;  1J7A A;  3X0W A;  2LGY A;  4LNF A;  1RLF A;  3FIL B;  3IXS A;  1KLG D;  3MP9 A;  3SHQ A;  4M00 A;  2WYQ A;  4HPL B;  4HEA 1;  3N1X C;  4IM3 A;  4LLG M;  5D3I B;  2LVP A;  2MBQ A;  2KTR B;  2WXF A;  2K8H A;  4WAA A;  2L52 A;  2HD5 B;  3L10 B;  3ZJV A;  1WRD B;  2A4Z A;  2MBH A;  2X38 A;  2JF5 A;  4FAD A;  4TV3 A;  2DBY A;  1OQR A;  2BB6 A;  4GSW A;  1RWS A;  4XWW A;  2B3A A;  1V1O A;  3NVW A;  2IY1 B;  2K6Q A;  3IVF A;  3PSE B;  3EA6 A;  2KAN A;  1TS3 A;  1QOG A;  3TIX A;  3Q14 C;  2KWC A;  1Q1O A;  1WGD A;  4WUR A;  1CK1 A;  1AW7 A;  3EUB 2;  2M4N A;  1ESF A;  2C7M B;  2KLG A;  2OJR A;  1WXM A;  3HK0 A;  2YVC A;  1E8X A;  1HTO A;  2CHW A;  5JHB A;  3V60 A;  4PT5 A;  4L23 A;  3K9P B;  1TKE A;  1L4Z B;  1OEY A;  2AWT A;  2MQJ A;  1FD6 A;  5C2T B;  2JYE A;  3AM9 A;  2C9W B;  3DBR B;  3HM3 A;  4MH0 E;  1OQQ A;  2IBI B;  4BOS C;  1WR1 A;  2WU2 B;  3ZJU A;  2KFK B;  3JSV B;  2ZW0 A;  4K3C A;  2M17 A;  3KVF B;  2RD0 A;  4FA6 A;  3EFC A;  1XCT L;  3WAL A;  1WMH B;  4W9L A;  2CHZ A;  2ICI A;  4ZRP A;  1YX6 B;  1PUT A;  3TMP B;  3IG3 A;  4ZRK A;  2V3P A;  2DEN B;  3Q3N C;  1V5T A;  4ANU A;  4C56 C;  4KDL B;  4K3B A;  2IDY A;  3EEC A;  4FXC A;  2Z59 B;  3WAN A;  2WDV B;  4LDT B;  1ZE3 D;  3ZJT A;  4W9D A;  2RDH A;  3BVZ A;  3PPA A;  2D3B A;  3EHV A;  2DHZ A;  3BK1 A;  1AWD A;  3ZDM C;  4B95 A;  1ISN A;  4HK2 A;  2PE6 B;  1WE6 A;  1NI3 A;  1T3Q A;  1JWU D;  4MJS B;  1E8W A;  5I4D A;  1XT9 B;  2ZNV B;  4JIO U;  3KWL A;  2JXT A;  3Q3M C;  3T9L A;  3AN1 A;  5AZG A;  3Q6B A;  3ZNZ B;  3VH4 B;  5EE0 A;  4HJK A;  4IWP A;  1ZPS A;  1WFY A;  1XLQ A;  5E6P A;  2OJW A;  3ZXR A;  3Q8F A;  5HFY A;  2JWU A;  2PIA A;  3ZYY X;  3LYY A;  2N9K A;  4BFR A;  3UQA A;  2RPQ A;  3IHP C;  2JRH A;  4NJC A;  3UIO B;  3LJ3 A;  1ZDV A;  4P16 A;  5CHF A;  3VRB B;  2QMT A;  4YSY B;  1WRI A;  2D11 A;  2KQ7 A;  1QKZ A;  3T8M A;  1YD8 U;  5DPT A;  1UGM A;  1MPE A;  4G3X B;  3N20 C;  2L0T A;  1IYF A;  2YLM A;  3TJP A;  3WAM A;  3SR6 A;  3ZRC A;  4ZDV A;  1YOV B;  1H4R A;  4RF1 A;  3PZ8 A;  4MAC A;  2M8S A;  3L16 A;  1YMH E;  3GS2 A;  4US9 A;  5D94 A;  1JML A;  2BS3 B;  1UF0 A;  2VRR B;  3ZNH B;  4KKI A;  1M4V A;  1BUI C;  1PDX A;  3UI3 A;  1MVK A;  1WX7 A;  4RCO A;  1QF6 A;  2KJH B;  4BKT A;  3C8Y A;  4IW0 A;  1VR9 A;  2HTM E;  1FCC C;  2JZP A;  2NMQ A;  3B9J A;  4C4V A;  3U52 E;  2IGD A;  4NQL B;  3QX1 A;  2WU5 B;  4B0E A;  2DNF A;  1N63 A;  1VDV