2GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gbqA00
2EPDA 2QDLA 1CKAA 1SRMA 1UTIA 4AFSC 1OPKA 2RMOA 1U3OA 1M3BA 3EHRA 2RQRA 1VYUA 2LQWA 2FEIA 1AZEA 1RLQC 2CT4A 2LNHB 1WXUA 2ECZA 1XOVA 2KRMA 2GGRA 1GCQC 1UECA 5ECAA 1BBZA 3QWYA 3EHQA 1JO8A 1TUCA 3M0QA 1KFZA 1ZUYA 1UG1A 2YT6A 3PVQA 1V1CA 1N5ZA 2BZXA 2JW4A 1UE9A 1M30A 2DJQA 1X2QA 4HVVA 2GBQA 2GTJA 1QKXA 1W70A 2KGTA 1SEMA 2K3BA 2H8HA 3KFVA 1WFWA 2IIMA 2ROLA 2KROA 1E6HA 4GLMA 5FWBA 1T0HA 2J6FA 1MV0B 5EC7A 3VS0A 1OEBA 2VWFA 1AWXA 4RTTA 2HBWA 3I35A 2A36A 1UUEA 3PE0A 4CC7A 1X2KA 1Z9QA 2AKLA 2FRYA 2AZVA 1WXTA 2NWMA 3TSZA 1J3TA 2ED1A 1NLOC 2MIOA 4LE9A 5HCKA 2NUZA 4OMNA 1TG0A 1VYTA 1T3SA 1AOJA 3H0FA 2FPFA 3H0HA 1UJYA 1IO6A 1WDXA 2HCKA 3I5RA 4RUGA 1X6BA 2DILA 1VYVA 2ESWA 3R6NA 4E6RA 3VS4A 2ENMA 1HJDA 2C0TA 2CUBA 2KEAA 4F17A 4EIKA 4J9GA 3ULRB 3EG0A 2RN8A 1ABOA 2L0AA 3M0SA 2DL5A 3UA6A 2CUDA 4GBQA 1M3CA 1AWJA 1HSQA 1GRIA 2RQTA 1ARKA 2D8HA 2CREA 4OMQA 1SPKA 1KSWA 2PTKA 4CC4B 3VS2A 2LX7A 1UFFA 1UJ0A 4OMMA 2EYXA 2O9SA 1PKTA 2LJ3A 2F2XA 1H92A 2KBTA 2DE0X 1RUWA 1WXBA 1H8KA 2EGCA 4J9EA 2C0OA 2EGEA 3M0TA 3JV3A 1YWPA 1WX6A 1Y0MA 1QWEA 1YWOA 4RTVA 2J06A 4AG1C 1UHFA 2F2VA 1UHCA 1GL5A 2L3QA 2X3WD 2J6OA 1WI7A 1EFNA 4J9IA 2LJ0A 3QWXX 2J05A 2E5KA 2M0YA 4J9CA 1HD3A 1QKWA 2CH4A 4FSSA 2I0NA 4A63B 2KR3A 2OJ2A 2PNIA 2V1RA 1ZLMA 4KRTA 4D8DA 2EYWA 1QCFA 3M0RA 3VRYA 4F14A 3C0CA 3TVTA 1B3QA 1JQQA 3EGUA 1PRMC 4AFQC 3EG1A 1UGVA 1GFDA 1BU1A 1M3AA 2MOXA 3VS5A 1X43A 2ROTA 3NGPA 2B86A 2SRCA 1JEGA 2ED0A 2YUOA 2EKHA 1NEGA 4JZ3A 1GBQA 2ABLA 4LNPA 1PKSA 2KXCA 3PVLA 2KNBB 1CKBA 1AWOA 1AVZC 1NYFA 2DF6A 2DBMA 2LZ6B 4ESRA 1GFCA 4ORZA 1KIKA 3VS3A 2K9GA 3UATA 1I0CA 1WLPB 4M4ZA 1OV3A 2P4RA 1K1ZA 4ZNXA 2DYBA 5FWCA 1NM7A 2HEQA 2K7AA 2CDTA 4X1VA 1UDLA 2DL7A 2W0ZA 3SHWA 2YUNA 1BK2A 2J7IA 2DNUA 3CQTA 2K6DA 4DEXA 4J9DA 2KYBA 1FMKA 3RBBB 5IXFA 4Z88A 1E6GA 1U06A 4RTXA 2CH4W 2A37A 2LMJA 5I11A 4F16A 2K79A 3REBB 2DL4A 3GBQA 4D8KA 1W1FA 1WIEA 2KXDA 2FO0A 2KE9A 1FYNA 1G2BA 1H3HA 4RTZA 3TSWA 1CSKA 1AWWA 2HDAA 1K9AA 2FPDA 2XMFA 2DRMA 3UF4A 1PRLC 2RQVA 1M8MA 1QLYA 1T3LA 4RTWA 3SEMA 4Y92A 2DBKA 4R0KA 4RTUA 1K0XA 2RQWA 1OOTA 2O9VA 4JJDA 2YUPA 2FRWA 2LJ1A 2D1XA 3VRZA 1K0SA 1K4US 1ZUKA 2EYZA 2M51A 2SEMA 5IHNA 1JXMA 4LUEA 2KYMA 5IHIA 2RF0A 2JM8A 3M0PA 3THKA 2GQIA 5IXBA 3RNJA 2DM1A 4OMPA 2DRKA 1MV3A 2CSQA 3LH5A 1W6XA 1Y57A 2BZ8A 1NG2A 3NHNA 4IIMA 1YNZA 1ABQA 2A08A 2D0NA 4J9HA 3I5SA 4JZ4A 2LCSA 1LCKA 3I9QA 4HCKA 4AFZC 1YN8A 2VVKA 2GTOA 5IHKA 1ZUUA 2JS2A 2YDLA 3A98A 3H41A 2L2PA 4HVUA 2DL3A 5I22A 2JTEA 3NPFA 3VS7A 1E7OA 1QWFA 1ZSGA 2VKNA 2KRSA 1YP5A 1A0NB 2JT4A 1TUDA 2MCNA 1SHGA 1AEYA 1AZGB 2OAWA 4LUDA 2D8JA 4JPBW 3VS1A 1VA7A 1ZX6A 2O2OA 2CSIA 2EQIA 2A28A 2JMCA 4IIOA 2OI3A 2K2MA 1G83A 2EVRA 2JMAA 2BZYA 1YCSB 2RPNA 2O88A 1X6GA 4RTYA 1SSHA 1Z9ZA 3M0UA 1SRLA 1X69A 2DMOA 2DX1A 2LQNA 4QT7A 1WYXA 2LP5A 2DA9A 2DLPA 2JXBA 4AG2C 2L3PA 1PNJA 4AFUC 2L3SA 2KRNA 2KT1A 2DL8A 1PHTA 2JS0A 2PZ1A 1B07A 2YUQA 2DVJA 5GJVB 1GCQA 2AKKA 3H0IA 1NYGA 1RI9A 1NLPC 1T0JA 2JM9A 1MUZA 4JJBA 1S1NA 1I1JA 2YSQA 4LN2A 3VS6A 2RQUA 2HSPA 2AK5A 4K11A 5IH2A 2FG0A 1GBRA 4HXJA 3NMZC 1AD5A 1NEBA 3FJ5A 2V1QA 3IQLA 3UA7A 1KJWA 5FW9A 2EW3A 4WCIA 1SHFA 2EGAA 4Z8AA 1JXOA 4J9FA 1X27A 3REAB 2O31A 2FPEA 1BB9A 3O5ZA 1I07A 4OMLA 2RNAA 1RLPC 2J6KA 5GJWB 2CT3A 3U23A 4CC2A 1U5SA 4HVWA 4DEYA 3EG2A 2C0IA 4Z89A 2F2WA 3ZL7C 1ZBJA 2KT8A 2X3XD 5L23A 3EG3A 4OMOA 1GCPA 1M27C 1WA7A 2W10A 2EBPA 2AZSA 2G6FX 4CC3A 1K76A 1JU5C 1PWTA 2BTTA 2GNCA 1OPLA 4JJCA 4J9BA 2EYYA
chains in the Genus database with same CATH superfamily
4M7DE 2LX9A 1CKAA 1UTIA 4KGXB 4AFSC 1OPKA 2RJDA 1M3BA 3EHRA 1VYUA 2LQWA 3ZBDA 2ZPHB 1VQ6T 1AZEA 1U1TA 5GAOl 3OW2P 3V8KA 2KRMA 4ELZC 3QWYA 2IVWA 3F70A 4EPCA 1JO8A 5FU6C 4PFOA 2DEUA 3TREA 2YT6A 2YRDA 4M75D 1V1CA 1N5ZA 4A4FA 1X2QA 1Q7YU 2OTLT 1QKXA 2X4JA 2H8HA 2K5LA 3FLGA 3MPUB 2KDSA 3JCMf 2RHIA 2IIMA 4KGVB 3JB9J 1VQKA 2V8IA 3VS0A 2EQUA 3X26B 4C0DB 2F5KA 4ZTFA 2QQAA 4RTTA 3OB9A 3I35A 2A36A 1VQKQ 4J5YA 3PE0A 1WHHA 4C5HA 3CPWP 3QYHB 2AKLA 3L42A 1M9SA 2BUDA 5CKDA 3HKSA 4M7AA 3MEVA 2PUOB 2X9HA 3V8JA 1VQMT 3ZFJA 1IGUA 2CZ0B 3H0HA 1G3YA 2F69A 2DIGA 2HCKA 3I5RA 1MMAA 4RUGA 1X6BA 1TH7A 1VYVA 1WJQA 3P8DA 4XU3A 1HJDA 2C0TA 2CUBA 4F17A 1N6AA 2MWOA 2DTHA 3EG0A 3LGFA 1YIJT 4BI4A 4XTXA 2YLCA 3N5BB 2CREA 1PM3A 2DTIA 4OMQA 4C5EA 2CP6A 2PVGB 3VS2A 2ZZDA 3OSVA 4F7UB 5LJ5j 1UFFA 1UJ0A 1JBMA 3A8MB 1VQ7T 4IUVA 3CMAQ 1YJ9Q 2L5QA 1H92A 2KBTA 1N9SA 3HSBA 4DA4A 4KUIA 3CD6A 3EGDA 4QKUA 3D7SB 4M78F 3PIOA 1UEBA 3R6OA 3L2VA 4M7AE 2EGCA 2QI2A 2EGEA 3OS1A 3FRNA 3JV3A 1WX6A 5D6WA 1MNEA 3CD6Q 1YWOA 2GFAA 5A0GA 1YCYA 4QVZA 2E6NA 1I5LA 3OYMA 4PJOB 2QTXA 3WVDB 2COYA 3JCMd 2QXFA 2J6OA 3EG9B 1EFNA 1PSFA 4J9CA 5IN1A 2ZPEB 2E65A 1W2BS 1HD3A 1QKWA 2CH4A 4FSSA 5FU7C 3G4SA 4HKEA 2KR3A 2PNIA 2DTOA 5GAOq 1ZLMA 4KRTA 2DETA 4D8DA 3E1SA 2ZCFB 2EYWA 1QVGS 5CIUA 3URGA 2L3RA 3OQ5A 5J3BA 3JCMh 2KI7A 3M0RA 4M77G 4F14A 3TVTA 1B3QA 3EGUA 5KYUB 3EFOB 1B7TA 2A3LA 1M3AA 3VS5A 3QDRB 2SRCA 1NJIC 2ED0A 3PFSA 5KE2A 3HTRA 1C1AA 4ME7A 3X28B 3JB9I 1GBQA 3G71T 2KXCA 2XIDA 1CKBA 1R0BG 1RACB 5GAOm 2DF6A 2X35A 4J83A 1M1GA 1NJIU 4M4ZA 1K1ZA 4E7KA 1Y71A 4ZNXA 5FWCA 3X25B 3G6ET 2C06A 3SWNB 2K3YA 2CDTA 1UDLA 4J7FA 4ELYC 4PK4A 3JCMe 2EKOA 4ZN1A 4M77D 4BE2A 2DNUA 2QEXQ 1KD1U 3AHUA 3MO8A 4BDZA 3PT9A 4Q5WA 3OYJA 1YHQA 3MEWA 3VKIA 1E6GA 5FROA 3M56A 1U06A 3DLMA 3JCMg 1M1KC 3LGLA 1M4ZA 4LXCA 1G3WA 1YHQQ 4F16A 2K79A 2HQHA 2DXCA 5LJ5f 2DL4A 4NOYA 4C92B 2CGHA 2KXDA 1SG5A 2KE9A 4BDYA 1H3HA 2HDAA 2FPDA 3SB2A 1YBYA 3C95A 3X24B 1WHMA 4PFPA 5GAOp 1T3LA 1UB4A 4RTWA 4O6JA 4JLIA 3OYYA 2RQWA 2O9VA 4LDVA 3RDVA 3RMSA 2VASA 2LJ1A 1WJRA 2EYZA 3META 2YLBA 2K5IA 2KYMA 5IHIA 4PKCC 4CI0C 3H6ZA 2CP0A 2JM8A 3RNJA 2DM1A 3VJPA 2ZGWA 2DRKA 1MV3A 2EQMA 2QAZA 2YRVA 4IKFA 2LT4A 1Y57A 4M7DB 3L2ZA 1WQWA 3NHNA 2HMAA 1Q7YR 1IZ6A 3I5SA 4JRQA 5KYXB 4HCKA 1YN8A 2VVKA 1EX4A 3V8LA 1UGRB 1DJ7B 5KYYB 3NTHA 3H41A 2MK5A 5GAN3 2DL3A 3NPFA 3INZA 4EMKA 3FIFA 1E7OA 1ZSGA 4EDUA 2KRSA 4OGCA 2JT4A 3RR6A 1TUDA 2MCNA 1SHGA 4XTUA 2OAWA 4JPBW 3L2WA 