2GBNA

Crystal structure of the 35-36 8 glycine insertion mutant of ubiquitin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGGGGGGGGGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbnA00
1WIAA 3M3JA 3CSTA 2UYZB 2O2VB 4AP4C 1E8YA 5JZEB 3RULA 2LVQA 4W9DA 2MX2A 3ZUNA 2MCNB 3WAMA 5HKHA 1BT0A 4URKA 5LXIB 1P98A 3W1SA 1NI2A 2DAFA 2WYQA 3PSEB 4HPLB 3ZO5B 4II3B 3QHTA 4NAWA 4BKTA 2KDBA 2JZ3B 4IWOA 4W9FA 4RM8A 1VCBA 1D3ZA 1YX5B 2JXXA 2CHWA 1WFYA 2BKFA 3N3KB 3PRZA 5KHQA 2D11A 2HJ8A 2N7EA 2KFJA 2IY0B 4DHJD 1OEYJ 2KO3A 1Z2MA 3GZNI 2MBHA 1YIWA 1V9JA 1J8CA 3HM6X 1RLFA 2LRWA 3PV1A 2KC1A 4FHKA 4JLCA 3KYDD 1WGGA 3BY4B 3L17A 5D2MB 4MGYE 3U7DA 2WX1A 3PHWB 4ASWC 3UQAA 4IUMB 4EZLA 2C60A 2KQ7A 5DPRA 4G11A 4HWIB 2J0MA 2KTRB 3AU5A 1H4RA 3D32A 2FUHB 2IO2B 3IHPC 1WX7A 1WXMA 1WF9A 1WXVA 2EMSA 2ZVNA 3RCZA 4MM3A 3ONSA 5FR6A 3M62B 2HD5B 1IP9A 4IM2A 3IFWB 5DPTA 2KVRA 4NJ7A 2LI5A 4W9GA 3QC8B 5AZGA 1TBEA 2MQJA 3X23A 1WJ4A 3A9KB 3Q3JA 4DDID 2KHWB 1K8RB 3APFA 4KIKA 3V61A 4E71A 4F1SA 2LASA 3PREA 5L95C 2N1VA 2L0FA 2ZVOA 4YL8A 4XC2A 2N1WA 2MRPA 4W9KA 2KDFB 3EECA 1V80A 1Z5SB 3NY5A 1V86A 2O6VA 2AEHA 2JF5A 5LXHA 2KKCA 4MH0E 3ZDTA 2C5LC 2MWSB 3EC8A 1EO6A 4BKSD 2L0TA 4ANXA 4AJWA 1L2NA 1H8CA 3I3TB 1E8ZA 4DBGA 3W1SC 2C9WB 4IWQA 2O2VA 2KWVB 4HCPB 1GUAB 1GC6A 1V2YA 2KMCA 3HM3A 3IBEA 3NZUA 2LZ6A 5AZFA 1C1YB 1OGWA 3TL5A 3LDZE 4DHJB 5JH5C 1ZKHA 2GBNA 1J0GA 2LGDA 3GOEA 5C23A 5G55A 3MHSD 1WGYA 1AARA 2K1FA 2DX5B 1M94A 2RR9A 2LVOA 1KM7A 4IC7B 1V49A 1ZW7A 2JUOA 4KDIC 3ML8A 2KMAA 2JY6A 4MEMA 3VHTC 1SIFA 1KOTA 3VUYA 2A5UA 2G3QB 2EMTA 3VVWB 4NPNA 5EDSA 3UINB 2K6QA 3PT2B 5JHBA 4N9F4 2CKHB 3L0WB 3QJZA 2IY1B 2JZZA 4WJQA 4EEWA 3QK0A 3ZNZB 2GMIC 4KZ0A 2KTRA 2KOXA 4MDKE 4BOZB 3APCA 3V6EB 1E8XA 3QQ8B 5DCNA 1E7UA 3HIZA 2IZVB 3OAWA 3C0RB 3T8MA 2ZJDA 4GGQA 3OJ4B 3A9KA 3UGBB 4K81A 2L05A 3QWZB 2DZJA 2LGXA 1P3QU 1SGHA 3HHMA 4G0NB 3ZLZA 2PE6B 1KJTA 3OLMD 4GMVA 4PS8A 2KNBA 1LQBA 2KN5A 2RGFA 3AI5A 2D07B 4FJVB 3B1LX 3PHXB 1WR1A 3V60A 4IW0A 2JVCA 2R2OA 4KV2A 4OVVA 4KDLB 5J18A 3OJ3A 5G2NA 3DVGX 3VH3B 2QHOA 1ISNA 5AZHA 2UWQA 4ZYNA 2LRUA 2Z59B 3LJ3A 2NPTB 4NQKE 5E6PA 3VUXA 4GXBA 4EKUA 1VD2A 3H9DA 2KDIA 2D10A 3DOWA 4PS3A 3K9OB 1LFDA 1OTRB 3DVNV 1WJ6A 1QZEA 4FA6A 2GBKA 2KWUB 3IG3A 4NNJB 1UD7A 2LGYA 2LD9A 1WXSA 3ALBA 3B08A 3UIPB 3IVFA 4GDLB 2MBQA 4PS7A 4X57B 1WZ0A 3DBSA 3TCAA 3DPDA 4GOCA 2RD0A 2GBJA 2XEWA 1FXTB 2LWPA 2KJRA 3U30A 3VH4B 2K8BA 1UBQA 1WXAA 2KC2A 1UELA 4MGZE 3MJWA 5GMVA 4TKNA 4JGHB 1GNUA 4FJYA 2DAJA 4K1RB 2CR5A 2NCNA 3RUIB 2YVCA 2G45B 3WA0A 3VAWA 3EHVA 4LDTB 4BBNC 1WR6E 3KW5B 2RSUA 4HXDA 2MBEA 3PRPB 1WM3A 4ZRJA 1WM2A 1G6JA 3RZFA 2LUEA 1GG3A 5KHOA 3RZWC 3A1QB 2NVUI 1WYWB 3PLUA 2MBOA 2D3GA 2FNJB 3ZTCA 2K39A 1S3SG 4ANWA 4EZJA 3H6NA 2DYBA 3A4RA 4WWPA 4K7WA 4GU2A 4RMAA 3X0WA 2Z0DB 5CHFA 1WGDA 1WE7A 2V3SA 3ZRFA 1WMHB 4NY0A 3B0AA 4W9LA 4BKSA 4E74A 3KUDB 3H7PA 2MLBA 1WJNA 2MSED 3VQIA 2ZEQA 1T0YA 3SDLC 4BKGA 3VXWA 2CHXA 1LM8B 4G50A 4ZRKA 4WJNA 3R7RA 3AULA 2WDTB 3ZDMC 4BVUC 2L76A 3L13A 3UF8A 2ZNVB 4K7SA 2JWZA 3W1YA 4GSWA 3VUWA 3T9LA 4MELA 2IBIB 4PYUA 1NBFC 4A3OA 2NPTA 2KTFA 2J0JA 4WWNA 4IWPA 4B95A 2KQSA 4FJZA 2IYDB 5CX3A 1TGZB 4MSQB 1E90A 4LJOB 3SD5A 4JL9A 1WE6A 2K25A 2KDEB 4ICUA 3DVGY 4GDLA 1X1MA 2L00B 4I6LB 2O6VD 2ZCBA 3VTUA 3ZRCA 3NOBA 1RAXA 4MGKE 1GC7A 3MTNB 3WANA 1R4NI 3V62A 3DBLI 2LXCA 2I1KA 2J7QB 1EF1A 2IO0B 3CSFA 3EFUA 4WAAA 3DVNU 2BWFA 2MP2B 3AU4A 3P2BA 2BKRB 2KLGA 2BYFA 2K8HA 3AXCA 3A9JB 4M8MA 4OVUA 3RT3B 2KLCA 2LVPA 3ZNID 4CYEA 1XT9B 3NHEB 4A3PA 2BWES 4GIVA 2FCMA 3H7SA 3QA8A 3RD2A 3QX1A 2DYMA 3H1UA 3WIMA 3A1QA 1YQBA 2M8SA 2DZMA 4IM3A 4AJYB 2N4FA 4EOYA 1Y8RC 3UIOB 3UQBA 1L7YA 2G4SA 2PPHA 5D7GA 2RPQA 4E3CA 2KZRA 2MBBB 1WZ3A 2AL6A 3PVLA 3ZTDA 2PJHA 2AL3A 2HTHA 2FIDA 2GBMA 3APDA 3N30A 4FLHA 2IO3B 4MSMB 1WMHA 2FIFA 3SHQA 5C1ZA 4W9CA 3DCGA 5E6OA 3S2AA 4EUTA 2C7NB 1UH6A 2N9PC 3DDCB 3V6CB 1F9JA 4II2B 2LJ5A 1E7VA 2KK8A 4HK2A 2AYOB 2G4DB 4DHZE 4KSLC 3A33B 1NDDA 4CHKA 3NZSA 4W9HA 3RYTA 2KX0A 4HDQA 4WJOA 4GB9A 4KZCA 3L54A 4TUUA 5J17A 1P0RA 1UZXB 1WJUA 4FHJA 4WQOB 3VTVA 4B6WA 1P1AA 2JT4B 4RM9A 4NJ6A 2OJRA 2KXJA 4AUQC 2EKEC 1I35A 2D2QA 1YJ1A 4LCDE 3DQVA 2GOWA 1WX9A 2IO1B 1OQYA 4P7IA 4K7UA 3L08A 1WGHA 2BYVE 2HE7A 4XZ4A 1WH3A 5J2RA 1S1QB 1Q5WB 2KFKB 2NR2A 4WJPA 4B9KA 4EZKA 2ZCCA 2KJ6A 2L7RA 4I6PA 4MJSB 3PS6A 4I6NB 3HK0A 3QCAA 2MP2A 2M4NA 1SE9A 2JPHA 5IAAC 3ZVVA 4BBNF 1C3TA 4F8CB 3M63B 4JIOU 4WWOA 5CHWA 2XBBC 3A9JA 3TJPA 3ZW3A 1LXDA 2BYEA 2C7MB 2I1JA 4DDGD 1WGRA 5AEKB 2YLMA 4M0WB 2W9NA 1Q1OA 3VTWA 2DZIA 3ECIA 4DK5A 2BF8B 2ZZPB 1KLVA 1I42A 1E5WA 1JRUA 2BGFA 2ZPYA 3WAOA 5DPWA 3QIJA 2K6DB 2M17A 4DWFA 3M95A 1P9DU 4ANUA 3QARA 4HVBA 4ICVA 1V6EA 2FCSA 5CTRC 1IYFA 2KD0A 2ZNVC 2PEAA 4FN2A 4HPMB 4KVGB 1V5TA 3ENEA 2PE9A 3WAPA 1E8WA 2Z0EB 3JSVB 3NS8A 1YD8U 3PPAA 3TMPB 3WALA 3O65B 2KWCA 3BINA 1OEYA 1Q0WB 2ASQA 2ZPNA 3CF6E 4GDKB 4AOFA 1WI0A 2BPSA 4TQ0A 1IPGA 2KX3A 3QAQA 4HLEA 5LLIA 1HE8A 4EFOA 2V4LA 3JYUA 3ZNHB 3U8ZA 2C7HA 3Q3FA 3PLVA 4PYZA 2OOBB 2XK5B 3PRMB 2JRIB 3KH0A 3K9PB 3N32A 4A20A 3ZKJC 3R3MA 3VFKA 3ZNGC 4IG7B 3SU8X 5IA7A 4IM0A 3A4SC 1V5OA 4ZRIA 2DYOA 4W9JA 4DXAB 1TZ1A 4ZDVA 4BFRA 2MW5A 5E6NA 1PQSA 2B3AA 4M8NA 5BO4B 1XD3B 2CS4A 4NAWB 2L8JA 2DENB 2KFKA 4HDOA 2N7DA 4XX5A 2NBVB 4DHZB 4MJSA 2FAZA 1MG8A 3KVFB 1WX8A 2JRHA 3L10B 1WY8A 3PTFC 4TQ1A 3VDZA 4FBJB 4FADA 4MGIE 5DPSA 1RFAA 2N9EB 1R4MI 4GN1A 4LJPB 3PZDA 2M1MA 2R2QA 1YX6B 4F7ZA 1XQQA 2FCQA 3DBHI 4JQWC 4W9EA 1ZGUB 1EF5A 2DHZA 2KJHB 1RRBA 1UGMA 2V1YA 3KUZA 5TR5A 5JHAA 2WX0A 2KANA 2L3ZA 2MA9B 2N9XA 2M0XA 1GJZA 3KUCB 2NBWB 5D94A 3TIXA 3PGEA 5D6JB 4HCNB 4LDTD 1UBIA 3JVZX 2GBRA 4KIKB 4CO7A 2K8CA 3L16A 4J6IA 2LXAA 2Y5BB 4BOSC 2REXA 3KYCD 3R66C 2DZKA 4NQLB 3ZIMA 1TTNA 5CHVC 1EUVB 4W9IA 3ML9A 1CMXB 2A4ZA 3JSVA 1WRDB 2WWZA 4TV3A 4FULA 2VRRB 2NS5A 1V81A 4HJKA 2J0KA 2O6VB 4GDKA 4AWJA 3H7PB 2AWTA 1U4AA 1A5RA 4KSKC 3JW0X 1J19A 3TBLD 3R7QA 5L83A 2CHZA 3DBRI 2FCNA 4ANVA 4G3XB 3CMMB 2CU1A 2NBUA 2XK5A
chains in the Genus database with same CATH superfamily
3M3JA 2LVQA 4WWMA 3WAMA 1BT0A 1GOZA 1ZUD2 2DAFA 2WYQA 4NAWA 4RM8A 2JXXA 1OEYJ 5D3IB 1YIWA 4JLCA 2WDQB 3NVVA 5D2MB 3U7DA 2VH1A 3MC9A 5DPRA 2LJIA 3AV8A 4HWIB 4RGMA 2IO2B 2FE8A 1WXVA 3ONSA 1VDVA 2KVRA 4H2AA 2IGGA 4NJ7A 2LI5A 3QC8B 3BYTB 3X23A 1QOFA 4DDID 3NG0A 4KIKA 3V61A 4F1SA 5L95C 3PREA 2N1VA 3GE3C 4US9A 1VZ6A 1SJHD 5TSSA 3W5VB 1V80A 1N63A 2WXPA 2BTEA 2KKCA 3Q3MC 2BB5A 1TKEA 1E8ZA 1D5MC 4IWQA 1STEA 2V3PA 4KKIA 3HM3A 3DBRB 3SFEB 5E6JA 5AZFA 4YXDB 1C1YB 1OGWA 2QSDA 3LDZE 5JH5C 1PUTA 2GBNA 1AYFA 1J0GA 2LGDA 1WGYA 1AARA 3TUOA 4IC7B 1KM7A 1V49A 1XLQA 1P7EA 2KMAA 4S17A 1HXYD 1SIFA 4NPNA 1MI0A 3AEDB 3AE9B 4A9AA 3L0WB 2IY1B 4EEWA 3NVZA 3ZNZB 2GMIC 5G5HA 3APCA 3FILB 5DCNA 1DOXA 1DOYA 4K81A 2L05A 2LGXA 3RNFC 3ZLZA 1LQBA 1VLBA 2RGFA 3AI5A 3PHXB 2QJLA 2JU6X 1L0XB 5J18A 3OJ3A 1JRPA 2H88B 3AEEB 2UWQA 1IGCA 3LJ3A 2NPTB 5E6PA 3VUXA 2ACZB 3K9OB 1LFDA 3DVNV 1WJ6A 2LGYA 3UIPB 3ALBA 2BS3B 2MBQA 1WZ0A 1XLNA 4GOCA 2KT7A 1F0ZA 2FUG1 1UBQA 2KC2A 5BMIA 4TKNA 4JGHB 1GNUA 4FJYA 2DAJA 1QOGA 3SR6A 2CR5A 4ARCA 2N9KA 5IO9A 4BBNC 3PRPB 1GPXA 4LNFA 1GG3A 3Q8FA 3A1QB 