A;  3PT2 B;  1SIJ A;  4WQM A;  4C00 A;  1UH6 A;  2EMT A;  3OG5 A;  1BT0 A;  3N1Z C;  5L83 A;  2AYO B;  3RD2 A;  3NHE B;  4JE3 B;  3W5U B;  2ZCB A;  4B9K A;  4BAX A;  1F9J A;  1EWC A;  3W9C B;  1E90 A;  3JSV A;  3Q69 A;  5H92 C;  2SEB D;  3DCG A;  1AN8 A;  1F1H A;  1JWM D;  1D5Z C;  2WS3 B;  2KX0 A;  5J17 A;  4KV2 A;  2WXM A;  2BWF A;  2WXR A;  3PLV A;  4XDD A;  4DK5 A;  3NZU A;  3QC8 B;  3RNA C;  1P98 A;  2Y3A A;  1XLP A;  1WZ3 A;  3UF8 A;  5G5H A;  3AED B;  4JLC A;  3RNE C;  1DOX A;  3SEB A;  3E56 A;  2GBR A;  1T0R C;  4ZRI A;  1MHX A;  2QJL A;  5D7G A;  1C1Y B;  2C5L C;  1E7V A;  2BYV E;  4FJV B;  4GDK A;  2N1V A;  1I4R A;  1GC7 A;  3RPF C;  1WJ6 A;  3MHS D;  4KZC A;  4RGN A;  3IAM 1;  4HXD A;  1L0X B;  1BML C;  3H7P A;  3BIN A;  3WCQ A;  3AE8 B;  3KQ4 A;  3ABV B;  1XF5 L;  4IG7 B;  3TSS A;  4WJO A;  3KW5 B;  4AS1 A;  2WDT B;  4LTU A;  3RI7 C;  4YT0 B;  1TY0 A;  2BTE A;  1TT5 B;  1KFY B;  4QAY A;  1UBQ A;  5BMH A;  5FKA C;  3GOE A;  5LXH A;  1I7H A;  5AUI A;  1K53 A;  3AEB B;  2LGI A;  2L0F A;  3NY5 A;  4KGT A;  2E3T A;  1RAX A;  4MGI E;  4NJ6 A;  1WM2 A;  5D3D A;  3DWM A;  3P4R B;  3RNF C;  1C9F A;  1STE A;  3R7Q A;  3P2B A;  2DX5 B;  4XGA B;  2D10 A;  2PJH A;  1V2Y A;  3H7S A;  3MJW A;  1SIF A;  3RT3 B;  4C80 A;  2BF8 B;  3TL5 A;  1ET6 A;  1E0Z A;  3ZRF A;  1FO4 A;  4GDL A;  1G6J A;  1C76 A;  4DDI D;  3KLS X;  1CMX B;  2KVZ A;  4MGK E;  1HXY D;  4MH8 A;  1TZO A;  1EWY C;  3UGB B;  3P4Q B;  4W9C A;  2KWU B;  2JQR B;  1D5M C;  3TEY A;  3PV1 A;  1TY2 A;  4C4V B;  2LZ6 A;  4J6I A;  1FXA A;  1WR6 E;  1MG8 A;  3BK2 A;  2GMI C;  5IP4 D;  4OW0 A;  1D6E C;  2J0J A;  1V9J A;  4WWM A;  2QCZ A;  2QIL A;  2MCN B;  2WDR B;  2N7J A;  2GBN A;  3P4P B;  4AJW A;  2LEK A;  3PTF C;  4FBJ B;  5AEK B;  4ITK A;  1QOB A;  3N30 A;  2PW9 A;  1YQ3 B;  1Y8R C;  1A70 A;  1KM7 A;  2JT4 B;  1FCL A;  1ZW7 A;  4HVB A;  4A6Q A;  3OLM D;  3PS6 A;  4YL8 A;  2V0G A;  3PHX B;  3AE5 B;  1WWT A;  5BYS A;  2ONQ A;  1FXI A;  1OEY J;  5EE3 A;  4EOY A;  2IO0 B;  1JRP A;  1RRB A;  3U4E G;  2CJO A;  4OVZ A;  4M8M A;  1MI0 A;  4NJ7 A;  1L7Y A;  3HUI A;  3RUI B;  2DZK A;  2WQY B;  4M0W B;  3UIN B;  1PGX A;  3PLU A;  2MRP A;  1V6E A;  1QT9 A;  3MC9 A;  1NYQ A;  2AL6 A;  3KYC D;  4KGR A;  3N3K B;  4K7S A;  2LVQ A;  3B0A A;  2MP2 A;  2KVR A;  3B2F A;  4TSS A;  2L1A A;  3PRP B;  2KLC A;  4KIK B;  2V1Y A;  3NVZ A;  4KX6 B;  2O6V B;  2CU3 A;  1SJE D;  1ZGU