1XQHA 2HAXA 4ATOA 2DO3A 4X9DA 3P8BB 2BZYA 3RESA 2JZ2A 3MCAB 2LT1A 4F7UA 1VQMA 2NUTB 5KE3A 5LJ5d 1BIAA 2DX1A 4JRPA 1QCNA 2DA9A 2DLPA 4DBQA 2HQXA 1Y96B 1VQMQ 4BB7A 2JOYA 1PHTA 2JS0A 3OYFA 1QVFS 1VQKT 5GJVB 1G8XA 2AKKA 3QJYA 4Z02A 3CPWA 2DAQA 3RERA 4PJOA 5LJ5h 3DB4A 1NLPC 1MUZA 1QP3A 1S1NA 4K11A 2HSPA 2AK5A 3EG9A 1BI0A 1KC8C 2FG0A 5GAOr 4M75F 1WZOA 3LX7A 3NMZC 3SFMA 1AD5A 1NEBA 4B9WA 5KCHA 3UA7A 1N8RU 3QZ5B 5CKHA 4ZTJA 5GAMd 4ANJA 4JS4A 2EW3A 1KC8U 3VUBA 5DY9A 5KYUA 1X27A 3EFOA 2FPEA 1X75C 1OQKA 1RLPC 2J6KA 1U5SA 3GF5A 2HKQB 5LJ5e 3ZL7C 2CP3A 4FT4A 4LDYA 3CMAT 3M58A 3BDUA 4M7AB 1YJ9T 4N0AC 4OMOA 4MZTA 4PJOE 3TCJA 4IUTA 4C8QG 2EIFA 3QHSA 1I4K1 5LJ5g 1HXDA 3S3OA 1KQSA 4E7HA 1NBEB 2DXBA 2HKNA 1LOJA 3EAEA 3SWNA 3CD6T 2QDLA 2ZPGB 1SRMA 5GANj 5LJ3j 1U3OA 4BE0A 1VQ9A 2Z0WA 1TOVA 3RUXA 2FEIA 3OMCA 2MWPA 3VV0A 4OB1B 1XOVA 1VQ9Q 2MYSA 1GCQC 5ECAA 1BBZA 5GAMe 2OAUA 4M78B 1ZSZB 1NJIR 1UG1A 3MP1A 3PVQA 1BCMA 2GBQA 1OYXA 3CCJT 1JJ2A 1SEMA 4DQ2A 2GFUA 5GAMg 3CBOA 2K4YA 4OP0A 4C8QD 4OB0B 2ROLA 2QA4A 1KD1R 1T0HA 2J6FA 3M54A 5KCOA 1MV0B 5CKEA 3RMQA 1B34A 1OEBA 2VWFA 1YJWA 2QA4Q 2E1HA 4CC7A 3PGGA 3V7RA 4Y91A 1Z9QA 2AZVA 1WXTA 3TSZA 1J3TA 4LE9A 4OMNA 1YJWQ 1TG0A 4BI8B 2WSCE 1VYTA 3HFOA 3CCET 3WVEB 2OX7A 3ER0A 2RB6A 2E4HA 4L6V5 1KQ2A 1EZZB 3H0FA 4JS5A 1WDXA 1O75A 2NLUA 2QEXT 3VYGA 5KYXA 2ENMA 1YITQ 4FYVB 5A2QE 3CCUQ 5KYYA 4HCCA 2KQWA 2RN8A 3GP8A 2L0AA 3M0SA 1SF9A 3UA6A 2CUDA 2EJGA 1AWJA 1YHQT 1D09B 1GRIA 2PVOB 1ARKA 2AHJB 3CXCS 1SPKA 4CC4B 4RCCA 2LX7A 3J80E 1WPYA 2HD0A 3BFMA 4OMMA 2O9SA 3FDRA 4BY6B 4F7UG 2F2XA 1TTHB 1QW1A 1RUWA 4HCBA 4M77F 2LTOA 1MMDA 2NUTA 4HT8A 3JCMV 2C0OA 3M0TA 5GANf 5LJ3f 2CZ7B 2K57A 2QGGA 3JSCA 4FM4B 3CCQT 2FL7A 1UHFA 2F2VA 8ATCB 1GL5A 2X3WD 3CPFA 2Y90A 4J9IA 5DLOA 2CP2A 2E5KA 1Q7YC 2ATCB 2RJFA 1MMNA 1Q86U 5CR2A 4M75C 4BACA 2OJ2A 1R8OB 2XK0A 3PMIA 4RMOA 3CXCA 3I55A 3VRYA 4WTOB 1GFDA 2FYKA 3I55Q 1BU1A 2MOXA 2K2VA 2PUKB 2DKGA 2YUOA 3ME9A 2EKHA 2DZCA 1NEGA 1OU9A 4MZMA 1PKSA 3UPUA 3V7CA 1AVZC 1OX8A 3L1AA 2LZ6B 1GFCA 1VOMA 1KIKA 4QQDA 3VS3A 3UATA 4A4GA 4B9XA 3S3MA 3GNFB 3L2UA 2JNGA 1QQJA 1N8RR 2VB6A 1KC8R 1TXQA 2YUNA 1ZA1B 5HY6A 1BK2A 2J7IA 2DXTA 3RBBB 5IXFA 3CCSQ 4EMKB 3CC7A 1X01A 2ZPFB 4RTXA 5LJ3d 3CCMT 4LD9K 1UGSB 3DKMA 4E7ZA 1MNDA 3REBB 3CC7Q 3GBQA 4D8KA 1BIBA 4II1A 1BYMA 1WQ7A 3A8LB 3CMAA 3V7SA 4C92G 1YJ9A 4O5VA 1G2BA 1M2VB 4M78A 1ZSZA 1AWWA 1K9AA 1RADB 4HA8A 2RK2A 2QASA 2EJ9A 5LJ3h 1QMCA 3LWHA 2V26A 3QIIA 2XICA 3C94A 2K5FA 1YFNA 2EYQA 5KYWB 2D1XA 1KQSP 5I21A 1VQPA 1K4US 4DOWA 5GAN6 3ZEHA 2M51A 1MGQA 2D6FA 4LUEA 5FU6B 1VQPQ 3LH5A 1W6XA 1PSEA 1VQ8Q 3MEUA 4PNOA 4M7DG 2D0NA 4C92D 1N9RA 1LCKA 1O9SA 4KBMB 3QYGB 3CCJA 2GTOA 1ZUUA 2JS2A 4MDWA 2H3JA 2VC8A 2HZYA 3CMEA 2YHTA 4M78E 3VU3C 2L2PA 4HVUA 4OB2B 2VXEA 1P92A 3CCJQ 2JTEA 3C4SA 1JJ2P 1YP5A 3O8VA 4HCZA 1GXIE 1VQ9T 5FLXE 2LVMA 3CMEQ 2OTJQ 5LJ3g 2D8JA 1ZX6A 5CQXA 1VQLA 1AT1B 2EQIA 5GAOn 2A28A 1VUBA 4MZPA 1EIFA 3HFNA 3OA6A 2EVRA 4FSXA 3CCVA 3KXTA 2M16A 3CCEA 2A0FB 1VQLQ 1SSHA 1Z9ZA 2BIVA 3S6WA 1KD1C 1X69A 2YRCA 4XTYA 2LQNA 3MJXA 3CCVQ 4E7SA 1W2BA 3CCEQ 2JXBA 4M77C 2QEXA 4M7DD 5L8RE 2KRNA 2KT1A 1KK7A 3NTKA 4ZGEB 4F04B 1B07A 2QA4T 1QVGA 1GCQA 3H0IA 4N4HA 2JM9A 2GCXA 4XU2A 1YJWT 4AMCA 2XKOC 4J6XA 3UWNA 4ZN3A 3BY7A 4J6WA 5GMKl 4E7LA 1K9MU 4QVDA 2V1QA 1PG5B 1FMVA 1KJWA 3A5ZB 2X4XA 1YITT 4C8QF 3CCUT 5A0DA 3RKWA 3A8OB 4WCIA 2DZ9A 1SHFA 2EGAA 2R57A 1K8AU 4A4HA 1XTDA 4J9FA 2LCLA 1I07A 1TS9A 4B6MA 2RNAA 2RHUA 2XHCA 3CCQA 1B34B 2BE7D 3U23A 5FU7B 1WGSA 2E64A 2HNIA 3QPHA 2F2WA 5GMKj 3CCQQ 2KK4A 1U8RA 1Q86R 2X3XD 4IUQA 5FRNA 4XU1A 2P84A 2RI2A 3OW2S 4M7AG 2EBPA 4BE1A 3OYLA 2G6FX 1TU0B 2CYZB 4JRIA 1JU5C 1TWBA 2DEQA 1OPLA 5AT1B 2E3IA 2EYYA 3X20B 3CXCP 2QDYB 4R56A 2RH2A 2RMOA 2RQRA 3OYKA 3RIRA 2E3HA 2CT4A 1H641 2LNHB 1K73U 1IREB 4PLIA 3QUIA 1IHWA 1WXUA 4KH1B 2ECZA 2GGRA 1UECA 2F1LA 3EHQA 2E70A 5GAN7 4E7IA 2L89A 1TUCA 4BUGA 2M0OA 4E2FB 2CS7A 4M78G 2CP5A 1I5OB 4HVVA 4ZGJB 1M2VA 2GTJA 2KY9A 1W70A 2KGTA 1SSFA 1WHLA 2B8AA 4M7AD 3I55T 2P0PA 1U1SA 1WFWA 2RI5A 1E6HA 5FWBA 2D9TA 3DLLA 3CC4A 2VYTA 5EC7A 3LH0A 5GAN4 3OYNA 3HRTA 1OZ3A 2QQBA 2FZGB 5KYWA 1AWXA 3M5AA 1UGQB 4M75A 3CC4Q 1UUEA 3C12A 1RAEB 5DM7R 3CCMA 2DVEA 1G3SA 3EFRA 2MIOA 3PIPA 1N8RC 2IPOB 4KUDK 1IGQA 1T3SA 3CCMQ 1AOJA 2FPFA 2LCCA 1UJYA 4F7UF 1D1AA 3EGXB 1D0ZA 8AT1B 5D6YA 4ZGDB 3JB9G 3QZ9B 3CCST 2M9UA 4EIKA 3OS5A 3ULRB 1D0YA 2DL5A 4GBQA 4UC4A 3JAME 3E9FA 3GIBA 3CC7T 2RQTA 2VV5A 3A8GB 2DERA 2D8HA 3E2UA 2PTKA 1M90U 3OMGA 1LJOA 1QVFA 3HRSA 3JCMW 1PKTA 2LJ3A 4M75E 4CRIA 5GMKm 4J8OA 2XDDA 2O01E 3OBWA 4XAXB 4XQ3A 4N4IA 4RCBA 1H8KA 3A8HB 2HL3A 1KG1A 4OF1A 1Y0MA 4XTVA 1QWEA 4RTVA 3JB9D 3EH1A 3CCLT 1VQPT 1KHCA 2L3QA 5I2MA 2YXYA 3E9GA 2LJ0A 1FX7A 3QWXX 2J05A 1VQ8T 2BKDN 1Y07A 3OYEA 4P5NA 1RAIB 4C0GA 1YI2A 4JJNK 2FZKB 3E19A 1OX9A 1QCFA 3JCMc 3CCRA 4C8QC 1NZ9A 4AFQC 1PRMC 3EG1A 4Y28E 1VQ5A 1YI2Q 3JCMP 2WSEE 1UGVA 2MF2A 5D7UA 1X43A 3CCRQ 3NGPA 2OTJT 3CMET 2B86A 1VQ5Q 1JEGA 2QGFB 1W2BP 2JUFA 2MAMA 4JZ3A 4LNPA 1JRIA 3PVLA 2KNBB 1QVGP 2DBMA 1Q81C 3CC2T 1VQLT 4ORZA 1K9MR 1I0CA 2LRQA 3UDCA 4C92F 3J7AF 3CCVT 2MI6A 2DYBA 3QG1A 3RKYA 4DOVA 4IUUA 1NM7A 2CZ6B 5GAN5 5CCAA 2RO0A 3QJ6A 2DYIA 1YITA 1G3TA 3CCUA 1OULA 1Q81U 1K8AR 1OZ2A 4VUBA 4L5GA 2EAYA 4EMHA 2K6DA 1RAAB 4DEXA 1FMWA 3LLRA 4J9DA 3OYAA 1IRXA 1FMKA 3LWIA 4Z88A 3OYGA 3JCMb 2K3XA 3BW1A 3QKJA 2LMJA 2MPXC 4C0DC 5CKBA 1W1FA 2F5TX 2JTMA 2FO0A 1C6VX 3M4GA 1FYNA 2P0KA 4M77A 3M9QA 1XNIA 2M1HA 1BKBA 1PRLC 1M8MA 1QLYA 3SEMA 4M7DF 2CKKA 2QYZA 2DBKA 4JJDA 1OOTA 3GLXA 2RJEA 2FRWA 1PD1A 3KUFA 2P4TA 4YTLA 3VRZA 1K0SA 1VIEA 3BDLA 5CK9A 1Q86C 2SEMA 4E47A 1K73R 5CKFA 2JN0A 3QSUA 3CEYA 2RF0A 4PJOG 5IXBA 2GQIA 1VQNQ 3FJPA 2CSQA 3TQ7P 2BZ8A 4KULA 1NG2A 2FHDA 3MP8A 2X51A 4WF2A 4PFZA 1YNZA 4JZ4A 4EMGA 5IHKA 2EFIA 3EGXA 5IAYA 4M77E 4FW2A 5I22A 5D6XA 1WJSA 4FYXB 2Y4YA 2LQ8A 2LC4A 1A0NB 2FVUA 1AEYA 1AZGB 3VS1A 1VIFA 4PJOC 1YJNT 2JMCA 4IIOA 4NS5A 2K2MA 2JMAA 3M53A 4XTZA 1YCSB 2O88A 4A54A 4PJOD 1X6GA 4RTYA 3M0UA 1SRLA 4FCYA 1LPLA 4GLKA 1PNJA 1HK9A 3JCMJ 1Q82C 1TSFA 3CCSA 