4ZYSA 5FK9C 3PLUA 2WP9B 2XNAC 2D3GA 4LK0M 2FNJB 4YSYB 2WNMA 3A4RA 2KACA 1LO5D 2N9LA 4US8A 1TY0A 3ZRFA 1VRAB 3B0AA 4W9LA 4E74A 1OQRA 2WLBA 4LTUA 3AE5B 3H7PA 5EE3A 3VQIA 2ZEQA 5HI1A 4WJNA 3IXSA 3AE3B 2L76A 3T9LA 4ZRQA 2IBIB 1K53A 2RPVA 3U52E 2EKIA 1PGAA 1J7BA 1KTKA 4MSQB 1E90A 3SD5A 2K25A 2KDEB 4I6LB 3ZRCA 4MGKE 3MTNB 1JWUD 3AE6B 4ZRPA 1EF1A 4WAAA 1F52A 2MP2B 1TS2A 2JX5A 3NHEB 2R61A 3ZGZA 2BWES 2BB6A 4GIVA 4AQ7A 3H7SA 3H1UA 1SF0A 2M8SA 2DZMA 4EOYA 2PPHA 1BUIC 4E3CA 2KZRA 3PVLA 2DNFA 4KGTA 3N30A 2IO3B 4C4VB 4W9CA 1YOVB 1HZ6A 1TS5A 4LNIA 1MJDA 1YN5A 2N9PC 2K9XA 2BT6A 4JX1C 4YSXB 2AYOB 4DHZE 2BS4B 3RYTA 5IP4D 2M0AA 1JALA 1P0RA 4OZBA 1B1ZA 1I35A 2IO1B 3W5UB 3RNGC 4K7UA 5J2RA 1VJKA 3I9V1 4EZKA 2ZCCA 2KJ6A 2L7RA 4MJSB 4I6NB 4REZA 2JPHA 4BBNF 4JIOU 3A9JA 2ON8A 3ZW3A 1XLOA 2C7MB 2JSVX 1WGRA 2YLMA 3VTWA 3ECIA 2BF8B 4RCOA 1E5WA 4IDIA 2ZPYA 2AQ3B 3MC8A 2M17A 4DWFA 4ANUA 3QARA 2MH7A 5CTRC 4RNAA 3ENEA 1FFUA 2Z0EB 3BK2A 2KWCA 3CF6E 4GDKB 2BPSA 3ZJUA 2V4LA 1C79A 2C7HA 2OOBB 4PK1A 2BW2A 3GB1A 3ZNGC 2WXLA 2NTSA 4W9JA 4DXAB 4ZDVA 4BFRA 4RF0A 3ZXVA 1XD3B 2D3AA 2V4IB 2KFKA 4HDOA 4A55A 1MG8A 1WX8A 1XLPA 2PVGC 4FBJB 3VDZA 5IN7A 1R7SA 1A70A 1UUPA 3PZDA 1MPEA 1XQQA 4C7ZA 1D6EC 1EF5A 2GLSA 3TEZA 2WXJA 1T0SC 3KUZA 2BS2B 4MM3B 2KANA 2L3ZA 1GJZA 1L0VB 4C80A 4YTPB 4YWGG 4C7YA 4J6IA 1JW9D 1XCTL 4P6VF 3RNAC 1IUEA 1V81A 3H7PB 1U4AA 2HTME 3R7QA 1XEEA 2AQ2B 2CU1A 2XK5A 1SE4A 3CSTA 2O2VB 4AP4C 2VZKB 2MX2A 3MHZA 1HEZE 1SSNA 1YQ3B 4QAYA 5EE0A 4URKA 1IYFA 4HPLB 4W9FA 2JZ3B 1D3ZA 1VCBA 1WFYA 3N3KB 3PRZA 5KHQA 4DHJD 2KO3A 1Z2MA 4A6QA 2MBHA 1SIJA 1RLFA 2LRWA 2KC1A 5LNK1 3BY4B 4ASWC 4IUMB 2KQ7A 1JROA 1SBBB 4G11A 2BQQA 1H4RA 1WX7A 3OWEB 2INNE 3M62B 2MJEA 3DBHB 4IM2A 5DPTA 1T0RC 3DWMA 2K3UA 5AZGA 3DWGC 3A9KB 2KHWB 1C78A 1K8RB 3APFA 3BVMA 2ZVOA 1QKZA 1EWYC 1Z5SB 2O6VA 5LXHA 4MH0E 3EC8A 3N9YC 1EO6A 2L0TA 4AJWA 4DBGA 2C9WB 5FR3A 1GUAB 1V2YA 3NZUA 1QLBB 3B2FA 3MHSD 1SB3C 2K1FA 2DX5B 4LNNA 2LVOA 3BK1A 3IAM1 3NS1A 1RWSA 1V1PA 3ML8A 1D4BA 2WQYB 5EDSA 3KWLA 3IT4B 3UINB 1TS4A 5JHBA 4B0EA 3QJZA 2KTRA 1LGRA 2KOXA 4MDKE 1SXTA 1FM0D 2LEKA 1E8XA 3QQ8B 1FRRA 1AW7A 1E7UA 2IZVB 3C0RB 2ZJDA 2KN4A 4GGQA 2ICIA 3ETRA 3AB5A 3QWZB 2DZJA 1SGHA 2PE6B 4GMVA 2L1AA 2D07B 2G9HD 3B1LX 3V60A 1MVKA 4KV2A 1L0YB 3TEXA 5AZHA 2Z59B 4NQKE 4GXBA 1WRIA 5BMGA 4DXFA 4EKUA 2KDIA 2D10A 1OTRB 2K0PA 3IG3A 3P4PB 4PS7A 4X57B 4TMAB 2AX5A 2LWPA 1I4HA 2QIEB 3U30A 1IBXA 1FNWA 5GMVA 4K3BA 2NCNA 3RUIB 3PO0A 2LGSA 1E6EB 3KW5B 4HXDA 1R4NB 1HTQA 5KHOA 2K39A 1S3SG 4ANWA 3H6NA 4WWPA 1NVID 2IPKD 3X0WA 5CHFA 2W3RA 1WMHB 4XDDA 2KMMA 2CHXA 1RYJA 1ESFA 4ZRKA 3AULA 2JYEA 3ZDMC 4BVUC 2ZNVB 3NRZA 1ZXHA 4GSWA 3VUWA 4MELA 4PYUA 2KTFA 1T3QA 4IWPA 2KQSA 3SFDB 2IYDB 1I4RA 1FCLA 3ZJVA 4DQOC 1PYWD 4GDLA 2WXIA 2QDFA 1X1MA 2L00B 4YTNB 1UWXA 1ET9A 1MHXA 3VTUA 3MJ5A 2PVOD 1JMLA 3WANA 4UDUC 1R4NI 1K50A 4A8XC 2KQ4X 2I1KA 1ZE3D 4OHJA 3CSFA 3OG5A 3AU4A 2BKRB 4L2YA 2K8HA 3RT3B 2KLCA 2DWQA 1JQ4A 4WIPA 5C3JB 3QX1A 4YSZB 3WIMA 2N7JA 3UIOB 2LGIA 2G4SA 5D7GA 2RPQA 2AL6A 3ZTDA 2HTHA 2FIDA 2TSSA 4FLHA 3VR9B 3SHQA 5C1ZA 2WDRB 5E6OA 3EUB2 5I4DA 1E7VA 2KK8A 5HG2A 5BYRA 4KSLC 3R8BA 3NZSA 1WXQA 3HUIA 4HDQA 3DHHC 4WJOA 4HEA1 3L54A 4B6WA 1WJUA 3VTVA 1UF0A 4NJ6A 2I38A 2WXOA 2OJRA 2KXJA 4AUQC 1YJ1A 4LCDE 2CU3A 4EE2A 3DQVA 1TIFA 1HQRD 1WX9A 4LNOA 4N58A 2W82A 4N59A 1GB1A 1ENFA 1OQYA 1N6ZA 2D5GA 5EE9A 1E10A 4XZ4A 1S1QB 1FNUA 3PS6A 3BIID 5IAAC 3M63B 5CHWA 2XBBC 3W2DA 3GP7A 3KWVA 4M0WB 3CWIA 3AEGB 2BGFA 5DPWA 5H8YE 2K6DB 1J7AA 1UNSA 2WXMA 2CJNA 4HPMB 1NYRA 4KVGB 1V5TA 3WAPA 3JSVB 3O65B 3BINA 1NENB 1Q0WB 4OZAA 1F2RI 4HLEA 5LLIA 4EFOA 4HJGE 3ZNHB 1FMAD 4D2KA 2JRIB 3Q69A 1FPYA 3ZKJC 3R3MA 2IJ0A 1ZDVA 5IA7A 3A4SC 5E6NA 1PQSA 3DHIC 2CS4A 4NAWB 1L4DB 1UGJA 1L5PA 1MG4A 2N7DA 4XX5A 4DHZB 2J52A 1QT9A 2FAZA 1CZPA 3EGRA 3AECB 4JE3B 5DPSA 1I4QA 2M1MA 3C19A 1C4CA 4HPPA 4W9EA 1ZGUB 2KJHB 3I63C 2V1YA 3GZNB 1MHHE 3NVWA 2ZW1A 1C77A 2M0XA 3KUCB 4M01A 2NBWB 4CQNA 2PMVA 5D6JB 4HCNB 2E6XA 1FIQA 4KIKB 1QILA 2Y5BB 1N61A 4BOSC 4OVZA 4NQLB 3ZIMA 1TTNA 4W9IA 3ML9A 2SAKA 2WWZA 4TV3A 1L4ZB 2J0KA 4AWJA 2AWTA 3GE8C 1VZ8A 1J19A 3JW0X 1IGDA 4ANVA 2FCNA 2KDMA 5JZEB 2V9HA 3Q8BA 4J3OD 4WURA 5LXIB 1P98A 3W1SA 1NI2A 3PSEB 4II3B 4BKTA 3UI3A 4IWOA 1WSPA 2W55A 2CHWA 2BKFA 3T3NA 2N7EA 2HJ8A 2BYTA 2KFJA 2IY0B 3GZNI 2Y3AA 5AUKA 4WH4A 3KYDD 3L17A 2X8XX 1TY2A 4MGYE 3IAS1 2WX1A 3PHWB 1KLGD 3I57A 4BZAA 3VRAB 2J0MA 3ABVB 1AN8A 3BWUD 1TT5B 1I4GA 2FUHB 2NMQA 2J42A 4YTMB 1WXMA 2EMSA 3RCZA 1CQVA 5FR6A 1KH0A 1TBEA 2MQJA 1WJ4A 3FC4A 1V1OA 1TKGA 4ITKA 2GRIA 1FXAA 4XC2A 2N1WA 2MRPA 4W9KA 3NY5A 4Q2JA 1YN3A 2AEHA 2JF5A 3ZDTA 2C5LC 2MWSB 1QF6A 2V3NA 3EA6A 4BKSD 4ANXA 3I3TB 3W1SC 4JWUC 1GC6A 2KMCA 3IBEA 4XYCA 2LZ6A 3TL5A 4NJCA 3HRDD 3KQ4A 1ZKHA 2L52A 1M94A 2RR9A 1C9FA 2JUOA 3U2SC 4KDIC 2YEPF 3BYYB 1XO3A 3VHTC 1ROEA 4ZOHC 1KOTA 3VUYA 1UWMA 2G3QB 2EMTA 1ET6A 3Q8AA 2PIAA 2K6QA 2CKHB 2UU7A 2IGHA 3HIZA 1XF5L 2RDGA 3OAWA 2FBWB 4AS1A 3T8MA 1MFWA 2N0SB 3HHMA 4RGOS 4G0NB 1KJTA 3OLMD 4TSSA 2KNBA 2KN5A 4PT5A 1NYQA 2DLBA 3HVDA 1YJIA 1PGXA 1WR1A 2WXQA 3GS2A 4IW0A 4OVVA 4KDLB 3RMKC 2INCC 2LFIA 1C4AA 1JCKB 3DVGX 3VH3B 1ISNA 4ZYNA 2LRUA 4KGSA 3H9DA 4RGNA 4PS3A 1SE3A 2RDBC 1QZEA 1NEKB 4NNJB 2LD9A 1WXSA 1JWAD 3IVFA 4WQMA 3TCAA 3DPDA 2RD0A 2GBJA 2XEWA 1FXTB 2KJRA 3NVYA 3VH4B 2K8BA 1JWSD 1UELA 4MGZE 2MEKA 3MJWA 3AM9A 4K1RB 4RH6A 2G45B 3WA0A 3E56A 2RSUA 4XGAB 2PW9A 1WM2A 1CJEA 2NVUI 2L32A 1WYWB 2RMMA 4JWSC 2MBOA 2SEBD 2DYBA 4K7WA 2Z0DB 1BXTA 2LMCA 3NUHB 4BKSA 3KUDB 4IKGA 3MP9A 1Q10A 1T0YA 4BKGA 1FO4A 3VXWA 3RNBC 1LM8B 3P4SB 1SE2A 2WDTB 3L13A 3UF8A 3BVZA 4K7SA 1KLUD 3ZQ4A 3H8HA 3NZ3A 1NBFC 2NPTA 4M02A 5G5GA 3URYA 4FJZA 5CX3A 3AE2B 4ICUA 4JL9A 2ZCBA 2WS3B 3NOBA 1RAXA 4ZHOA 1T6BX 3V62A 3DBLI 2IO0B 1DGJA 2BWFA 3P2BA 2KLGA 4M8MA 3A9JB 2QEJC 4CYEA 2LVPA 4A3PA 2FCMA 2WXKA 1TKYA 3RD2A 2DYMA 2INDC 3LYYA 3A1QA 1YQBA 3N20C 4P1BC 1L7YA 1WZ3A 4NAMA 2PJHA 4HRSA 2JQRB 4MSMB 2FIFA 2GI9A 3ZJTA 2KVZA 3DCGA 5BMHA 2Y5PA 1F2RC 3N1ZC 3U4EG 2C7NB 1UH6A 4II2B 2M56B 1ZOYB 3VRBB 4CHKA 5T8IA 4W9HA 2KX0A 4GB9A 2IDYA 3ZXRA 1SJED 1TZOA 4TUUA 3AE1B 4WQOB 2L83A 5AUIA 2JT4B 4RM9A 2EKEC 1N60A 4OW0A 3HVZA 2GOWA 4XWWA 4L1BA 4P7IA 2JZPA 1WGHA 2BYVE 2HE7A 1EM7A 1FEHA 3Q14C 1Q5WB 2KFKB 2NR2A 4WJPA 1DOIA 4C56C 2Z8LA 2MP2A 2ONQA 4GLSC 4WWOA 3TJPA 1LXDA 3BZDB 5HHDG 4DDGD 1V8CA 1T0QC 5AEKB 1SEBD 1Q1OA 2DZIA 4DK5A 2ZZPB 1KLVA 4MT5A 4DXGA 1JRUA 3WAOA 4JPSA 3T3OA 3QIJA 1P7FA 1HTOA 3M95A 4ICVA 3Q2AC 2KD0A 4C4VA 4FN2A 3R2IA 4ARIA 3P1MA 3WCQA 2AQ1B 2BBCA 1I4XA 3NS8A 3PPAA 3WALA 2OEDA 2ZPNA 4AOFA 1FNVA 4RF1A 1WI0A 4TQ0A 3LB8C 3QAQA 3JYUA 3U8ZA 3Q3FA 2XK5B 3KH0A 3N32A 1JWMD 3N1XC 3VFKA 3TEYA 4IG7B 3SU8X 4IM0A 1V5OA 2DYOA 2H89B 3RNEC 2WU2B 1TZ1A 3RN9C 2MW5A 2EELA 5BO4B 1OQQA 2L8JA 2VZKD 4P1CC 3P4QB 4MJSA 3EFCA 2BVCA 2JRHA 3L10B 1WY8A 3PTFC 4TQ1A 3KLSX 3FAHA 4FADA 1RFAA 4GN1A 4LJPB 4MACA 2QMTA 1YX6B 4F7ZA 1E0ZA 2G1EA 4JQWC 4KX6B 1VZ7A 1UGMA 5TR5A 5JHAA 4C00A 2WGSA 3AEAB 2JYTA 4BAXA 4XWTA 3AEBB 3PGEA 3TSSA 4KGRA 3JVZX 2K8CA 3L16A 3KYCD 3RPFC 3AE8B 1EUVB 5CHVC 1Y56A 2W3SA 4FULA 2NS5A 4HJKA 2O6VB 4GDKA 2WDVB 3DBRI 2K5PA 