2GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
molecule keywords GRB2
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gbqA00
1PKTA 2ED1A 1T3LA 1SHFA 3NMZC 1BK2A 2K7AA 1M3CA 5IH2A 2M0YA 1X6BA 4JJCA 5HCKA 4J9BA 2RQUA 1AZGB 2L3PA 1U3OA 3VRZA 1WLPB 2A28A 1V1CA 3UA7A 2LZ6B 1UGVA 2W10A 3PVQA 2EPDA 2L0AA 3H41A 1K4US 1VYTA 3I35A 3PVLA 1NG2A 4RTXA 1K76A 1GBRA 3I9QA 1ZUKA 2DRKA 4JPBW 4KRTA 1H3HA 4LE9A 1YWOA 5IHKA 1B3QA 1T0HA 4RTZA 1W70A 1WI7A 2A08A 2O88A 1NLOC 3UF4A 1VA7A 2D8HA 1SSHA 2EGCA 1HD3A 1I0CA 2J6FA 2A36A 2OAWA 2DL3A 3RNJA 1RLPC 1X27A 4J9GA 3VS2A 1NYGA 2QDLA 1QKXA 2H8HA 2J6OA 2EVRA 1LCKA 1NLPC 4LN2A 2YUOA 5ECAA 2CSQA 2JMCA 2FPFA 2C0TA 4AFSC 2JM8A 1J3TA 1AD5A 2C0OA 2EQIA 1ZSGA 1X6GA 4HVWA 1JXMA 2YUQA 1UHCA 1CKAA 2LP5A 4JJBA 1W6XA 1ZUUA 4AFQC 3SEMA 1T0JA 2LNHB 2GGRA 1GL5A 1FMKA 1HJDA 1K0SA 2VWFA 2KRNA 4Z88A 2KNBB 2C0IA 2EBPA 2EYXA 3ULRB 2IIMA 1UJ0A 3NGPA 2GNCA 1YN8A 1OPKA 1K0XA 2FRYA 2HSPA 1BU1A 1AEYA 1Z9ZA 1SEMA 2LJ1A 3I5SA 1G83A 3M0UA 1MUZA 1PWTA 3TSZA 4WCIA 2DL7A 2JS2A 2KGTA 2DYBA 1QWEA 1NYFA 4RTUA 2BZXA 4Y92A 2F2WA 2KE9A 4X1VA 1YNZA 2J6KA 2O2OA 4HVUA 2K9GA 2FRWA 4Z8AA 1K1ZA 3H0HA 1SRMA 2RMOA 2AKKA 2F2XA 5FWCA 1NEGA 2DLPA 3EG0A 4R0KA 3UA6A 4IIOA 1I07A 2CDTA 3M0QA 1UUEA 1AWJA 4D8DA 2K3BA 1XOVA 1QKWA 3U23A 3FJ5A 3KFVA 1BBZA 2DL8A 1WYXA 2A37A 3H0FA 3QWXX 2O9VA 4LNPA 4ORZA 1AWWA 1JO8A 3EG3A 2ROLA 1UE9A 2KYBA 2DA9A 3VS3A 4F17A 1YWPA 2PZ1A 1T3SA 4OMPA 5I22A 1G2BA 3VRYA 2D1XA 1UFFA 4J9HA 4FSSA 1H92A 1X69A 1NEBA 2V1QA 2BZYA 2CREA 3VS6A 3CQTA 1Z9QA 2FEIA 2L2PA 2J7IA 2KXCA 2JM9A 4J9CA 2LQWA 2VVKA 5GJWB 3H0IA 2ECZA 2RPNA 1M3BA 2EYYA 1M30A 2FPEA 2DF6A 2DRMA 1ABQA 2KROA 4OMNA 2KXDA 1WXUA 5GJVB 1AWXA 1RI9A 1TUDA 3EGUA 1GCPA 1I1JA 2YUPA 2D8JA 4RTWA 3EG2A 2F2VA 3TSWA 2DE0X 3I5RA 4Z89A 3NHNA 2CT4A 1TUCA 1MV0B 4OMOA 4AG2C 4RTYA 1X43A 5EC7A 1ZUYA 4CC3A 2G6FX 2MIOA 5IHNA 2JT4A 4DEXA 2X3XD 4J9EA 1S1NA 1OPLA 5FWBA 4M4ZA 3REBB 3IQLA 4AFUC 2EYWA 4CC2A 1BB9A 4HVVA 2DVJA 2CUBA 1HSQA 1PRMC 2KRMA 1UTIA 2ESWA 1M3AA 1WIEA 2LCSA 1GRIA 4HCKA 2J06A 1GCQA 2HCKA 2X3WD 1B07A 3VS7A 1WDXA 4OMMA 1AVZC 2KR3A 1AOJA 5IXFA 2CH4W 2GTJA 2GTOA 1YP5A 2FO0A 1X2KA 2AZVA 1W1FA 2RNAA 4HXJA 3VS5A 2J05A 2EW3A 2I0NA 2YT6A 4JZ4A 2CT3A 1X2QA 5L23A 1GFDA 4J9FA 3RBBB 2ENMA 4J9DA 1WX6A 2RQWA 2KBTA 3M0PA 2PNIA 2OJ2A 1ZLMA 3C0CA 2KYMA 2RQTA 4OMLA 1Y57A 3PE0A 1SHGA 2JS0A 1UJYA 3VS1A 1M27C 2CSIA 2DBKA 2NUZA 2GBQA 2DMOA 4JJDA 2JTEA 2E5KA 4J9IA 2YDLA 1ABOA 4K11A 1KIKA 2HEQA 4EIKA 2DILA 1RLQC 1NM7A 1UDLA 4A63B 2HDAA 2KRSA 2VKNA 2SEMA 1JQQA 2LQNA 1PHTA 1H8KA 4CC4B 2O31A 2AK5A 2RQVA 1PNJA 2ABLA 1A0NB 1VYUA 3LH5A 1N5ZA 1QLYA 1OEBA 3O5ZA 3ZL7C 2L3QA 1KFZA 4RUGA 2O9SA 1UECA 1PKSA 2RN8A 1QWFA 1TG0A 3NPFA 4OMQA 2W0ZA 1U06A 1E6HA 1Y0MA 3R6NA 4DEYA 3EHQA 1JU5C 1ARKA 4GBQA 2GQIA 2XMFA 3UATA 2KT1A 2EKHA 4F16A 2AZSA 2ROTA 1JXOA 2AKLA 1YCSB 1RUWA 1PRLC 2KEAA 1E7OA 2PTKA 1KSWA 4RTTA 2DM1A 1CSKA 1SPKA 2K6DA 1E6GA 1SRLA 4AG1C 3VS4A 1AZEA 4RTVA 2YSQA 2V1RA 4D8KA 2CH4A 5IXBA 2FG0A 1MV3A 1CKBA 2LJ3A 2CUDA 1KJWA 2YUNA 2D0NA 3TVTA 2JW4A 2DNUA 5FW9A 1WA7A 1GBQA 2MOXA 2B86A 2DX1A 4LUDA 2EGAA 4LUEA 1WXTA 3JV3A 3M0TA 1UHFA 2K2MA 2JXBA 3A98A 1ZX6A 1EFNA 2NWMA 3VS0A 2DBMA 3REAB 2JMAA 4AFZC 2RF0A 3EG1A 1UG1A 1OV3A 2OI3A 5IHIA 4ESRA 3M0SA 1FYNA 4CC7A 1VYVA 3EHRA 4F14A 4IIMA 2KT8A 2L3SA 1ZBJA 1WFWA 2EYZA 1JEGA 2DJQA 4GLMA 1AWOA 2EGEA 2RQRA 3THKA 1U5SA 1WXBA 1GFCA 2ED0A 4QT7A 1M8MA 2SRCA 1K9AA 3SHWA 2DL4A 2P4RA 3QWYA 1QCFA 2BTTA 2MCNA 4JZ3A 2LJ0A 2BZ8A 3GBQA 2DL5A 5I11A 2FPDA 1IO6A 4E6RA 2K79A 1GCQC 2M51A 2LX7A 2LMJA 3M0RA 1OOTA 2HBWA 4ZNXA
chains in the Genus database with same CATH superfamily
3C95A 1PKTA 1D0ZA 4RMOA 3EAEA 5LJ5d 3OBYA 5D6YA 3HP9A 2BE7D 2QEXQ 3VRZA 4ZGJB 3I55Q 3QIIA 5LJ5f 1FMWA 3LX7A 2EPDA 2YWWA 5GAOq 3MCAB 3DB3A 2Z0WA 1UB4A 2VXFA 1K9MU 2YLBA 2P4TA 3BW1A 4PFZA 4RTXA 1YJ9Q 4E7SA 2YRCA 2DRKA 2RI2A 4FU6A 2MPXC 5IHKA 1B3QA 3EGXA 5CKFA 4A4EA 2VGNA 1Y7XA 2EJ9A 1NLOC 3UF4A 2DETA 5GANj 1VQ9T 5A0DA 4JLIA 1I0CA 1K8AC 3JCMP 2O01E 3VS2A 1RLPC 1KD1U 1QKXA 2H8HA 3D7SB 1MGQA 3CC2Q 1Q81U 2YUOA 4MMLA 2HQXA 3CCUQ 2CZ1B 2L5QA 2CSQA 3V8LA 1J3TA 1AD5A 3AHUA 4C8QB 4M7AG 4EMKB 4M75B 3RERA 4EPCA 3V8JA 1JXMA 3GF5A 4BE1A 2LP5A 3JCMb 4M7DE 4M78B 1ZUUA 5CKEA 3TQ7P 4AFQC 2NUTB 1T0JA 2FYKA 3CCST 3NTHA 1M2OA 2LNHB 2LVMA 1RAAB 1GL5A 1K0SA 2ZPFB 3CCJT 2KRNA 2KNBB 2LQKA 4PJOF 1YHQA 1VQ8A 3OB9A 3ULRB 1VIFA 2DD4A 4A4GA 1UJ0A 3NGPA 2K4YA 1YN8A 5GMKj 2GFAA 4PKCC 5FU6B 3JB9G 1SEMA 3ME9A 2E4HA 1VQLQ 3S6WA 2KVQG 1YHQT 3L2UA 3RKXA 2FVUA 1MUZA 1PWTA 4C92C 3TSZA 4JLGA 3Q1JA 1M5Q1 4OP0A 3CC7A 1KHIA 2DXUA 2KE9A 1M2VA 2K9GA 1S72Q 2FRWA 1VIEA 5FU7B 1SRMA 2RMOA 3CCRA 1RAFB 1NEGA 1EIFA 4R0KA 4J5YA 3A8LB 1U8RA 2CDTA 1AWJA 1R77A 3RMSA 3FJ5A 2E5QA 1KC8R 1BBZA 1WJRA 4M77A 1M2VB 3M56A 2ROLA 1UE9A 2KYBA 2RK1A 4J83A 5GAN4 1G2BA 1G5VA 3JCMh 4EMGA 1H92A 1X69A 5DLQE 3VS6A 1ZA2B 3CQTA 5GAOm 3I56T 1QVPA 2FEIA 2L2PA 2GCXA 2VVKA 2V8JA 1Q82R 1RAIB 2RPNA 1M3BA 3OYBA 4BUGA 1VQOQ 3FLGA 1M30A 4M7AA 4JUVA 2FL7A 1FX7A 1MMAA 1I1JA 4PJJA 4BACA 1Y07A 3EG2A 1IZ6A 3CCLA 2XK0A 5GAMg 1K8AU 4PNOA 4PFOA 2ZPGB 5GMKi 1VQMT 1I4K1 1TUCA 4A54A 2O4XA 2QQAA 2HKNA 4CC3A 2PVDB 2XHCA 7AT1B 1VQ4Q 2BKDN 2LC4A 2QASA 4M4ZA 3REBB 2E64A 1VQOT 5KCHA 2EYWA 1RAHB 1Q7YC 5KH6A 1BB9A 4F7UE 4HVVA 5GAN6 2DVJA 1HSQA 2DIGA 1MHNA 4F7UF 2ESWA 2LCSA 5J26A 2K5FA 1D1AA 4M77E 3QJ6A 1YITA 2RB6A 3HTRA 1AOJA 2ZPHB 1YP5A 5CCAA 2FO0A 1YITQ 1NJIR 1X2KA 2FZKB 1VQLT 2QA4A 3CXCP 2QQRA 3QZ5B 1GFDA 4DBQA 4J9FA 3GLXA 1K9MC 2KBTA 3M0PA 1D09B 2E41A 4OMLA 3FC3A 3CMAA 5KYXA 4IKFA 1M9SA 2EJFA 5IT9E 4PJOA 1UJYA 2CSIA 3RKYA 2DMOA 4JJDA 3WVDB 3RIRA 4X34A 1RLQC 4A63B 2KRSA 4QW2A 2VKNA 5DY9A 5FLXE 1KD1R 2DTOA 1BIAA 1PNJA 2ABLA 3CBMA 1VYUA 4E2FB 3O5ZA 2L3QA 1UECA 3L42A 1PKSA 1TG0A 4KUIA 1U06A 4LDXA 4M78E 1WHMA 2IVWA 1Y0MA 3R6NA 5KCOA 3EHQA 3MPUB 1X6OA 1JU5C 2ZPEB 2LDMA 4GBQA 1C0MA 1VQ4T 1M4ZA 1EX4A 1M1FA 3UATA 2OTLT 4FT4A 1TH7A 2RD1A 4B6MA 1YCYA 5GAOn 1VQ7T 4N0AA 1IXDA 2KEAA 2PTKA 4C5GA 5GAMe 1VQ5T 3HFOA 5L8RE 2K6DA 3CCQA 1SRLA 4XU3A 3G7ZA 4AG1C 2CS7A 1VQPT 