2DL8A 3KBGA 1I81A 1M2OA 2E10A 1BCOA 2DVJA 3CC4T 3OY9A 2DPPB 4KH0B 3JRZA 1RI9A 1T0JA 1KQ1A 1RAFB 4FU6A 1QCOA 2DD5A 3HHTB 2X4WA 3JCMX 1WNLA 4X34A 3VS6A 4LN2A 2RQUA 5J39A 1V29B 3OSSC 1KHIA 5IH2A 5GANd 1Q82U 1M90R 4FYYB 1ACMB 3FJ5A 4RG8A 4M7AF 3P8HA 4BI3A 4QVCA 1M8VA 1AHJB 1D1CA 1C0MA 3OYCA 1QVFP 1IHVA 3NTIA 5GANh 4C5IA 3PMTA 4IURA 1JXOA 4A4EA 3SWNC 3QXEB 5J26A 3REAB 2O31A 2R58A 3TU4K 4OMLA 1RABB 2E41A 5C0MA 3L2RA 2E12A 5DLQE 5GJWB 4GY5A 1BI3A 3T9NA 3CCLA 2YWWA 4HVWA 1VQOA 1R0CB 4M75B 4DEYA 2XG8D 2C0IA 4OVAA 3ASKA 3CCLQ 1VQ8A 3EG3A 1VQOQ 2W10A 1RI0A 2EQKA 1ZA2B 4C92C 1PWTA 2BTTA 4JDSA 4RG2A 2GNCA 3M4YA 2XDBA 4J9BA 1NPPA 2EPDA 7AT1B 5GANe 2QQSA 5LJ3e 3EFSA 2D0QB 3QO3A 1WHGA 2OTJA 3UT1A 1RLQC 4NL2A 5C6SA 3LYIA 1H3ZA 5GANg 4DBHA 2RK1A 2L8DA 4N0AA 4JLGA 4C5GA 5GAMj 3CC2A 3M0QA 1KFZA 2LNVA 3QDFA 1ZBXA 1ZUYA 3G4SQ 2DK3A 1IB8A 2BZXA 2JW4A 1UE9A 1M30A 2DJQA 1NE8A 4FT2A 3I56A 2HQEA 1YI2T 1M5Q1 3CC2Q 4C0FA 3OS0A 2K3BA 3KFVA 4M7DC 5EG2A 1Q81R 2O4XB 4PJNA 3CCRT 3OYHA 2KROA 3GPLA 4GLMA 3I56Q 1VQ5T 3JB9F 3JCMQ 2COZA 5CO7A 1S72T 2DD4A 2EQJA 1D0XA 3PTAA 2HBWA 4PLLA 4HT9A 3MKDA 3S3NA 1X2KA 1K9MC 2FRYA 6AT1B 2NWMA 1F1BB 2ED1A 1NLOC 5HCKA 2NUZA 3GNGA 3J81E 3SDZA 4XTWA 2NYSA 4C8QA 1VQ4A 2V8KA 1K8AC 1N27A 1IO6A 4FW1A 2FB7A 3RKXA 3LW5E 3SD4A 2DILA 1VQ4Q 2ESWA 2XDPA 3R6NA 2PVDB 4E6RA 3VS4A 1TUGB 2KEAA 1OI1A 4J9GA 1RL2A 1ABOA 1M3CA 4LDXA 1HSQA 2G3RA 4JRKA 5CQYA 5LL6S 1KSWA 4FL6A 2R5MA 5CVIA 1M1KU 2RA2A 2EYXA 3AT1B 2IG0A 2CZ1B 2KSSA 3Q1JA 4OMFB 2RM4A 1LVKA 2DE0X 2RJCA 3FB9A 1WXBA 4FYWB 5KH6A 2RI3A 4J9EA 4C8QE 1MMGA 4DBRA 2X4YA 4MDXA 1YWPA 1K73C 4X9CA 3OYDA 1OU8A 2AIRB 1VQ6A 2HBPA 2J06A 4AG1C 3BE3A 4TVRA 1UHCA 5GAN2 2NUPB 1VQNT 1SKUB 1WI7A 1I8FA 5GAMf 1VQ6Q 2Y4XA 2I2LA 2M0YA 3M57A 1YJNA 2KVQG 3H9NA 2I0NA 3A1PA 4A63B 3M55A 3DB3A 3HP9A 3OYBA 2V1RA 4DBFA 2OTLA 1UGPB 3OYIA 4M77B 1FWZA 2KMTA 1YJNQ 4M7AC 3HL8A 4NL3A 3CPWS 1PCXA 2E5QA 3C0CA 2RHZA 1JQQA 5CAIA 2OTLQ 1BI1A 2JVVA 3H8ZA 1NPRA 3OW2A 4N4GA 2VXFA 1LNXA 2ROTA 4KT0E 1JB0E 1PD0A 2ABLA 1G5VA 2GF7A 2XI9A 4XU0A 1R77A 1NYFA 1Q82R 1AWOA 4ESRA 4A53A 2WACA 3WXMB 2PQWA 2K9GA 1WLPB 1OV3A 2P4RA 2RHYA 3MEAA 3G7ZA 4M78C 1ZSZC 2VUBA 4V2SA 1D3BB 2HEQA 2K7AA 3TEEA 4X1VA 2DL7A 2W0ZA 2ZPIB 3SHWA 4M78D 3CQTA 1YIJA 5HKCA 2A7YA 4MMLA 2KYBA 3MP6A 3CBMA 2VGMA 1M90C 1YIJQ 2CH4W 3FEOA 2A37A 4PJJA 2ZPBB 3HRUA 1KQSS 5I11A 2QQ9A 5HK0A 5HK3A 4PJOF 1VQ7A 1WIEA 1WHJA 4FIBA 4RTZA 3HPWA 1CSKA 1MHNA 3TSWA 2XMFA 2PU9B 2DRMA 3UF4A 1X6OA 3PNWC 1VQ7Q 2R5AA 4QQ6A 2RQVA 2BE9B 2EWNA 4Y92A 4RTUA 4R0KA 1K0XA 1HYOA 4F7UE 3QBYA 4AT1B 5M9OA 2YUPA 2O4XA 3L2QA 5FRMA 5I2SA 1Q95G 1ZUKA 2DIQA 2FZCB 5GAMh 2XU8A 3G1JA 5IHNA 1JXMA 3OBYA 3CBPA 2KAFA 4QQGA 2E6ZA 3EH2A 1ZHIA 3M0PA 3THKA 1VQOT 1JJ2S 1V76A 4OMPA 2M02A 3JB9H 4D6WA 1XJWB 4MMKA 2HSEB 4LDUA 5GAN8 2DXUA 4IIMA 1ABQA 2A08A 4J9HA 2LCSA 4XK8E 3I9QA 4AFZC 4LD6A 4BY6C 2QG9B 2YDLA 3A98A 1PC0A 2JJ9A 2DFUA 4R55A 4OGEA 3VS7A 1QWFA 1S72A 2VKNA 2AT1B 5KYNA 3G71A 3NFCA 2LQKA 2JTFA 4LUDA 1VA7A 2O2OA 3VYHB 2CSIA 3G4ST 2RHXA 4C92A 1S72Q 2OI3A 1FXXA 3G71Q 1G83A 3FC3A 1D1BA 2RPNA 2P0QA 3G6EA 4QW2A 9ATCB 3EGDB 4KGZB 4OB3B 2DMOA 3I56T 4QT7A 1WYXA 2LP5A 4AG2C 3G6EQ 2L3PA 4PJMA 2COWA 4AFUC 1QP2A 2L3SA 4J7IA 2VGNA 2PZ1A 4IUPA 2YUQA 2EJFA 1NYGA 2DJZA 5GMKh 4E7JA 4A4KA 1QVPA 4JJBA 2NUPA 2QK0A 1I1JA 2V8JA 2YSQA 3OS2A 1GBRA 1M1KR 4HXJA 4L59A 4M7DA 1M1FA 2CP7A 1RAGB 2GQVA 1VQ4T 3IQLA 4PJLA 3GOXA 4C92E 5FW9A 2WSFE 2ZAEA 1IXDA 4RKUE 4Z8AA 1Y7XA 1WHKA 3M59A 5GMKi 1BB9A 3O5ZA 1W4SA 1RAHB 2CT3A 4JUVA 2QQRA 4CC2A 1VQNA 2H3EB 2XD0A 3EG2A 4EMKC 4Z89A 5GMKe 2HL5C 4M75G 1ZBJA 1ZQ1A 2KT8A 3VUZA 5IT9E 4PL6A 5L23A 1GCPA 1M27C 1WA7A 5A0LA 2MMPA 4C8QB 5AYFA 1BI2A 2AZSA 4C0ZA 4CC3A 1K76A 4J6YA 4BD3A 2RD1A 1Y96A 4LDWA 2LDMA 1D3BA 3MHXA 4JJCA 2QTVA
chains in the Genus database with same CATH topology
2EPDA 2QDLA 1CKAA 1SRMA 1UTIA 4AFSC 1OPKA 2RMOA 1U3OA 1M3BA 3EHRA 2RQRA 1VYUA 2LQWA 2FEIA 1AZEA 1RLQC 2CT4A 2LNHB 1WXUA 2ECZA 1XOVA 2KRMA 2GGRA 1GCQC 1UECA 5ECAA 1BBZA 3QWYA 3EHQA 1JO8A 1TUCA 3M0QA 1KFZA 1ZUYA 1UG1A 2YT6A 3PVQA 1V1CA 1N5ZA 2BZXA 2JW4A 1UE9A 1M30A 2DJQA 1X2QA 4HVVA 2GBQA 2GTJA 1QKXA 1W70A 2KGTA 1SEMA 2K3BA 2H8HA 3KFVA 1WFWA 2IIMA 2ROLA 2KROA 1E6HA 4GLMA 5FWBA 1T0HA 2J6FA 1MV0B 5EC7A 3VS0A 1OEBA 2VWFA 1AWXA 4RTTA 2HBWA 3I35A 2A36A 1UUEA 3PE0A 4CC7A 1X2KA 1Z9QA 2AKLA 2FRYA 2AZVA 1WXTA 2NWMA 3TSZA 1J3TA 2ED1A 1NLOC 2MIOA 4LE9A 5HCKA 2NUZA 4OMNA 1TG0A 1VYTA 1T3SA 1AOJA 3H0FA 2FPFA 3H0HA 1UJYA 1IO6A 1WDXA 2HCKA 3I5RA 4RUGA 1X6BA 2DILA 1VYVA 2ESWA 3R6NA 4E6RA 3VS4A 2ENMA 1HJDA 2C0TA 2CUBA 2KEAA 4F17A 4EIKA 4J9GA 3ULRB 3EG0A 2RN8A 1ABOA 2L0AA 3M0SA 2DL5A 3UA6A 2CUDA 4GBQA 1M3CA 1AWJA 1HSQA 1GRIA 2RQTA 1ARKA 2D8HA 2CREA 4OMQA 1SPKA 1KSWA 2PTKA 4CC4B 3VS2A 2LX7A 1UFFA 1UJ0A 4OMMA 2EYXA 2O9SA 1PKTA 2LJ3A 2F2XA 1H92A 2KBTA 2DE0X 1RUWA 1WXBA 1H8KA 2EGCA 4J9EA 2C0OA 2EGEA 3M0TA 3JV3A 1YWPA 1WX6A 1Y0MA 1QWEA 1YWOA 4RTVA 2J06A 4AG1C 1UHFA 2F2VA 1UHCA 1GL5A 2L3QA 2X3WD 2J6OA 1WI7A 1EFNA 4J9IA 2LJ0A 3QWXX 2J05A 2E5KA 2M0YA 4J9CA 1HD3A 1QKWA 2CH4A 4FSSA 2I0NA 4A63B 2KR3A 2OJ2A 2PNIA 2V1RA 1ZLMA 4KRTA 4D8DA 2EYWA 1QCFA 3M0RA 3VRYA 4F14A 3C0CA 3TVTA 1B3QA 1JQQA 3EGUA 1PRMC 4AFQC 3EG1A 1UGVA 1GFDA 1BU1A 1M3AA 2MOXA 3VS5A 1X43A 2ROTA 3NGPA 2B86A 2SRCA 1JEGA 2ED0A 2YUOA 2EKHA 1NEGA 4JZ3A 1GBQA 2ABLA 4LNPA 1PKSA 2KXCA 3PVLA 2KNBB 1CKBA 1AWOA 1AVZC 1NYFA 2DF6A 2DBMA 2LZ6B 4ESRA 1GFCA 4ORZA 1KIKA 3VS3A 2K9GA 3UATA 1I0CA 1WLPB 4M4ZA 1OV3A 2P4RA 1K1ZA 4ZNXA 2DYBA 5FWCA 1NM7A 2HEQA 2K7AA 2CDTA 4X1VA 1UDLA 2DL7A 2W0ZA 3SHWA 2YUNA 1BK2A 2J7IA 2DNUA 3CQTA 2K6DA 4DEXA 4J9DA 2KYBA 1FMKA 3RBBB 5IXFA 4Z88A 1E6GA 1U06A 4RTXA 2CH4W 2A37A 2LMJA 5I11A 4F16A 2K79A 3REBB 2DL4A 3GBQA 4D8KA 1W1FA 1WIEA 2KXDA 2FO0A 2KE9A 1FYNA 1G2BA 1H3HA 4RTZA 3TSWA 1CSKA 1AWWA 2HDAA 1K9AA 2FPDA 2XMFA 2DRMA 3UF4A 1PRLC 2RQVA 1M8MA 1QLYA 1T3LA 4RTWA 3SEMA 4Y92A 2DBKA 4R0KA 4RTUA 1K0XA 2RQWA 1OOTA 2O9VA 4JJDA 2YUPA 2FRWA 2LJ1A 2D1XA 3VRZA 1K0SA 1K4US 1ZUKA 2EYZA 2M51A 2SEMA 5IHNA 1JXMA 4LUEA 2KYMA 5IHIA 2RF0A 2JM8A 3M0PA 