3Q8EA 4G3XB 3CMMB 2NBUA 1WIAA 2UYZB 1E8YA 3RULA 4W9DA 2RDHA 3ZUNA 2MCNB 1I4PA 5HKHA 1QOAA 2LHDA 4WAFA 3ZO5B 3QHTA 2KDBA 4O1NA 3BVGA 1YX5B 2PLPA 1V1PB 1B9RA 2D11A 5D3DA 1J8CA 1V9JA 3HM6X 1FD6A 3PV1A 4FHKA 1WGGA 4P16A 3AE4B 1C4PA 3C8YA 3UQAA 4EZLA 2C60A 3CIRB 2KTRB 3AU5A 3IHPC 3D32A 1WF9A 2ZVNA 4MM3A 4ZHPA 2HD5B 1IP9A 3IFWB 4W9GA 2B76B 3FKYA 2M19A 3Q3JA 3Q3NC 1GAQB 3IT6B 2K22A 4E71A 2LASA 3V05A 2LUMA 2L0FA 4YL8A 1RFKA 3AE7B 2KDFB 3EECA 2J4XA 1V86A 5HFYA 3VR8B 2MHJA 1N5WA 1L2NA 1H8CA 3AH7A 1WWTA 3W9CB 1YNTE 2O2VA 2KWVB 4HCPB 3U7ZA 4DHJB 1AWDA 3GOEA 5C23A 5G55A 3P63A 1VR9A 4XE0A 3SEBA 1IBXB 1ZW7A 1M4VA 2KWDA 2JY6A 4MEMA 2VH2A 2A5UA 3VVWB 3PT2B 4OZCA 4N9F4 2JZZA 4WJQA 1L6VA 3QK0A 4KZ0A 4BOZB 3V6EB 5EE1A 2OHFA 1ZP0B 3OJ4B 3E9SA 3A9KA 3UGBB 2XN9C 1D5XC 1P3QU 4PS8A 3P42A 4FJVB 2JVCA 2R2OA 3O13A 2HJ1A 5MPOA 2OJWA 4K3CA 5G2NA 1HZ5A 3N1YC 3LXFA 2QHOA 1WYGA 3Q8CA 2D3CA 1VD2A 2QC8A 3DOWA 4FA6A 2GBKA 2KWUB 4KKJA 1UD7A 3B08A 1YN4A 3V3XA 1J7CA 4GDLB 3DBSA 5GXGB 1V97A 1E9MA 3PZ7A 5IKCM 2WXGA 2ZW0A 1WXAA 3Q6BA 1K51A 2I2YA 2YVCA 3VAWA 3EHVA 4LDTB 1WR6E 2MBEA 1WM3A 4ZRJA 1G6JA 3R2TA 2LUEA 3RZFA 2JWUA 4MH8A 2QILA 3RZWC 3AN1A 3AMZA 3ZTCA 4HKZE 4EZJA 4GU2A 4RMAA 1WGDA 1WE7A 2V3SA 4B0MA 4NY0A 1WGKA 2MLBA 3MC0B 1WJNA 2DBYA 2NTTA 2MSED 3SDLC 4G50A 3R7RA 1F77A 1FFVA 2JWZA 2Y5CA 4A3OA 3I5JC 2J0JA 4WWNA 4B95A 5C2TB 1CK1A 1TGZB 4LJOB 1WE6A 5BYSA 1ZDXA 3DVGY 2O6VD 1GC7A 5JXVA 2LXCA 2QCZA 2J7QB 1FXIA 3EFUA 3DVNU 1C76A 2BYFA 1DYQA 3P4RB 3AXCA 3ZNID 4OVUA 1XT9B 3PZ8A 3QA8A 2YEPB 4IM3A 4N6EB 4RGTA 4AJYB 2N4FA 1Y8RC 3UQBA 1ZPSA 1I7HA 2MBBB 4ACFA 1PGBA 1JWBD 2AL3A 2GBMA 3APDA 3RI7C 4IOIE 1WMHA 2PKOA 1EU4A 3S2AA 4EUTA 1FRDA 3DDCB 3V6CB 4HKQA 1QQRA 1F9JA 2LJ5A 4HK2A 2G4DB 2E3TA 3A33B 1PDXA 1NDDA 2WXRA 4KZCA 3RFZB 5J17A 1UZXB 4FHJA 1P1AA 5FKAC 3J9CA 2D2QA 5BYQA 4NZLB 3MFGA 3Q3OC 2V0GA 3L08A 1WH3A 1YJJA 4B9KA 1HA5A 4I6PA 1KF6B 1KRHA 3TEWA 3HK0A 3QCAA 1NI3A 4XDCA 2M4NA 1SE9A 3ZVVA 1C3TA 4F8CB 3DBLB 1PFDA 2BYEA 5H92C 1OFFA 2I1JA 3FILA 2WHIA 4LNKA 2W9NA 1I42A 3AEFB 3NJTA 1ACCA 1R4MB 1E7PB 1P9DU 2X38A 1TS3A 1KFYB 5IOIA 1V6EA 2FCSA 2ZNVC 2PEAA 2PTLA 1D5ZC 3DHGC 2PE9A 1E8WA 3TMPB 1YD8U 4HVBA 1OEYA 2ASQA 2Q5WD 1IPGA 2KX3A 3L4PA 1HE8A 2KYWA 3PLVA 4PYZA 4L23A 3PRMB 4YT0B 3K9PB 4A20A 4M00A 4USAA 4ZRIA 1FCCC 1GB4A 2B3AA 4M8NA 2GB1A 1BMLC 3B9JA 1EU3A 2WU5B 2DENB 4A90A 2NBVB 4RFBA 3KVFB 1TJEA 2MJDA 4LLGM 4R3DA 4MGIE 2N9EB 1R4MI 2D3BA 1ZXIA 2R2QA 1XXGA 2IGDA 1TYGB 2LHEA 2FCQA 2WXHA 3DBHI 4M0WA 2DHZA 4S0RA 1EWCA 1QOBA 2WXFA 3B2GA 1YMHE 1RRBA 2KAJA 2W54A 2WX0A 2MA9B 2N9XA 2CJOA 2J53A 1L6UA 5D94A 3TIXA 4LDTD 1UBIA 2GBRA 4HROA 4CO7A 2LXAA 1N62A 2REXA 3R66C 2DZKA 3ZYYX 1N5XA 2HDEA 1CMXB 2A4ZA 3JSVA 1WRDB 2VRRB 1F1HA 1T5XD 1K52A 1YQ4B 1RM6C 2MJ3A 1A5RA 4KSKC 4FXCA 3RNCC 2INPE 3TBLD 2JXTA 5L83A 1XCQL 2CHZA 3W1YA 2WXNA
chains in the Genus database with same CATH topology
1WIAA 3M3JA 3CSTA 2UYZB 2O2VB 4AP4C 1E8YA 5JZEB 3RULA 2LVQA 4W9DA 2MX2A 3ZUNA 2MCNB 3WAMA 5HKHA 1BT0A 4URKA 5LXIB 1P98A 3W1SA 1NI2A 2DAFA 2WYQA 3PSEB 4HPLB 3ZO5B 4II3B 3QHTA 4NAWA 4BKTA 2KDBA 2JZ3B 4IWOA 4W9FA 4RM8A 1VCBA 1D3ZA 1YX5B 2JXXA 2CHWA 1WFYA 2BKFA 3N3KB 3PRZA 5KHQA 2D11A 2HJ8A 2N7EA 2KFJA 2IY0B 4DHJD 1OEYJ 2KO3A 1Z2MA 3GZNI 2MBHA 1YIWA 1V9JA 1J8CA 3HM6X 1RLFA 2LRWA 3PV1A 2KC1A 4FHKA 4JLCA 3KYDD 1WGGA 3BY4B 3L17A 5D2MB 4MGYE 3U7DA 2WX1A 3PHWB 4ASWC 3UQAA 4IUMB 4EZLA 2C60A 2KQ7A 5DPRA 4G11A 4HWIB 2J0MA 2KTRB 3AU5A 1H4RA 3D32A 2FUHB 2IO2B 3IHPC 1WX7A 1WXMA 1WF9A 1WXVA 2EMSA 2ZVNA 3RCZA 4MM3A 3ONSA 5FR6A 3M62B 2HD5B 1IP9A 4IM2A 3IFWB 5DPTA 2KVRA 4NJ7A 2LI5A 4W9GA 3QC8B 5AZGA 1TBEA 2MQJA 3X23A 1WJ4A 3A9KB 3Q3JA 4DDID 2KHWB 1K8RB 3APFA 4KIKA 3V61A 4E71A 4F1SA 2LASA 3PREA 5L95C 2N1VA 2L0FA 2ZVOA 4YL8A 4XC2A 2N1WA 2MRPA 4W9KA 2KDFB 3EECA 1V80A 1Z5SB 3NY5A 1V86A 2O6VA 2AEHA 2JF5A 5LXHA 2KKCA 4MH0E 3ZDTA 2C5LC 2MWSB 3EC8A 1EO6A 4BKSD 2L0TA 4ANXA 4AJWA 1L2NA 1H8CA 3I3TB 1E8ZA 4DBGA 3W1SC 2C9WB 4IWQA 2O2VA 2KWVB 4HCPB 1GUAB 1GC6A 1V2YA 2KMCA 3HM3A 3IBEA 3NZUA 2LZ6A 5AZFA 1C1YB 1OGWA 3TL5A 3LDZE 4DHJB 5JH5C 1ZKHA 2GBNA 1J0GA 2LGDA 3GOEA 5C23A 5G55A 3MHSD 1WGYA 1AARA 2K1FA 2DX5B 1M94A 2RR9A 2LVOA 1KM7A 4IC7B 1V49A 1ZW7A 2JUOA 4KDIC 3ML8A 2KMAA 2JY6A 4MEMA 3VHTC 1SIFA 1KOTA 3VUYA 2A5UA 2G3QB 2EMTA 3VVWB 4NPNA 5EDSA 3UINB 2K6QA 3PT2B 5JHBA 4N9F4 2CKHB 3L0WB 3QJZA 2IY1B 2JZZA 4WJQA 4EEWA 3QK0A 3ZNZB 2GMIC 4KZ0A 2KTRA 2KOXA 4MDKE 4BOZB 3APCA 3V6EB 1E8XA 3QQ8B 5DCNA 1E7UA 3HIZA 2IZVB 3OAWA 3C0RB 3T8MA 2ZJDA 4GGQA 3OJ4B 3A9KA 3UGBB 4K81A 2L05A 3QWZB 2DZJA 2LGXA 1P3QU 1SGHA 3HHMA 4G0NB 3ZLZA 2PE6B 1KJTA 3OLMD 4GMVA 4PS8A 2KNBA 1LQBA 2KN5A 2RGFA 3AI5A 2D07B 4FJVB 3B1LX 3PHXB 1WR1A 3V60A 4IW0A 2JVCA 2R2OA 4KV2A 4OVVA 4KDLB 5J18A 3OJ3A 5G2NA 3DVGX 3VH3B 2QHOA 1ISNA 5AZHA 2UWQA 4ZYNA 2LRUA 2Z59B 3LJ3A 2NPTB 4NQKE 5E6PA 3VUXA 4GXBA 4EKUA 1VD2A 3H9DA 2KDIA 2D10A 3DOWA 4PS3A 3K9OB 1LFDA 1OTRB 3DVNV 1WJ6A 1QZEA 4FA6A 2GBKA 2KWUB 3IG3A 4NNJB 1UD7A 2LGYA 2LD9A 1WXSA 3ALBA 3B08A 3UIPB 3IVFA 4GDLB 2MBQA 4PS7A 4X57B 1WZ0A 3DBSA 3TCAA 3DPDA 4GOCA 2RD0A 2GBJA 2XEWA 1FXTB 2LWPA 2KJRA 3U30A 3VH4B 2K8BA 1UBQA 1WXAA 2KC2A 1UELA 4MGZE 3MJWA 5GMVA 4TKNA 4JGHB 1GNUA 4FJYA 2DAJA 4K1RB 2CR5A 2NCNA 3RUIB 2YVCA 2G45B 3WA0A 3VAWA 3EHVA 4LDTB 4BBNC 1WR6E 3KW5B 2RSUA 4HXDA 2MBEA 3PRPB 1WM3A 4ZRJA 1WM2A 1G6JA 3RZFA 2LUEA 1GG3A 5KHOA 3RZWC 3A1QB 2NVUI 1WYWB 3PLUA 2MBOA 2D3GA 2FNJB 3ZTCA 2K39A 1S3SG 4ANWA 4EZJA 3H6NA 2DYBA 3A4RA 4WWPA 4K7WA 4GU2A 4RMAA 3X0WA 2Z0DB 5CHFA 1WGDA 1WE7A 2V3SA 3ZRFA 1WMHB 4NY0A 3B0AA 4W9LA 4BKSA 4E74A 3KUDB 3H7PA 2MLBA 1WJNA 2MSED 3VQIA 2ZEQA 1T0YA 3SDLC 4BKGA 3VXWA 2CHXA 1LM8B 4G50A 4ZRKA 4WJNA 3R7RA 3AULA 2WDTB 3ZDMC 4BVUC 2L76A 3L13A 3UF8A 2ZNVB 4K7SA 2JWZA 3W1YA 4GSWA 3VUWA 3T9LA 4MELA 2IBIB 4PYUA 1NBFC 4A3OA 2NPTA 2KTFA 2J0JA 4WWNA 4IWPA 4B95A 2KQSA 4FJZA 2IYDB 5CX3A 1TGZB 4MSQB 1E90A 4LJOB 3SD5A 4JL9A 1WE6A 2K25A 2KDEB 4ICUA 3DVGY 4GDLA 1X1MA 2L00B 4I6LB 2O6VD 2ZCBA 3VTUA 3ZRCA 3NOBA 1RAXA 4MGKE 1GC7A 3MTNB 3WANA 1R4NI 3V62A 3DBLI 2LXCA 2I1KA 2J7QB 1EF1A 2IO0B 3CSFA 3EFUA 4WAAA 3DVNU 2BWFA 2MP2B 3AU4A 3P2BA 2BKRB 2KLGA 2BYFA 2K8HA 3AXCA 3A9JB 4M8MA 4OVUA 3RT3B 2KLCA 2LVPA 3ZNID 4CYEA 1XT9B 3NHEB 4A3PA 2BWES 4GIVA 2FCMA 3H7SA 3QA8A 3RD2A 3QX1A 2DYMA 3H1UA 3WIMA 3A1QA 1YQBA 2M8SA 2DZMA 4IM3A 4AJYB 2N4FA 4EOYA 1Y8RC 3UIOB 3UQBA 1L7YA 2G4SA 2PPHA 5D7GA 2RPQA 4E3CA 2KZRA 2MBBB 1WZ3A 2AL6A 3PVLA 3ZTDA 2PJHA 2AL3A 2HTHA 2FIDA 2GBMA 3APDA 3N30A 4FLHA 2IO3B 4MSMB 1WMHA 2FIFA 3SHQA 5C1ZA 4W9CA 3DCGA 5E6OA 3S2AA 4EUTA 2C7NB 1UH6A 2N9PC 3DDCB 3V6CB 1F9JA 4II2B 2LJ5A 1E7VA 2KK8A 4HK2A 2AYOB 2G4DB 4DHZE 4KSLC 3A33B 1NDDA 4CHKA 3NZSA 4W9HA 3RYTA 2KX0A 4HDQA 4WJOA 4GB9A 4KZCA 3L54A 4TUUA 5J17A 1P0RA 1UZXB 1WJUA 4FHJA 4WQOB 3VTVA 4B6WA 1P1AA 2JT4B 4RM9A 4NJ6A 2OJRA 2KXJA 4AUQC 2EKEC 1I35A 2D2QA 1YJ1A 4LCDE 3DQVA 2GOWA 1WX9A 2IO1B 1OQYA 4P7IA 4K7UA 3L08A 1WGHA 2BYVE 2HE7A 4XZ4A 1WH3A 5J2RA 1S1QB 1Q5WB 2KFKB 2NR2A 4WJPA 4B9KA 4EZKA 2ZCCA 2KJ6A 2L7RA 4I6PA 4MJSB 3PS6A 4I6NB 3HK0A 3QCAA 2MP2A 2M4NA 1SE9A 2JPHA 5IAAC 3ZVVA 4BBNF 1C3TA 4F8CB 3M63B 4JIOU 4WWOA 5CHWA 