3VS4A 1KQ1A 1QCOA 3G4SQ 4IURA 4BDZA 2YSQA 1ACMB 2VC8A 5IXBA 2FG0A 4E7IA 3A5ZB 1QVGA 1CKBA 2CUDA 4QQ6A 3LH0A 1I8FA 2OX7A 2ATCB 1GBQA 2MOXA 1RL2A 2DX1A 4LUDA 3I56Q 1ZQ1A 4LD6A 1WXTA 4CRIA 1RAEB 3M0TA 5FU6C 5D6XA 2DBMA 2V8IA 3REAB 3C4SA 2RF0A 4X9DA 1N6AA 3JCMJ 1R0CB 4HT9A 5IHIA 4ESRA 3X25B 2DTIA 2Y4YA 3M0SA 4CC7A 1VYVA 3EHRA 4XQ3A 4ZN3A 4MZPA 4IIMA 2AHJB 1D3BB 3M4GA 5LJ3e 3M55A 2DPPB 2BUDA 2EGEA 1MMNA 1YJWT 2QDYB 2ED0A 4HA8A 2SRCA 4FL6A 2RI3A 1QVGS 2DL4A 3QWYA 2FZGB 2LJ0A 4KULA 1WHLA 3CPWP 3HPWA 3SD4A 2DL5A 1KG1A 1BKBA 4V2SA 3NTIA 4C8QG 2LX7A 4ZNXA 2ED1A 4ELYC 1YJNT 5GANf 2WSFE 1T3LA 3QZ9B 3NMZC 1K73R 5KE3A 3CMAT 2X51A 1X6BA 4LDVA 2JUFA 5HCKA 3OSVA 1U3OA 3JSCA 2ZPIB 2A3LA 3MKDA 2HBPA 3UA7A 1K8AR 2W10A 1M90C 2L0AA 2XKOC 1BI3A 3URGA 1TUGB 1OX9A 2MMPA 3OYHA 4OB1B 2M1HA 3S3NA 3CCQT 1GBRA 3SWNA 4JPBW 4F7UG 3E19A 4KRTA 3CCLQ 4Q5WA 1Y96B 3CCEA 4C8QE 1LPLA 4BY6C 1W70A 2D9TA 1WI7A 4EMKC 3RDVA 2A08A 1TWBA 3CCMA 1VA7A 5KYWA 2XD0A 2EGCA 2J6FA 3E9FA 2JN0A 5KYYA 4NL3A 1KHCA 4JRKA 1MMGA 2DL3A 1Y96A 3RNJA 1X27A 1QQJA 1OYXA 3EFSA 1NLPC 4LN2A 4M77B 4M7DD 3SFMA 2RK2A 5GAN2 4A4HA 5KYWB 2C0TA 1B7TA 2G3RA 2JM8A 2LCCA 3LWIA 1KC8U 2EQIA 3E9GA 5D6WA 3CCRT 4FCYA 4E7HA 4JDSA 2DIQA 1UHCA 3EGXB 1N9SA 1JJ2A 4C92E 3CC4Q 2DEUA 4KH0B 3A8MB 5GAMh 2MAMA 2E70A 3OYYA 2C0IA 1X75C 3BFMA 4JS5A 3X20B 2GNCA 1AT1B 1K0XA 2FRYA 2ZPBB 1BU1A 3SWNC 5I2MA 1AEYA 3META 2F5TX 4O6JA 5CQXA 2LRQA 3I5SA 1G83A 4GLKA 3ASKA 5HKCA 1FMVA 1VQPQ 1XTDA 1ZSZA 3SDZA 3AT1B 2MK5A 2DL7A 4M7DC 5EG2A 2JS2A 3I55A 2KGTA 2DYBA 1NYFA 4JS4A 4X1VA 2J6KA 2O2OA 3RR6A 2QK0A 1K1ZA 1VOMA 2F2XA 3QKJA 4KUDK 3EG0A 1UGPB 3OYKA 2MF2A 3UA6A 4Y91A 1UUEA 2JNGA 4DBRA 4LDWA 1EZZB 2JTFA 3CCVQ 3JCMQ 3H0FA 2O9VA 4LNPA 5KYUB 4N0AC 3OYNA 2RJEA 1JO8A 4M75G 3VS3A 4OMPA 2MYSA 4WTOB 4C8QA 3JB9F 2D1XA 2CKKA 4IUUA 1UFFA 1NEBA 2V1QA 4XTUA 1PC0A 4M78A 2J7IA 3JB9I 3CCQQ 1SSFA 4QVZA 2EYYA 2R57A 1VQ8T 2XG8D 2FPEA 2QA4T 2DF6A 2R58A 1ABQA 1U1TA 4ZTFA 4O5VA 2FZCB 2CP2A 3CXCA 4L5GA 1VQ8Q 1WXUA 3EGUA 1GCPA 4RTWA 2YUPA 2D8JA 2F2VA 1TU0B 4M7AF 2DYIA 3JCMW 2DE0X 4OMFB 1YFNA 2CT4A 1MV0B 4DOVA 5EC7A 3CPWS 1K73U 2MIOA 3DKMA 2JT4A 3CCMQ 1OPLA 3NTKA 3VU3C 4M77G 4AFUC 2CZ7B 3QPHA 4QQDA 1RACB 3QXEB 5KYXB 1YBYA 2KRMA 3MHXA 3JAME 4C8QC 1WIEA 1GRIA 2JVVA 3MEAA 2X3WD 1B07A 1G3SA 3HKSA 3VS7A 3OYEA 3PIOA 2X4JA 2QTXA 2PUKB 2GTOA 2XIDA 3BY7A 1QVGP 3UT1A 3OS1A 2H3EB 2LTOA 1D1BA 3M9QA 3PT9A 3CCET 3MP6A 4HXJA 4HCCA 2J05A 2X35A 2I0NA 4KGXB 1NJIU 1KQ2A 1X2QA 3RBBB 4AT1B 4J9DA 2D6FA 1VQNT 1ZLMA 1MMDA 2KYMA 4BI8B 1KQSS 4FIBA 2F1LA 1D0YA 1XJWB 4C92B 3PGGA 2NUZA 1OZ2A 2JTEA 2E5KA 2GQVA 3CCSA 4WF2A 2LT4A 2QEXT 5DM7R 4EIKA 2DILA 4DBFA 1UDLA 5A0LA 5FROA 5FU7C 2LQNA 1PHTA 1H8KA 2PQWA 2O31A 3VJPA 3DLLA 3CMEQ 1DJ7B 3CD6T 3OS0A 1VQ7Q 2E65A 2KY9A 3QBYA 1N5ZA 3UDCA 2OTLQ 4JRQA 1Q82U 2VV5A 3CCVA 1PD0A 5M9OA 3NPFA 2W0ZA 1KC8C 1E6HA 3LLRA 2CP6A 1ARKA 2P0PA 3WVEB 4XAXB 4DA4A 2KT1A 1N27A 3E1SA 2HMAA 4F16A 2QXFA 3OS2A 2AKLA 1YCSB 4VUBA 1RUWA 2QG9B 3GPLA 3QSUA 1S72T 4QVDA 3A8OB 2PUOB 1VQOA 1WHHA 1SPKA 2COWA 3C12A 1E6GA 5KYNA 4BE2A 1RADB 4RTVA 2M02A 1OU9A 1NE8A 1K73C 2X4YA 2D0NA 3TVTA 5FW9A 1JJ2S 3JCMc 4IUQA 2HQEA 4PJMA 1YJNQ 4PJOB 2KMTA 4HCBA 2VASA 3JV3A 5DLOA 1UHFA 5GAN5 1ZX6A 3J80E 2E6NA 1SF9A 3ZBDA 2E3HA 1M1KU 2JMAA 2OAUA 5GANd 4AFZC 1KK7A 3JB9J 2E6ZA 2VYTA 1ZHIA 1ZBXA 2OI3A 3MEVA 2Y4XA 1VQ7A 2NYSA 3LW5E 1FYNA 3OYLA 2K3YA 1ZBJA 4GY5A 2EYZA 3DLMA 1LVKA 2RQRA 1M1KR 4J6YA 1Y71A 3CCUA 4DBHA 4ATOA 5LJ5h 3JB9H 2P4RA 1NPRA 3V7SA 1I5OB 2EQUA 4JZ3A 1BI1A 1IO6A 3GOXA 2JOYA 5LJ5j 4B9WA 2MWPA 1NZ9A 2K79A 2M51A 1NBEB 3EG9B 4J7FA 3KXTA 2E3IA 3LGLA 2QQSA 1SHFA 4BY6B 1H3ZA 1BK2A 1M3CA 2CP0A 1YJ9T 5IH2A 1YJNA 1M1GA 4M77D 4J9BA 2RQUA 1AZGB 2L3PA 3OYFA 1RAGB 2A28A 1V1CA 3S3OA 1UGVA 1HXDA 3HL8A 2EYQA 4BD3A 1I81A 1VQLA 4M78F 1K4US 4M75D 3I35A 1UGSB 3PVLA 3G4SA 4C0ZA 4M77C 3I9QA 1F1BB 1ZUKA 3CPFA 4RTZA 5GAOp 1HYOA 5GMKm 5HK0A 2FHDA 3GNFB 1G3TA 1VUBA 2O88A 2HKQB 5GAN8 2D8HA 4XTYA 1SSHA 1HD3A 5AT1B 2DZ9A 3G6EA 4EDUA 2OAWA 4J9GA 4IUTA 1X01A 4HT8A 2DFUA 5ECAA 2A0FB 2RA2A 2COZA 1B34B 4AFSC 2FPFA 1ZSZB 5LJ3d 3JCMX 3G1JA 2YXYA 1QW1A 5GAMj 3CBPA 4HVWA 1VQKQ 3X28B 3PFSA 3RESA 4PJOD 1W6XA 1YI2A 1HK9A 2GGRA 4DOWA 3M59A 4AMCA 4R56A 3UPUA 2VWFA 4Z88A 5GMKe 2EBPA 2IIMA 2JZ2A 2C06A 4BI4A 1OPKA 1UGQB 1IHWA 2AIRB 2LJ1A 3QYHB 1YI2T 2RJCA 1VQ6A 1NJIC 4XTZA 1KQSA 1W2BA 1O9SA 2E12A 3GP8A 2RHUA 4MZTA 4RTUA 4Y92A 3OY9A 2F2WA 2DEQA 2ZZDA 1H641 4HVUA 3EH1A 5LJ3h 4Z8AA 2DKGA 3VKIA 2AKKA 4PLIA 5FWCA 5GAOr 5LJ3j 3V8KA 5KYYB 3BE3A 4IIOA 1FXXA 3HRUA 4D8DA 3M0QA 4FYWB 1QKWA 3U23A 4RKUE 3KFVA 4C5EA 1UEBA 5GAMf 2DL8A 1WYXA 5GMKl 3QWXX 2K57A 2P0KA 4M75F 3CC7T 4RCBA 5HK3A 2B8AA 3V7CA 1T3SA 4M75E 1N9RA 3LYIA 3CEYA 3CD6Q 2BZYA 1WPYA 2HQHA 3JCMg 2KXCA 4J9CA 3TU4K 4E7ZA 4XK8E 3H0IA 2HAXA 1SG5A 2DRMA 3G71Q 4OMNA 4MDWA 3INZA 3G4ST 4PJNA 4C92F 1AWXA 1TUDA 4FW1A 1YJ9A 1D0XA 3TSWA 1QMCA 1RABB 3MO8A 4NL2A 4OB0B 3OW2A 1VQNQ 2M9UA 3I5RA 3CCJA 1XNIA 2V8KA 2QGGA 4Z89A 2YRVA 4C0DC 1BCMA 2H3JA 2YLCA 4RTYA 5J3BA 5CIUA 2P84A 3RMQA 3OYIA 2HNIA 5J39A 4LD9K 2G6FX 4J6XA 3ER0A 3OA6A 3G6EQ 2X3XD 4J9EA 1S1NA 3CC4T 2RJFA 1MNEA 2QI2A 3HSBA 3IQLA 1M90R 3QUIA 2DXTA 3L2WA 4CC2A 2O4XB 2LCLA 1TSFA 1LJOA 1VQ9A 3HRTA 1UTIA 4N4GA 1VQMA 4PJOE 4HCKA 1VQ4A 2L89A 3OYMA 4M78G 1KD1C 3P8HA 3GNGA 5C6SA 5GAN3 1WDXA 1AVZC 3OW2S 1FWZA 2KR3A 5IXFA 1VQKA 2GTJA 1W2BS 2NUPA 1WGSA 1W1FA 2QAZA 4BB7A 5GANh 4A53A 2K5LA 2RNAA 4RG8A 3VS5A 1VQ6T 1IREB 1M90U 4J7IA 3DB4A 1WX6A 2MWOA 2PNIA 2OJ2A 4M7DG 2LX9A 3MEWA 5CQYA 3C0CA 1XQHA 2DVEA 1TXQA 6AT1B 1SHGA 2WSEE 1QVFA 3CXCS 5CKBA 1NPPA 1OULA 1M27C 4N4HA 4PJLA 2F5KA 2QA4Q 2BE9B 2GBQA 1TS9A 3BDLA 4K11A 1ABOA 3OYAA 1VQ5A 2JTMA 2HEQA 5A2QE 5C0MA 1G3YA 4C5IA 1NM7A 1Q81R 2HDAA 1JQQA 2EFIA 4CC4B 2RQVA 1OX8A 1Q86R 3CCJQ 1BIBA 2I2LA 5IAYA 4MDXA 4FYXB 1JJ2P 4E7JA 3OBWA 3ZL7C 4RUGA 2O9SA 4L59A 5CO7A 1QWFA 2XDDA 2DZCA 4OMQA 2XU8A 1AHJB 3MP8A 3CCVT 1JB0E 4DEYA 2CYZB 2LNVA 3M4YA 2KI7A 5I2SA 3J81E 4XTVA 3ZFJA 1JXOA 4M7AE 2KQWA 2DXCA 2RM4A 4M7AB 3PMTA 3CC2T 4RTTA 1IRXA 2EIFA 4QKUA 1CSKA 3L1AA 