B;  1YJI A;  3KUZ A;  1V1P A;  4WWO A;  2FCS A;  3VUW A;  2MBE A;  1E7U A;  1P9D U;  2IGG A;  1I35 A;  2K39 A;  1GNU A;  1I4G A;  4NNJ B;  3U7D A;  4UDU C;  2RDG A;  3NG0 A;  2G1E A;  3DPD A;  4HCN B;  1KTK A;  2IZV B;  3RUL A;  3MFG A;  3AB5 A;  4MSM B;  1Q5W B;  3MC0 B;  3FC4 A;  2R61 A;  1JQ4 A;  3IT4 B;  4REZ A;  3DVG Y;  2BPS A;  3NRZ A;  2MBB B;  1ET9 A;  1F52 A;  5AUK A;  1PFD A;  5CHW A;  3TEX A;  3AI5 A;  1V5O A;  3LDZ E;  1I4H A;  1L2N A;  3H1U A;  4MEL A;  3VFK A;  4EZL A;  1IBX A;  2W55 A;  3QWZ B;  2KAJ A;  2J53 A;  1ZUD 2;  2DWQ A;  3BVM A;  4WWN A;  2LHE A;  3I5J C;  4IC7 B;  2NTT A;  3P63 A;  1CZP A;  4RGM A;  3H7P B;  3TEZ A;  3NVY A;  2IO3 B;  4NQK E;  3ZO5 B;  2K8C A;  4OZA A;  1QOA A;  4WJN A;  4ZRJ A;  4YTP B;  1FIQ A;  4HPM B;  1WGH A;  3R2T A;  1FFV A;  4WQO B;  3QAR A;  1Y56 A;  2NS5 A;  3GE3 C;  1HQR D;  4K7W A;  2FUH B;  5AZF A;  2PEA A;  1EF5 A;  3VRA B;  2HDE A;  4GMV A;  1H8C A;  3VTV A;  2JRI B;  4XZ4 A;  4PS7 A;  3M63 B;  2KMA A;  2XN9 C;  1TZ1 A;  4IUM B;  2LD9 A;  4KGS A;  1IP9 A;  5DCN A;  2KK8 A;  2UWQ A;  2KT7 A;  1DGJ A;  3V6E B;  3V05 A;  3Q3F A;  4ARI A;  2L3Z A;  3Q2A C;  2LJI A;  2L83 A;  5BYR A;  1LO5 D;  3ZTD A;  1GJZ A;  4WAF A;  3V62 A;  3H6N A;  4S17 A;  3GB1 A;  2E6X A;  3Q8A A;  5L95 C;  3CST A;  1TJE A;  1SE2 A;  1WJ4 A;  3KH0 A;  3MTN B;  2K0P A;  1KRH A;  1SF0 A;  3BZD B;  1A5R A;  1L0Y B;  1LFD A;  2LXA A;  4J3O D;  2DZJ A;  3SFD B;  3P1M A;  2Y5C A;  3QIJ A;  4ZYS A;  1N5X A;  5C23 A;  4TUU A;  3AE9 B;  1WE7 A;  1FMA D;  2WXH A;  3N9Y C;  2AQ1 B;  5D6J B;  2KTR A;  5G5G A;  3DVG X;  3DBL I;  4E3C A;  2CHX A;  3QJZ A;  4AJY B;  4GN1 A;  5JZE B;  2OOB B;  3ZNI D;  3ONS A;  1VLB A;  2JUO A;  3VR9 B;  1YX5 B;  2WXO A;  3RCZ A;  1WSP A;  1TKY A;  2KQS A;  4A55 A;  3B1L X;  3AE2 B;  2EMS A;  1V8C A;  3AEF B;  3VH3 B;  2N4F A;  2RSU A;  2W9N A;  1LXD A;  2MH7 A;  4HRO A;  4A9A A;  3BVG A;  2JY6 A;  4TQ0 A;  1ZKH A;  2L32 A;  1IGD A;  2LUE A;  3DHH C;  4LK0 M;  3AE6 B;  2RMM A;  4ICU A;  2NVU I;  2Y5P A;  1GPX A;  4S0R A;  3VUY A;  2LVO A;  4FLH A;  5IA7 A;  1MJD A;  2WX0 A;  3BWU D;  1RYJ A;  2LGX A;  4RNA A;  4GDK B;  2KMC A;  3VUX A;  4IKG A;  1IGC A;  3I3T B;  3QCA A;  5HG2 A;  1HTQ A;  2LRW A;  5CTR C;  3DVN U;  2RPV A;  2V4L A;  3HIZ A;  1JCK B;  2XEW A;  3SU8 X;  1FRR A;  2FAZ A;  2LWP A;  2AEH A;  1EU4 A;  1QLB B;  1OQY A;  2K1F A;  2AX5 A;  1K52 A;  2ZPY