2XBBC 3A9JA 3TJPA 3ZW3A 1LXDA 2BYEA 2C7MB 2I1JA 4DDGD 1WGRA 5AEKB 2YLMA 4M0WB 2W9NA 1Q1OA 3VTWA 2DZIA 3ECIA 4DK5A 2BF8B 2ZZPB 1KLVA 1I42A 1E5WA 1JRUA 2BGFA 2ZPYA 3WAOA 5DPWA 3QIJA 2K6DB 2M17A 4DWFA 3M95A 1P9DU 4ANUA 3QARA 4HVBA 4ICVA 1V6EA 2FCSA 5CTRC 1IYFA 2KD0A 2ZNVC 2PEAA 4FN2A 4HPMB 4KVGB 1V5TA 3ENEA 2PE9A 3WAPA 1E8WA 2Z0EB 3JSVB 3NS8A 1YD8U 3PPAA 3TMPB 3WALA 3O65B 2KWCA 3BINA 1OEYA 1Q0WB 2ASQA 2ZPNA 3CF6E 4GDKB 4AOFA 1WI0A 2BPSA 4TQ0A 1IPGA 2KX3A 3QAQA 4HLEA 5LLIA 1HE8A 4EFOA 2V4LA 3JYUA 3ZNHB 3U8ZA 2C7HA 3Q3FA 3PLVA 4PYZA 2OOBB 2XK5B 3PRMB 2JRIB 3KH0A 3K9PB 3N32A 4A20A 3ZKJC 3R3MA 3VFKA 3ZNGC 4IG7B 3SU8X 5IA7A 4IM0A 3A4SC 1V5OA 4ZRIA 2DYOA 4W9JA 4DXAB 1TZ1A 4ZDVA 4BFRA 2MW5A 5E6NA 1PQSA 2B3AA 4M8NA 5BO4B 1XD3B 2CS4A 4NAWB 2L8JA 2DENB 2KFKA 4HDOA 2N7DA 4XX5A 2NBVB 4DHZB 4MJSA 2FAZA 1MG8A 3KVFB 1WX8A 2JRHA 3L10B 1WY8A 3PTFC 4TQ1A 3VDZA 4FBJB 4FADA 4MGIE 5DPSA 1RFAA 2N9EB 1R4MI 4GN1A 4LJPB 3PZDA 2M1MA 2R2QA 1YX6B 4F7ZA 1XQQA 2FCQA 3DBHI 4JQWC 4W9EA 1ZGUB 1EF5A 2DHZA 2KJHB 1RRBA 1UGMA 2V1YA 3KUZA 5TR5A 5JHAA 2WX0A 2KANA 2L3ZA 2MA9B 2N9XA 2M0XA 1GJZA 3KUCB 2NBWB 5D94A 3TIXA 3PGEA 5D6JB 4HCNB 4LDTD 1UBIA 3JVZX 2GBRA 4KIKB 4CO7A 2K8CA 3L16A 4J6IA 2LXAA 2Y5BB 4BOSC 2REXA 3KYCD 3R66C 2DZKA 4NQLB 3ZIMA 1TTNA 5CHVC 1EUVB 4W9IA 3ML9A 1CMXB 2A4ZA 3JSVA 1WRDB 2WWZA 4TV3A 4FULA 2VRRB 2NS5A 1V81A 4HJKA 2J0KA 2O6VB 4GDKA 4AWJA 3H7PB 2AWTA 1U4AA 1A5RA 4KSKC 3JW0X 1J19A 3TBLD 3R7QA 5L83A 2CHZA 3DBRI 2FCNA 4ANVA 4G3XB 3CMMB 2CU1A 2NBUA 2XK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIA A;  3M3J A;  3CST A;  2UYZ B;  2O2V B;  4AP4 C;  1E8Y A;  5JZE B;  3RUL A;  2LVQ A;  4W9D A;  2MX2 A;  3ZUN A;  2MCN B;  3WAM A;  5HKH A;  1BT0 A;  4URK A;  5LXI B;  1P98 A;  3W1S A;  1NI2 A;  2DAF A;  2WYQ A;  3PSE B;  4HPL B;  3ZO5 B;  4II3 B;  3QHT A;  4NAW A;  4BKT A;  2KDB A;  2JZ3 B;  4IWO A;  4W9F A;  4RM8 A;  1VCB A;  1D3Z A;  1YX5 B;  2JXX A;  2CHW A;  1WFY A;  2BKF A;  3N3K B;  3PRZ A;  5KHQ A;  2D11 A;  2HJ8 A;  2N7E A;  2KFJ A;  2IY0 B;  4DHJ D;  1OEY J;  2KO3 A;  1Z2M A;  3GZN I;  2MBH A;  1YIW A;  1V9J A;  1J8C A;  3HM6 X;  1RLF A;  2LRW A;  3PV1 A;  2KC1 A;  4FHK A;  4JLC A;  3KYD D;  1WGG A;  3BY4 B;  3L17 A;  5D2M B;  4MGY E;  3U7D A;  2WX1 A;  3PHW B;  4ASW C;  3UQA A;  4IUM B;  4EZL A;  2C60 A;  2KQ7 A;  5DPR A;  4G11 A;  4HWI B;  2J0M A;  2KTR B;  3AU5 A;  1H4R A;  3D32 A;  2FUH B;  2IO2 B;  3IHP C;  1WX7 A;  1WXM A;  1WF9 A;  1WXV A;  2EMS A;  2ZVN A;  3RCZ A;  4MM3 A;  3ONS A;  5FR6 A;  3M62 B;  2HD5 B;  1IP9 A;  4IM2 A;  3IFW B;  5DPT A;  2KVR A;  4NJ7 A;  2LI5 A;  4W9G A;  3QC8 B;  5AZG A;  1TBE A;  2MQJ A;  3X23 A;  1WJ4 A;  3A9K B;  3Q3J A;  4DDI D;  2KHW B;  1K8R B;  3APF A;  4KIK A;  3V61 A;  4E71 A;  4F1S A;  2LAS A;  3PRE A;  5L95 C;  2N1V A;  2L0F A;  2ZVO A;  4YL8 A;  4XC2 A;  2N1W A;  2MRP A;  4W9K A;  2KDF B;  3EEC A;  1V80 A;  1Z5S B;  3NY5 A;  1V86 A;  2O6V A;  2AEH A;  2JF5 A;  5LXH A;  2KKC A;  4MH0 E;  3ZDT A;  2C5L C;  2MWS B;  3EC8 A;  1EO6 A;  4BKS D;  2L0T A;  4ANX A;  4AJW A;  1L2N A;  1H8C A;  3I3T B;  1E8Z A;  4DBG A;  3W1S C;  2C9W B;  4IWQ A;  2O2V A;  2KWV B;  4HCP B;  1GUA B;  1GC6 A;  1V2Y A;  2KMC A;  3HM3 A;  3IBE A;  3NZU A;  2LZ6 A;  5AZF A;  1C1Y B;  1OGW A;  3TL5 A;  3LDZ E;  4DHJ B;  5JH5 C;  1ZKH A;  2GBN A;  1J0G A;  2LGD A;  3GOE A;  5C23 A;  5G55 A;  3MHS D;  1WGY A;  1AAR A;  2K1F A;  2DX5 B;  1M94 A;  2RR9 A;  2LVO A;  1KM7 A;  4IC7 B;  1V49 A;  1ZW7 A;  2JUO A;  4KDI C;  3ML8 A;  2KMA A;  2JY6 A;  4MEM A;  3VHT C;  1SIF A;  1KOT A;  3VUY A;  2A5U A;  2G3Q B;  2EMT A;  3VVW B;  4NPN A;  5EDS A;  3UIN B;  2K6Q A;  3PT2 B;  5JHB A;  4N9F 4;  2CKH B;  3L0W B;  3QJZ A;  2IY1 B;  2JZZ A;  4WJQ A;  4EEW A;  3QK0 A;  3ZNZ B;  2GMI C;  4KZ0 A;  2KTR A;  2KOX A;  4MDK E;  4BOZ B;  3APC A;  3V6E B;  1E8X A;  3QQ8 B;  5DCN A;  1E7U A;  3HIZ A;  2IZV B;  3OAW A;  3C0R B;  3T8M A;  2ZJD A;  4GGQ A;  3OJ4 B;  3A9K A;  3UGB B;  4K81 A;  2L05 A;  3QWZ B;  2DZJ A;  2LGX A;  1P3Q U;  1SGH A;  3HHM A;  4G0N B;  3ZLZ A;  2PE6 B;  1KJT A;  3OLM D;  4GMV A;  4PS8 A;  2KNB A;  1LQB A;  2KN5 A;  2RGF A;  3AI5 A;  2D07 B;  4FJV B;  3B1L X;  3PHX B;  1WR1 A;  3V60 A;  4IW0 A;  2JVC A;  2R2O A;  4KV2 A;  4OVV A;  4KDL B;  5J18 A;  3OJ3 A;  5G2N A;  3DVG X;  3VH3 B;  2QHO A;  1ISN A;  5AZH A;  2UWQ A;  4ZYN A;  2LRU A;  2Z59 B;  3LJ3 A;  2NPT B;  4NQK E;  5E6P A;  3VUX A;  4GXB A;  4EKU A;  1VD2 A;  3H9D A;  2KDI A;  2D10 A;  3DOW A;  4PS3 A;  3K9O B;  1LFD A;  1OTR B;  3DVN V;  1WJ6 A;  1QZE A;  4FA6 A;  2GBK A;  2KWU B;  3IG3 A;  4NNJ B;  1UD7 A;  2LGY A;  2LD9 A;  1WXS A;  3ALB A;  3B08 A;  3UIP B;  3IVF A;  4GDL B;  2MBQ A;  4PS7 A;  4X57 B;  1WZ0 A;  3DBS A;  3TCA A;  3DPD A;  4GOC A;  2RD0 A;  2GBJ A;  2XEW A;  1FXT B;  2LWP A;  2KJR A;  3U30 A;  3VH4 B;  2K8B A;  1UBQ A;  1WXA A;  2KC2 A;  1UEL A;  4MGZ E;  3MJW A;  5GMV A;  4TKN A;  4JGH B;  1GNU A;  4FJY A;  2DAJ A;  4K1R B;  2CR5 A;  2NCN A;  3RUI B;  2YVC A;  2G45 B;  3WA0 A;  3VAW A;  3EHV A;  4LDT B;  4BBN C;  1WR6 E;  3KW5 B;  2RSU A;  4HXD A;  2MBE A;  3PRP B;  1WM3 A;  4ZRJ A;  1WM2 A;  1G6J A;  3RZF A;  2LUE A;  1GG3 A;  5KHO A;  3RZW C;  3A1Q B;  2NVU I;  1WYW B;  3PLU A;  2MBO A;  2D3G A;  2FNJ B;  3ZTC A;  2K39 A;  1S3S G;  4ANW A;  4EZJ A;  3H6N A;  2DYB A;  3A4R A;  4WWP A;  4K7W A;  4GU2 A;  4RMA A;  3X0W A;  2Z0D B;  5CHF A;  1WGD A;  1WE7 A;  2V3S A;  3ZRF A;  1WMH B;  4NY0 A;  3B0A A;  4W9L A;  4BKS A;  4E74 A;  3KUD B;  3H7P A;  2MLB A;  1WJN A;  2MSE D;  3VQI A;  2ZEQ A;  1T0Y A;  3SDL C;  4BKG A;  3VXW A;  2CHX A;  1LM8 B;  4G50 A;  4ZRK A;  4WJN A;  3R7R A;  3AUL A;  2WDT B;  3ZDM C;  4BVU C;  2L76 A;  3L13 A;  3UF8 A;  2ZNV B;  4K7S A;  2JWZ A;  3W1Y A;  4GSW A;  3VUW A;  3T9L A;  4MEL A;  2IBI B;  4PYU A;  1NBF C;  4A3O A;  2NPT A;  2KTF A;  2J0J A;  4WWN A;  4IWP A;  4B95 A;  2KQS A;  4FJZ A;  2IYD B;  5CX3 A;  1TGZ B;  4MSQ B;  1E90 A;  4LJO B;  3SD5 A;  4JL9 A;  1WE6 A;  2K25 A;  2KDE B;  4ICU A;  3DVG Y;  4GDL A;  1X1M A;  2L00 B;  4I6L B;  2O6V D;  2ZCB A;  3VTU A;  3ZRC A;  3NOB A;  1RAX A;  4MGK E;  1GC7 A;  3MTN B;  3WAN A;  1R4N I;  3V62 A;  3DBL I;  2LXC A;  2I1K A;  2J7Q B;  1EF1 A;  2IO0 B;  3CSF A;  3EFU A;  4WAA A;  3DVN U;  2BWF A;  2MP2 B;  3AU4 A;  3P2B A;  2BKR B;  2KLG A;  2BYF A;  2K8H A;  3AXC A;  3A9J B;  4M8M A;  4OVU A;  3RT3 B;  2KLC A;  2LVP A;  3ZNI D;  4CYE A;  1XT9 B;  3NHE B;  4A3P A;  2BWE S;  4GIV A;  2FCM A;  3H7S A;  3QA8 A;  3RD2 A;  3QX1 A;  2DYM A;  3H1U A;  3WIM A;  3A1Q A;  1YQB A;  2M8S A;  2DZM A;  4IM3 A;  4AJY B;  2N4F A;  4EOY A;  1Y8R C;  3UIO B;  3UQB A;  1L7Y A;  2G4S A;  2PPH A;  5D7G A;  2RPQ A;  4E3C A;  2KZR A;  2MBB B;  1WZ3 A;  2AL6 A;  3PVL A;  3ZTD A;  2PJH A;  2AL3 A;  2HTH A;  2FID A;  2GBM A;  3APD A;  3N30 A;  4FLH A;  2IO3 B;  4MSM B;  1WMH A;  2FIF A;  3SHQ A;  5C1Z A;  4W9C A;  3DCG A;  5E6O A;  3S2A A;  4EUT A;  2C7N B;  1UH6 A;  2N9P C;  3DDC B;  3V6C B;  1F9J A;  4II2 B;  2LJ5 A;  