4DQ2A 4RCCA 2M0OA 1WZOA 3KBGA 3G71T 1KQSP 2PVGB 2CH4A 2QEXA 3FB9A 2ZGWA 2LJ3A 4P5NA 2YUNA 3M58A 2JW4A 2DNUA 2XICA 4YTLA 2EGAA 4C0GA 4D6WA 1YIJA 4XU2A 3QO3A 2K2MA 2JXBA 3A98A 2L8DA 1D3BA 3FEOA 2NWMA 3CCEQ 4M7AD 4KGZB 3TEEA 4ANJA 1G8XA 4A4KA 3QHSA 5CKHA 3F70A 3EG1A 4IUVA 4JRIA 3FDRA 1OV3A 3MJXA 4NS5A 4L6V5 2RH2A 3I56A 8ATCB 2RHZA 2PVOB 2KT8A 2BIVA 1WFWA 4PFPA 4PJOC 2PU9B 5CVIA 2DO3A 1JEGA 2DJQA 4GLMA 5FRNA 5I21A 3JCMe 4QT7A 1M8MA 1K9AA 1QVFS 2XDPA 3JB9D 1Q7YU 3QDRB 2AT1B 2DK3A 2YHTA 3OS5A 5GMKh 2MCNA 2BTTA 2OTJA 8AT1B 5I11A 2FPDA 3JCMd 4E6RA 1GCQC 2RI5A 2LMJA 3M0RA 4M7DF 1OOTA 2HBWA 3MEUA 5KYUA 3BDUA 2K3XA 1WHKA 1IGQA 3VV0A 3CCLT 4NOYA 3OYDA 4M7DA 5CKDA 3EGDB 2VB6A 1QP2A 2K7AA 4ZGEB 1P92A 2QQBA 2M0YA 3E2UA 1BI0A 2X4WA 1PM3A 1OU8A 2CZ6B 2YRDA 4JJCA 1WLPB 4FW2A 2LZ6B 3PVQA 5CK9A 3JCMV 1B34A 3H41A 4ZTJA 5GAOl 3X26B 1VYTA 1NG2A 2MI6A 1K76A 4CI0C 3HFNA 2HZYA 3RKWA 1H3HA 1JBMA 4LE9A 4MZMA 1YWOA 1T0HA 2QYZA 3CMEA 2DXBA 3PNWC 5LJ5e 1VQ6Q 4F7UB 3FRNA 4M75C 4M77F 1YIJQ 1YITT 3C94A 3EFOA 2A36A 4M78C 3P8DA 2F69A 1M8VA 5GANe 1C6VX 1C1AA 3OSSC 3FIFA 1NYGA 2QDLA 2J6OA 2EVRA 1LCKA 3QYGB 4IUPA 3M57A 3CD6A 5GAN7 4F7UA 2EQJA 1VQMQ 3HHTB 4PLLA 4ZGDB 4A4FA 4XTXA 2JMCA 1W4SA 2C0OA 4FM4B 2EWNA 2RHXA 3L2QA 2K2VA 1ZSGA 4C92G 1V29B 1X6GA 2YUQA 1CKAA 3PIPA 4JJBA 2LQ8A 3QJYA 2CGHA 3SEMA 3OYJA 4C5HA 4II1A 1U1SA 1VQNA 3I55T 5A0GA 1FMKA 1HJDA 1WQ7A 4E47A 1G3WA 3S3MA 4TVRA 1PD1A 2VUBA 2EYXA 4J8OA 2HSPA 1Z9ZA 4Z02A 3JCMf 3R6OA 1LOJA 4XTWA 2ZCFB 3M0UA 2CP7A 4UC4A 2E1HA 4FSXA 4LDUA 4WCIA 2P0QA 4M75A 4JJNK 4OF1A 1QWEA 3SB2A 1Q82C 3X24B 2BZXA 5GANg 3CCRQ 1YNZA 2NUTA 3WXMB 3H0HA 2KDSA 3QDFA 5IN1A 1GXIE 2QQ9A 5CR2A 2HSEB 2DLPA 2V26A 4JRPA 1I07A 2KAFA 2GFUA 4OVAA 2K3BA 4FYYB 5KE2A 1XOVA 4F04B 2OTJT 1OZ3A 4XU0A 1BYMA 2KK4A 2X4XA 2A37A 4ORZA 1AWWA 3EH2A 3L2ZA 1MNDA 3EG3A 3CCMT 2DA9A 4BI3A 4F17A 1YWPA 2RJDA 2PZ1A 5I22A 1YI2Q 3CC4A 3VRYA 3CPWA 3H6ZA 4EMKA 2WACA 3GIBA 4J9HA 4FSSA 1PG5B 2NUPB 3L2VA 5AYFA 2CREA 3CMAQ 1Z9QA 4J6WA 4C0DB 1N8RR 1WJSA 1Q95G 2JM9A 2LQWA 3JRZA 5GJWB 2M16A 3OYGA 2ECZA 3RUXA 4QVCA 4C0FA 3N5BB 2KROA 1Q86U 4BE0A 2KXDA 1YHQQ 2WSCE 4Y28E 5GJVB 1RI9A 1VQKT 3HRSA 3EFRA 1K9MR 1M1KC 1WQWA 3P8BB 4ELZC 4QQGA 1N8RC 1IGUA 3H8ZA 1TOVA 3MP1A 3NHNA 4KT0E 3M5AA 4OMOA 3V7RA 4AG2C 4PJOG 1X43A 4E7KA 3LWHA 3G71A 1ZUYA 4FT2A 5IHNA 3CCSQ 4DEXA 4C8QD 5FWBA 1UGRB 4EMHA 4KGVB 3CC2A 4MMKA 2CP5A 2HL5C 3O8VA 4OB2B 1V76A 2RHYA 3UWNA 2CUBA 1PRMC 2EAYA 1YJWQ 2CZ0B 3CCUT 3J7AF 1ZSZC 2XI9A 1M3AA 5D7UA 1Q7YR 3CBOA 4R55A 2J06A 3ZEHA 1OI1A 4LXCA 1GCQA 2HCKA 2ZAEA 1PSFA 1D1CA 4OMMA 1PSEA 2FB7A 2CH4W 3T9NA 2RO0A 3OW2P 3LGFA 5FRMA 3A1PA 2EQKA 2AZVA 4OB3B 3VUZA 2EW3A 1VQ5Q 2YT6A 4JZ4A 2CT3A 5L23A 2ENMA 4RG2A 2RQWA 4ME7A 1RI0A 4C8QF 9ATCB 2RQTA 3EG9A 3FJPA 1Y57A 2VXEA 3PE0A 3OQ5A 5LJ5g 2JS0A 1VQPA 3OYCA 3VS1A 2XDBA 2DBKA 4J9IA 4HKEA 2YDLA 1KIKA 3OMCA 3L2RA 2L3RA 2DAQA 1JRIA 1SKUB 1I5LA 4LDYA 2SEMA 2KSSA 3QG1A 4KH1B 2AK5A 4C92D 3NFCA 4E7LA 5HY6A 4ZN1A 4C92A 5LL6S 2GF7A 1A0NB 3LH5A 1QLYA 1OEBA 4X9CA 1KFZA 3CC7Q 4OGCA 2RN8A 2RHIA 3TREA 3VUBA 2Y90A 2OTLA 2GQIA 2XMFA 2IPOB 1OQKA 1IB8A 4OGEA 1ZA1B 2CP3A 2DD5A 1Q86C 2EKHA 2AZSA 2ROTA 1TTHB 2JJ9A 1R8OB 1PRLC 2DJZA 1WHGA 1E7OA 4N4IA 2E10A 1KSWA 2DM1A 1WNLA 1BCOA 1QCNA 2EJGA 1N8RU 1Q81C 2HL3A 3EGDA 3M53A 4HCZA 1AZEA 1WJQA 1PCXA 2V1RA 1YIJT 2LT1A 4D8KA 3TCJA 2DTHA 1MV3A 4KBMB 1KJWA 3KUFA 2HD0A 1WHJA 1WA7A 2EQMA 2QGFB 4M78D 4M7AC 4LUEA 3VYGA 4PL6A 5GAMd 1S72A 3SWNB 1EFNA 2R5MA 2R5AA 2IG0A 1QP3A 3PTAA 1W2BP 2NLUA 3VS0A 1O75A 3M54A 4B9XA 3A8HB 5LJ3f 1QVFP 1UG1A 3G6ET 2DERA 4M7DB 2A7YA 2COYA 3A8GB 1BI2A 2OTJQ 4XU1A 4F14A 3EFOB 2L3SA 4PK4A 1R0BG 3H9NA 1YJWA 1AWOA 3CMET 3THKA 1U5SA 1WXBA 2EKOA 1GFCA 3SHWA 1LNXA 3PMIA 2QTVA 1QCFA 2K5IA 4BDYA 2BZ8A 1VQ9Q 3GBQA 5CAIA 3OMGA 3VYHB 2D0QB 5LJ3g 2X9HA 2VGMA 1IHVA 2B86A 4FYVB
chains in the Genus database with same CATH topology
1PKTA 2ED1A 1T3LA 1SHFA 3NMZC 1BK2A 2K7AA 1M3CA 5IH2A 2M0YA 1X6BA 4JJCA 5HCKA 4J9BA 2RQUA 1AZGB 2L3PA 1U3OA 3VRZA 1WLPB 2A28A 1V1CA 3UA7A 2LZ6B 1UGVA 2W10A 3PVQA 2EPDA 2L0AA 3H41A 1K4US 1VYTA 3I35A 3PVLA 1NG2A 4RTXA 1K76A 1GBRA 3I9QA 1ZUKA 2DRKA 4JPBW 4KRTA 1H3HA 4LE9A 1YWOA 5IHKA 1B3QA 1T0HA 4RTZA 1W70A 1WI7A 2A08A 2O88A 1NLOC 3UF4A 1VA7A 2D8HA 1SSHA 2EGCA 1HD3A 1I0CA 2J6FA 2A36A 2OAWA 2DL3A 3RNJA 1RLPC 1X27A 4J9GA 3VS2A 1NYGA 2QDLA 1QKXA 2H8HA 2J6OA 2EVRA 1LCKA 1NLPC 4LN2A 2YUOA 5ECAA 2CSQA 2JMCA 2FPFA 2C0TA 4AFSC 2JM8A 1J3TA 1AD5A 2C0OA 2EQIA 1ZSGA 1X6GA 4HVWA 1JXMA 2YUQA 1UHCA 1CKAA 2LP5A 4JJBA 1W6XA 1ZUUA 4AFQC 3SEMA 1T0JA 2LNHB 2GGRA 1GL5A 1FMKA 1HJDA 1K0SA 2VWFA 2KRNA 4Z88A 2KNBB 2C0IA 2EBPA 2EYXA 3ULRB 2IIMA 1UJ0A 3NGPA 2GNCA 1YN8A 1OPKA 1K0XA 2FRYA 2HSPA 1BU1A 1AEYA 1Z9ZA 1SEMA 2LJ1A 3I5SA 1G83A 3M0UA 1MUZA 1PWTA 3TSZA 4WCIA 2DL7A 2JS2A 2KGTA 2DYBA 1QWEA 1NYFA 4RTUA 2BZXA 4Y92A 2F2WA 2KE9A 4X1VA 1YNZA 2J6KA 2O2OA 4HVUA 2K9GA 2FRWA 4Z8AA 1K1ZA 3H0HA 1SRMA 2RMOA 2AKKA 2F2XA 5FWCA 1NEGA 2DLPA 3EG0A 4R0KA 3UA6A 4IIOA 1I07A 2CDTA 3M0QA 1UUEA 1AWJA 4D8DA 2K3BA 1XOVA 1QKWA 3U23A 3FJ5A 3KFVA 1BBZA 2DL8A 1WYXA 2A37A 3H0FA 3QWXX 2O9VA 4LNPA 4ORZA 1AWWA 1JO8A 3EG3A 2ROLA 1UE9A 2KYBA 2DA9A 3VS3A 4F17A 1YWPA 2PZ1A 1T3SA 4OMPA 5I22A 1G2BA 3VRYA 2D1XA 1UFFA 4J9HA 4FSSA 1H92A 1X69A 1NEBA 2V1QA 2BZYA 2CREA 3VS6A 3CQTA 1Z9QA 2FEIA 2L2PA 2J7IA 2KXCA 2JM9A 4J9CA 2LQWA 2VVKA 5GJWB 3H0IA 2ECZA 2RPNA 1M3BA 2EYYA 1M30A 2FPEA 2DF6A 2DRMA 1ABQA 2KROA 4OMNA 2KXDA 1WXUA 5GJVB 1AWXA 1RI9A 1TUDA 3EGUA 1GCPA 1I1JA 2YUPA 2D8JA 4RTWA 3EG2A 2F2VA 3TSWA 2DE0X 3I5RA 4Z89A 3NHNA 2CT4A 1TUCA 1MV0B 4OMOA 4AG2C 4RTYA 1X43A 5EC7A 1ZUYA 4CC3A 2G6FX 2MIOA 5IHNA 2JT4A 4DEXA 2X3XD 4J9EA 1S1NA 1OPLA 5FWBA 4M4ZA 3REBB 3IQLA 4AFUC 2EYWA 4CC2A 1BB9A 4HVVA 2DVJA 2CUBA 1HSQA 1PRMC 2KRMA 1UTIA 2ESWA 1M3AA 1WIEA 2LCSA 1GRIA 4HCKA 2J06A 1GCQA 2HCKA 2X3WD 1B07A 3VS7A 1WDXA 4OMMA 1AVZC 2KR3A 1AOJA 5IXFA 2CH4W 2GTJA 2GTOA 1YP5A 2FO0A 1X2KA 2AZVA 1W1FA 2RNAA 4HXJA 3VS5A 2J05A 2EW3A 2I0NA 2YT6A 4JZ4A 2CT3A 1X2QA 5L23A 1GFDA 4J9FA 3RBBB 2ENMA 4J9DA 1WX6A 2RQWA 2KBTA 3M0PA 2PNIA 