A;  3DQV A;  2G3Q B;  2IO1 B;  2NTS A;  2LFI A;  4MM3 A;  3Q3J A;  3Q8B A;  3K9O B;  2EKE C;  2PE9 A;  3MHZ A;  2IND C;  2N1W A;  3VTU A;  4WJP A;  1GOZ A;  4EFO A;  1J0G A;  2LXC A;  2AQ3 B;  1D5X C;  1HZ5 A;  4CHK A;  2EEL A;  3M3J A;  5IKC M;  2IPK D;  1R4N I;  2FCQ A;  2QIE B;  4USA A;  3C19 A;  1K51 A;  4L1B A;  1F77 A;  4DHZ B;  2Y5B B;  4XWT A;  2WXN A;  3VVW B;  1L6V A;  2I2Y A;  4ZOH C;  2QSD A;  1KH0 A;  3CWI A;  3SFE B;  2KHW B;  5FR3 A;  3CMM B;  2JWZ A;  4ICV A;  4KSL C;  2N9P C;  3EFU A;  3AE7 B;  4PYU A;  2KAC A;  2KDB A;  2CJN A;  2HJ1 A;  3RYT A;  1HA5 A;  2R2O A;  1KJT A;  3DBR I;  5D2M B;  3DBS A;  3RMK C;  3VQI A;  4ZHO A;  2ON8 A;  2BGF A;  4OZB A;  4EEW A;  2CU1 A;  1VCB A;  2J42 A;  2LI5 A;  2N9E B;  2KD0 A;  3ZKJ C;  2WWZ A;  4ANW A;  2H88 B;  4B6W A;  4I6L B;  2XNA C;  2NBW B;  4BVU C;  4BOZ B;  2C7H A;  1E8Y A;  4KVG B;  1EO6 A;  4YWG G;  3B2G A;  3R66 C;  3L4P A;  2HE7 A;  3GZN B;  1QOF A;  1XQQ A;  3NS1 A;  4M01 A;  3A1Q B;  1LM8 B;  4KDI C;  1XD3 B;  3ML8 A;  2BS2 B;  1VJK A;  3KUD B;  4LJO B;  2QHO A;  3U7Z A;  2V9H A;  1J7C A;  3ZW3 A;  2JZ3 B;  4N9F 4;  3A9K B;  2MJE A;  2KJ6 A;  2GLS A;  1OFF A;  1JRO A;  2INN E;  5HI1 A;  4JWS C;  3SD5 A;  3KUC B;  2WXJ A;  2BW2 A;  2KYW A;  2WXP A;  2BB5 A;  1E5W A;  2RR9 A;  4W9F A;  2JPH A;  3ZGZ A;  5JXV A;  1VZ6 A;  1I4P A;  3W1S A;  4L2Y A;  4JL9 A;  2D3C A;  3VTW A;  2W3S A;  4CO7 A;  1NEN B;  1J8C A;  2IGH A;  1L5P A;  4FUL A;  4HKZ E;  3PO0 A;  1XO3 A;  3NOB A;  4LNO A;  1WX8 A;  2NR2 A;  4YSX B;  1YN5 A;  2BVC A;  2DYM A;  4GB9 A;  3V3X A;  3R7R A;  1NDD A;  3TCA A;  2M1M A;  3AEA B;  4HKQ A;  2FIF A;  1WI0 A;  2BQQ A;  3T3O A;  2DLB A;  4C7Z A;  1MFW A;  1R7S A;  1C77 A;  4N59 A;  4A3O A;  4K1R B;  1R4M B;  2FID A;  2R2Q A;  3NUH B;  1XCQ L;  3R2I A;  1OTR B;  2NPT A;  2GI9 A;  2I38 A;  3AE3 B;  3M62 B;  3W2D A;  2K8B A;  2C7N B;  1PGA A;  4B0M A;  4HCP B;  2WLB A;  1X1M A;  3A1Q A;  1L4D B;  3DBH I;  2ZPN A;  1D4B A;  2O6V D;  4YTN B;  4KKJ A;  2DAJ A;  1P0R A;  4RMA A;  3ZQ4 A;  1JWS D;  1PYW D;  2MSE D;  2J0K A;  4PS3 A;  1QZE A;  2WDQ B;  1T0S C;  3AH7 A;  5J18 A;  3TEW A;  1WY8 A;  1BXT A;  2MHJ A;  5J2R A;  5C1Z A;  4G50 A;  1WF9 A;  5LLI A;  4DXG A;  1UNS A;  1GC6 A;  1FNU A;  1DOI A;  2OHF A;  4LNN A;  1P7E A;  1NI2 A;  3O65 B;  2O2V A;  2GB1 A;  1WGG A;  1IUE A;  4I6N B;  1C4P A;  1C79 A;  3OJ3 A;  4A8X C;  2HJ8 A;  1AYF