3THKA 2GQIA 5IXBA 3RNJA 2DM1A 4OMPA 2DRKA 1MV3A 2CSQA 3LH5A 1W6XA 1Y57A 2BZ8A 1NG2A 3NHNA 4IIMA 1YNZA 1ABQA 2A08A 2D0NA 4J9HA 3I5SA 4JZ4A 2LCSA 1LCKA 3I9QA 4HCKA 4AFZC 1YN8A 2VVKA 2GTOA 5IHKA 1ZUUA 2JS2A 2YDLA 3A98A 3H41A 2L2PA 4HVUA 2DL3A 5I22A 2JTEA 3NPFA 3VS7A 1E7OA 1QWFA 1ZSGA 2VKNA 2KRSA 1YP5A 1A0NB 2JT4A 1TUDA 2MCNA 1SHGA 1AEYA 1AZGB 2OAWA 4LUDA 2D8JA 4JPBW 3VS1A 1VA7A 1ZX6A 2O2OA 2CSIA 2EQIA 2A28A 2JMCA 4IIOA 2OI3A 2K2MA 1G83A 2EVRA 2JMAA 2BZYA 1YCSB 2RPNA 2O88A 1X6GA 4RTYA 1SSHA 1Z9ZA 3M0UA 1SRLA 1X69A 2DMOA 2DX1A 2LQNA 4QT7A 1WYXA 2LP5A 2DA9A 2DLPA 2JXBA 4AG2C 2L3PA 1PNJA 4AFUC 2L3SA 2KRNA 2KT1A 2DL8A 1PHTA 2JS0A 2PZ1A 1B07A 2YUQA 2DVJA 5GJVB 1GCQA 2AKKA 3H0IA 1NYGA 1RI9A 1NLPC 1T0JA 2JM9A 1MUZA 4JJBA 1S1NA 1I1JA 2YSQA 4LN2A 3VS6A 2RQUA 2HSPA 2AK5A 4K11A 5IH2A 2FG0A 1GBRA 4HXJA 3NMZC 1AD5A 1NEBA 3FJ5A 2V1QA 3IQLA 3UA7A 1KJWA 5FW9A 2EW3A 4WCIA 1SHFA 2EGAA 4Z8AA 1JXOA 4J9FA 1X27A 3REAB 2O31A 2FPEA 1BB9A 3O5ZA 1I07A 4OMLA 2RNAA 1RLPC 2J6KA 5GJWB 2CT3A 3U23A 4CC2A 1U5SA 4HVWA 4DEYA 3EG2A 2C0IA 4Z89A 2F2WA 3ZL7C 1ZBJA 2KT8A 2X3XD 5L23A 3EG3A 4OMOA 1GCPA 1M27C 1WA7A 2W10A 2EBPA 2AZSA 2G6FX 4CC3A 1K76A 1JU5C 1PWTA 2BTTA 2GNCA 1OPLA 4JJCA 4J9BA 2EYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPD A;  2QDL A;  1CKA A;  1SRM A;  1UTI A;  4AFS C;  1OPK A;  2RMO A;  1U3O A;  1M3B A;  3EHR A;  2RQR A;  1VYU A;  2LQW A;  2FEI A;  1AZE A;  1RLQ C;  2CT4 A;  2LNH B;  1WXU A;  2ECZ A;  1XOV A;  2KRM A;  2GGR A;  1GCQ C;  1UEC A;  5ECA A;  1BBZ A;  3QWY A;  3EHQ A;  1JO8 A;  1TUC A;  3M0Q A;  1KFZ A;  1ZUY A;  1UG1 A;  2YT6 A;  3PVQ A;  1V1C A;  1N5Z A;  2BZX A;  2JW4 A;  1UE9 A;  1M30 A;  2DJQ A;  1X2Q A;  4HVV A;  2GBQ A;  2GTJ A;  1QKX A;  1W70 A;  2KGT A;  1SEM A;  2K3B A;  2H8H A;  3KFV A;  1WFW A;  2IIM A;  2ROL A;  2KRO A;  1E6H A;  4GLM A;  5FWB A;  1T0H A;  2J6F A;  1MV0 B;  5EC7 A;  3VS0 A;  1OEB A;  2VWF A;  1AWX A;  4RTT A;  2HBW A;  3I35 A;  2A36 A;  1UUE A;  3PE0 A;  4CC7 A;  1X2K A;  1Z9Q A;  2AKL A;  2FRY A;  2AZV A;  1WXT A;  2NWM A;  3TSZ A;  1J3T A;  2ED1 A;  1NLO C;  2MIO A;  4LE9 A;  5HCK A;  2NUZ A;  4OMN A;  1TG0 A;  1VYT A;  1T3S A;  1AOJ A;  3H0F A;  2FPF A;  3H0H A;  1UJY A;  1IO6 A;  1WDX A;  2HCK A;  3I5R A;  4RUG A;  1X6B A;  2DIL A;  1VYV A;  2ESW A;  3R6N A;  4E6R A;  3VS4 A;  2ENM A;  1HJD A;  2C0T A;  2CUB A;  2KEA A;  4F17 A;  4EIK A;  4J9G A;  3ULR B;  3EG0 A;  2RN8 A;  1ABO A;  2L0A A;  3M0S A;  2DL5 A;  3UA6 A;  2CUD A;  4GBQ A;  1M3C A;  1AWJ A;  1HSQ A;  1GRI A;  2RQT A;  1ARK A;  2D8H A;  2CRE A;  4OMQ A;  1SPK A;  1KSW A;  2PTK A;  4CC4 B;  3VS2 A;  2LX7 A;  1UFF A;  1UJ0 A;  4OMM A;  2EYX A;  2O9S A;  1PKT A;  2LJ3 A;  2F2X A;  1H92 A;  2KBT A;  2DE0 X;  1RUW A;  1WXB A;  1H8K A;  2EGC A;  4J9E A;  2C0O A;  2EGE A;  3M0T A;  3JV3 A;  1YWP A;  1WX6 A;  1Y0M A;  1QWE A;  1YWO A;  4RTV A;  2J06 A;  4AG1 C;  1UHF A;  2F2V A;  1UHC A;  1GL5 A;  2L3Q A;  2X3W D;  2J6O A;  1WI7 A;  1EFN A;  4J9I A;  2LJ0 A;  3QWX X;  2J05 A;  2E5K A;  2M0Y A;  4J9C A;  1HD3 A;  1QKW A;  2CH4 A;  4FSS A;  2I0N A;  4A63 B;  2KR3 A;  2OJ2 A;  2PNI A;  2V1R A;  1ZLM A;  4KRT A;  4D8D A;  2EYW A;  1QCF A;  3M0R A;  3VRY A;  4F14 A;  3C0C A;  3TVT A;  1B3Q A;  1JQQ A;  3EGU A;  1PRM C;  4AFQ C;  3EG1 A;  1UGV A;  1GFD A;  1BU1 A;  1M3A A;  2MOX A;  3VS5 A;  1X43 A;  2ROT A;  3NGP A;  2B86 A;  2SRC A;  1JEG A;  2ED0 A;  2YUO A;  2EKH A;  1NEG A;  4JZ3 A;  1GBQ A;  2ABL A;  4LNP A;  1PKS A;  2KXC A;  3PVL A;  2KNB B;  1CKB A;  1AWO A;  1AVZ C;  1NYF A;  2DF6 A;  2DBM A;  2LZ6 B;  4ESR A;  1GFC A;  4ORZ A;  1KIK A;  3VS3 A;  2K9G A;  3UAT A;  1I0C A;  1WLP B;  4M4Z A;  1OV3 A;  2P4R A;  1K1Z A;  4ZNX A;  2DYB A;  5FWC A;  1NM7 A;  2HEQ A;  2K7A A;  2CDT A;  4X1V A;  1UDL A;  2DL7 A;  2W0Z A;  3SHW A;  2YUN A;  1BK2 A;  2J7I A;  2DNU A;  3CQT A;  2K6D A;  4DEX A;  4J9D A;  2KYB A;  1FMK A;  3RBB B;  5IXF A;  4Z88 A;  1E6G A;  1U06 A;  4RTX A;  2CH4 W;  2A37 A;  2LMJ A;  5I11 A;  4F16 A;  2K79 A;  3REB B;  2DL4 A;  3GBQ A;  4D8K A;  1W1F A;  1WIE A;  2KXD A;  2FO0 A;  2KE9 A;  1FYN A;  1G2B A;  1H3H A;  4RTZ A;  3TSW A;  1CSK A;  1AWW A;  2HDA A;  1K9A A;  2FPD A;  2XMF A;  2DRM A;  3UF4 A;  1PRL C;  2RQV A;  1M8M A;  1QLY A;  1T3L A;  4RTW A;  3SEM A;  4Y92 A;  2DBK A;  4R0K A;  4RTU A;  1K0X A;  2RQW A;  1OOT A;  2O9V A;  4JJD A;  2YUP A;  2FRW A;  2LJ1 A;  2D1X A;  3VRZ A;  1K0S A;  1K4U S;  1ZUK A;  2EYZ A;  2M51 A;  2SEM A;  5IHN A;  1JXM A;  4LUE A;  2KYM A;  5IHI A;  2RF0 A;  2JM8 A;  3M0P A;  3THK A;  2GQI A;  5IXB A;  3RNJ A;  2DM1 A;  4OMP A;  2DRK A;  1MV3 A;  2CSQ A;  3LH5 A;  1W6X A;  1Y57 A;  2BZ8 A;  1NG2 A;  3NHN A;  4IIM A;  1YNZ A;  1ABQ A;  2A08 A;  2D0N A;  4J9H A;  3I5S A;  4JZ4 A;  2LCS A;  1LCK A;  3I9Q A;  4HCK A;  4AFZ C;  1YN8 A;  2VVK A;  2GTO A;  5IHK A;  1ZUU A;  2JS2 A;  2YDL A;  3A98 A;  3H41 A;  2L2P A;  4HVU A;  2DL3 A;  5I22 A;  2JTE A;  3NPF A;  3VS7 A;  1E7O A;  1QWF A;  1ZSG A;  2VKN A;  2KRS A;  1YP5 A;  1A0N B;  2JT4 A;  1TUD A;  2MCN A;  1SHG A;  1AEY A;  1AZG B;  2OAW A;  4LUD A;  2D8J A;  4JPB W;  3VS1 A;  1VA7 A;  1ZX6 A;  2O2O A;  2CSI A;  2EQI A;  2A28 A;  2JMC A;  4IIO A;  2OI3 A;  2K2M A;  1G83 A;  2EVR A;  2JMA A;  2BZY A;  1YCS B;  2RPN A;  2O88 A;  1X6G A;  4RTY A;  1SSH A;  1Z9Z A;  3M0U A;  1SRL A;  1X69 A;  2DMO A;  2DX1 A;  2LQN A;  4QT7 A;  1WYX A;  2LP5 A;  2DA9 A;  2DLP A;  2JXB A;  4AG2 C;  2L3P A;  1PNJ A;  4AFU C;  2L3S A;  2KRN A;  2KT1 A;  2DL8 A;  1PHT A;  2JS0 A;  2PZ1 A;  1B07 A;  2YUQ A;  2DVJ A;  5GJV B;  1GCQ A;  2AKK A;  3H0I A;  1NYG A;  1RI9 A;  1NLP C;  1T0J A;  2JM9 A;  1MUZ A;  4JJB A;  1S1N A;  1I1J A;  2YSQ A;  4LN2 A;  3VS6 A;  2RQU A;  2HSP A;  2AK5 A;  4K11 A;  5IH2 A;  2FG0 A;  1GBR A;  4HXJ A;  3NMZ C;  1AD5 A;  1NEB A;  3FJ5 A;  2V1Q A;  3IQL A;  3UA7 A;  1KJW A;  5FW9 A;  2EW3 A;  4WCI A;  1SHF A;  2EGA A;  4Z8A A;  1JXO A;  4J9F A;  1X27 A;  3REA B;  2O31 A;  2FPE A;  1BB9 A;  3O5Z A;  1I07 A;  4OML A;  2RNA A;  1RLP C;  2J6K A;  5GJW B;  2CT3 A;  3U23 A;  4CC2 A;  1U5S A;  4HVW A;  4DEY A;  3EG2 A;  2C0I A;  4Z89 A;  2F2W A;  3ZL7 C;  1ZBJ A;  2KT8 A;  2X3X D;  5L23 A;  3EG3 A;  4OMO A;  1GCP A;  1M27 C;  1WA7 A;  2W10 A;  2EBP A;  2AZS A;  2G6F X;  4CC3 A;  1K76 A;  1JU5 C;  1PWT A;  2BTT A;  2GNC A;  1OPL A;  4JJC A;  4J9B A;  2EYY A; 