2OJ2A 1ZLMA 3C0CA 2KYMA 2RQTA 4OMLA 1Y57A 3PE0A 1SHGA 2JS0A 1UJYA 3VS1A 1M27C 2CSIA 2DBKA 2NUZA 2GBQA 2DMOA 4JJDA 2JTEA 2E5KA 4J9IA 2YDLA 1ABOA 4K11A 1KIKA 2HEQA 4EIKA 2DILA 1RLQC 1NM7A 1UDLA 4A63B 2HDAA 2KRSA 2VKNA 2SEMA 1JQQA 2LQNA 1PHTA 1H8KA 4CC4B 2O31A 2AK5A 2RQVA 1PNJA 2ABLA 1A0NB 1VYUA 3LH5A 1N5ZA 1QLYA 1OEBA 3O5ZA 3ZL7C 2L3QA 1KFZA 4RUGA 2O9SA 1UECA 1PKSA 2RN8A 1QWFA 1TG0A 3NPFA 4OMQA 2W0ZA 1U06A 1E6HA 1Y0MA 3R6NA 4DEYA 3EHQA 1JU5C 1ARKA 4GBQA 2GQIA 2XMFA 3UATA 2KT1A 2EKHA 4F16A 2AZSA 2ROTA 1JXOA 2AKLA 1YCSB 1RUWA 1PRLC 2KEAA 1E7OA 2PTKA 1KSWA 4RTTA 2DM1A 1CSKA 1SPKA 2K6DA 1E6GA 1SRLA 4AG1C 3VS4A 1AZEA 4RTVA 2YSQA 2V1RA 4D8KA 2CH4A 5IXBA 2FG0A 1MV3A 1CKBA 2LJ3A 2CUDA 1KJWA 2YUNA 2D0NA 3TVTA 2JW4A 2DNUA 5FW9A 1WA7A 1GBQA 2MOXA 2B86A 2DX1A 4LUDA 2EGAA 4LUEA 1WXTA 3JV3A 3M0TA 1UHFA 2K2MA 2JXBA 3A98A 1ZX6A 1EFNA 2NWMA 3VS0A 2DBMA 3REAB 2JMAA 4AFZC 2RF0A 3EG1A 1UG1A 1OV3A 2OI3A 5IHIA 4ESRA 3M0SA 1FYNA 4CC7A 1VYVA 3EHRA 4F14A 4IIMA 2KT8A 2L3SA 1ZBJA 1WFWA 2EYZA 1JEGA 2DJQA 4GLMA 1AWOA 2EGEA 2RQRA 3THKA 1U5SA 1WXBA 1GFCA 2ED0A 4QT7A 1M8MA 2SRCA 1K9AA 3SHWA 2DL4A 2P4RA 3QWYA 1QCFA 2BTTA 2MCNA 4JZ3A 2LJ0A 2BZ8A 3GBQA 2DL5A 5I11A 2FPDA 1IO6A 4E6RA 2K79A 1GCQC 2M51A 2LX7A 2LMJA 3M0RA 1OOTA 2HBWA 4ZNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKT A;  2ED1 A;  1T3L A;  1SHF A;  3NMZ C;  1BK2 A;  2K7A A;  1M3C A;  5IH2 A;  2M0Y A;  1X6B A;  4JJC A;  5HCK A;  4J9B A;  2RQU A;  1AZG B;  2L3P A;  1U3O A;  3VRZ A;  1WLP B;  2A28 A;  1V1C A;  3UA7 A;  2LZ6 B;  1UGV A;  2W10 A;  3PVQ A;  2EPD A;  2L0A A;  3H41 A;  1K4U S;  1VYT A;  3I35 A;  3PVL A;  1NG2 A;  4RTX A;  1K76 A;  1GBR A;  3I9Q A;  1ZUK A;  2DRK A;  4JPB W;  4KRT A;  1H3H A;  4LE9 A;  1YWO A;  5IHK A;  1B3Q A;  1T0H A;  4RTZ A;  1W70 A;  1WI7 A;  2A08 A;  2O88 A;  1NLO C;  3UF4 A;  1VA7 A;  2D8H A;  1SSH A;  2EGC A;  1HD3 A;  1I0C A;  2J6F A;  2A36 A;  2OAW A;  2DL3 A;  3RNJ A;  1RLP C;  1X27 A;  4J9G A;  3VS2 A;  1NYG A;  2QDL A;  1QKX A;  2H8H A;  2J6O A;  2EVR A;  1LCK A;  1NLP C;  4LN2 A;  2YUO A;  5ECA A;  2CSQ A;  2JMC A;  2FPF A;  2C0T A;  4AFS C;  2JM8 A;  1J3T A;  1AD5 A;  2C0O A;  2EQI A;  1ZSG A;  1X6G A;  4HVW A;  1JXM A;  2YUQ A;  1UHC A;  1CKA A;  2LP5 A;  4JJB A;  1W6X A;  1ZUU A;  4AFQ C;  3SEM A;  1T0J A;  2LNH B;  2GGR A;  1GL5 A;  1FMK A;  1HJD A;  1K0S A;  2VWF A;  2KRN A;  4Z88 A;  2KNB B;  2C0I A;  2EBP A;  2EYX A;  3ULR B;  2IIM A;  1UJ0 A;  3NGP A;  2GNC A;  1YN8 A;  1OPK A;  1K0X A;  2FRY A;  2HSP A;  1BU1 A;  1AEY A;  1Z9Z A;  1SEM A;  2LJ1 A;  3I5S A;  1G83 A;  3M0U A;  1MUZ A;  1PWT A;  3TSZ A;  4WCI A;  2DL7 A;  2JS2 A;  2KGT A;  2DYB A;  1QWE A;  1NYF A;  4RTU A;  2BZX A;  4Y92 A;  2F2W A;  2KE9 A;  4X1V A;  1YNZ A;  2J6K A;  2O2O A;  4HVU A;  2K9G A;  2FRW A;  4Z8A A;  1K1Z A;  3H0H A;  1SRM A;  2RMO A;  2AKK A;  2F2X A;  5FWC A;  1NEG A;  2DLP A;  3EG0 A;  4R0K A;  3UA6 A;  4IIO A;  1I07 A;  2CDT A;  3M0Q A;  1UUE A;  1AWJ A;  4D8D A;  2K3B A;  1XOV A;  1QKW A;  3U23 A;  3FJ5 A;  3KFV A;  1BBZ A;  2DL8 A;  1WYX A;  2A37 A;  3H0F A;  3QWX X;  2O9V A;  4LNP A;  4ORZ A;  1AWW A;  1JO8 A;  3EG3 A;  2ROL A;  1UE9 A;  2KYB A;  2DA9 A;  3VS3 A;  4F17 A;  1YWP A;  2PZ1 A;  1T3S A;  4OMP A;  5I22 A;  1G2B A;  3VRY A;  2D1X A;  1UFF A;  4J9H A;  4FSS A;  1H92 A;  1X69 A;  1NEB A;  2V1Q A;  2BZY A;  2CRE A;  3VS6 A;  3CQT A;  1Z9Q A;  2FEI A;  2L2P A;  2J7I A;  2KXC A;  2JM9 A;  4J9C A;  2LQW A;  2VVK A;  5GJW B;  3H0I A;  2ECZ A;  2RPN A;  1M3B A;  2EYY A;  1M30 A;  2FPE A;  2DF6 A;  2DRM A;  1ABQ A;  2KRO A;  4OMN A;  2KXD A;  1WXU A;  5GJV B;  1AWX A;  1RI9 A;  1TUD A;  3EGU A;  1GCP A;  1I1J A;  2YUP A;  2D8J A;  4RTW A;  3EG2 A;  2F2V A;  3TSW A;  2DE0 X;  3I5R A;  4Z89 A;  3NHN A;  2CT4 A;  1TUC A;  1MV0 B;  4OMO A;  4AG2 C;  4RTY A;  1X43 A;  5EC7 A;  1ZUY A;  4CC3 A;  2G6F X;  2MIO A;  5IHN A;  2JT4 A;  4DEX A;  2X3X D;  4J9E A;  1S1N A;  1OPL A;  5FWB A;  4M4Z A;  3REB B;  3IQL A;  4AFU C;  2EYW A;  4CC2 A;  1BB9 A;  4HVV A;  2DVJ A;  2CUB A;  1HSQ A;  1PRM C;  2KRM A;  1UTI A;  2ESW A;  1M3A A;  1WIE A;  2LCS A;  1GRI A;  4HCK A;  2J06 A;  1GCQ A;  2HCK A;  2X3W D;  1B07 A;  3VS7 A;  1WDX A;  4OMM A;  1AVZ C;  2KR3 A;  1AOJ A;  5IXF A;  2CH4 W;  2GTJ A;  2GTO A;  1YP5 A;  2FO0 A;  1X2K A;  2AZV A;  1W1F A;  2RNA A;  4HXJ A;  3VS5 A;  2J05 A;  2EW3 A;  2I0N A;  2YT6 A;  4JZ4 A;  2CT3 A;  1X2Q A;  5L23 A;  1GFD A;  4J9F A;  3RBB B;  2ENM A;  4J9D A;  1WX6 A;  2RQW A;  2KBT A;  3M0P A;  2PNI A;  2OJ2 A;  1ZLM A;  3C0C A;  2KYM A;  2RQT A;  4OML A;  1Y57 A;  3PE0 A;  1SHG A;  2JS0 A;  1UJY A;  3VS1 A;  1M27 C;  2CSI A;  2DBK A;  2NUZ A;  2GBQ A;  2DMO A;  4JJD A;  2JTE A;  2E5K A;  4J9I A;  2YDL A;  1ABO A;  4K11 A;  1KIK A;  2HEQ A;  4EIK A;  2DIL A;  1RLQ C;  1NM7 A;  1UDL A;  4A63 B;  2HDA A;  2KRS A;  2VKN A;  2SEM A;  1JQQ A;  2LQN A;  1PHT A;  1H8K A;  4CC4 B;  2O31 A;  2AK5 A;  2RQV A;  1PNJ A;  2ABL A;  1A0N B;  1VYU A;  3LH5 A;  1N5Z A;  1QLY A;  1OEB A;  3O5Z A;  3ZL7 C;  2L3Q A;  1KFZ A;  4RUG A;  2O9S A;  1UEC A;  1PKS A;  2RN8 A;  1QWF A;  1TG0 A;  3NPF A;  4OMQ A;  2W0Z A;  1U06 A;  1E6H A;  1Y0M A;  3R6N A;  4DEY A;  3EHQ A;  1JU5 C;  1ARK A;  4GBQ A;  2GQI A;  2XMF A;  3UAT A;  2KT1 A;  2EKH A;  4F16 A;  2AZS A;  2ROT A;  1JXO A;  2AKL A;  1YCS B;  1RUW A;  1PRL C;  2KEA A;  1E7O A;  2PTK A;  1KSW A;  4RTT A;  2DM1 A;  1CSK A;  1SPK A;  2K6D A;  1E6G A;  1SRL A;  4AG1 C;  3VS4 A;  1AZE A;  4RTV A;  2YSQ A;  2V1R A;  4D8K A;  2CH4 A;  5IXB A;  2FG0 A;  1MV3 A;  1CKB A;  2LJ3 A;  2CUD A;  1KJW A;  2YUN A;  2D0N A;  3TVT A;  2JW4 A;  2DNU A;  5FW9 A;  1WA7 A;  1GBQ A;  2MOX A;  2B86 A;  2DX1 A;  4LUD A;  2EGA A;  4LUE A;  1WXT A;  3JV3 A;  3M0T A;  1UHF A;  2K2M A;  2JXB A;  3A98 A;  1ZX6 A;  1EFN A;  2NWM A;  3VS0 A;  2DBM A;  3REA B;  2JMA A;  4AFZ C;  2RF0 A;  3EG1 A;  1UG1 A;  1OV3 A;  2OI3 A;  5IHI A;  4ESR A;  3M0S A;  1FYN A;  4CC7 A;  1VYV A;  3EHR A;  4F14 A;  4IIM A;  2KT8 A;  2L3S A;  1ZBJ A;  1WFW A;  2EYZ A;  1JEG A;  2DJQ A;  4GLM A;  1AWO A;  2EGE A;  2RQR A;  3THK A;  1U5S A;  1WXB A;  1GFC A;  2ED0 A;  4QT7 A;  1M8M A;  2SRC A;  1K9A A;  3SHW A;  2DL4 A;  2P4R A;  3QWY A;  1QCF A;  2BTT A;  2MCN A;  4JZ3 A;  2LJ0 A;  2BZ8 A;  3GBQ A;  2DL5 A;  5I11 A;  2FPD A;  1IO6 A;  4E6R A;  2K79 A;  1GCQ C;  2M51 A;  2LX7 A;  2LMJ A;  3M0R A;  1OOT A;  2HBW A;  4ZNX A; 