A;  2K5P A;  2WNM A;  5CX3 A;  1ZDX A;  2KQ4 X;  4KIK A;  2G4D B;  4I6P A;  1S1Q B;  3KYD D;  3RZW C;  2KOX A;  1YN4 A;  3ML9 A;  3NZS A;  3M95 A;  1WIA A;  2O2V B;  2KFK A;  2L8J A;  2FCM A;  4N58 A;  2FCN A;  4IM0 A;  5JHA A;  2V3N A;  4DXF A;  2A5U A;  4W9K A;  3QA8 A;  5IAA C;  2VZK D;  3W1Y A;  4ZRQ A;  2YEP F;  3VDZ A;  1VRA B;  5MPO A;  3W1S C;  2WX1 A;  1SJH D;  2OED A;  3P42 A;  1HEZ E;  3AMZ A;  5E6N A;  2KWD A;  3AV8 A;  4EKU A;  4W9G A;  3BYY B;  4DHJ B;  2SAK A;  4AQ7 A;  2BYT A;  1FM0 D;  3NVV A;  3HM6 X;  2INC C;  1E8Z A;  4ANV A;  1RFK A;  1SBB B;  3EC8 A;  4AP4 C;  2GBK A;  3PRM B;  2M19 A;  2PVO D;  5TR5 A;  1GAQ B;  4LNK A;  4BKS D;  3V6C B;  4XDC A;  4E74 A;  3WAP A;  2MLB A;  1F2R I;  3UIP B;  4WWP A;  1WX9 A;  4RM8 A;  1FNV A;  4FHJ A;  3A9J A;  1YQB A;  1WYG A;  4D2K A;  2WGS A;  3HVZ A;  1WM3 A;  2IO2 B;  1WGK A;  2G45 B;  3APC A;  1SB3 C;  2LAS A;  2NPT B;  3AEC B;  4MT5 A;  1UWX A;  3JVZ X;  3N1Y C;  3AEG B;  2K9X A;  4TMA B;  3ZUN A;  3I57 A;  5FR6 A;  3X23 A;  5EE1 A;  1T5X D;  2K22 A;  3H9D A;  3EGR A;  1FNW A;  3RFZ B;  3L17 A;  5IN7 A;  1V81 A;  4YXD B; 
#chains in the Genus database with same CATH homology
 3PRE A;  2KX0 A;  4GXB A;  5J17 A;  2LUE A;  4KV2 A;  2DYB A;  4FJY A;  1D3Z A;  2BWF A;  4HDQ A;  3PLV A;  4ICU A;  3WAO A;  2NVU I;  4DK5 A;  3ZIM A;  3NZU A;  3QC8 B;  4CYE A;  3VUY A;  2LVO A;  2D07 B;  4FLH A;  5IA7 A;  2WX0 A;  2L76 A;  1P98 A;  2LGX A;  3QK0 A;  2RGF A;  4LDT D;  3S2A A;  4GDK B;  2KMC A;  3VUX A;  1WZ3 A;  3GZN I;  3UF8 A;  3I3T B;  3QCA A;  4EZK A;  2L00 B;  4JLC A;  4JQW C;  2LRW A;  2K6D B;  3A4S C;  3PHW B;  3PZD A;  4TQ1 A;  3DVN U;  5CTR C;  4TKN A;  2V4L A;  3HHM A;  5KHO A;  3DOW A;  3HIZ A;  5CHV C;  2GBR A;  4AOF A;  4NAW A;  2NBV B;  2XEW A;  4BBN C;  2NBU A;  4URK A;  4DXA B;  1GG3 A;  1YJ1 A;  4ZRI A;  3SU8 X;  2FAZ A;  3WIM A;  2LWP A;  2L7R A;  5EDS A;  2KXJ A;  5D7G A;  2AEH A;  1C1Y B;  2C5L C;  1E7V A;  1EUV B;  2N7D A;  1UZX B;  2BYV E;  2KWV B;  3DDC B;  4FJV B;  1WMH A;  2N1V A;  1GC7 A;  4GDK A;  1OQY A;  4OVV A;  5LXI B;  1WJ6 A;  1WXA A;  3MHS D;  2K1F A;  4KZC A;  4KSK C;  2ZPY A;  3DQV A;  3ECI A;  4HXD A;  2G3Q B;  3H7P A;  2IO1 B;  3NS8 A;  1Q0W B;  2JZZ A;  3BIN A;  1WH3 A;  4MM3 A;  1U4A A;  4NAW B;  2KX3 A;  3ENE A;  3Q3J A;  2K25 A;  3K9O B;  3APF A;  2EKE C;  5G55 A;  3U8Z A;  2MX2 A;  1K8R B;  4IG7 B;  4WJO A;  3BY4 