1E7V A;  2KK8 A;  4HK2 A;  2AYO B;  2G4D B;  4DHZ E;  4KSL C;  3A33 B;  1NDD A;  4CHK A;  3NZS A;  4W9H A;  3RYT A;  2KX0 A;  4HDQ A;  4WJO A;  4GB9 A;  4KZC A;  3L54 A;  4TUU A;  5J17 A;  1P0R A;  1UZX B;  1WJU A;  4FHJ A;  4WQO B;  3VTV A;  4B6W A;  1P1A A;  2JT4 B;  4RM9 A;  4NJ6 A;  2OJR A;  2KXJ A;  4AUQ C;  2EKE C;  1I35 A;  2D2Q A;  1YJ1 A;  4LCD E;  3DQV A;  2GOW A;  1WX9 A;  2IO1 B;  1OQY A;  4P7I A;  4K7U A;  3L08 A;  1WGH A;  2BYV E;  2HE7 A;  4XZ4 A;  1WH3 A;  5J2R A;  1S1Q B;  1Q5W B;  2KFK B;  2NR2 A;  4WJP A;  4B9K A;  4EZK A;  2ZCC A;  2KJ6 A;  2L7R A;  4I6P A;  4MJS B;  3PS6 A;  4I6N B;  3HK0 A;  3QCA A;  2MP2 A;  2M4N A;  1SE9 A;  2JPH A;  5IAA C;  3ZVV A;  4BBN F;  1C3T A;  4F8C B;  3M63 B;  4JIO U;  4WWO A;  5CHW A;  2XBB C;  3A9J A;  3TJP A;  3ZW3 A;  1LXD A;  2BYE A;  2C7M B;  2I1J A;  4DDG D;  1WGR A;  5AEK B;  2YLM A;  4M0W B;  2W9N A;  1Q1O A;  3VTW A;  2DZI A;  3ECI A;  4DK5 A;  2BF8 B;  2ZZP B;  1KLV A;  1I42 A;  1E5W A;  1JRU A;  2BGF A;  2ZPY A;  3WAO A;  5DPW A;  3QIJ A;  2K6D B;  2M17 A;  4DWF A;  3M95 A;  1P9D U;  4ANU A;  3QAR A;  4HVB A;  4ICV A;  1V6E A;  2FCS A;  5CTR C;  1IYF A;  2KD0 A;  2ZNV C;  2PEA A;  4FN2 A;  4HPM B;  4KVG B;  1V5T A;  3ENE A;  2PE9 A;  3WAP A;  1E8W A;  2Z0E B;  3JSV B;  3NS8 A;  1YD8 U;  3PPA A;  3TMP B;  3WAL A;  3O65 B;  2KWC A;  3BIN A;  1OEY A;  1Q0W B;  2ASQ A;  2ZPN A;  3CF6 E;  4GDK B;  4AOF A;  1WI0 A;  2BPS A;  4TQ0 A;  1IPG A;  2KX3 A;  3QAQ A;  4HLE A;  5LLI A;  1HE8 A;  4EFO A;  2V4L A;  3JYU A;  3ZNH B;  3U8Z A;  2C7H A;  3Q3F A;  3PLV A;  4PYZ A;  2OOB B;  2XK5 B;  3PRM B;  2JRI B;  3KH0 A;  3K9P B;  3N32 A;  4A20 A;  3ZKJ C;  3R3M A;  3VFK A;  3ZNG C;  4IG7 B;  3SU8 X;  5IA7 A;  4IM0 A;  3A4S C;  1V5O A;  4ZRI A;  2DYO A;  4W9J A;  4DXA B;  1TZ1 A;  4ZDV A;  4BFR A;  2MW5 A;  5E6N A;  1PQS A;  2B3A A;  4M8N A;  5BO4 B;  1XD3 B;  2CS4 A;  4NAW B;  2L8J A;  2DEN B;  2KFK A;  4HDO A;  2N7D A;  4XX5 A;  2NBV B;  4DHZ B;  4MJS A;  2FAZ A;  1MG8 A;  3KVF B;  1WX8 A;  2JRH A;  3L10 B;  1WY8 A;  3PTF C;  4TQ1 A;  3VDZ A;  4FBJ B;  4FAD A;  4MGI E;  5DPS A;  1RFA A;  2N9E B;  1R4M I;  4GN1 A;  4LJP B;  3PZD A;  2M1M A;  2R2Q A;  1YX6 B;  4F7Z A;  1XQQ A;  2FCQ A;  3DBH I;  4JQW C;  4W9E A;  1ZGU B;  1EF5 A;  2DHZ A;  2KJH B;  1RRB A;  1UGM A;  2V1Y A;  3KUZ A;  5TR5 A;  5JHA A;  2WX0 A;  2KAN A;  2L3Z A;  2MA9 B;  2N9X A;  2M0X A;  1GJZ A;  3KUC B;  2NBW B;  5D94 A;  3TIX A;  3PGE A;  5D6J B;  4HCN B;  4LDT D;  1UBI A;  3JVZ X;  2GBR A;  4KIK B;  4CO7 A;  2K8C A;  3L16 A;  4J6I A;  2LXA A;  2Y5B B;  4BOS C;  2REX A;  3KYC D;  3R66 C;  2DZK A;  4NQL B;  3ZIM A;  1TTN A;  5CHV C;  1EUV B;  4W9I A;  3ML9 A;  1CMX B;  2A4Z A;  3JSV A;  1WRD B;  2WWZ A;  4TV3 A;  4FUL A;  2VRR B;  2NS5 A;  1V81 A;  4HJK A;  2J0K A;  2O6V B;  4GDK A;  4AWJ A;  3H7P B;  2AWT A;  1U4A A;  1A5R A;  4KSK C;  3JW0 X;  1J19 A;  3TBL D;  3R7Q A;  5L83 A;  2CHZ A;  3DBR I;  2FCN A;  4ANV A;  4G3X B;  3CMM B;  2CU1 A;  2NBU A;  2XK5 A; 
#chains in the Genus database with same CATH topology
 3M3J A;  2LVQ A;  4WWM A;  3WAM A;  1BT0 A;  1GOZ A;  1ZUD 2;  2DAF A;  2WYQ A;  4NAW A;  4RM8 A;  2JXX A;  1OEY J;  5D3I B;  1YIW A;  4JLC A;  2WDQ B;  3NVV A;  5D2M B;  3U7D A;  2VH1 A;  3MC9 A;  5DPR A;  2LJI A;  3AV8 A;  4HWI B;  4RGM A;  2IO2 B;  2FE8 A;  1WXV A;  3ONS A;  1VDV A;  2KVR A;  4H2A A;  2IGG A;  4NJ7 A;  2LI5 A;  3QC8 B;  3BYT B;  3X23 A;  1QOF A;  4DDI D;  3NG0 A;  4KIK A;  3V61 A;  4F1S A;  5L95 C;  3PRE A;  2N1V A;  3GE3 C;  4US9 A;  1VZ6 A;  1SJH D;  5TSS A;  3W5V B;  1V80 A;  1N63 A;  2WXP A;  2BTE A;  2KKC A;  3Q3M C;  2BB5 A;  1TKE A;  1E8Z A;  1D5M C;  4IWQ A;  1STE A;  2V3P A;  4KKI A;  3HM3 A;  3DBR B;  3SFE B;  5E6J A;  5AZF A;  4YXD B;  1C1Y B;  1OGW A;  2QSD A;  3LDZ E;  5JH5 C;  1PUT A;  2GBN A;  1AYF A;  1J0G A;  2LGD A;  1WGY A;  1AAR A;  3TUO A;  4IC7 B;  1KM7 A;  1V49 A;  1XLQ A;  1P7E A;  2KMA A;  4S17 A;  1HXY D;  1SIF A;  4NPN A;  1MI0 A;  3AED B;  3AE9 B;  4A9A A;  3L0W B;  2IY1 B;  4EEW A;  3NVZ A;  3ZNZ B;  2GMI C;  5G5H A;  3APC A;  3FIL B;  5DCN A;  1DOX A;  1DOY A;  4K81 A;  2L05 A;  2LGX A;  3RNF C;  3ZLZ A;  1LQB A;  1VLB A;  2RGF A;  3AI5 A;  3PHX B;  2QJL A;  2JU6 X;  1L0X B;  5J18 A;  3OJ3 A;  1JRP A;  2H88 B;  3AEE B;  2UWQ A;  1IGC A;  3LJ3 A;  2NPT B;  5E6P A;  3VUX A;  2ACZ B;  3K9O B;  1LFD A;  3DVN V;  1WJ6 A;  2LGY A;  3UIP B;  3ALB A;  2BS3 B;  2MBQ A;  1WZ0 A;  1XLN A;  4GOC A;  2KT7 A;  1F0Z A;  2FUG 1;  1UBQ A;  2KC2 A;  5BMI A;  4TKN A;  4JGH B;  1GNU A;  4FJY A;  2DAJ A;  1QOG A;  3SR6 A;  2CR5 A;  4ARC A;  2N9K A;  5IO9 A;  4BBN C;  3PRP B;  1GPX A;  4LNF A;  1GG3 A;  3Q8F A;  3A1Q B;  4ZYS A;  5FK9 C;  3PLU A;  2WP9 B;  2XNA C;  2D3G A;  4LK0 M;  2FNJ B;  4YSY B;  2WNM A;  3A4R A;  2KAC A;  1LO5 D;  2N9L A;  4US8 A;  1TY0 A;  3ZRF A;  1VRA B;  3B0A A;  4W9L A;  4E74 A;  1OQR A;  2WLB A;  4LTU A;  3AE5 B;  3H7P A;  5EE3 A;  3VQI A;  2ZEQ A;  5HI1 A;  4WJN A;  3IXS A;  3AE3 B;  2L76 A;  3T9L A;  4ZRQ A;  2IBI B;  1K53 A;  2RPV A;  3U52 E;  2EKI A;  1PGA A;  1J7B A;  1KTK A;  4MSQ B;  1E90 A;  3SD5 A;  2K25 A;  2KDE B;  4I6L B;  3ZRC A;  4MGK E;  3MTN B;  1JWU D;  3AE6 B;  4ZRP A;  1EF1 A;  4WAA A;  1F52 A;  2MP2 B;  1TS2 A;  2JX5 A;  3NHE B;  2R61 A;  3ZGZ A;  2BWE S;  2BB6 A;  4GIV A;  4AQ7 A;  3H7S A;  3H1U A;  1SF0 A;  2M8S A;  2DZM A;  4EOY A;  2PPH A;  1BUI C;  4E3C A;  2KZR A;  3PVL A;  2DNF A;  4KGT A;  3N30 A;  2IO3 B;  4C4V B;  4W9C A;  1YOV B;  1HZ6 A;  1TS5 A;  4LNI A;  1MJD A;  1YN5 A;  2N9P C;  2K9X A;  2BT6 A;  4JX1 C;  4YSX B;  2AYO B;  4DHZ E;  2BS4 B;  3RYT A;  5IP4 D;  2M0A A;  1JAL A;  1P0R A;  4OZB A;  1B1Z A;  1I35 A;  2IO1 B;  3W5U B;  3RNG C;  4K7U A;  5J2R A;  1VJK A;  3I9V 1;  4EZK A;  2ZCC A;  2KJ6 A;  2L7R A;  4MJS B;  4I6N B;  4REZ A;  2JPH A;  4BBN F;  4JIO U;  3A9J A;  2ON8 A;  3ZW3 A;  1XLO A;  2C7M B;  2JSV X;  1WGR A;  2YLM A;  3VTW A;  3ECI A;  2BF8 B;  4RCO A;  1E5W A;  4IDI A;  2ZPY A;  2AQ3 B;  3MC8 A;  2M17 A;  4DWF A;  4ANU A;  3QAR A;  2MH7 A;  5CTR C;  4RNA A;  3ENE A;  1FFU A;  2Z0E B;  3BK2 A;  2KWC A;  3CF6 E;  4GDK B;  2BPS A;  3ZJU A;  2V4L A;  1C79 A;  2C7H A;  2OOB B;  4PK1 A;  2BW2 A;  3GB1 A;  3ZNG C;  2WXL A;  2NTS A;  4W9J A;  4DXA B;  4ZDV A;  4BFR A;  4RF0 A;  3ZXV A;  1XD3 B;  2D3A A;  2V4I B;  2KFK A;  4HDO A;  4A55 A;  1MG8 A;  1WX8 A;  1XLP A;  2PVG C;  4FBJ B;  3VDZ A;  5IN7 A;  1R7S A;  1A70 A;  1UUP A;  3PZD A;  1MPE A;  1XQQ A;  4C7Z A;  1D6E C;  1EF5 A;  2GLS A;  3TEZ A;  2WXJ A;  1T0S C;  3KUZ A;  2BS2 B;  4MM3 B;  2KAN A;  2L3Z A;  1GJZ A;  1L0V B;  4C80 A;  4YTP B;  4YWG G;  4C7Y A;  4J6I A;  1JW9 D;  1XCT L;  4P6V F;  3RNA C;  1IUE A;  1V81 A;  3H7P B;  1U4A A;  2HTM E;  3R7Q A;  1XEE A;  2AQ2 B;  2CU1 A;  2XK5 A;  1SE4 A;  3CST A;  2O2V B;  4AP4 C;  2VZK B;  2MX2 A;  3MHZ A;  1HEZ E;  1SSN A;  1YQ3 B;  4QAY A;  5EE0 A;  4URK A;  1IYF A;  4HPL B;  4W9F A;  2JZ3 B;  1D3Z A;  1VCB A;  1WFY