#chains in the Genus database with same CATH topology
 4M7D E;  2LX9 A;  1CKA A;  1UTI A;  4KGX B;  4AFS C;  1OPK A;  2RJD A;  1M3B A;  3EHR A;  1VYU A;  2LQW A;  3ZBD A;  2ZPH B;  1VQ6 T;  1AZE A;  1U1T A;  5GAO l;  3OW2 P;  3V8K A;  2KRM A;  4ELZ C;  3QWY A;  2IVW A;  3F70 A;  4EPC A;  1JO8 A;  5FU6 C;  4PFO A;  2DEU A;  3TRE A;  2YT6 A;  2YRD A;  4M75 D;  1V1C A;  1N5Z A;  4A4F A;  1X2Q A;  1Q7Y U;  2OTL T;  1QKX A;  2X4J A;  2H8H A;  2K5L A;  3FLG A;  3MPU B;  2KDS A;  3JCM f;  2RHI A;  2IIM A;  4KGV B;  3JB9 J;  1VQK A;  2V8I A;  3VS0 A;  2EQU A;  3X26 B;  4C0D B;  2F5K A;  4ZTF A;  2QQA A;  4RTT A;  3OB9 A;  3I35 A;  2A36 A;  1VQK Q;  4J5Y A;  3PE0 A;  1WHH A;  4C5H A;  3CPW P;  3QYH B;  2AKL A;  3L42 A;  1M9S A;  2BUD A;  5CKD A;  3HKS A;  4M7A A;  3MEV A;  2PUO B;  2X9H A;  3V8J A;  1VQM T;  3ZFJ A;  1IGU A;  2CZ0 B;  3H0H A;  1G3Y A;  2F69 A;  2DIG A;  2HCK A;  3I5R A;  1MMA A;  4RUG A;  1X6B A;  1TH7 A;  1VYV A;  1WJQ A;  3P8D A;  4XU3 A;  1HJD A;  2C0T A;  2CUB A;  4F17 A;  1N6A A;  2MWO A;  2DTH A;  3EG0 A;  3LGF A;  1YIJ T;  4BI4 A;  4XTX A;  2YLC A;  3N5B B;  2CRE A;  1PM3 A;  2DTI A;  4OMQ A;  4C5E A;  2CP6 A;  2PVG B;  3VS2 A;  2ZZD A;  3OSV A;  4F7U B;  5LJ5 j;  1UFF A;  1UJ0 A;  1JBM A;  3A8M B;  1VQ7 T;  4IUV A;  3CMA Q;  1YJ9 Q;  2L5Q A;  1H92 A;  2KBT A;  1N9S A;  3HSB A;  4DA4 A;  4KUI A;  3CD6 A;  3EGD A;  4QKU A;  3D7S B;  4M78 F;  3PIO A;  1UEB A;  3R6O A;  3L2V A;  4M7A E;  2EGC A;  2QI2 A;  2EGE A;  3OS1 A;  3FRN A;  3JV3 A;  1WX6 A;  5D6W A;  1MNE A;  3CD6 Q;  1YWO A;  2GFA A;  5A0G A;  1YCY A;  4QVZ A;  2E6N A;  1I5L A;  3OYM A;  4PJO B;  2QTX A;  3WVD B;  2COY A;  3JCM d;  2QXF A;  2J6O A;  3EG9 B;  1EFN A;  1PSF A;  4J9C A;  5IN1 A;  2ZPE B;  2E65 A;  1W2B S;  1HD3 A;  1QKW A;  2CH4 A;  4FSS A;  5FU7 C;  3G4S A;  4HKE A;  2KR3 A;  2PNI A;  2DTO A;  5GAO q;  1ZLM A;  4KRT A;  2DET A;  4D8D A;  3E1S A;  2ZCF B;  2EYW A;  1QVG S;  5CIU A;  3URG A;  2L3R A;  3OQ5 A;  5J3B A;  3JCM h;  2KI7 A;  3M0R A;  4M77 G;  4F14 A;  3TVT A;  1B3Q A;  3EGU A;  5KYU B;  3EFO B;  1B7T A;  2A3L A;  1M3A A;  3VS5 A;  3QDR B;  2SRC A;  1NJI C;  2ED0 A;  3PFS A;  5KE2 A;  3HTR A;  1C1A A;  4ME7 A;  3X28 B;  3JB9 I;  1GBQ A;  3G71 T;  2KXC A;  2XID A;  1CKB A;  1R0B G;  1RAC B;  5GAO m;  2DF6 A;  2X35 A;  4J83 A;  1M1G A;  1NJI U;  4M4Z A;  1K1Z A;  4E7K A;  1Y71 A;  4ZNX A;  5FWC A;  3X25 B;  3G6E T;  2C06 A;  3SWN B;  2K3Y A;  2CDT A;  1UDL A;  4J7F A;  4ELY C;  4PK4 A;  3JCM e;  2EKO A;  4ZN1 A;  4M77 D;  4BE2 A;  2DNU A;  2QEX Q;  1KD1 U;  3AHU A;  3MO8 A;  4BDZ A;  3PT9 A;  4Q5W A;  3OYJ A;  1YHQ A;  3MEW A;  3VKI A;  1E6G A;  5FRO A;  3M56 A;  1U06 A;  3DLM A;  3JCM g;  1M1K C;  3LGL A;  1M4Z A;  4LXC A;  1G3W A;  1YHQ Q;  4F16 A;  2K79 A;  2HQH A;  2DXC A;  5LJ5 f;  2DL4 A;  4NOY A;  4C92 B;  2CGH A;  2KXD A;  1SG5 A;  2KE9 A;  4BDY A;  1H3H A;  2HDA A;  2FPD A;  3SB2 A;  1YBY A;  3C95 A;  3X24 B;  1WHM A;  4PFP A;  5GAO p;  1T3L A;  1UB4 A;  4RTW A;  4O6J A;  4JLI A;  3OYY A;  2RQW A;  2O9V A;  4LDV A;  3RDV A;  3RMS A;  2VAS A;  2LJ1 A;  1WJR A;  2EYZ A;  3MET A;  2YLB A;  2K5I A;  2KYM A;  5IHI A;  4PKC C;  4CI0 C;  3H6Z A;  2CP0 A;  2JM8 A;  3RNJ A;  2DM1 A;  3VJP A;  2ZGW A;  2DRK A;  1MV3 A;  2EQM A;  2QAZ A;  2YRV A;  4IKF A;  2LT4 A;  1Y57 A;  4M7D B;  3L2Z A;  1WQW A;  3NHN A;  2HMA A;  1Q7Y R;  1IZ6 A;  3I5S A;  4JRQ A;  5KYX B;  4HCK A;  1YN8 A;  2VVK A;  1EX4 A;  3V8L A;  1UGR B;  1DJ7 B;  5KYY B;  3NTH A;  3H41 A;  2MK5 A;  5GAN 3;  2DL3 A;  3NPF A;  3INZ A;  4EMK A;  3FIF A;  1E7O A;  1ZSG A;  4EDU A;  2KRS A;  4OGC A;  2JT4 A;  3RR6 A;  1TUD A;  2MCN A;  1SHG A;  4XTU A;  2OAW A;  4JPB W;  3L2W A;  1XQH A;  2HAX A;  4ATO A;  2DO3 A;  4X9D A;  3P8B B;  2BZY A;  3RES A;  2JZ2 A;  3MCA B;  2LT1 A;  4F7U A;  1VQM A;  2NUT B;  5KE3 A;  5LJ5 d;  1BIA A;  2DX1 A;  4JRP A;  1QCN A;  2DA9 A;  2DLP A;  4DBQ A;  2HQX A;  1Y96 B;  1VQM Q;  4BB7 A;  2JOY A;  1PHT A;  2JS0 A;  3OYF A;  1QVF S;  1VQK T;  5GJV B;  1G8X A;  2AKK A;  3QJY A;  4Z02 A;  3CPW A;  2DAQ A;  3RER A;  4PJO A;  5LJ5 h;  3DB4 A;  1NLP C;  1MUZ A;  1QP3 A;  1S1N A;  4K11 A;  2HSP A;  2AK5 A;  3EG9 A;  1BI0 A;  1KC8 C;  2FG0 A;  5GAO r;  4M75 F;  1WZO A;  3LX7 A;  3NMZ C;  3SFM A;  1AD5 A;  1NEB A;  4B9W A;  5KCH A;  3UA7 A;  1N8R U;  3QZ5 B;  5CKH A;  4ZTJ A;  5GAM d;  4ANJ A;  4JS4 A;  2EW3 A;  1KC8 U;  3VUB A;  5DY9 A;  5KYU A;  1X27 A;  3EFO A;  2FPE A;  1X75 C;  1OQK A;  1RLP C;  2J6K A;  1U5S A;  3GF5 A;  2HKQ B;  5LJ5 e;  3ZL7 C;  2CP3 A;  4FT4 A;  4LDY A;  3CMA T;  3M58 A;  3BDU A;  4M7A B;  1YJ9 T;  4N0A C;  4OMO A;  4MZT A;  4PJO E;  3TCJ A;  4IUT A;  4C8Q G;  2EIF A;  3QHS A;  1I4K 1;  5LJ5 g;  1HXD A;  3S3O A;  1KQS A;  4E7H A;  1NBE B;  2DXB A;  2HKN A;  1LOJ A;  3EAE A;  3SWN A;  3CD6 T;  2QDL A;  2ZPG B;  1SRM A;  5GAN j;  5LJ3 j;  1U3O A;  4BE0 A;  1VQ9 A;  2Z0W A;  1TOV A;  3RUX A;  2FEI A;  3OMC A;  2MWP A;  3VV0 A;  4OB1 B;  1XOV A;  1VQ9 Q;  2MYS A;  1GCQ C;  5ECA A;  1BBZ A;  5GAM e;  2OAU A;  4M78 B;  1ZSZ B;  1NJI R;  1UG1 A;  3MP1 A;  3PVQ A;  1BCM A;  2GBQ A;  1OYX A;  3CCJ T;  1JJ2 A;  1SEM A;  4DQ2 A;  2GFU A;  5GAM g;  3CBO A;  2K4Y A;  4OP0 A;  4C8Q D;  4OB0 B;  2ROL A;  2QA4 A;  1KD1 R;  1T0H A;  2J6F A;  3M54 A;  5KCO A;  1MV0 B;  5CKE A;  3RMQ A;  1B34 A;  1OEB A;  2VWF A;  1YJW A;  2QA4 Q;  2E1H A;  4CC7 A;  3PGG A;  3V7R A;  4Y91 A;  1Z9Q A;  2AZV A;  1WXT A;  3TSZ A;  1J3T A;  4LE9 A;  4OMN A;  1YJW Q;  1TG0 A;  4BI8 B;  2WSC E;  1VYT A;  3HFO A;  3CCE T;  