B;  3KW5 B;  2XK5 B;  2KO3 A;  2PE9 A;  2N1W A;  1WXS A;  2WDT B;  3A4R A;  1UEL A;  2LRU A;  4WJP A;  3VTU A;  4EFO A;  3AUL A;  1J0G A;  3OJ4 B;  1UBQ A;  2LXC A;  4IWO A;  2KDE B;  1AAR A;  2ZEQ A;  3GOE A;  4CHK A;  5LXH A;  5HKH A;  3M3J A;  3B08 A;  1SGH A;  3L0W B;  5DPS A;  3ZTC A;  4P7I A;  1WXV A;  1WGY A;  2BWE S;  1R4N I;  1V49 A;  2L0F A;  3NY5 A;  5BO4 B;  2FCQ A;  2BYE A;  1RAX A;  2CS4 A;  4MGI E;  2I1K A;  2C60 A;  4NJ6 A;  1WM2 A;  3N32 A;  2IY0 B;  3R7Q A;  3P2B A;  2DX5 B;  4EUT A;  2D10 A;  2PJH A;  4DHZ B;  1V2Y A;  3H7S A;  1T0Y A;  1SIF A;  1TGZ B;  2Y5B B;  3MJW A;  3RT3 B;  4OVU A;  2BF8 B;  1Z2M A;  3AXC A;  3TL5 A;  3VVW B;  1C3T A;  4HDO A;  3ZRF A;  3AU4 A;  2KJR A;  4W9J A;  2KHW B;  4GDL A;  3CMM B;  3TBL D;  2JWZ A;  1G6J A;  4LCD E;  4ICV A;  4DDI D;  4KSL C;  2KZR A;  2N9P C;  1CMX B;  2O6V A;  4MGK E;  2KKC A;  3EFU A;  2ASQ A;  4PYU A;  4GIV A;  3IBE A;  3UGB B;  2KDB A;  4W9C A;  1TBE A;  1R4M I;  2GBJ A;  3RYT A;  2KWU B;  2R2O A;  2ZNV C;  2ZVO A;  4ASW C;  1KJT A;  3DBR I;  4FHK A;  3ZVV A;  1SE9 A;  5D2M B;  2J7Q B;  1KLV A;  3DBS A;  3PV1 A;  1S3S G;  4AUQ C;  3VQI A;  4MGY E;  4PYZ A;  2LZ6 A;  2BGF A;  4J6I A;  1JRU A;  1WR6 E;  1MG8 A;  2DAF A;  4GDL B;  1LQB A;  4HLE A;  1Z5S B;  2GMI C;  4EEW A;  2CU1 A;  1VCB A;  4G0N B;  4GOC A;  2BYF A;  2LI5 A;  2BKF A;  2N9E B;  2J0J A;  2KD0 A;  3ZKJ C;  1V9J A;  2WWZ A;  1WYW B;  2MCN B;  2D2Q A;  2MP2 B;  4IWQ A;  4ANW A;  4B6W A;  2CR5 A;  4KZ0 A;  2FNJ B;  4I6L B;  4ANX A;  1VD2 A;  2GBN A;  3APD A;  2DZI A;  4AJW A;  2KN5 A;  3PTF C;  4FBJ B;  5AEK B;  4DDG D;  2NBW B;  2M0X A;  3ZLZ A;  3CF6 E;  4BVU C;  2GBM A;  4BOZ B;  2C7H A;  3N30 A;  1E8Y A;  1Y8R C;  1KM7 A;  2LJ5 A;  4KVG B;  2JT4 B;  1WZ0 A;  1EO6 A;  2KNB A;  1ZW7 A;  1UD7 A;  2DYO A;  4HVB A;  1WJN A;  3PGE A;  3R66 C;  3OLM D;  3PS6 A;  4YL8 A;  2HE7 A;  3PHX B;  4II2 B;  3A9J B;  2G4S A;  2XK5 A;  2D3G A;  2UYZ B;  5GMV A;  1NBF C;  1XQQ A;  4BKS A;  1PQS A;  2NCN A;  2Z0E B;  1OEY J;  1WGR A;  3A1Q B;  1LM8 B;  4XX5 A;  3U30 A;  4KDI C;  4EOY A;  1XD3 B;  2IO0 B;  3UQB A;  2MBO A;  3ML8 A;  1RRB A;  3KUD B;  1FXT B;  4LJO B;  3X0W A;  4F1S A;  2QHO A;  4XC2 A;  2LGY A;  2MA9 B;  3QAQ A;  4M8M A;  3ZW3 A;  4NJ7 A;  2JVC A;  1L7Y A;  1RLF A;  2JZ3 B;  2CKH B;  3RUI B;  2DZK A;  4N9F 4;  4M0W B;  3A9K B;  3UIN B;  3SHQ A;  3PLU A;  2MRP A;  2KJ6 A;  1V6E