#chains in the Genus database with same CATH topology
 3C95 A;  1PKT A;  1D0Z A;  4RMO A;  3EAE A;  5LJ5 d;  3OBY A;  5D6Y A;  3HP9 A;  2BE7 D;  2QEX Q;  3VRZ A;  4ZGJ B;  3I55 Q;  3QII A;  5LJ5 f;  1FMW A;  3LX7 A;  2EPD A;  2YWW A;  5GAO q;  3MCA B;  3DB3 A;  2Z0W A;  1UB4 A;  2VXF A;  1K9M U;  2YLB A;  2P4T A;  3BW1 A;  4PFZ A;  4RTX A;  1YJ9 Q;  4E7S A;  2YRC A;  2DRK A;  2RI2 A;  4FU6 A;  2MPX C;  5IHK A;  1B3Q A;  3EGX A;  5CKF A;  4A4E A;  2VGN A;  1Y7X A;  2EJ9 A;  1NLO C;  3UF4 A;  2DET A;  5GAN j;  1VQ9 T;  5A0D A;  4JLI A;  1I0C A;  1K8A C;  3JCM P;  2O01 E;  3VS2 A;  1RLP C;  1KD1 U;  1QKX A;  2H8H A;  3D7S B;  1MGQ A;  3CC2 Q;  1Q81 U;  2YUO A;  4MML A;  2HQX A;  3CCU Q;  2CZ1 B;  2L5Q A;  2CSQ A;  3V8L A;  1J3T A;  1AD5 A;  3AHU A;  4C8Q B;  4M7A G;  4EMK B;  4M75 B;  3RER A;  4EPC A;  3V8J A;  1JXM A;  3GF5 A;  4BE1 A;  2LP5 A;  3JCM b;  4M7D E;  4M78 B;  1ZUU A;  5CKE A;  3TQ7 P;  4AFQ C;  2NUT B;  1T0J A;  2FYK A;  3CCS T;  3NTH A;  1M2O A;  2LNH B;  2LVM A;  1RAA B;  1GL5 A;  1K0S A;  2ZPF B;  3CCJ T;  2KRN A;  2KNB B;  2LQK A;  4PJO F;  1YHQ A;  1VQ8 A;  3OB9 A;  3ULR B;  1VIF A;  2DD4 A;  4A4G A;  1UJ0 A;  3NGP A;  2K4Y A;  1YN8 A;  5GMK j;  2GFA A;  4PKC C;  5FU6 B;  3JB9 G;  1SEM A;  3ME9 A;  2E4H A;  1VQL Q;  3S6W A;  2KVQ G;  1YHQ T;  3L2U A;  3RKX A;  2FVU A;  1MUZ A;  1PWT A;  4C92 C;  3TSZ A;  4JLG A;  3Q1J A;  1M5Q 1;  4OP0 A;  3CC7 A;  1KHI A;  2DXU A;  2KE9 A;  1M2V A;  2K9G A;  1S72 Q;  2FRW A;  1VIE A;  5FU7 B;  1SRM A;  2RMO A;  3CCR A;  1RAF B;  1NEG A;  1EIF A;  4R0K A;  4J5Y A;  3A8L B;  1U8R A;  2CDT A;  1AWJ A;  1R77 A;  3RMS A;  3FJ5 A;  2E5Q A;  1KC8 R;  1BBZ A;  1WJR A;  4M77 A;  1M2V B;  3M56 A;  2ROL A;  1UE9 A;  2KYB A;  2RK1 A;  4J83 A;  5GAN 4;  1G2B A;  1G5V A;  3JCM h;  4EMG A;  1H92 A;  1X69 A;  5DLQ E;  3VS6 A;  1ZA2 B;  3CQT A;  5GAO m;  3I56 T;  1QVP A;  2FEI A;  2L2P A;  2GCX A;  2VVK A;  2V8J A;  1Q82 R;  1RAI B;  2RPN A;  1M3B A;  3OYB A;  4BUG A;  1VQO Q;  3FLG A;  1M30 A;  4M7A A;  4JUV A;  2FL7 A;  1FX7 A;  1MMA A;  1I1J A;  4PJJ A;  4BAC A;  1Y07 A;  3EG2 A;  1IZ6 A;  3CCL A;  2XK0 A;  5GAM g;  1K8A U;  4PNO A;  4PFO A;  2ZPG B;  5GMK i;  1VQM T;  1I4K 1;  1TUC A;  4A54 A;  2O4X A;  2QQA A;  2HKN A;  4CC3 A;  2PVD B;  2XHC A;  7AT1 B;  1VQ4 Q;  2BKD N;  2LC4 A;  2QAS A;  4M4Z A;  3REB B;  2E64 A;  1VQO T;  5KCH A;  2EYW A;  1RAH B;  1Q7Y C;  5KH6 A;  1BB9 A;  4F7U E;  4HVV A;  5GAN 6;  2DVJ A;  1HSQ A;  2DIG A;  1MHN A;  4F7U F;  2ESW A;  2LCS A;  5J26 A;  2K5F A;  1D1A A;  4M77 E;  3QJ6 A;  1YIT A;  2RB6 A;  3HTR A;  1AOJ A;  2ZPH B;  1YP5 A;  5CCA A;  2FO0 A;  1YIT Q;  1NJI R;  1X2K A;  2FZK B;  1VQL T;  2QA4 A;  3CXC P;  2QQR A;  3QZ5 B;  1GFD A;  4DBQ A;  4J9F A;  3GLX A;  1K9M C;  2KBT A;  3M0P A;  1D09 B;  2E41 A;  4OML A;  3FC3 A;  3CMA A;  5KYX A;  4IKF A;  1M9S A;  2EJF A;  5IT9 E;  4PJO A;  1UJY A;  2CSI A;  3RKY A;  2DMO A;  4JJD A;  3WVD B;  3RIR A;  4X34 A;  1RLQ C;  4A63 B;  2KRS A;  4QW2 A;  2VKN A;  5DY9 A;  5FLX E;  1KD1 R;  2DTO A;  1BIA A;  1PNJ A;  2ABL A;  3CBM A;  1VYU A;  4E2F B;  3O5Z A;  2L3Q A;  1UEC A;  3L42 A;  1PKS A;  1TG0 A;  4KUI A;  1U06 A;  4LDX A;  4M78 E;  1WHM A;  2IVW A;  1Y0M A;  3R6N A;  5KCO A;  3EHQ A;  3MPU B;  1X6O A;  1JU5 C;  2ZPE B;  2LDM A;  4GBQ A;  1C0M A;  1VQ4 T;  1M4Z A;  1EX4 A;  1M1F A;  3UAT A;  2OTL T;  4FT4 A;  1TH7 A;  2RD1 A;  4B6M A;  1YCY A;  5GAO n;  1VQ7 T;  4N0A A;  1IXD A;  2KEA A;  2PTK A;  4C5G A;  5GAM e;  1VQ5 T;  3HFO A;  5L8R E;  2K6D A;  3CCQ A;  1SRL A;  4XU3 A;  3G7Z A;  4AG1 C;  2CS7 A;  1VQP T;  3VS4 A;  1KQ1 A;  1QCO A;  3G4S Q;  4IUR A;  4BDZ A;  2YSQ A;  1ACM B;  2VC8 A;  5IXB A;  2FG0 A;  4E7I A;  3A5Z B;  1QVG A;  1CKB A;  2CUD A;  4QQ6 A;  3LH0 A;  1I8F A;  2OX7 A;  2ATC B;  1GBQ A;  2MOX A;  1RL2 A;  2DX1 A;  4LUD A;  3I56 Q;  1ZQ1 A;  4LD6 A;  1WXT A;  4CRI A;  1RAE B;  3M0T A;  5FU6 C;  5D6X A;  2DBM A;  2V8I A;  3REA B;  3C4S A;  2RF0 A;  4X9D A;  1N6A A;  3JCM J;  1R0C B;  4HT9 A;  5IHI A;  4ESR A;  3X25 B;  2DTI A;  2Y4Y A;  3M0S A;  4CC7 A;  1VYV A;  3EHR A;  4XQ3 A;  4ZN3 A;  4MZP A;  4IIM A;  2AHJ B;  1D3B B;  3M4G A;  5LJ3 e;  3M55 A;  2DPP B;  2BUD A;  2EGE A;  1MMN A;  1YJW T;  2QDY B;  2ED0 A;  4HA8 A;  2SRC A;  4FL6 A;  2RI3 A;  1QVG S;  2DL4 A;  3QWY A;  2FZG B;  2LJ0 A;  4KUL A;  1WHL A;  3CPW P;  3HPW A;  3SD4 A;  2DL5 A;  1KG1 A;  1BKB A;  4V2S A;  3NTI A;  4C8Q G;  2LX7 A;  4ZNX A;  2ED1 A;  4ELY C;  1YJN T;  5GAN f;  2WSF E;  1T3L A;  3QZ9 B;  3NMZ C;  1K73 R;  5KE3 A;  3CMA T;  2X51 A;  1X6B A;  4LDV A;  2JUF A;  5HCK A;  3OSV A;  1U3O A;  3JSC A;  2ZPI B;  2A3L A;  3MKD A;  2HBP A;  3UA7 A;  1K8A R;  2W10 A;  1M90 C;  2L0A A;  2XKO C;  1BI3 A;  3URG A;  1TUG B;  1OX9 A;  2MMP A;  3OYH A;  4OB1 B;  2M1H A;  3S3N A;  3CCQ T;  1GBR A;  3SWN A;  4JPB W;  4F7U G;  3E19 A;  4KRT A;  3CCL Q;  4Q5W A;  1Y96 B;  3CCE A;  4C8Q E;  1LPL A;  4BY6 C;  1W70 A;  2D9T A;  1WI7 A;  4EMK C;  3RDV A;  2A08 A;  1TWB A;  3CCM A;  1VA7 A;  5KYW A;  2XD0 A;  2EGC A;  2J6F A;  3E9F A;  2JN0 A;  5KYY A;  4NL3 A;  1KHC A;  4JRK A;  1MMG A;  2DL3 A;  1Y96 A;  3RNJ A;  1X27 A;  1QQJ A;  1OYX A;  3EFS A;  1NLP C;  4LN2 A;  4M77 B;  4M7D D;  3SFM A;  2RK2 A;  5GAN 2;  4A4H A;  5KYW B;  2C0T A;  1B7T A;  2G3R A;  2JM8 A;  2LCC A;  3LWI A;  1KC8 U;  2EQI A;  3E9G A;  5D6W A;  3CCR T;  4FCY A;  4E7H A;  4JDS A;  2DIQ A;  1UHC A;  3EGX B;  1N9S A;  1JJ2 A;  4C92 E;  3CC4 Q;  2DEU A;  4KH0 B;  3A8M B;  5GAM h;  2MAM A;  