3WVE B;  2OX7 A;  3ER0 A;  2RB6 A;  2E4H A;  4L6V 5;  1KQ2 A;  1EZZ B;  3H0F A;  4JS5 A;  1WDX A;  1O75 A;  2NLU A;  2QEX T;  3VYG A;  5KYX A;  2ENM A;  1YIT Q;  4FYV B;  5A2Q E;  3CCU Q;  5KYY A;  4HCC A;  2KQW A;  2RN8 A;  3GP8 A;  2L0A A;  3M0S A;  1SF9 A;  3UA6 A;  2CUD A;  2EJG A;  1AWJ A;  1YHQ T;  1D09 B;  1GRI A;  2PVO B;  1ARK A;  2AHJ B;  3CXC S;  1SPK A;  4CC4 B;  4RCC A;  2LX7 A;  3J80 E;  1WPY A;  2HD0 A;  3BFM A;  4OMM A;  2O9S A;  3FDR A;  4BY6 B;  4F7U G;  2F2X A;  1TTH B;  1QW1 A;  1RUW A;  4HCB A;  4M77 F;  2LTO A;  1MMD A;  2NUT A;  4HT8 A;  3JCM V;  2C0O A;  3M0T A;  5GAN f;  5LJ3 f;  2CZ7 B;  2K57 A;  2QGG A;  3JSC A;  4FM4 B;  3CCQ T;  2FL7 A;  1UHF A;  2F2V A;  8ATC B;  1GL5 A;  2X3W D;  3CPF A;  2Y90 A;  4J9I A;  5DLO A;  2CP2 A;  2E5K A;  1Q7Y C;  2ATC B;  2RJF A;  1MMN A;  1Q86 U;  5CR2 A;  4M75 C;  4BAC A;  2OJ2 A;  1R8O B;  2XK0 A;  3PMI A;  4RMO A;  3CXC A;  3I55 A;  3VRY A;  4WTO B;  1GFD A;  2FYK A;  3I55 Q;  1BU1 A;  2MOX A;  2K2V A;  2PUK B;  2DKG A;  2YUO A;  3ME9 A;  2EKH A;  2DZC A;  1NEG A;  1OU9 A;  4MZM A;  1PKS A;  3UPU A;  3V7C A;  1AVZ C;  1OX8 A;  3L1A A;  2LZ6 B;  1GFC A;  1VOM A;  1KIK A;  4QQD A;  3VS3 A;  3UAT A;  4A4G A;  4B9X A;  3S3M A;  3GNF B;  3L2U A;  2JNG A;  1QQJ A;  1N8R R;  2VB6 A;  1KC8 R;  1TXQ A;  2YUN A;  1ZA1 B;  5HY6 A;  1BK2 A;  2J7I A;  2DXT A;  3RBB B;  5IXF A;  3CCS Q;  4EMK B;  3CC7 A;  1X01 A;  2ZPF B;  4RTX A;  5LJ3 d;  3CCM T;  4LD9 K;  1UGS B;  3DKM A;  4E7Z A;  1MND A;  3REB B;  3CC7 Q;  3GBQ A;  4D8K A;  1BIB A;  4II1 A;  1BYM A;  1WQ7 A;  3A8L B;  3CMA A;  3V7S A;  4C92 G;  1YJ9 A;  4O5V A;  1G2B A;  1M2V B;  4M78 A;  1ZSZ A;  1AWW A;  1K9A A;  1RAD B;  4HA8 A;  2RK2 A;  2QAS A;  2EJ9 A;  5LJ3 h;  1QMC A;  3LWH A;  2V26 A;  3QII A;  2XIC A;  3C94 A;  2K5F A;  1YFN A;  2EYQ A;  5KYW B;  2D1X A;  1KQS P;  5I21 A;  1VQP A;  1K4U S;  4DOW A;  5GAN 6;  3ZEH A;  2M51 A;  1MGQ A;  2D6F A;  4LUE A;  5FU6 B;  1VQP Q;  3LH5 A;  1W6X A;  1PSE A;  1VQ8 Q;  3MEU A;  4PNO A;  4M7D G;  2D0N A;  4C92 D;  1N9R A;  1LCK A;  1O9S A;  4KBM B;  3QYG B;  3CCJ A;  2GTO A;  1ZUU A;  2JS2 A;  4MDW A;  2H3J A;  2VC8 A;  2HZY A;  3CME A;  2YHT A;  4M78 E;  3VU3 C;  2L2P A;  4HVU A;  4OB2 B;  2VXE A;  1P92 A;  3CCJ Q;  2JTE A;  3C4S A;  1JJ2 P;  1YP5 A;  3O8V A;  4HCZ A;  1GXI E;  1VQ9 T;  5FLX E;  2LVM A;  3CME Q;  2OTJ Q;  5LJ3 g;  2D8J A;  1ZX6 A;  5CQX A;  1VQL A;  1AT1 B;  2EQI A;  5GAO n;  2A28 A;  1VUB A;  4MZP A;  1EIF A;  3HFN A;  3OA6 A;  2EVR A;  4FSX A;  3CCV A;  3KXT A;  2M16 A;  3CCE A;  2A0F B;  1VQL Q;  1SSH A;  1Z9Z A;  2BIV A;  3S6W A;  1KD1 C;  1X69 A;  2YRC A;  4XTY A;  2LQN A;  3MJX A;  3CCV Q;  4E7S A;  1W2B A;  3CCE Q;  2JXB A;  4M77 C;  2QEX A;  4M7D D;  5L8R E;  2KRN A;  2KT1 A;  1KK7 A;  3NTK A;  4ZGE B;  4F04 B;  1B07 A;  2QA4 T;  1QVG A;  1GCQ A;  3H0I A;  4N4H A;  2JM9 A;  2GCX A;  4XU2 A;  1YJW T;  4AMC A;  2XKO C;  4J6X A;  3UWN A;  4ZN3 A;  3BY7 A;  4J6W A;  5GMK l;  4E7L A;  1K9M U;  4QVD A;  2V1Q A;  1PG5 B;  1FMV A;  1KJW A;  3A5Z B;  2X4X A;  1YIT T;  4C8Q F;  3CCU T;  5A0D A;  3RKW A;  3A8O B;  4WCI A;  2DZ9 A;  1SHF A;  2EGA A;  2R57 A;  1K8A U;  4A4H A;  1XTD A;  4J9F A;  2LCL A;  1I07 A;  1TS9 A;  4B6M A;  2RNA A;  2RHU A;  2XHC A;  3CCQ A;  1B34 B;  2BE7 D;  3U23 A;  5FU7 B;  1WGS A;  2E64 A;  2HNI A;  3QPH A;  2F2W A;  5GMK j;  3CCQ Q;  2KK4 A;  1U8R A;  1Q86 R;  2X3X D;  4IUQ A;  5FRN A;  4XU1 A;  2P84 A;  2RI2 A;  3OW2 S;  4M7A G;  2EBP A;  4BE1 A;  3OYL A;  2G6F X;  1TU0 B;  2CYZ B;  4JRI A;  1JU5 C;  1TWB A;  2DEQ A;  1OPL A;  5AT1 B;  2E3I A;  2EYY A;  3X20 B;  3CXC P;  2QDY B;  4R56 A;  2RH2 A;  2RMO A;  2RQR A;  3OYK A;  3RIR A;  2E3H A;  2CT4 A;  1H64 1;  2LNH B;  1K73 U;  1IRE B;  4PLI A;  3QUI A;  1IHW A;  1WXU A;  4KH1 B;  2ECZ A;  2GGR A;  1UEC A;  2F1L A;  3EHQ A;  2E70 A;  5GAN 7;  4E7I A;  2L89 A;  1TUC A;  4BUG A;  2M0O A;  4E2F B;  2CS7 A;  4M78 G;  2CP5 A;  1I5O B;  4HVV A;  4ZGJ B;  1M2V A;  2GTJ A;  2KY9 A;  1W70 A;  2KGT A;  1SSF A;  1WHL A;  2B8A A;  4M7A D;  3I55 T;  2P0P A;  1U1S A;  1WFW A;  2RI5 A;  1E6H A;  5FWB A;  2D9T A;  3DLL A;  3CC4 A;  2VYT A;  5EC7 A;  3LH0 A;  5GAN 4;  3OYN A;  3HRT A;  1OZ3 A;  2QQB A;  2FZG B;  5KYW A;  1AWX A;  3M5A A;  1UGQ B;  4M75 A;  3CC4 Q;  1UUE A;  3C12 A;  1RAE B;  5DM7 R;  3CCM A;  2DVE A;  1G3S A;  3EFR A;  2MIO A;  3PIP A;  1N8R C;  2IPO B;  4KUD K;  1IGQ A;  1T3S A;  3CCM Q;  1AOJ A;  2FPF A;  2LCC A;  1UJY A;  4F7U F;  1D1A A;  3EGX B;  1D0Z A;  8AT1 B;  5D6Y A;  4ZGD B;  3JB9 G;  3QZ9 B;  3CCS T;  2M9U A;  4EIK A;  3OS5 A;  3ULR B;  1D0Y A;  2DL5 A;  4GBQ A;  4UC4 A;  3JAM E;  3E9F A;  3GIB A;  3CC7 T;  2RQT A;  2VV5 A;  3A8G B;  2DER A;  2D8H A;  3E2U A;  2PTK A;  1M90 U;  3OMG A;  1LJO A;  1QVF A;  3HRS A;  3JCM W;  1PKT A;  2LJ3 A;  4M75 E;  4CRI A;  5GMK m;  4J8O A;  2XDD A;  2O01 E;  3OBW A;  4XAX B;  4XQ3 A;  4N4I A;  4RCB A;  1H8K A;  3A8H B;  2HL3 A;  1KG1 A;  4OF1 A;  1Y0M A;  4XTV A;  1QWE A;  4RTV A;  3JB9 D;  3EH1 A;  3CCL T;  1VQP T;  1KHC A;  2L3Q A;  5I2M A;  2YXY A;  3E9G A;  2LJ0 A;  1FX7 A;  3QWX X;  2J05 A;  1VQ8 T;  2BKD N;  1Y07 A;  3OYE A;  4P5N A;  1RAI B;  4C0G A;  1YI2 A;  4JJN K;  2FZK B;  3E19 A;  1OX9 A;  1QCF A;  3JCM c;  3CCR A;  4C8Q C;  1NZ9 A;  4AFQ C;  1PRM C;  3EG1 A;  4Y28 E;  1VQ5 A;  1YI2 Q;  3JCM P;  2WSE E;  1UGV A;  2MF2 A;  5D7U A;  1X43 A;  3CCR Q;  3NGP A;  2OTJ T;  3CME T;  2B86 A;  1VQ5 Q;  1JEG A;  2QGF B;  1W2B P;  2JUF A;  2MAM A;  4JZ3 A;  4LNP A;  1JRI A;  3PVL A;  2KNB B;  1QVG P;  2DBM A;  1Q81 C;  3CC2 T;  1VQL T;  4ORZ A;  1K9M R;  1I0C A;  2LRQ A;  3UDC A;  4C92 F;  3J7A F;  3CCV T;  2MI6 A;  2DYB A;  3QG1 A;  3RKY A;  4DOV A;  4IUU A;  1NM7 A;  2CZ6 B;  5GAN 5;  5CCA A;  2RO0 A;  3QJ6 A;  2DYI A;  1YIT A;  1G3T A;  3CCU A;  1OUL A;  1Q81 U;  1K8A R;  1OZ2 A;  4VUB A;  4L5G A;  2EAY A;  4EMH A;  2K6D A;  1RAA B;  4DEX A;  1FMW A;  3LLR A;  