A;  4GGQ A;  2WYQ A;  4HPL B;  4IM3 A;  4HWI B;  1KOT A;  5AZH A;  3SD5 A;  2AL6 A;  3KYC D;  3KUC B;  3N3K B;  4K7S A;  2I1J A;  2LVQ A;  2LVP A;  2AL3 A;  3B0A A;  2MP2 A;  2MBQ A;  2KTR B;  2KVR A;  2K8H A;  4DWF A;  4WAA A;  2Z0D B;  3PRP B;  1E5W A;  2HD5 B;  2RR9 A;  2JPH A;  3L10 B;  4W9F A;  2KLC A;  1UBI A;  1WRD B;  4KIK B;  2A4Z A;  2MBH A;  3W1S A;  2V1Y A;  2ZJD A;  4JL9 A;  4CO7 A;  3VTW A;  2JF5 A;  3ZDT A;  4TV3 A;  4FAD A;  4DBG A;  1J8C A;  3R3M A;  4GSW A;  2O6V B;  4FUL A;  2B3A A;  1ZGU B;  3KUZ A;  2IY1 B;  2K6Q A;  3IVF A;  4WWO A;  2FCS A;  3NOB A;  2MWS B;  3PSE B;  3VUW A;  5DPW A;  1WX8 A;  2KAN A;  2KFJ A;  2MBE A;  1E7U A;  1V86 A;  1P9D U;  2NR2 A;  4WJQ A;  3TIX A;  1I35 A;  2KWC A;  2K39 A;  1GNU A;  1Q1O A;  4AWJ A;  4NNJ B;  2DYM A;  3U7D A;  4GB9 A;  1WGD A;  3R7R A;  1NDD A;  3TCA A;  3OAW A;  2M4N A;  2M1M A;  3DPD A;  2C7M B;  2DZM A;  2KLG A;  2FIF A;  2OJR A;  4HCN B;  1WXM A;  2IZV B;  1WI0 A;  3HK0 A;  2YVC A;  1E8X A;  3RUL A;  2CHW A;  1TTN A;  3CSF A;  3V60 A;  5JHB A;  4MSM B;  4K1R B;  1Q5W B;  4A3O A;  4DHJ D;  3VAW A;  3K9P B;  2FID A;  5JH5 C;  1P1A A;  3A9K A;  2R2Q A;  3DVG Y;  2BPS A;  1OEY A;  1OTR B;  2AWT A;  2MQJ A;  2NPT A;  3ALB A;  3AU5 A;  2MBB B;  5CHW A;  3AI5 A;  2C9W B;  3M62 B;  2REX A;  2K8B A;  3HM3 A;  4F7Z A;  4MH0 E;  1V5O A;  2C7N B;  2IBI B;  4BOS C;  3LDZ E;  1L2N A;  1WR1 A;  3QHT A;  3V61 A;  2KFK B;  3H1U A;  4HCP B;  4MEL A;  3VFK A;  4EZL A;  4MDK E;  1X1M A;  3A1Q A;  3JSV B;  4K7U A;  4ZYN A;  3DBH I;  2ZPN A;  4NPN A;  2M17 A;  2O6V D;  3KVF B;  2RD0 A;  4FA6 A;  1YIW A;  1P0R A;  2DAJ A;  3QWZ B;  4RMA A;  3RZF A;  1V80 A;  3WAL A;  3L13 A;  4WWN A;  2MSE D;  1WMH B;  4W9L A;  2CHZ A;  2J0K A;  1IPG A;  4PS3 A;  1QZE A;  5G2N A;  4IC7 B;  1YX6 B;  5J18 A;  3H7P B;  1WY8 A;  3JW0 X;  3TMP B;  2IO3 B;  3IG3 A;  4NQK E;  4ZRK A;  3ZO5 B;  5J2R A;  2K8C A;  2DEN B;  5C1Z A;  2KC2 A;  1V5T A;  4WJN A;  4ZRJ A;  4ANU A;  4KDL B;  5E6O A;  4G50 A;  1WF9 A;  5LLI A;  4HPM B;  3EEC A;  1WGH A;  2V3S A;  1GC6 A;  2Z59 B;  4WQO B;  3WAN A;  4LDT B;  3VHT C;  3QAR A;  2IYD B;  4DHZ E;  2NS5 A;  3DVN V;  4W9D A;  1I42 A;  4EZJ A;  4K7W A;  2FUH B;  3PPA A;  5AZF A;  2PEA A;  1NI2 A;  1RFA A;  1EF5 A;  3O65 B;  2O2V A;  3EHV A;  1WGG A;  4I6N B;  2DHZ A;  3ZDM C;  4MEM A;  4B95 A;  2JXX A;  4GMV A;  3OJ3 A;  2HJ8 A;  1ISN A;  4HK2 A;  2PE6 