2E70 A;  3OYY A;  2C0I A;  1X75 C;  3BFM A;  4JS5 A;  3X20 B;  2GNC A;  1AT1 B;  1K0X A;  2FRY A;  2ZPB B;  1BU1 A;  3SWN C;  5I2M A;  1AEY A;  3MET A;  2F5T X;  4O6J A;  5CQX A;  2LRQ A;  3I5S A;  1G83 A;  4GLK A;  3ASK A;  5HKC A;  1FMV A;  1VQP Q;  1XTD A;  1ZSZ A;  3SDZ A;  3AT1 B;  2MK5 A;  2DL7 A;  4M7D C;  5EG2 A;  2JS2 A;  3I55 A;  2KGT A;  2DYB A;  1NYF A;  4JS4 A;  4X1V A;  2J6K A;  2O2O A;  3RR6 A;  2QK0 A;  1K1Z A;  1VOM A;  2F2X A;  3QKJ A;  4KUD K;  3EG0 A;  1UGP B;  3OYK A;  2MF2 A;  3UA6 A;  4Y91 A;  1UUE A;  2JNG A;  4DBR A;  4LDW A;  1EZZ B;  2JTF A;  3CCV Q;  3JCM Q;  3H0F A;  2O9V A;  4LNP A;  5KYU B;  4N0A C;  3OYN A;  2RJE A;  1JO8 A;  4M75 G;  3VS3 A;  4OMP A;  2MYS A;  4WTO B;  4C8Q A;  3JB9 F;  2D1X A;  2CKK A;  4IUU A;  1UFF A;  1NEB A;  2V1Q A;  4XTU A;  1PC0 A;  4M78 A;  2J7I A;  3JB9 I;  3CCQ Q;  1SSF A;  4QVZ A;  2EYY A;  2R57 A;  1VQ8 T;  2XG8 D;  2FPE A;  2QA4 T;  2DF6 A;  2R58 A;  1ABQ A;  1U1T A;  4ZTF A;  4O5V A;  2FZC B;  2CP2 A;  3CXC A;  4L5G A;  1VQ8 Q;  1WXU A;  3EGU A;  1GCP A;  4RTW A;  2YUP A;  2D8J A;  2F2V A;  1TU0 B;  4M7A F;  2DYI A;  3JCM W;  2DE0 X;  4OMF B;  1YFN A;  2CT4 A;  1MV0 B;  4DOV A;  5EC7 A;  3CPW S;  1K73 U;  2MIO A;  3DKM A;  2JT4 A;  3CCM Q;  1OPL A;  3NTK A;  3VU3 C;  4M77 G;  4AFU C;  2CZ7 B;  3QPH A;  4QQD A;  1RAC B;  3QXE B;  5KYX B;  1YBY A;  2KRM A;  3MHX A;  3JAM E;  4C8Q C;  1WIE A;  1GRI A;  2JVV A;  3MEA A;  2X3W D;  1B07 A;  1G3S A;  3HKS A;  3VS7 A;  3OYE A;  3PIO A;  2X4J A;  2QTX A;  2PUK B;  2GTO A;  2XID A;  3BY7 A;  1QVG P;  3UT1 A;  3OS1 A;  2H3E B;  2LTO A;  1D1B A;  3M9Q A;  3PT9 A;  3CCE T;  3MP6 A;  4HXJ A;  4HCC A;  2J05 A;  2X35 A;  2I0N A;  4KGX B;  1NJI U;  1KQ2 A;  1X2Q A;  3RBB B;  4AT1 B;  4J9D A;  2D6F A;  1VQN T;  1ZLM A;  1MMD A;  2KYM A;  4BI8 B;  1KQS S;  4FIB A;  2F1L A;  1D0Y A;  1XJW B;  4C92 B;  3PGG A;  2NUZ A;  1OZ2 A;  2JTE A;  2E5K A;  2GQV A;  3CCS A;  4WF2 A;  2LT4 A;  2QEX T;  5DM7 R;  4EIK A;  2DIL A;  4DBF A;  1UDL A;  5A0L A;  5FRO A;  5FU7 C;  2LQN A;  1PHT A;  1H8K A;  2PQW A;  2O31 A;  3VJP A;  3DLL A;  3CME Q;  1DJ7 B;  3CD6 T;  3OS0 A;  1VQ7 Q;  2E65 A;  2KY9 A;  3QBY A;  1N5Z A;  3UDC A;  2OTL Q;  4JRQ A;  1Q82 U;  2VV5 A;  3CCV A;  1PD0 A;  5M9O A;  3NPF A;  2W0Z A;  1KC8 C;  1E6H A;  3LLR A;  2CP6 A;  1ARK A;  2P0P A;  3WVE B;  4XAX B;  4DA4 A;  2KT1 A;  1N27 A;  3E1S A;  2HMA A;  4F16 A;  2QXF A;  3OS2 A;  2AKL A;  1YCS B;  4VUB A;  1RUW A;  2QG9 B;  3GPL A;  3QSU A;  1S72 T;  4QVD A;  3A8O B;  2PUO B;  1VQO A;  1WHH A;  1SPK A;  2COW A;  3C12 A;  1E6G A;  5KYN A;  4BE2 A;  1RAD B;  4RTV A;  2M02 A;  1OU9 A;  1NE8 A;  1K73 C;  2X4Y A;  2D0N A;  3TVT A;  5FW9 A;  1JJ2 S;  3JCM c;  4IUQ A;  2HQE A;  4PJM A;  1YJN Q;  4PJO B;  2KMT A;  4HCB A;  2VAS A;  3JV3 A;  5DLO A;  1UHF A;  5GAN 5;  1ZX6 A;  3J80 E;  2E6N A;  1SF9 A;  3ZBD A;  2E3H A;  1M1K U;  2JMA A;  2OAU A;  5GAN d;  4AFZ C;  1KK7 A;  3JB9 J;  2E6Z A;  2VYT A;  1ZHI A;  1ZBX A;  2OI3 A;  3MEV A;  2Y4X A;  1VQ7 A;  2NYS A;  3LW5 E;  1FYN A;  3OYL A;  2K3Y A;  1ZBJ A;  4GY5 A;  2EYZ A;  3DLM A;  1LVK A;  2RQR A;  1M1K R;  4J6Y A;  1Y71 A;  3CCU A;  4DBH A;  4ATO A;  5LJ5 h;  3JB9 H;  2P4R A;  1NPR A;  3V7S A;  1I5O B;  2EQU A;  4JZ3 A;  1BI1 A;  1IO6 A;  3GOX A;  2JOY A;  5LJ5 j;  4B9W A;  2MWP A;  1NZ9 A;  2K79 A;  2M51 A;  1NBE B;  3EG9 B;  4J7F A;  3KXT A;  2E3I A;  3LGL A;  2QQS A;  1SHF A;  4BY6 B;  1H3Z A;  1BK2 A;  1M3C A;  2CP0 A;  1YJ9 T;  5IH2 A;  1YJN A;  1M1G A;  4M77 D;  4J9B A;  2RQU A;  1AZG B;  2L3P A;  3OYF A;  1RAG B;  2A28 A;  1V1C A;  3S3O A;  1UGV A;  1HXD A;  3HL8 A;  2EYQ A;  4BD3 A;  1I81 A;  1VQL A;  4M78 F;  1K4U S;  4M75 D;  3I35 A;  1UGS B;  3PVL A;  3G4S A;  4C0Z A;  4M77 C;  3I9Q A;  1F1B B;  1ZUK A;  3CPF A;  4RTZ A;  5GAO p;  1HYO A;  5GMK m;  5HK0 A;  2FHD A;  3GNF B;  1G3T A;  1VUB A;  2O88 A;  2HKQ B;  5GAN 8;  2D8H A;  4XTY A;  1SSH A;  1HD3 A;  5AT1 B;  2DZ9 A;  3G6E A;  4EDU A;  2OAW A;  4J9G A;  4IUT A;  1X01 A;  4HT8 A;  2DFU A;  5ECA A;  2A0F B;  2RA2 A;  2COZ A;  1B34 B;  4AFS C;  2FPF A;  1ZSZ B;  5LJ3 d;  3JCM X;  3G1J A;  2YXY A;  1QW1 A;  5GAM j;  3CBP A;  4HVW A;  1VQK Q;  3X28 B;  3PFS A;  3RES A;  4PJO D;  1W6X A;  1YI2 A;  1HK9 A;  2GGR A;  4DOW A;  3M59 A;  4AMC A;  4R56 A;  3UPU A;  2VWF A;  4Z88 A;  5GMK e;  2EBP A;  2IIM A;  2JZ2 A;  2C06 A;  4BI4 A;  1OPK A;  1UGQ B;  1IHW A;  2AIR B;  2LJ1 A;  3QYH B;  1YI2 T;  2RJC A;  1VQ6 A;  1NJI C;  4XTZ A;  1KQS A;  1W2B A;  1O9S A;  2E12 A;  3GP8 A;  2RHU A;  4MZT A;  4RTU A;  4Y92 A;  3OY9 A;  2F2W A;  2DEQ A;  2ZZD A;  1H64 1;  4HVU A;  3EH1 A;  5LJ3 h;  4Z8A A;  2DKG A;  3VKI A;  2AKK A;  4PLI A;  5FWC A;  5GAO r;  5LJ3 j;  3V8K A;  5KYY B;  3BE3 A;  4IIO A;  1FXX A;  3HRU A;  4D8D A;  3M0Q A;  4FYW B;  1QKW A;  3U23 A;  4RKU E;  3KFV A;  4C5E A;  1UEB A;  5GAM f;  2DL8 A;  1WYX A;  5GMK l;  3QWX X;  2K57 A;  2P0K A;  4M75 F;  3CC7 T;  4RCB A;  5HK3 A;  2B8A A;  3V7C A;  1T3S A;  4M75 E;  1N9R A;  3LYI A;  3CEY A;  3CD6 Q;  2BZY A;  1WPY A;  2HQH A;  3JCM g;  2KXC A;  4J9C A;  3TU4 K;  4E7Z A;  4XK8 E;  3H0I A;  2HAX A;  1SG5 A;  2DRM A;  3G71 Q;  4OMN A;  4MDW A;  3INZ A;  3G4S T;  4PJN A;  4C92 F;  1AWX A;  1TUD A;  4FW1 A;  1YJ9 A;  1D0X A;  3TSW A;  1QMC A;  1RAB B;  3MO8 A;  4NL2 A;  4OB0 B;  3OW2 A;  1VQN Q;  2M9U A;  3I5R A;  3CCJ A;  1XNI A;  2V8K A;  2QGG A;  4Z89 A;  2YRV A;  4C0D C;  1BCM A;  2H3J A;  2YLC A;  4RTY A;  5J3B A;  5CIU A;  2P84 A;  3RMQ A;  3OYI A;  2HNI A;  5J39 A;  4LD9 K;  2G6F X;  4J6X A;  3ER0 A;  3OA6 A;  3G6E Q;  2X3X D;  4J9E A;  1S1N A;  3CC4 T;  2RJF A;  1MNE A;  2QI2 A;  3HSB A;  3IQL A;  1M90 R;  3QUI A;  2DXT A;  3L2W A;  4CC2 A;  2O4X B;  2LCL A;  1TSF A;  1LJO A;  1VQ9 A;  3HRT A;  1UTI A;  4N4G A;  1VQM A;  4PJO E;  4HCK A;  1VQ4 A;  2L89 A;  3OYM A;  4M78 G;  1KD1 C;  3P8H A;  3GNG A;  5C6S A;  5GAN 3;  1WDX A;  1AVZ C;  3OW2 S;  1FWZ A;  2KR3 A;  