A;  3N3K B;  3PRZ A;  5KHQ A;  4DHJ D;  2KO3 A;  1Z2M A;  4A6Q A;  2MBH A;  1SIJ A;  1RLF A;  2LRW A;  2KC1 A;  5LNK 1;  3BY4 B;  4ASW C;  4IUM B;  2KQ7 A;  1JRO A;  1SBB B;  4G11 A;  2BQQ A;  1H4R A;  1WX7 A;  3OWE B;  2INN E;  3M62 B;  2MJE A;  3DBH B;  4IM2 A;  5DPT A;  1T0R C;  3DWM A;  2K3U A;  5AZG A;  3DWG C;  3A9K B;  2KHW B;  1C78 A;  1K8R B;  3APF A;  3BVM A;  2ZVO A;  1QKZ A;  1EWY C;  1Z5S B;  2O6V A;  5LXH A;  4MH0 E;  3EC8 A;  3N9Y C;  1EO6 A;  2L0T A;  4AJW A;  4DBG A;  2C9W B;  5FR3 A;  1GUA B;  1V2Y A;  3NZU A;  1QLB B;  3B2F A;  3MHS D;  1SB3 C;  2K1F A;  2DX5 B;  4LNN A;  2LVO A;  3BK1 A;  3IAM 1;  3NS1 A;  1RWS A;  1V1P A;  3ML8 A;  1D4B A;  2WQY B;  5EDS A;  3KWL A;  3IT4 B;  3UIN B;  1TS4 A;  5JHB A;  4B0E A;  3QJZ A;  2KTR A;  1LGR A;  2KOX A;  4MDK E;  1SXT A;  1FM0 D;  2LEK A;  1E8X A;  3QQ8 B;  1FRR A;  1AW7 A;  1E7U A;  2IZV B;  3C0R B;  2ZJD A;  2KN4 A;  4GGQ A;  2ICI A;  3ETR A;  3AB5 A;  3QWZ B;  2DZJ A;  1SGH A;  2PE6 B;  4GMV A;  2L1A A;  2D07 B;  2G9H D;  3B1L X;  3V60 A;  1MVK A;  4KV2 A;  1L0Y B;  3TEX A;  5AZH A;  2Z59 B;  4NQK E;  4GXB A;  1WRI A;  5BMG A;  4DXF A;  4EKU A;  2KDI A;  2D10 A;  1OTR B;  2K0P A;  3IG3 A;  3P4P B;  4PS7 A;  4X57 B;  4TMA B;  2AX5 A;  2LWP A;  1I4H A;  2QIE B;  3U30 A;  1IBX A;  1FNW A;  5GMV A;  4K3B A;  2NCN A;  3RUI B;  3PO0 A;  2LGS A;  1E6E B;  3KW5 B;  4HXD A;  1R4N B;  1HTQ A;  5KHO A;  2K39 A;  1S3S G;  4ANW A;  3H6N A;  4WWP A;  1NVI D;  2IPK D;  3X0W A;  5CHF A;  2W3R A;  1WMH B;  4XDD A;  2KMM A;  2CHX A;  1RYJ A;  1ESF A;  4ZRK A;  3AUL A;  2JYE A;  3ZDM C;  4BVU C;  2ZNV B;  3NRZ A;  1ZXH A;  4GSW A;  3VUW A;  4MEL A;  4PYU A;  2KTF A;  1T3Q A;  4IWP A;  2KQS A;  3SFD B;  2IYD B;  1I4R A;  1FCL A;  3ZJV A;  4DQO C;  1PYW D;  4GDL A;  2WXI A;  2QDF A;  1X1M A;  2L00 B;  4YTN B;  1UWX A;  1ET9 A;  1MHX A;  3VTU A;  3MJ5 A;  2PVO D;  1JML A;  3WAN A;  4UDU C;  1R4N I;  1K50 A;  4A8X C;  2KQ4 X;  2I1K A;  1ZE3 D;  4OHJ A;  3CSF A;  3OG5 A;  3AU4 A;  2BKR B;  4L2Y A;  2K8H A;  3RT3 B;  2KLC A;  2DWQ A;  1JQ4 A;  4WIP A;  5C3J B;  3QX1 A;  4YSZ B;  3WIM A;  2N7J A;  3UIO B;  2LGI A;  2G4S A;  5D7G A;  2RPQ A;  2AL6 A;  3ZTD A;  2HTH A;  2FID A;  2TSS A;  4FLH A;  3VR9 B;  3SHQ A;  5C1Z A;  2WDR B;  5E6O A;  3EUB 2;  5I4D A;  1E7V A;  2KK8 A;  5HG2 A;  5BYR A;  4KSL C;  3R8B A;  3NZS A;  1WXQ A;  3HUI A;  4HDQ A;  3DHH C;  4WJO A;  4HEA 1;  3L54 A;  4B6W A;  1WJU A;  3VTV A;  1UF0 A;  4NJ6 A;  2I38 A;  2WXO A;  2OJR A;  2KXJ A;  4AUQ C;  1YJ1 A;  4LCD E;  2CU3 A;  4EE2 A;  3DQV A;  1TIF A;  1HQR D;  1WX9 A;  4LNO A;  4N58 A;  2W82 A;  4N59 A;  1GB1 A;  1ENF A;  1OQY A;  1N6Z A;  2D5G A;  5EE9 A;  1E10 A;  4XZ4 A;  1S1Q B;  1FNU A;  3PS6 A;  3BII D;  5IAA C;  3M63 B;  5CHW A;  2XBB C;  3W2D A;  3GP7 A;  3KWV A;  4M0W B;  3CWI A;  3AEG B;  2BGF A;  5DPW A;  5H8Y E;  2K6D B;  1J7A A;  1UNS A;  2WXM A;  2CJN A;  4HPM B;  1NYR A;  4KVG B;  1V5T A;  3WAP A;  3JSV B;  3O65 B;  3BIN A;  1NEN B;  1Q0W B;  4OZA A;  1F2R I;  4HLE A;  5LLI A;  4EFO A;  4HJG E;  3ZNH B;  1FMA D;  4D2K A;  2JRI B;  3Q69 A;  1FPY A;  3ZKJ C;  3R3M A;  2IJ0 A;  1ZDV A;  5IA7 A;  3A4S C;  5E6N A;  1PQS A;  3DHI C;  2CS4 A;  4NAW B;  1L4D B;  1UGJ A;  1L5P A;  1MG4 A;  2N7D A;  4XX5 A;  4DHZ B;  2J52 A;  1QT9 A;  2FAZ A;  1CZP A;  3EGR A;  3AEC B;  4JE3 B;  5DPS A;  1I4Q A;  2M1M A;  3C19 A;  1C4C A;  4HPP A;  4W9E A;  1ZGU B;  2KJH B;  3I63 C;  2V1Y A;  3GZN B;  1MHH E;  3NVW A;  2ZW1 A;  1C77 A;  2M0X A;  3KUC B;  4M01 A;  2NBW B;  4CQN A;  2PMV A;  5D6J B;  4HCN B;  2E6X A;  1FIQ A;  4KIK B;  1QIL A;  2Y5B B;  1N61 A;  4BOS C;  4OVZ A;  4NQL B;  3ZIM A;  1TTN A;  4W9I A;  3ML9 A;  2SAK A;  2WWZ A;  4TV3 A;  1L4Z B;  2J0K A;  4AWJ A;  2AWT A;  3GE8 C;  1VZ8 A;  1J19 A;  3JW0 X;  1IGD A;  4ANV A;  2FCN A;  2KDM A;  5JZE B;  2V9H A;  3Q8B A;  4J3O D;  4WUR A;  5LXI B;  1P98 A;  3W1S A;  1NI2 A;  3PSE B;  4II3 B;  4BKT A;  3UI3 A;  4IWO A;  1WSP A;  2W55 A;  2CHW A;  2BKF A;  3T3N A;  2N7E A;  2HJ8 A;  2BYT A;  2KFJ A;  2IY0 B;  3GZN I;  2Y3A A;  5AUK A;  4WH4 A;  3KYD D;  3L17 A;  2X8X X;  1TY2 A;  4MGY E;  3IAS 1;  2WX1 A;  3PHW B;  1KLG D;  3I57 A;  4BZA A;  3VRA B;  2J0M A;  3ABV B;  1AN8 A;  3BWU D;  1TT5 B;  1I4G A;  2FUH B;  2NMQ A;  2J42 A;  4YTM B;  1WXM A;  2EMS A;  3RCZ A;  1CQV A;  5FR6 A;  1KH0 A;  1TBE A;  2MQJ A;  1WJ4 A;  3FC4 A;  1V1O A;  1TKG A;  4ITK A;  2GRI A;  1FXA A;  4XC2 A;  2N1W A;  2MRP A;  4W9K A;  3NY5 A;  4Q2J A;  1YN3 A;  2AEH A;  2JF5 A;  3ZDT A;  2C5L C;  2MWS B;  1QF6 A;  2V3N A;  3EA6 A;  4BKS D;  4ANX A;  3I3T B;  3W1S C;  4JWU C;  1GC6 A;  2KMC A;  3IBE A;  4XYC A;  2LZ6 A;  3TL5 A;  4NJC A;  3HRD D;  3KQ4 A;  1ZKH A;  2L52 A;  1M94 A;  2RR9 A;  1C9F A;  2JUO A;  3U2S C;  4KDI C;  2YEP F;  3BYY B;  1XO3 A;  3VHT C;  1ROE A;  4ZOH C;  1KOT A;  3VUY A;  1UWM A;  2G3Q B;  2EMT A;  1ET6 A;  3Q8A A;  2PIA A;  2K6Q A;  2CKH B;  2UU7 A;  2IGH A;  3HIZ A;  1XF5 L;  2RDG A;  3OAW A;  2FBW B;  4AS1 A;  3T8M A;  1MFW A;  2N0S B;  3HHM A;  4RGO S;  4G0N B;  1KJT A;  3OLM D;  4TSS A;  2KNB A;  2KN5 A;  4PT5 A;  1NYQ A;  2DLB A;  3HVD A;  1YJI A;  1PGX A;  1WR1 A;  2WXQ A;  3GS2 A;  4IW0 A;  4OVV A;  4KDL B;  3RMK C;  2INC C;  2LFI A;  1C4A A;  1JCK B;  3DVG X;  3VH3 B;  1ISN A;  4ZYN A;  2LRU A;  4KGS A;  3H9D A;  4RGN A;  4PS3 A;  1SE3 A;  2RDB C;  1QZE A;  1NEK B;  4NNJ B;  2LD9 A;  1WXS A;  1JWA D;  3IVF A;  4WQM A;  3TCA A;  3DPD A;  2RD0 A;  2GBJ A;  2XEW A;  1FXT B;  2KJR A;  3NVY A;  3VH4 B;  2K8B A;  1JWS D;  1UEL A;  4MGZ E;  2MEK A;  3MJW A;  3AM9 A;  4K1R B;  4RH6 A;  2G45 B;  3WA0 A;  3E56 A;  2RSU A;  4XGA B;  2PW9 A;  1WM2 A;  1CJE A;  2NVU I;  2L32 A;  1WYW B;  2RMM A;  4JWS C;  2MBO A;  2SEB D;  2DYB A;  4K7W A;  2Z0D B;  1BXT A;  2LMC A;  3NUH B;  4BKS A;  3KUD B;  4IKG A;  3MP9 A;  1Q10 A;  1T0Y A;  4BKG A;  1FO4 A;  3VXW A;  3RNB C;  1LM8 B;  3P4S B;  1SE2 A;  2WDT B;  3L13 A;  3UF8 A;  3BVZ A;  4K7S A;  1KLU D;  3ZQ4 A;  3H8H A;  3NZ3 A;  1NBF C;  2NPT A;  4M02 A;  5G5G A;  3URY A;  4FJZ A;  5CX3 A;  3AE2 B;  4ICU A;  4JL9 A;  2ZCB A;  2WS3 B;  3NOB A;  1RAX A;  4ZHO A;  1T6B X;  3V62 A;  3DBL I;  2IO0 B;  1DGJ A;  2BWF A;  3P2B A;  2KLG A;  4M8M A;  3A9J B;  2QEJ C;  4CYE A;  2LVP A;  4A3P A;  2FCM A;  2WXK A;  1TKY A;  3RD2 A;  2DYM A;  2IND C;  3LYY A;  3A1Q A;  1YQB A;  3N20 C;  4P1B C;  1L7Y A;  1WZ3 A;  4NAM A;  2PJH A;  4HRS A;  2JQR B;  4MSM B;  2FIF A;  2GI9 A;  3ZJT A;  2KVZ A;  3DCG A;  5BMH A;  2Y5P A;  1F2R C;  3N1Z C;  3U4E G;  2C7N B;  1UH6 A;  4II2 B;  2M56 B;  1ZOY B;  3VRB B;  4CHK A;  5T8I A;  4W9H A;  2KX0 A;  4GB9 A;  2IDY A;  3ZXR A;  1SJE D;  1TZO A;  4TUU A;  3AE1 B;  4WQO B;  2L83 A;  5AUI A;  2JT4 B;  4RM9 A;  2EKE C;  1N60 A;  4OW0 A;  3HVZ A;  2GOW A;  4XWW A;  4L1B A;  4P7I A;  2JZP A;  1WGH A;  2BYV E;  2HE7 A;  1EM7 A;  1FEH A;  3Q14 C;  1Q5W B;  2KFK B;  2NR2 A;  4WJP A;  1DOI A;  4C56 C;  2Z8L A;  2MP2 A;  2ONQ A;  4GLS C;  