4J9D A;  3OYA A;  1IRX A;  1FMK A;  3LWI A;  4Z88 A;  3OYG A;  3JCM b;  2K3X A;  3BW1 A;  3QKJ A;  2LMJ A;  2MPX C;  4C0D C;  5CKB A;  1W1F A;  2F5T X;  2JTM A;  2FO0 A;  1C6V X;  3M4G A;  1FYN A;  2P0K A;  4M77 A;  3M9Q A;  1XNI A;  2M1H A;  1BKB A;  1PRL C;  1M8M A;  1QLY A;  3SEM A;  4M7D F;  2CKK A;  2QYZ A;  2DBK A;  4JJD A;  1OOT A;  3GLX A;  2RJE A;  2FRW A;  1PD1 A;  3KUF A;  2P4T A;  4YTL A;  3VRZ A;  1K0S A;  1VIE A;  3BDL A;  5CK9 A;  1Q86 C;  2SEM A;  4E47 A;  1K73 R;  5CKF A;  2JN0 A;  3QSU A;  3CEY A;  2RF0 A;  4PJO G;  5IXB A;  2GQI A;  1VQN Q;  3FJP A;  2CSQ A;  3TQ7 P;  2BZ8 A;  4KUL A;  1NG2 A;  2FHD A;  3MP8 A;  2X51 A;  4WF2 A;  4PFZ A;  1YNZ A;  4JZ4 A;  4EMG A;  5IHK A;  2EFI A;  3EGX A;  5IAY A;  4M77 E;  4FW2 A;  5I22 A;  5D6X A;  1WJS A;  4FYX B;  2Y4Y A;  2LQ8 A;  2LC4 A;  1A0N B;  2FVU A;  1AEY A;  1AZG B;  3VS1 A;  1VIF A;  4PJO C;  1YJN T;  2JMC A;  4IIO A;  4NS5 A;  2K2M A;  2JMA A;  3M53 A;  4XTZ A;  1YCS B;  2O88 A;  4A54 A;  4PJO D;  1X6G A;  4RTY A;  3M0U A;  1SRL A;  4FCY A;  1LPL A;  4GLK A;  1PNJ A;  1HK9 A;  3JCM J;  1Q82 C;  1TSF A;  3CCS A;  2DL8 A;  3KBG A;  1I81 A;  1M2O A;  2E10 A;  1BCO A;  2DVJ A;  3CC4 T;  3OY9 A;  2DPP B;  4KH0 B;  3JRZ A;  1RI9 A;  1T0J A;  1KQ1 A;  1RAF B;  4FU6 A;  1QCO A;  2DD5 A;  3HHT B;  2X4W A;  3JCM X;  1WNL A;  4X34 A;  3VS6 A;  4LN2 A;  2RQU A;  5J39 A;  1V29 B;  3OSS C;  1KHI A;  5IH2 A;  5GAN d;  1Q82 U;  1M90 R;  4FYY B;  1ACM B;  3FJ5 A;  4RG8 A;  4M7A F;  3P8H A;  4BI3 A;  4QVC A;  1M8V A;  1AHJ B;  1D1C A;  1C0M A;  3OYC A;  1QVF P;  1IHV A;  3NTI A;  5GAN h;  4C5I A;  3PMT A;  4IUR A;  1JXO A;  4A4E A;  3SWN C;  3QXE B;  5J26 A;  3REA B;  2O31 A;  2R58 A;  3TU4 K;  4OML A;  1RAB B;  2E41 A;  5C0M A;  3L2R A;  2E12 A;  5DLQ E;  5GJW B;  4GY5 A;  1BI3 A;  3T9N A;  3CCL A;  2YWW A;  4HVW A;  1VQO A;  1R0C B;  4M75 B;  4DEY A;  2XG8 D;  2C0I A;  4OVA A;  3ASK A;  3CCL Q;  1VQ8 A;  3EG3 A;  1VQO Q;  2W10 A;  1RI0 A;  2EQK A;  1ZA2 B;  4C92 C;  1PWT A;  2BTT A;  4JDS A;  4RG2 A;  2GNC A;  3M4Y A;  2XDB A;  4J9B A;  1NPP A;  2EPD A;  7AT1 B;  5GAN e;  2QQS A;  5LJ3 e;  3EFS A;  2D0Q B;  3QO3 A;  1WHG A;  2OTJ A;  3UT1 A;  1RLQ C;  4NL2 A;  5C6S A;  3LYI A;  1H3Z A;  5GAN g;  4DBH A;  2RK1 A;  2L8D A;  4N0A A;  4JLG A;  4C5G A;  5GAM j;  3CC2 A;  3M0Q A;  1KFZ A;  2LNV A;  3QDF A;  1ZBX A;  1ZUY A;  3G4S Q;  2DK3 A;  1IB8 A;  2BZX A;  2JW4 A;  1UE9 A;  1M30 A;  2DJQ A;  1NE8 A;  4FT2 A;  3I56 A;  2HQE A;  1YI2 T;  1M5Q 1;  3CC2 Q;  4C0F A;  3OS0 A;  2K3B A;  3KFV A;  4M7D C;  5EG2 A;  1Q81 R;  2O4X B;  4PJN A;  3CCR T;  3OYH A;  2KRO A;  3GPL A;  4GLM A;  3I56 Q;  1VQ5 T;  3JB9 F;  3JCM Q;  2COZ A;  5CO7 A;  1S72 T;  2DD4 A;  2EQJ A;  1D0X A;  3PTA A;  2HBW A;  4PLL A;  4HT9 A;  3MKD A;  3S3N A;  1X2K A;  1K9M C;  2FRY A;  6AT1 B;  2NWM A;  1F1B B;  2ED1 A;  1NLO C;  5HCK A;  2NUZ A;  3GNG A;  3J81 E;  3SDZ A;  4XTW A;  2NYS A;  4C8Q A;  1VQ4 A;  2V8K A;  1K8A C;  1N27 A;  1IO6 A;  4FW1 A;  2FB7 A;  3RKX A;  3LW5 E;  3SD4 A;  2DIL A;  1VQ4 Q;  2ESW A;  2XDP A;  3R6N A;  2PVD B;  4E6R A;  3VS4 A;  1TUG B;  2KEA A;  1OI1 A;  4J9G A;  1RL2 A;  1ABO A;  1M3C A;  4LDX A;  1HSQ A;  2G3R A;  4JRK A;  5CQY A;  5LL6 S;  1KSW A;  4FL6 A;  2R5M A;  5CVI A;  1M1K U;  2RA2 A;  2EYX A;  3AT1 B;  2IG0 A;  2CZ1 B;  2KSS A;  3Q1J A;  4OMF B;  2RM4 A;  1LVK A;  2DE0 X;  2RJC A;  3FB9 A;  1WXB A;  4FYW B;  5KH6 A;  2RI3 A;  4J9E A;  4C8Q E;  1MMG A;  4DBR A;  2X4Y A;  4MDX A;  1YWP A;  1K73 C;  4X9C A;  3OYD A;  1OU8 A;  2AIR B;  1VQ6 A;  2HBP A;  2J06 A;  4AG1 C;  3BE3 A;  4TVR A;  1UHC A;  5GAN 2;  2NUP B;  1VQN T;  1SKU B;  1WI7 A;  1I8F A;  5GAM f;  1VQ6 Q;  2Y4X A;  2I2L A;  2M0Y A;  3M57 A;  1YJN A;  2KVQ G;  3H9N A;  2I0N A;  3A1P A;  4A63 B;  3M55 A;  3DB3 A;  3HP9 A;  3OYB A;  2V1R A;  4DBF A;  2OTL A;  1UGP B;  3OYI A;  4M77 B;  1FWZ A;  2KMT A;  1YJN Q;  4M7A C;  3HL8 A;  4NL3 A;  3CPW S;  1PCX A;  2E5Q A;  3C0C A;  2RHZ A;  1JQQ A;  5CAI A;  2OTL Q;  1BI1 A;  2JVV A;  3H8Z A;  1NPR A;  3OW2 A;  4N4G A;  2VXF A;  1LNX A;  2ROT A;  4KT0 E;  1JB0 E;  1PD0 A;  2ABL A;  1G5V A;  2GF7 A;  2XI9 A;  4XU0 A;  1R77 A;  1NYF A;  1Q82 R;  1AWO A;  4ESR A;  4A53 A;  2WAC A;  3WXM B;  2PQW A;  2K9G A;  1WLP B;  1OV3 A;  2P4R A;  2RHY A;  3MEA A;  3G7Z A;  4M78 C;  1ZSZ C;  2VUB A;  4V2S A;  1D3B B;  2HEQ A;  2K7A A;  3TEE A;  4X1V A;  2DL7 A;  2W0Z A;  2ZPI B;  3SHW A;  4M78 D;  3CQT A;  1YIJ A;  5HKC A;  2A7Y A;  4MML A;  2KYB A;  3MP6 A;  3CBM A;  2VGM A;  1M90 C;  1YIJ Q;  2CH4 W;  3FEO A;  2A37 A;  4PJJ A;  2ZPB B;  3HRU A;  1KQS S;  5I11 A;  2QQ9 A;  5HK0 A;  5HK3 A;  4PJO F;  1VQ7 A;  1WIE A;  1WHJ A;  4FIB A;  4RTZ A;  3HPW A;  1CSK A;  1MHN A;  3TSW A;  2XMF A;  2PU9 B;  2DRM A;  3UF4 A;  1X6O A;  3PNW C;  1VQ7 Q;  2R5A A;  4QQ6 A;  2RQV A;  2BE9 B;  2EWN A;  4Y92 A;  4RTU A;  4R0K A;  1K0X A;  1HYO A;  4F7U E;  3QBY A;  4AT1 B;  5M9O A;  2YUP A;  2O4X A;  3L2Q A;  5FRM A;  5I2S A;  1Q95 G;  1ZUK A;  2DIQ A;  2FZC B;  5GAM h;  2XU8 A;  3G1J A;  5IHN A;  1JXM A;  3OBY A;  3CBP A;  2KAF A;  4QQG A;  2E6Z A;  3EH2 A;  1ZHI A;  3M0P A;  3THK A;  1VQO T;  1JJ2 S;  1V76 A;  4OMP A;  2M02 A;  3JB9 H;  4D6W A;  1XJW B;  4MMK A;  2HSE B;  4LDU A;  5GAN 8;  2DXU A;  4IIM A;  1ABQ A;  2A08 A;  4J9H A;  2LCS A;  4XK8 E;  3I9Q A;  4AFZ C;  4LD6 A;  4BY6 C;  2QG9 B;  2YDL A;  3A98 A;  1PC0 A;  2JJ9 A;  2DFU A;  4R55 A;  4OGE A;  3VS7 A;  1QWF A;  1S72 A;  2VKN A;  2AT1 B;  5KYN A;  3G71 A;  3NFC A;  2LQK A;  2JTF A;  4LUD A;  1VA7 A;  2O2O A;  3VYH B;  2CSI A;  3G4S T;  2RHX A;  4C92 A;  1S72 Q;  2OI3 A;  1FXX A;  3G71 Q;  1G83 A;  3FC3 A;  1D1B A;  2RPN A;  2P0Q A;  3G6E A;  4QW2 A;  9ATC B;  3EGD B;  4KGZ B;  4OB3 B;  2DMO A;  3I56 T;  4QT7 A;  1WYX A;  2LP5 A;  4AG2 C;  3G6E Q;  2L3P A;  4PJM A;  2COW A;  4AFU C;  1QP2 A;  2L3S A;  4J7I A;  2VGN A;  2PZ1 A;  4IUP A;  2YUQ A;  2EJF A;  1NYG A;  2DJZ A;  5GMK h;  4E7J A;  4A4K A;  1QVP A;  4JJB A;  2NUP A;  2QK0 A;  1I1J A;  2V8J A;  2YSQ A;  3OS2 A;  1GBR A;  1M1K R;  4HXJ A;  4L59 A;  4M7D A;  1M1F A;  2CP7 A;  1RAG B;  2GQV A;  1VQ4 T;  3IQL A;  4PJL A;  3GOX A;  4C92 E;  5FW9 A;  2WSF E;  2ZAE A;  1IXD A;  4RKU E;  4Z8A A;  1Y7X A;  1WHK A;  3M59 A;  5GMK i;  1BB9 A;  3O5Z A;  1W4S A;  1RAH B;  2CT3 A;  4JUV A;  2QQR A;  4CC2 A;  1VQN A;  2H3E B;  2XD0 A;  3EG2 A;  4EMK C;  4Z89 A;  5GMK e;  2HL5 C;  4M75 G;  1ZBJ A;  1ZQ1 A;  2KT8 A;  3VUZ A;  5IT9 E;  4PL6 A;  5L23 A;  1GCP A;  1M27 C;  1WA7 A;  5A0L A;  2MMP A;  4C8Q B;  5AYF A;  1BI2 A;  2AZS A;  4C0Z A;  4CC3 A;  1K76 A;  4J6Y A;  4BD3 A;  2RD1 A;  1Y96 A;  4LDW A;  2LDM A;  1D3B A;  3MHX A;  4JJC A;  2QTV A; 