5IXF A;  1VQK A;  2GTJ A;  1W2B S;  2NUP A;  1WGS A;  1W1F A;  2QAZ A;  4BB7 A;  5GAN h;  4A53 A;  2K5L A;  2RNA A;  4RG8 A;  3VS5 A;  1VQ6 T;  1IRE B;  1M90 U;  4J7I A;  3DB4 A;  1WX6 A;  2MWO A;  2PNI A;  2OJ2 A;  4M7D G;  2LX9 A;  3MEW A;  5CQY A;  3C0C A;  1XQH A;  2DVE A;  1TXQ A;  6AT1 B;  1SHG A;  2WSE E;  1QVF A;  3CXC S;  5CKB A;  1NPP A;  1OUL A;  1M27 C;  4N4H A;  4PJL A;  2F5K A;  2QA4 Q;  2BE9 B;  2GBQ A;  1TS9 A;  3BDL A;  4K11 A;  1ABO A;  3OYA A;  1VQ5 A;  2JTM A;  2HEQ A;  5A2Q E;  5C0M A;  1G3Y A;  4C5I A;  1NM7 A;  1Q81 R;  2HDA A;  1JQQ A;  2EFI A;  4CC4 B;  2RQV A;  1OX8 A;  1Q86 R;  3CCJ Q;  1BIB A;  2I2L A;  5IAY A;  4MDX A;  4FYX B;  1JJ2 P;  4E7J A;  3OBW A;  3ZL7 C;  4RUG A;  2O9S A;  4L59 A;  5CO7 A;  1QWF A;  2XDD A;  2DZC A;  4OMQ A;  2XU8 A;  1AHJ B;  3MP8 A;  3CCV T;  1JB0 E;  4DEY A;  2CYZ B;  2LNV A;  3M4Y A;  2KI7 A;  5I2S A;  3J81 E;  4XTV A;  3ZFJ A;  1JXO A;  4M7A E;  2KQW A;  2DXC A;  2RM4 A;  4M7A B;  3PMT A;  3CC2 T;  4RTT A;  1IRX A;  2EIF A;  4QKU A;  1CSK A;  3L1A A;  4DQ2 A;  4RCC A;  2M0O A;  1WZO A;  3KBG A;  3G71 T;  1KQS P;  2PVG B;  2CH4 A;  2QEX A;  3FB9 A;  2ZGW A;  2LJ3 A;  4P5N A;  2YUN A;  3M58 A;  2JW4 A;  2DNU A;  2XIC A;  4YTL A;  2EGA A;  4C0G A;  4D6W A;  1YIJ A;  4XU2 A;  3QO3 A;  2K2M A;  2JXB A;  3A98 A;  2L8D A;  1D3B A;  3FEO A;  2NWM A;  3CCE Q;  4M7A D;  4KGZ B;  3TEE A;  4ANJ A;  1G8X A;  4A4K A;  3QHS A;  5CKH A;  3F70 A;  3EG1 A;  4IUV A;  4JRI A;  3FDR A;  1OV3 A;  3MJX A;  4NS5 A;  4L6V 5;  2RH2 A;  3I56 A;  8ATC B;  2RHZ A;  2PVO B;  2KT8 A;  2BIV A;  1WFW A;  4PFP A;  4PJO C;  2PU9 B;  5CVI A;  2DO3 A;  1JEG A;  2DJQ A;  4GLM A;  5FRN A;  5I21 A;  3JCM e;  4QT7 A;  1M8M A;  1K9A A;  1QVF S;  2XDP A;  3JB9 D;  1Q7Y U;  3QDR B;  2AT1 B;  2DK3 A;  2YHT A;  3OS5 A;  5GMK h;  2MCN A;  2BTT A;  2OTJ A;  8AT1 B;  5I11 A;  2FPD A;  3JCM d;  4E6R A;  1GCQ C;  2RI5 A;  2LMJ A;  3M0R A;  4M7D F;  1OOT A;  2HBW A;  3MEU A;  5KYU A;  3BDU A;  2K3X A;  1WHK A;  1IGQ A;  3VV0 A;  3CCL T;  4NOY A;  3OYD A;  4M7D A;  5CKD A;  3EGD B;  2VB6 A;  1QP2 A;  2K7A A;  4ZGE B;  1P92 A;  2QQB A;  2M0Y A;  3E2U A;  1BI0 A;  2X4W A;  1PM3 A;  1OU8 A;  2CZ6 B;  2YRD A;  4JJC A;  1WLP B;  4FW2 A;  2LZ6 B;  3PVQ A;  5CK9 A;  3JCM V;  1B34 A;  3H41 A;  4ZTJ A;  5GAO l;  3X26 B;  1VYT A;  1NG2 A;  2MI6 A;  1K76 A;  4CI0 C;  3HFN A;  2HZY A;  3RKW A;  1H3H A;  1JBM A;  4LE9 A;  4MZM A;  1YWO A;  1T0H A;  2QYZ A;  3CME A;  2DXB A;  3PNW C;  5LJ5 e;  1VQ6 Q;  4F7U B;  3FRN A;  4M75 C;  4M77 F;  1YIJ Q;  1YIT T;  3C94 A;  3EFO A;  2A36 A;  4M78 C;  3P8D A;  2F69 A;  1M8V A;  5GAN e;  1C6V X;  1C1A A;  3OSS C;  3FIF A;  1NYG A;  2QDL A;  2J6O A;  2EVR A;  1LCK A;  3QYG B;  4IUP A;  3M57 A;  3CD6 A;  5GAN 7;  4F7U A;  2EQJ A;  1VQM Q;  3HHT B;  4PLL A;  4ZGD B;  4A4F A;  4XTX A;  2JMC A;  1W4S A;  2C0O A;  4FM4 B;  2EWN A;  2RHX A;  3L2Q A;  2K2V A;  1ZSG A;  4C92 G;  1V29 B;  1X6G A;  2YUQ A;  1CKA A;  3PIP A;  4JJB A;  2LQ8 A;  3QJY A;  2CGH A;  3SEM A;  3OYJ A;  4C5H A;  4II1 A;  1U1S A;  1VQN A;  3I55 T;  5A0G A;  1FMK A;  1HJD A;  1WQ7 A;  4E47 A;  1G3W A;  3S3M A;  4TVR A;  1PD1 A;  2VUB A;  2EYX A;  4J8O A;  2HSP A;  1Z9Z A;  4Z02 A;  3JCM f;  3R6O A;  1LOJ A;  4XTW A;  2ZCF B;  3M0U A;  2CP7 A;  4UC4 A;  2E1H A;  4FSX A;  4LDU A;  4WCI A;  2P0Q A;  4M75 A;  4JJN K;  4OF1 A;  1QWE A;  3SB2 A;  1Q82 C;  3X24 B;  2BZX A;  5GAN g;  3CCR Q;  1YNZ A;  2NUT A;  3WXM B;  3H0H A;  2KDS A;  3QDF A;  5IN1 A;  1GXI E;  2QQ9 A;  5CR2 A;  2HSE B;  2DLP A;  2V26 A;  4JRP A;  1I07 A;  2KAF A;  2GFU A;  4OVA A;  2K3B A;  4FYY B;  5KE2 A;  1XOV A;  4F04 B;  2OTJ T;  1OZ3 A;  4XU0 A;  1BYM A;  2KK4 A;  2X4X A;  2A37 A;  4ORZ A;  1AWW A;  3EH2 A;  3L2Z A;  1MND A;  3EG3 A;  3CCM T;  2DA9 A;  4BI3 A;  4F17 A;  1YWP A;  2RJD A;  2PZ1 A;  5I22 A;  1YI2 Q;  3CC4 A;  3VRY A;  3CPW A;  3H6Z A;  4EMK A;  2WAC A;  3GIB A;  4J9H A;  4FSS A;  1PG5 B;  2NUP B;  3L2V A;  5AYF A;  2CRE A;  3CMA Q;  1Z9Q A;  4J6W A;  4C0D B;  1N8R R;  1WJS A;  1Q95 G;  2JM9 A;  2LQW A;  3JRZ A;  5GJW B;  2M16 A;  3OYG A;  2ECZ A;  3RUX A;  4QVC A;  4C0F A;  3N5B B;  2KRO A;  1Q86 U;  4BE0 A;  2KXD A;  1YHQ Q;  2WSC E;  4Y28 E;  5GJV B;  1RI9 A;  1VQK T;  3HRS A;  3EFR A;  1K9M R;  1M1K C;  1WQW A;  3P8B B;  4ELZ C;  4QQG A;  1N8R C;  1IGU A;  3H8Z A;  1TOV A;  3MP1 A;  3NHN A;  4KT0 E;  3M5A A;  4OMO A;  3V7R A;  4AG2 C;  4PJO G;  1X43 A;  4E7K A;  3LWH A;  3G71 A;  1ZUY A;  4FT2 A;  5IHN A;  3CCS Q;  4DEX A;  4C8Q D;  5FWB A;  1UGR B;  4EMH A;  4KGV B;  3CC2 A;  4MMK A;  2CP5 A;  2HL5 C;  3O8V A;  4OB2 B;  1V76 A;  2RHY A;  3UWN A;  2CUB A;  1PRM C;  2EAY A;  1YJW Q;  2CZ0 B;  3CCU T;  3J7A F;  1ZSZ C;  2XI9 A;  1M3A A;  5D7U A;  1Q7Y R;  3CBO A;  4R55 A;  2J06 A;  3ZEH A;  1OI1 A;  4LXC A;  1GCQ A;  2HCK A;  2ZAE A;  1PSF A;  1D1C A;  4OMM A;  1PSE A;  2FB7 A;  2CH4 W;  3T9N A;  2RO0 A;  3OW2 P;  3LGF A;  5FRM A;  3A1P A;  2EQK A;  2AZV A;  4OB3 B;  3VUZ A;  2EW3 A;  1VQ5 Q;  2YT6 A;  4JZ4 A;  2CT3 A;  5L23 A;  2ENM A;  4RG2 A;  2RQW A;  4ME7 A;  1RI0 A;  4C8Q F;  9ATC B;  2RQT A;  3EG9 A;  3FJP A;  1Y57 A;  2VXE A;  3PE0 A;  3OQ5 A;  5LJ5 g;  2JS0 A;  1VQP A;  3OYC A;  3VS1 A;  2XDB A;  2DBK A;  4J9I A;  4HKE A;  2YDL A;  1KIK A;  3OMC A;  3L2R A;  2L3R A;  2DAQ A;  1JRI A;  1SKU B;  1I5L A;  4LDY A;  2SEM A;  2KSS A;  3QG1 A;  4KH1 B;  2AK5 A;  4C92 D;  3NFC A;  4E7L A;  5HY6 A;  4ZN1 A;  4C92 A;  5LL6 S;  2GF7 A;  1A0N B;  3LH5 A;  1QLY A;  1OEB A;  4X9C A;  1KFZ A;  3CC7 Q;  4OGC A;  2RN8 A;  2RHI A;  3TRE A;  3VUB A;  2Y90 A;  2OTL A;  2GQI A;  2XMF A;  2IPO B;  1OQK A;  1IB8 A;  4OGE A;  1ZA1 B;  2CP3 A;  2DD5 A;  1Q86 C;  2EKH A;  2AZS A;  2ROT A;  1TTH B;  2JJ9 A;  1R8O B;  1PRL C;  2DJZ A;  1WHG A;  1E7O A;  4N4I A;  2E10 A;  1KSW A;  2DM1 A;  1WNL A;  1BCO A;  1QCN A;  2EJG A;  1N8R U;  1Q81 C;  2HL3 A;  3EGD A;  3M53 A;  4HCZ A;  1AZE A;  1WJQ A;  1PCX A;  2V1R A;  1YIJ T;  2LT1 A;  4D8K A;  3TCJ A;  2DTH A;  1MV3 A;  4KBM B;  1KJW A;  3KUF A;  2HD0 A;  1WHJ A;  1WA7 A;  2EQM A;  2QGF B;  4M78 D;  4M7A C;  4LUE A;  3VYG A;  4PL6 A;  5GAM d;  1S72 A;  3SWN B;  1EFN A;  2R5M A;  2R5A A;  2IG0 A;  1QP3 A;  3PTA A;  1W2B P;  2NLU A;  3VS0 A;  1O75 A;  3M54 A;  4B9X A;  3A8H B;  5LJ3 f;  1QVF P;  1UG1 A;  3G6E T;  2DER A;  4M7D B;  2A7Y A;  2COY A;  3A8G B;  1BI2 A;  2OTJ Q;  4XU1 A;  4F14 A;  3EFO B;  2L3S A;  4PK4 A;  1R0B G;  3H9N A;  1YJW A;  1AWO A;  3CME T;  3THK A;  1U5S A;  1WXB A;  2EKO A;  1GFC A;  3SHW A;  1LNX A;  3PMI A;  2QTV A;  1QCF A;  2K5I A;  4BDY A;  2BZ8 A;  1VQ9 Q;  3GBQ A;  5CAI A;  3OMG A;  3VYH B;  2D0Q B;  5LJ3 g;  2X9H A;  2VGM A;  1IHV A;  2B86 A;  4FYV B; 