B;  4F8C B;  1WE6 A;  5CX3 A;  1H8C A;  4MJS B;  1E8W A;  1XT9 B;  4KIK A;  3VTV A;  2ZNV B;  4JIO U;  2JRI B;  2G4D B;  4I6P A;  1S1Q B;  3KYD D;  4PS7 A;  3M63 B;  4XZ4 A;  3RZW C;  2KMA A;  2KOX A;  1TZ1 A;  3ML9 A;  4IUM B;  3NZS A;  3M95 A;  5L83 A;  1WIA A;  2LD9 A;  2O2V B;  2KFK A;  3T9L A;  2L8J A;  1HE8 A;  2FCM A;  4NY0 A;  5AZG A;  3D32 A;  1IP9 A;  2HTH A;  2FCN A;  2KK8 A;  5DCN A;  4IM0 A;  2UWQ A;  3ZNG C;  5JHA A;  3QQ8 B;  2A5U A;  4W9K A;  4W9I A;  3V6E B;  3VH4 B;  3QA8 A;  3ZNZ B;  4HJK A;  3Q3F A;  2KC1 A;  4IWP A;  1WFY A;  5IAA C;  2XBB C;  2ZVN A;  3W1Y A;  5E6P A;  3WA0 A;  4MJS A;  4BKG A;  1P3Q U;  4M8N A;  4FJZ A;  2KTF A;  3VDZ A;  2L3Z A;  4W9H A;  4BBN F;  4BFR A;  3W1S C;  2RPQ A;  3UQA A;  2WX1 A;  3IHP C;  2JRH A;  3L54 A;  5E6N A;  3UIO B;  3VXW A;  3LJ3 A;  1J19 A;  5CHF A;  3JYU A;  4G11 A;  2J0M A;  1OGW A;  4EKU A;  3C0R B;  2D11 A;  3ZTD A;  2KQ7 A;  4W9G A;  4FN2 A;  1GJZ A;  3T8M A;  1YD8 U;  3H6N A;  4MGZ E;  3V62 A;  5DPT A;  4DHJ B;  1UGM A;  5L95 C;  4G3X B;  4II3 B;  3CST A;  4IM2 A;  2L0T A;  1IYF A;  2YLM A;  3TJP A;  1WJU A;  4GU2 A;  3WAM A;  1WJ4 A;  5DPR A;  3ZRC A;  4ZDV A;  1H4R A;  3KH0 A;  4X57 B;  3HM6 X;  3A33 B;  2M8S A;  1E8Z A;  3L16 A;  3MTN B;  4ANV A;  3EC8 A;  4AP4 C;  1A5R A;  2GBK A;  5D94 A;  3PRM B;  2BKR B;  4LJP B;  1LFD A;  2LXA A;  2L05 A;  2VRR B;  3PRZ A;  2DZJ A;  1M94 A;  2KDI A;  1GUA B;  5TR5 A;  3ZNH B;  3QIJ A;  3IFW B;  4BKS D;  3V6C B;  4E74 A;  5C23 A;  4TUU A;  3WAP A;  2MLB A;  2N9X A;  1WE7 A;  3UIP B;  1WX7 A;  4WWP A;  2KJH B;  1WX9 A;  4JGH B;  4BKT A;  4RM8 A;  4A20 A;  5D6J B;  4IW0 A;  4FHJ A;  3A9J A;  1YQB A;  2KTR A;  3DVG X;  5KHQ A;  3DBL I;  4E3C A;  2CHX A;  3QJZ A;  4AJY B;  1WM3 A;  4GN1 A;  2IO2 B;  2OOB B;  2G45 B;  3ONS A;  3ZNI D;  5JZE B;  3APC A;  2LAS A;  4NQL B;  2NPT B;  2JUO A;  3QX1 A;  1YX5 B;  3RCZ A;  2KQS A;  3PVL A;  3L08 A;  3B1L X;  3JVZ X;  2PPH A;  3PT2 B;  2MW5 A;  4MSQ B;  1UH6 A;  2EMT A;  2EMS A;  3VH3 B;  1BT0 A;  2LGD A;  4PS8 A;  2N4F A;  2AYO B;  4K81 A;  3NHE B;  2RSU A;  3RD2 A;  3ZUN A;  4E71 A;  4RM9 A;  2ZCB A;  4B9K A;  1F9J A;  5FR6 A;  3X23 A;  2W9N A;  3SDL C;  1LXD A;  2N7E A;  1E90 A;  2ZCC A;  2ZZP B;  3JSV A;  3H9D A;  4W9E A;  2JY6 A;  4A3P A;  2KDF B;  3L17 A;  1EF1 A;  4TQ0 A;  1V81 A;  1ZKH A;  2GOW A;  3DCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...