4WWO A;  3TJP A;  1LXD A;  3BZD B;  5HHD G;  4DDG D;  1V8C A;  1T0Q C;  5AEK B;  1SEB D;  1Q1O A;  2DZI A;  4DK5 A;  2ZZP B;  1KLV A;  4MT5 A;  4DXG A;  1JRU A;  3WAO A;  4JPS A;  3T3O A;  3QIJ A;  1P7F A;  1HTO A;  3M95 A;  4ICV A;  3Q2A C;  2KD0 A;  4C4V A;  4FN2 A;  3R2I A;  4ARI A;  3P1M A;  3WCQ A;  2AQ1 B;  2BBC A;  1I4X A;  3NS8 A;  3PPA A;  3WAL A;  2OED A;  2ZPN A;  4AOF A;  1FNV A;  4RF1 A;  1WI0 A;  4TQ0 A;  3LB8 C;  3QAQ A;  3JYU A;  3U8Z A;  3Q3F A;  2XK5 B;  3KH0 A;  3N32 A;  1JWM D;  3N1X C;  3VFK A;  3TEY A;  4IG7 B;  3SU8 X;  4IM0 A;  1V5O A;  2DYO A;  2H89 B;  3RNE C;  2WU2 B;  1TZ1 A;  3RN9 C;  2MW5 A;  2EEL A;  5BO4 B;  1OQQ A;  2L8J A;  2VZK D;  4P1C C;  3P4Q B;  4MJS A;  3EFC A;  2BVC A;  2JRH A;  3L10 B;  1WY8 A;  3PTF C;  4TQ1 A;  3KLS X;  3FAH A;  4FAD A;  1RFA A;  4GN1 A;  4LJP B;  4MAC A;  2QMT A;  1YX6 B;  4F7Z A;  1E0Z A;  2G1E A;  4JQW C;  4KX6 B;  1VZ7 A;  1UGM A;  5TR5 A;  5JHA A;  4C00 A;  2WGS A;  3AEA B;  2JYT A;  4BAX A;  4XWT A;  3AEB B;  3PGE A;  3TSS A;  4KGR A;  3JVZ X;  2K8C A;  3L16 A;  3KYC D;  3RPF C;  3AE8 B;  1EUV B;  5CHV C;  1Y56 A;  2W3S A;  4FUL A;  2NS5 A;  4HJK A;  2O6V B;  4GDK A;  2WDV B;  3DBR I;  2K5P A;  3Q8E A;  4G3X B;  3CMM B;  2NBU A;  1WIA A;  2UYZ B;  1E8Y A;  3RUL A;  4W9D A;  2RDH A;  3ZUN A;  2MCN B;  1I4P A;  5HKH A;  1QOA A;  2LHD A;  4WAF A;  3ZO5 B;  3QHT A;  2KDB A;  4O1N A;  3BVG A;  1YX5 B;  2PLP A;  1V1P B;  1B9R A;  2D11 A;  5D3D A;  1J8C A;  1V9J A;  3HM6 X;  1FD6 A;  3PV1 A;  4FHK A;  1WGG A;  4P16 A;  3AE4 B;  1C4P A;  3C8Y A;  3UQA A;  4EZL A;  2C60 A;  3CIR B;  2KTR B;  3AU5 A;  3IHP C;  3D32 A;  1WF9 A;  2ZVN A;  4MM3 A;  4ZHP A;  2HD5 B;  1IP9 A;  3IFW B;  4W9G A;  2B76 B;  3FKY A;  2M19 A;  3Q3J A;  3Q3N C;  1GAQ B;  3IT6 B;  2K22 A;  4E71 A;  2LAS A;  3V05 A;  2LUM A;  2L0F A;  4YL8 A;  1RFK A;  3AE7 B;  2KDF B;  3EEC A;  2J4X A;  1V86 A;  5HFY A;  3VR8 B;  2MHJ A;  1N5W A;  1L2N A;  1H8C A;  3AH7 A;  1WWT A;  3W9C B;  1YNT E;  2O2V A;  2KWV B;  4HCP B;  3U7Z A;  4DHJ B;  1AWD A;  3GOE A;  5C23 A;  5G55 A;  3P63 A;  1VR9 A;  4XE0 A;  3SEB A;  1IBX B;  1ZW7 A;  1M4V A;  2KWD A;  2JY6 A;  4MEM A;  2VH2 A;  2A5U A;  3VVW B;  3PT2 B;  4OZC A;  4N9F 4;  2JZZ A;  4WJQ A;  1L6V A;  3QK0 A;  4KZ0 A;  4BOZ B;  3V6E B;  5EE1 A;  2OHF A;  1ZP0 B;  3OJ4 B;  3E9S A;  3A9K A;  3UGB B;  2XN9 C;  1D5X C;  1P3Q U;  4PS8 A;  3P42 A;  4FJV B;  2JVC A;  2R2O A;  3O13 A;  2HJ1 A;  5MPO A;  2OJW A;  4K3C A;  5G2N A;  1HZ5 A;  3N1Y C;  3LXF A;  2QHO A;  1WYG A;  3Q8C A;  2D3C A;  1VD2 A;  2QC8 A;  3DOW A;  4FA6 A;  2GBK A;  2KWU B;  4KKJ A;  1UD7 A;  3B08 A;  1YN4 A;  3V3X A;  1J7C A;  4GDL B;  3DBS A;  5GXG B;  1V97 A;  1E9M A;  3PZ7 A;  5IKC M;  2WXG A;  2ZW0 A;  1WXA A;  3Q6B A;  1K51 A;  2I2Y A;  2YVC A;  3VAW A;  3EHV A;  4LDT B;  1WR6 E;  2MBE A;  1WM3 A;  4ZRJ A;  1G6J A;  3R2T A;  2LUE A;  3RZF A;  2JWU A;  4MH8 A;  2QIL A;  3RZW C;  3AN1 A;  3AMZ A;  3ZTC A;  4HKZ E;  4EZJ A;  4GU2 A;  4RMA A;  1WGD A;  1WE7 A;  2V3S A;  4B0M A;  4NY0 A;  1WGK A;  2MLB A;  3MC0 B;  1WJN A;  2DBY A;  2NTT A;  2MSE D;  3SDL C;  4G50 A;  3R7R A;  1F77 A;  1FFV A;  2JWZ A;  2Y5C A;  4A3O A;  3I5J C;  2J0J A;  4WWN A;  4B95 A;  5C2T B;  1CK1 A;  1TGZ B;  4LJO B;  1WE6 A;  5BYS A;  1ZDX A;  3DVG Y;  2O6V D;  1GC7 A;  5JXV A;  2LXC A;  2QCZ A;  2J7Q B;  1FXI A;  3EFU A;  3DVN U;  1C76 A;  2BYF A;  1DYQ A;  3P4R B;  3AXC A;  3ZNI D;  4OVU A;  1XT9 B;  3PZ8 A;  3QA8 A;  2YEP B;  4IM3 A;  4N6E B;  4RGT A;  4AJY B;  2N4F A;  1Y8R C;  3UQB A;  1ZPS A;  1I7H A;  2MBB B;  4ACF A;  1PGB A;  1JWB D;  2AL3 A;  2GBM A;  3APD A;  3RI7 C;  4IOI E;  1WMH A;  2PKO A;  1EU4 A;  3S2A A;  4EUT A;  1FRD A;  3DDC B;  3V6C B;  4HKQ A;  1QQR A;  1F9J A;  2LJ5 A;  4HK2 A;  2G4D B;  2E3T A;  3A33 B;  1PDX A;  1NDD A;  2WXR A;  4KZC A;  3RFZ B;  5J17 A;  1UZX B;  4FHJ A;  1P1A A;  5FKA C;  3J9C A;  2D2Q A;  5BYQ A;  4NZL B;  3MFG A;  3Q3O C;  2V0G A;  3L08 A;  1WH3 A;  1YJJ A;  4B9K A;  1HA5 A;  4I6P A;  1KF6 B;  1KRH A;  3TEW A;  3HK0 A;  3QCA A;  1NI3 A;  4XDC A;  2M4N A;  1SE9 A;  3ZVV A;  1C3T A;  4F8C B;  3DBL B;  1PFD A;  2BYE A;  5H92 C;  1OFF A;  2I1J A;  3FIL A;  2WHI A;  4LNK A;  2W9N A;  1I42 A;  3AEF B;  3NJT A;  1ACC A;  1R4M B;  1E7P B;  1P9D U;  2X38 A;  1TS3 A;  1KFY B;  5IOI A;  1V6E A;  2FCS A;  2ZNV C;  2PEA A;  2PTL A;  1D5Z C;  3DHG C;  2PE9 A;  1E8W A;  3TMP B;  1YD8 U;  4HVB A;  1OEY A;  2ASQ A;  2Q5W D;  1IPG A;  2KX3 A;  3L4P A;  1HE8 A;  2KYW A;  3PLV A;  4PYZ A;  4L23 A;  3PRM B;  4YT0 B;  3K9P B;  4A20 A;  4M00 A;  4USA A;  4ZRI A;  1FCC C;  1GB4 A;  2B3A A;  4M8N A;  2GB1 A;  1BML C;  3B9J A;  1EU3 A;  2WU5 B;  2DEN B;  4A90 A;  2NBV B;  4RFB A;  3KVF B;  1TJE A;  2MJD A;  4LLG M;  4R3D A;  4MGI E;  2N9E B;  1R4M I;  2D3B A;  1ZXI A;  2R2Q A;  1XXG A;  2IGD A;  1TYG B;  2LHE A;  2FCQ A;  2WXH A;  3DBH I;  4M0W A;  2DHZ A;  4S0R A;  1EWC A;  1QOB A;  2WXF A;  3B2G A;  1YMH E;  1RRB A;  2KAJ A;  2W54 A;  2WX0 A;  2MA9 B;  2N9X A;  2CJO A;  2J53 A;  1L6U A;  5D94 A;  3TIX A;  4LDT D;  1UBI A;  2GBR A;  4HRO A;  4CO7 A;  2LXA A;  1N62 A;  2REX A;  3R66 C;  2DZK A;  3ZYY X;  1N5X A;  2HDE A;  1CMX B;  2A4Z A;  3JSV A;  1WRD B;  2VRR B;  1F1H A;  1T5X D;  1K52 A;  1YQ4 B;  1RM6 C;  2MJ3 A;  1A5R A;  4KSK C;  4FXC A;  3RNC C;  2INP E;  3TBL D;  2JXT A;  5L83 A;  1XCQ L;  2CHZ A;  3W1Y A;  2WXN A; 
#chains in the Genus database with same CATH homology
 1WIA A;  3M3J A;  3CST A;  2UYZ B;  2O2V B;  4AP4 C;  1E8Y A;  5JZE B;  3RUL A;  2LVQ A;  4W9D A;  2MX2 A;  3ZUN A;  2MCN B;  3WAM A;  5HKH A;  1BT0 A;  4URK A;  5LXI B;  1P98 A;  3W1S A;  1NI2 A;  2DAF A;  2WYQ A;  3PSE B;  4HPL B;  3ZO5 B;  4II3 B;  3QHT A;  4NAW A;  4BKT A;  2KDB A;  2JZ3 B;  4IWO A;  4W9F A;  4RM8 A;  1VCB A;  1D3Z A;  1YX5 B;  2JXX A;  2CHW A;  1WFY A;  2BKF A;  3N3K B;  3PRZ A;  5KHQ A;  2D11 A;  2HJ8 A;  2N7E A;  2KFJ A;  2IY0 B;  4DHJ D;  1OEY J;  2KO3 A;  1Z2M A;  3GZN I;  2MBH A;  1YIW A;  1V9J A;  1J8C A;  3HM6 X;  1RLF A;  2LRW A;  3PV1 A;  2KC1 A;  4FHK A;  4JLC A;  3KYD D;  1WGG A;  3BY4 B;  3L17 A;  5D2M B;  4MGY E;  3U7D A;  2WX1 A;  3PHW B;  4ASW C;  3UQA A;  4IUM B;  4EZL A;  2C60 A;  2KQ7 A;  5DPR A;  4G11 A;  4HWI B;  2J0M A;  2KTR B;  3AU5 A;  1H4R A;  3D32 A;  2FUH B;  2IO2 B;  3IHP C;  1WX7 A;  1WXM A;  1WF9 A;  1WXV A;  2EMS A;  2ZVN A;  3RCZ A;  4MM3 A;  3ONS A;  5FR6 A;  3M62 B;  2HD5 B;  1IP9 A;  4IM2 A;  3IFW B;  5DPT A;  2KVR A;  4NJ7 A;  2LI5 A;  4W9G A;  3QC8 B;  5AZG A;  1TBE A;  2MQJ A;  3X23 A;  1WJ4 A;  3A9K B;  3Q3J A;  4DDI D;  2KHW B;  1K8R B;  3APF A;  4KIK A;  3V61 A;  4E71 A;  4F1S A;  2LAS A;  3PRE A;  5L95 C;  2N1V A;  2L0F A;  2ZVO A;  4YL8 A;  4XC2 A;  2N1W A;  2MRP A;  4W9K A;  2KDF B;  3EEC A;  1V80 A;  1Z5S B;  3NY5 A;  1V86 A;  2O6V A;  2AEH A;  2JF5 A;  5LXH A;  2KKC A;  4MH0 E;  3ZDT A;  2C5L C;  2MWS B;  3EC8 A;  1EO6 A;  4BKS D;  2L0T A;  4ANX A;  4AJW A;  1L2N A;  1H8C A;  3I3T B;  