#chains in the Genus database with same CATH homology
 2EPD A;  2QDL A;  1CKA A;  1SRM A;  1UTI A;  4AFS C;  1OPK A;  2RMO A;  1U3O A;  1M3B A;  3EHR A;  2RQR A;  1VYU A;  2LQW A;  2FEI A;  1AZE A;  1RLQ C;  2CT4 A;  2LNH B;  1WXU A;  2ECZ A;  1XOV A;  2KRM A;  2GGR A;  1GCQ C;  1UEC A;  5ECA A;  1BBZ A;  3QWY A;  3EHQ A;  1JO8 A;  1TUC A;  3M0Q A;  1KFZ A;  1ZUY A;  1UG1 A;  2YT6 A;  3PVQ A;  1V1C A;  1N5Z A;  2BZX A;  2JW4 A;  1UE9 A;  1M30 A;  2DJQ A;  1X2Q A;  4HVV A;  2GBQ A;  2GTJ A;  1QKX A;  1W70 A;  2KGT A;  1SEM A;  2K3B A;  2H8H A;  3KFV A;  1WFW A;  2IIM A;  2ROL A;  2KRO A;  1E6H A;  4GLM A;  5FWB A;  1T0H A;  2J6F A;  1MV0 B;  5EC7 A;  3VS0 A;  1OEB A;  2VWF A;  1AWX A;  4RTT A;  2HBW A;  3I35 A;  2A36 A;  1UUE A;  3PE0 A;  4CC7 A;  1X2K A;  1Z9Q A;  2AKL A;  2FRY A;  2AZV A;  1WXT A;  2NWM A;  3TSZ A;  1J3T A;  2ED1 A;  1NLO C;  2MIO A;  4LE9 A;  5HCK A;  2NUZ A;  4OMN A;  1TG0 A;  1VYT A;  1T3S A;  1AOJ A;  3H0F A;  2FPF A;  3H0H A;  1UJY A;  1IO6 A;  1WDX A;  2HCK A;  3I5R A;  4RUG A;  1X6B A;  2DIL A;  1VYV A;  2ESW A;  3R6N A;  4E6R A;  3VS4 A;  2ENM A;  1HJD A;  2C0T A;  2CUB A;  2KEA A;  4F17 A;  4EIK A;  4J9G A;  3ULR B;  3EG0 A;  2RN8 A;  1ABO A;  2L0A A;  3M0S A;  2DL5 A;  3UA6 A;  2CUD A;  4GBQ A;  1M3C A;  1AWJ A;  1HSQ A;  1GRI A;  2RQT A;  1ARK A;  2D8H A;  2CRE A;  4OMQ A;  1SPK A;  1KSW A;  2PTK A;  4CC4 B;  3VS2 A;  2LX7 A;  1UFF A;  1UJ0 A;  4OMM A;  2EYX A;  2O9S A;  1PKT A;  2LJ3 A;  2F2X A;  1H92 A;  2KBT A;  2DE0 X;  1RUW A;  1WXB A;  1H8K A;  2EGC A;  4J9E A;  2C0O A;  2EGE A;  3M0T A;  3JV3 A;  1YWP A;  1WX6 A;  1Y0M A;  1QWE A;  1YWO A;  4RTV A;  2J06 A;  4AG1 C;  1UHF A;  2F2V A;  1UHC A;  1GL5 A;  2L3Q A;  2X3W D;  2J6O A;  1WI7 A;  1EFN A;  4J9I A;  2LJ0 A;  3QWX X;  2J05 A;  2E5K A;  2M0Y A;  4J9C A;  1HD3 A;  1QKW A;  2CH4 A;  4FSS A;  2I0N A;  4A63 B;  2KR3 A;  2OJ2 A;  2PNI A;  2V1R A;  1ZLM A;  4KRT A;  4D8D A;  2EYW A;  1QCF A;  3M0R A;  3VRY A;  4F14 A;  3C0C A;  3TVT A;  1B3Q A;  1JQQ A;  3EGU A;  1PRM C;  4AFQ C;  3EG1 A;  1UGV A;  1GFD A;  1BU1 A;  1M3A A;  2MOX A;  3VS5 A;  1X43 A;  2ROT A;  3NGP A;  2B86 A;  2SRC A;  1JEG A;  2ED0 A;  2YUO A;  2EKH A;  1NEG A;  4JZ3 A;  1GBQ A;  2ABL A;  4LNP A;  1PKS A;  2KXC A;  3PVL A;  2KNB B;  1CKB A;  1AWO A;  1AVZ C;  1NYF A;  2DF6 A;  2DBM A;  2LZ6 B;  4ESR A;  1GFC A;  4ORZ A;  1KIK A;  3VS3 A;  2K9G A;  3UAT A;  1I0C A;  1WLP B;  4M4Z A;  1OV3 A;  2P4R A;  1K1Z A;  4ZNX A;  2DYB A;  5FWC A;  1NM7 A;  2HEQ A;  2K7A A;  2CDT A;  4X1V A;  1UDL A;  2DL7 A;  2W0Z A;  3SHW A;  2YUN A;  1BK2 A;  2J7I A;  2DNU A;  3CQT A;  2K6D A;  4DEX A;  4J9D A;  2KYB A;  1FMK A;  3RBB B;  5IXF A;  4Z88 A;  1E6G A;  1U06 A;  4RTX A;  2CH4 W;  2A37 A;  2LMJ A;  5I11 A;  4F16 A;  2K79 A;  3REB B;  2DL4 A;  3GBQ A;  4D8K A;  1W1F A;  1WIE A;  2KXD A;  2FO0 A;  2KE9 A;  1FYN A;  1G2B A;  1H3H A;  4RTZ A;  3TSW A;  1CSK A;  1AWW A;  2HDA A;  1K9A A;  2FPD A;  2XMF A;  2DRM A;  3UF4 A;  1PRL C;  2RQV A;  1M8M A;  1QLY A;  1T3L A;  4RTW A;  3SEM A;  4Y92 A;  2DBK A;  4R0K A;  4RTU A;  1K0X A;  2RQW A;  1OOT A;  2O9V A;  4JJD A;  2YUP A;  2FRW A;  2LJ1 A;  2D1X A;  3VRZ A;  1K0S A;  1K4U S;  1ZUK A;  2EYZ A;  2M51 A;  2SEM A;  5IHN A;  1JXM A;  4LUE A;  2KYM A;  5IHI A;  2RF0 A;  2JM8 A;  3M0P A;  3THK A;  2GQI A;  5IXB A;  3RNJ A;  2DM1 A;  4OMP A;  2DRK A;  1MV3 A;  2CSQ A;  3LH5 A;  1W6X A;  1Y57 A;  2BZ8 A;  1NG2 A;  3NHN A;  4IIM A;  1YNZ A;  1ABQ A;  2A08 A;  2D0N A;  4J9H A;  3I5S A;  4JZ4 A;  2LCS A;  1LCK A;  3I9Q A;  4HCK A;  4AFZ C;  1YN8 A;  2VVK A;  2GTO A;  5IHK A;  1ZUU A;  2JS2 A;  2YDL A;  3A98 A;  3H41 A;  2L2P A;  4HVU A;  2DL3 A;  5I22 A;  2JTE A;  3NPF A;  3VS7 A;  1E7O A;  1QWF A;  1ZSG A;  2VKN A;  2KRS A;  1YP5 A;  1A0N B;  2JT4 A;  1TUD A;  2MCN A;  1SHG A;  1AEY A;  1AZG B;  2OAW A;  4LUD A;  2D8J A;  4JPB W;  3VS1 A;  1VA7 A;  1ZX6 A;  2O2O A;  2CSI A;  2EQI A;  2A28 A;  2JMC A;  4IIO A;  2OI3 A;  2K2M A;  1G83 A;  2EVR A;  2JMA A;  2BZY A;  1YCS B;  2RPN A;  2O88 A;  1X6G A;  4RTY A;  1SSH A;  1Z9Z A;  3M0U A;  1SRL A;  1X69 A;  2DMO A;  2DX1 A;  2LQN A;  4QT7 A;  1WYX A;  2LP5 A;  2DA9 A;  2DLP A;  2JXB A;  4AG2 C;  2L3P A;  1PNJ A;  4AFU C;  2L3S A;  2KRN A;  2KT1 A;  2DL8 A;  1PHT A;  2JS0 A;  2PZ1 A;  1B07 A;  2YUQ A;  2DVJ A;  5GJV B;  1GCQ A;  2AKK A;  3H0I A;  1NYG A;  1RI9 A;  1NLP C;  1T0J A;  2JM9 A;  1MUZ A;  4JJB A;  1S1N A;  1I1J A;  2YSQ A;  4LN2 A;  3VS6 A;  2RQU A;  2HSP A;  2AK5 A;  4K11 A;  5IH2 A;  2FG0 A;  1GBR A;  4HXJ A;  3NMZ C;  1AD5 A;  1NEB A;  3FJ5 A;  2V1Q A;  3IQL A;  3UA7 A;  1KJW A;  5FW9 A;  2EW3 A;  4WCI A;  1SHF A;  2EGA A;  4Z8A A;  1JXO A;  4J9F A;  1X27 A;  3REA B;  2O31 A;  2FPE A;  1BB9 A;  3O5Z A;  1I07 A;  4OML A;  2RNA A;  1RLP C;  2J6K A;  5GJW B;  2CT3 A;  3U23 A;  4CC2 A;  1U5S A;  4HVW A;  4DEY A;  3EG2 A;  2C0I A;  4Z89 A;  2F2W A;  3ZL7 C;  1ZBJ A;  2KT8 A;  2X3X D;  5L23 A;  3EG3 A;  4OMO A;  1GCP A;  1M27 C;  1WA7 A;  2W10 A;  2EBP A;  2AZS A;  2G6F X;  4CC3 A;  1K76 A;  1JU5 C;  1PWT A;  2BTT A;  2GNC A;  1OPL A;  4JJC A;  4J9B A;  2EYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...