#chains in the Genus database with same CATH homology
 1PKT A;  2ED1 A;  1T3L A;  1SHF A;  3NMZ C;  1BK2 A;  2K7A A;  1M3C A;  5IH2 A;  2M0Y A;  1X6B A;  4JJC A;  5HCK A;  4J9B A;  2RQU A;  1AZG B;  2L3P A;  1U3O A;  3VRZ A;  1WLP B;  2A28 A;  1V1C A;  3UA7 A;  2LZ6 B;  1UGV A;  2W10 A;  3PVQ A;  2EPD A;  2L0A A;  3H41 A;  1K4U S;  1VYT A;  3I35 A;  3PVL A;  1NG2 A;  4RTX A;  1K76 A;  1GBR A;  3I9Q A;  1ZUK A;  2DRK A;  4JPB W;  4KRT A;  1H3H A;  4LE9 A;  1YWO A;  5IHK A;  1B3Q A;  1T0H A;  4RTZ A;  1W70 A;  1WI7 A;  2A08 A;  2O88 A;  1NLO C;  3UF4 A;  1VA7 A;  2D8H A;  1SSH A;  2EGC A;  1HD3 A;  1I0C A;  2J6F A;  2A36 A;  2OAW A;  2DL3 A;  3RNJ A;  1RLP C;  1X27 A;  4J9G A;  3VS2 A;  1NYG A;  2QDL A;  1QKX A;  2H8H A;  2J6O A;  2EVR A;  1LCK A;  1NLP C;  4LN2 A;  2YUO A;  5ECA A;  2CSQ A;  2JMC A;  2FPF A;  2C0T A;  4AFS C;  2JM8 A;  1J3T A;  1AD5 A;  2C0O A;  2EQI A;  1ZSG A;  1X6G A;  4HVW A;  1JXM A;  2YUQ A;  1UHC A;  1CKA A;  2LP5 A;  4JJB A;  1W6X A;  1ZUU A;  4AFQ C;  3SEM A;  1T0J A;  2LNH B;  2GGR A;  1GL5 A;  1FMK A;  1HJD A;  1K0S A;  2VWF A;  2KRN A;  4Z88 A;  2KNB B;  2C0I A;  2EBP A;  2EYX A;  3ULR B;  2IIM A;  1UJ0 A;  3NGP A;  2GNC A;  1YN8 A;  1OPK A;  1K0X A;  2FRY A;  2HSP A;  1BU1 A;  1AEY A;  1Z9Z A;  1SEM A;  2LJ1 A;  3I5S A;  1G83 A;  3M0U A;  1MUZ A;  1PWT A;  3TSZ A;  4WCI A;  2DL7 A;  2JS2 A;  2KGT A;  2DYB A;  1QWE A;  1NYF A;  4RTU A;  2BZX A;  4Y92 A;  2F2W A;  2KE9 A;  4X1V A;  1YNZ A;  2J6K A;  2O2O A;  4HVU A;  2K9G A;  2FRW A;  4Z8A A;  1K1Z A;  3H0H A;  1SRM A;  2RMO A;  2AKK A;  2F2X A;  5FWC A;  1NEG A;  2DLP A;  3EG0 A;  4R0K A;  3UA6 A;  4IIO A;  1I07 A;  2CDT A;  3M0Q A;  1UUE A;  1AWJ A;  4D8D A;  2K3B A;  1XOV A;  1QKW A;  3U23 A;  3FJ5 A;  3KFV A;  1BBZ A;  2DL8 A;  1WYX A;  2A37 A;  3H0F A;  3QWX X;  2O9V A;  4LNP A;  4ORZ A;  1AWW A;  1JO8 A;  3EG3 A;  2ROL A;  1UE9 A;  2KYB A;  2DA9 A;  3VS3 A;  4F17 A;  1YWP A;  2PZ1 A;  1T3S A;  4OMP A;  5I22 A;  1G2B A;  3VRY A;  2D1X A;  1UFF A;  4J9H A;  4FSS A;  1H92 A;  1X69 A;  1NEB A;  2V1Q A;  2BZY A;  2CRE A;  3VS6 A;  3CQT A;  1Z9Q A;  2FEI A;  2L2P A;  2J7I A;  2KXC A;  2JM9 A;  4J9C A;  2LQW A;  2VVK A;  5GJW B;  3H0I A;  2ECZ A;  2RPN A;  1M3B A;  2EYY A;  1M30 A;  2FPE A;  2DF6 A;  2DRM A;  1ABQ A;  2KRO A;  4OMN A;  2KXD A;  1WXU A;  5GJV B;  1AWX A;  1RI9 A;  1TUD A;  3EGU A;  1GCP A;  1I1J A;  2YUP A;  2D8J A;  4RTW A;  3EG2 A;  2F2V A;  3TSW A;  2DE0 X;  3I5R A;  4Z89 A;  3NHN A;  2CT4 A;  1TUC A;  1MV0 B;  4OMO A;  4AG2 C;  4RTY A;  1X43 A;  5EC7 A;  1ZUY A;  4CC3 A;  2G6F X;  2MIO A;  5IHN A;  2JT4 A;  4DEX A;  2X3X D;  4J9E A;  1S1N A;  1OPL A;  5FWB A;  4M4Z A;  3REB B;  3IQL A;  4AFU C;  2EYW A;  4CC2 A;  1BB9 A;  4HVV A;  2DVJ A;  2CUB A;  1HSQ A;  1PRM C;  2KRM A;  1UTI A;  2ESW A;  1M3A A;  1WIE A;  2LCS A;  1GRI A;  4HCK A;  2J06 A;  1GCQ A;  2HCK A;  2X3W D;  1B07 A;  3VS7 A;  1WDX A;  4OMM A;  1AVZ C;  2KR3 A;  1AOJ A;  5IXF A;  2CH4 W;  2GTJ A;  2GTO A;  1YP5 A;  2FO0 A;  1X2K A;  2AZV A;  1W1F A;  2RNA A;  4HXJ A;  3VS5 A;  2J05 A;  2EW3 A;  2I0N A;  2YT6 A;  4JZ4 A;  2CT3 A;  1X2Q A;  5L23 A;  1GFD A;  4J9F A;  3RBB B;  2ENM A;  4J9D A;  1WX6 A;  2RQW A;  2KBT A;  3M0P A;  2PNI A;  2OJ2 A;  1ZLM A;  3C0C A;  2KYM A;  2RQT A;  4OML A;  1Y57 A;  3PE0 A;  1SHG A;  2JS0 A;  1UJY A;  3VS1 A;  1M27 C;  2CSI A;  2DBK A;  2NUZ A;  2GBQ A;  2DMO A;  4JJD A;  2JTE A;  2E5K A;  4J9I A;  2YDL A;  1ABO A;  4K11 A;  1KIK A;  2HEQ A;  4EIK A;  2DIL A;  1RLQ C;  1NM7 A;  1UDL A;  4A63 B;  2HDA A;  2KRS A;  2VKN A;  2SEM A;  1JQQ A;  2LQN A;  1PHT A;  1H8K A;  4CC4 B;  2O31 A;  2AK5 A;  2RQV A;  1PNJ A;  2ABL A;  1A0N B;  1VYU A;  3LH5 A;  1N5Z A;  1QLY A;  1OEB A;  3O5Z A;  3ZL7 C;  2L3Q A;  1KFZ A;  4RUG A;  2O9S A;  1UEC A;  1PKS A;  2RN8 A;  1QWF A;  1TG0 A;  3NPF A;  4OMQ A;  2W0Z A;  1U06 A;  1E6H A;  1Y0M A;  3R6N A;  4DEY A;  3EHQ A;  1JU5 C;  1ARK A;  4GBQ A;  2GQI A;  2XMF A;  3UAT A;  2KT1 A;  2EKH A;  4F16 A;  2AZS A;  2ROT A;  1JXO A;  2AKL A;  1YCS B;  1RUW A;  1PRL C;  2KEA A;  1E7O A;  2PTK A;  1KSW A;  4RTT A;  2DM1 A;  1CSK A;  1SPK A;  2K6D A;  1E6G A;  1SRL A;  4AG1 C;  3VS4 A;  1AZE A;  4RTV A;  2YSQ A;  2V1R A;  4D8K A;  2CH4 A;  5IXB A;  2FG0 A;  1MV3 A;  1CKB A;  2LJ3 A;  2CUD A;  1KJW A;  2YUN A;  2D0N A;  3TVT A;  2JW4 A;  2DNU A;  5FW9 A;  1WA7 A;  1GBQ A;  2MOX A;  2B86 A;  2DX1 A;  4LUD A;  2EGA A;  4LUE A;  1WXT A;  3JV3 A;  3M0T A;  1UHF A;  2K2M A;  2JXB A;  3A98 A;  1ZX6 A;  1EFN A;  2NWM A;  3VS0 A;  2DBM A;  3REA B;  2JMA A;  4AFZ C;  2RF0 A;  3EG1 A;  1UG1 A;  1OV3 A;  2OI3 A;  5IHI A;  4ESR A;  3M0S A;  1FYN A;  4CC7 A;  1VYV A;  3EHR A;  4F14 A;  4IIM A;  2KT8 A;  2L3S A;  1ZBJ A;  1WFW A;  2EYZ A;  1JEG A;  2DJQ A;  4GLM A;  1AWO A;  2EGE A;  2RQR A;  3THK A;  1U5S A;  1WXB A;  1GFC A;  2ED0 A;  4QT7 A;  1M8M A;  2SRC A;  1K9A A;  3SHW A;  2DL4 A;  2P4R A;  3QWY A;  1QCF A;  2BTT A;  2MCN A;  4JZ3 A;  2LJ0 A;  2BZ8 A;  3GBQ A;  2DL5 A;  5I11 A;  2FPD A;  1IO6 A;  4E6R A;  2K79 A;  1GCQ C;  2M51 A;  2LX7 A;  2LMJ A;  3M0R A;  1OOT A;  2HBW A;  4ZNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...