1E8Z A;  4DBG A;  3W1S C;  2C9W B;  4IWQ A;  2O2V A;  2KWV B;  4HCP B;  1GUA B;  1GC6 A;  1V2Y A;  2KMC A;  3HM3 A;  3IBE A;  3NZU A;  2LZ6 A;  5AZF A;  1C1Y B;  1OGW A;  3TL5 A;  3LDZ E;  4DHJ B;  5JH5 C;  1ZKH A;  2GBN A;  1J0G A;  2LGD A;  3GOE A;  5C23 A;  5G55 A;  3MHS D;  1WGY A;  1AAR A;  2K1F A;  2DX5 B;  1M94 A;  2RR9 A;  2LVO A;  1KM7 A;  4IC7 B;  1V49 A;  1ZW7 A;  2JUO A;  4KDI C;  3ML8 A;  2KMA A;  2JY6 A;  4MEM A;  3VHT C;  1SIF A;  1KOT A;  3VUY A;  2A5U A;  2G3Q B;  2EMT A;  3VVW B;  4NPN A;  5EDS A;  3UIN B;  2K6Q A;  3PT2 B;  5JHB A;  4N9F 4;  2CKH B;  3L0W B;  3QJZ A;  2IY1 B;  2JZZ A;  4WJQ A;  4EEW A;  3QK0 A;  3ZNZ B;  2GMI C;  4KZ0 A;  2KTR A;  2KOX A;  4MDK E;  4BOZ B;  3APC A;  3V6E B;  1E8X A;  3QQ8 B;  5DCN A;  1E7U A;  3HIZ A;  2IZV B;  3OAW A;  3C0R B;  3T8M A;  2ZJD A;  4GGQ A;  3OJ4 B;  3A9K A;  3UGB B;  4K81 A;  2L05 A;  3QWZ B;  2DZJ A;  2LGX A;  1P3Q U;  1SGH A;  3HHM A;  4G0N B;  3ZLZ A;  2PE6 B;  1KJT A;  3OLM D;  4GMV A;  4PS8 A;  2KNB A;  1LQB A;  2KN5 A;  2RGF A;  3AI5 A;  2D07 B;  4FJV B;  3B1L X;  3PHX B;  1WR1 A;  3V60 A;  4IW0 A;  2JVC A;  2R2O A;  4KV2 A;  4OVV A;  4KDL B;  5J18 A;  3OJ3 A;  5G2N A;  3DVG X;  3VH3 B;  2QHO A;  1ISN A;  5AZH A;  2UWQ A;  4ZYN A;  2LRU A;  2Z59 B;  3LJ3 A;  2NPT B;  4NQK E;  5E6P A;  3VUX A;  4GXB A;  4EKU A;  1VD2 A;  3H9D A;  2KDI A;  2D10 A;  3DOW A;  4PS3 A;  3K9O B;  1LFD A;  1OTR B;  3DVN V;  1WJ6 A;  1QZE A;  4FA6 A;  2GBK A;  2KWU B;  3IG3 A;  4NNJ B;  1UD7 A;  2LGY A;  2LD9 A;  1WXS A;  3ALB A;  3B08 A;  3UIP B;  3IVF A;  4GDL B;  2MBQ A;  4PS7 A;  4X57 B;  1WZ0 A;  3DBS A;  3TCA A;  3DPD A;  4GOC A;  2RD0 A;  2GBJ A;  2XEW A;  1FXT B;  2LWP A;  2KJR A;  3U30 A;  3VH4 B;  2K8B A;  1UBQ A;  1WXA A;  2KC2 A;  1UEL A;  4MGZ E;  3MJW A;  5GMV A;  4TKN A;  4JGH B;  1GNU A;  4FJY A;  2DAJ A;  4K1R B;  2CR5 A;  2NCN A;  3RUI B;  2YVC A;  2G45 B;  3WA0 A;  3VAW A;  3EHV A;  4LDT B;  4BBN C;  1WR6 E;  3KW5 B;  2RSU A;  4HXD A;  2MBE A;  3PRP B;  1WM3 A;  4ZRJ A;  1WM2 A;  1G6J A;  3RZF A;  2LUE A;  1GG3 A;  5KHO A;  3RZW C;  3A1Q B;  2NVU I;  1WYW B;  3PLU A;  2MBO A;  2D3G A;  2FNJ B;  3ZTC A;  2K39 A;  1S3S G;  4ANW A;  4EZJ A;  3H6N A;  2DYB A;  3A4R A;  4WWP A;  4K7W A;  4GU2 A;  4RMA A;  3X0W A;  2Z0D B;  5CHF A;  1WGD A;  1WE7 A;  2V3S A;  3ZRF A;  1WMH B;  4NY0 A;  3B0A A;  4W9L A;  4BKS A;  4E74 A;  3KUD B;  3H7P A;  2MLB A;  1WJN A;  2MSE D;  3VQI A;  2ZEQ A;  1T0Y A;  3SDL C;  4BKG A;  3VXW A;  2CHX A;  1LM8 B;  4G50 A;  4ZRK A;  4WJN A;  3R7R A;  3AUL A;  2WDT B;  3ZDM C;  4BVU C;  2L76 A;  3L13 A;  3UF8 A;  2ZNV B;  4K7S A;  2JWZ A;  3W1Y A;  4GSW A;  3VUW A;  3T9L A;  4MEL A;  2IBI B;  4PYU A;  1NBF C;  4A3O A;  2NPT A;  2KTF A;  2J0J A;  4WWN A;  4IWP A;  4B95 A;  2KQS A;  4FJZ A;  2IYD B;  5CX3 A;  1TGZ B;  4MSQ B;  1E90 A;  4LJO B;  3SD5 A;  4JL9 A;  1WE6 A;  2K25 A;  2KDE B;  4ICU A;  3DVG Y;  4GDL A;  1X1M A;  2L00 B;  4I6L B;  2O6V D;  2ZCB A;  3VTU A;  3ZRC A;  3NOB A;  1RAX A;  4MGK E;  1GC7 A;  3MTN B;  3WAN A;  1R4N I;  3V62 A;  3DBL I;  2LXC A;  2I1K A;  2J7Q B;  1EF1 A;  2IO0 B;  3CSF A;  3EFU A;  4WAA A;  3DVN U;  2BWF A;  2MP2 B;  3AU4 A;  3P2B A;  2BKR B;  2KLG A;  2BYF A;  2K8H A;  3AXC A;  3A9J B;  4M8M A;  4OVU A;  3RT3 B;  2KLC A;  2LVP A;  3ZNI D;  4CYE A;  1XT9 B;  3NHE B;  4A3P A;  2BWE S;  4GIV A;  2FCM A;  3H7S A;  3QA8 A;  3RD2 A;  3QX1 A;  2DYM A;  3H1U A;  3WIM A;  3A1Q A;  1YQB A;  2M8S A;  2DZM A;  4IM3 A;  4AJY B;  2N4F A;  4EOY A;  1Y8R C;  3UIO B;  3UQB A;  1L7Y A;  2G4S A;  2PPH A;  5D7G A;  2RPQ A;  4E3C A;  2KZR A;  2MBB B;  1WZ3 A;  2AL6 A;  3PVL A;  3ZTD A;  2PJH A;  2AL3 A;  2HTH A;  2FID A;  2GBM A;  3APD A;  3N30 A;  4FLH A;  2IO3 B;  4MSM B;  1WMH A;  2FIF A;  3SHQ A;  5C1Z A;  4W9C A;  3DCG A;  5E6O A;  3S2A A;  4EUT A;  2C7N B;  1UH6 A;  2N9P C;  3DDC B;  3V6C B;  1F9J A;  4II2 B;  2LJ5 A;  1E7V A;  2KK8 A;  4HK2 A;  2AYO B;  2G4D B;  4DHZ E;  4KSL C;  3A33 B;  1NDD A;  4CHK A;  3NZS A;  4W9H A;  3RYT A;  2KX0 A;  4HDQ A;  4WJO A;  4GB9 A;  4KZC A;  3L54 A;  4TUU A;  5J17 A;  1P0R A;  1UZX B;  1WJU A;  4FHJ A;  4WQO B;  3VTV A;  4B6W A;  1P1A A;  2JT4 B;  4RM9 A;  4NJ6 A;  2OJR A;  2KXJ A;  4AUQ C;  2EKE C;  1I35 A;  2D2Q A;  1YJ1 A;  4LCD E;  3DQV A;  2GOW A;  1WX9 A;  2IO1 B;  1OQY A;  4P7I A;  4K7U A;  3L08 A;  1WGH A;  2BYV E;  2HE7 A;  4XZ4 A;  1WH3 A;  5J2R A;  1S1Q B;  1Q5W B;  2KFK B;  2NR2 A;  4WJP A;  4B9K A;  4EZK A;  2ZCC A;  2KJ6 A;  2L7R A;  4I6P A;  4MJS B;  3PS6 A;  4I6N B;  3HK0 A;  3QCA A;  2MP2 A;  2M4N A;  1SE9 A;  2JPH A;  5IAA C;  3ZVV A;  4BBN F;  1C3T A;  4F8C B;  3M63 B;  4JIO U;  4WWO A;  5CHW A;  2XBB C;  3A9J A;  3TJP A;  3ZW3 A;  1LXD A;  2BYE A;  2C7M B;  2I1J A;  4DDG D;  1WGR A;  5AEK B;  2YLM A;  4M0W B;  2W9N A;  1Q1O A;  3VTW A;  2DZI A;  3ECI A;  4DK5 A;  2BF8 B;  2ZZP B;  1KLV A;  1I42 A;  1E5W A;  1JRU A;  2BGF A;  2ZPY A;  3WAO A;  5DPW A;  3QIJ A;  2K6D B;  2M17 A;  4DWF A;  3M95 A;  1P9D U;  4ANU A;  3QAR A;  4HVB A;  4ICV A;  1V6E A;  2FCS A;  5CTR C;  1IYF A;  2KD0 A;  2ZNV C;  2PEA A;  4FN2 A;  4HPM B;  4KVG B;  1V5T A;  3ENE A;  2PE9 A;  3WAP A;  1E8W A;  2Z0E B;  3JSV B;  3NS8 A;  1YD8 U;  3PPA A;  3TMP B;  3WAL A;  3O65 B;  2KWC A;  3BIN A;  1OEY A;  1Q0W B;  2ASQ A;  2ZPN A;  3CF6 E;  4GDK B;  4AOF A;  1WI0 A;  2BPS A;  4TQ0 A;  1IPG A;  2KX3 A;  3QAQ A;  4HLE A;  5LLI A;  1HE8 A;  4EFO A;  2V4L A;  3JYU A;  3ZNH B;  3U8Z A;  2C7H A;  3Q3F A;  3PLV A;  4PYZ A;  2OOB B;  2XK5 B;  3PRM B;  2JRI B;  3KH0 A;  3K9P B;  3N32 A;  4A20 A;  3ZKJ C;  3R3M A;  3VFK A;  3ZNG C;  4IG7 B;  3SU8 X;  5IA7 A;  4IM0 A;  3A4S C;  1V5O A;  4ZRI A;  2DYO A;  4W9J A;  4DXA B;  1TZ1 A;  4ZDV A;  4BFR A;  2MW5 A;  5E6N A;  1PQS A;  2B3A A;  4M8N A;  5BO4 B;  1XD3 B;  2CS4 A;  4NAW B;  2L8J A;  2DEN B;  2KFK A;  4HDO A;  2N7D A;  4XX5 A;  2NBV B;  4DHZ B;  4MJS A;  2FAZ A;  1MG8 A;  3KVF B;  1WX8 A;  2JRH A;  3L10 B;  1WY8 A;  3PTF C;  4TQ1 A;  3VDZ A;  4FBJ B;  4FAD A;  4MGI E;  5DPS A;  1RFA A;  2N9E B;  1R4M I;  4GN1 A;  4LJP B;  3PZD A;  2M1M A;  2R2Q A;  1YX6 B;  4F7Z A;  1XQQ A;  2FCQ A;  3DBH I;  4JQW C;  4W9E A;  1ZGU B;  1EF5 A;  2DHZ A;  2KJH B;  1RRB A;  1UGM A;  2V1Y A;  3KUZ A;  5TR5 A;  5JHA A;  2WX0 A;  2KAN A;  2L3Z A;  2MA9 B;  2N9X A;  2M0X A;  1GJZ A;  3KUC B;  2NBW B;  5D94 A;  3TIX A;  3PGE A;  5D6J B;  4HCN B;  4LDT D;  1UBI A;  3JVZ X;  2GBR A;  4KIK B;  4CO7 A;  2K8C A;  3L16 A;  4J6I A;  2LXA A;  2Y5B B;  4BOS C;  2REX A;  3KYC D;  3R66 C;  2DZK A;  4NQL B;  3ZIM A;  1TTN A;  5CHV C;  1EUV B;  4W9I A;  3ML9 A;  1CMX B;  2A4Z A;  3JSV A;  1WRD B;  2WWZ A;  4TV3 A;  4FUL A;  2VRR B;  2NS5 A;  1V81 A;  4HJK A;  2J0K A;  2O6V B;  4GDK A;  4AWJ A;  3H7P B;  2AWT A;  1U4A A;  1A5R A;  4KSK C;  3JW0 X;  1J19 A;  3TBL D;  3R7Q A;  5L83 A;  2CHZ A;  3DBR I;  2FCN A;  4ANV A;  4G3X B;  3CMM B;  2CU1 A;  2NBU A;  2XK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...