2GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
b'MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
molecule tags Complex (signal transduction/peptide)
source organism Mus musculus
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gbqA00
1MUZA 1AD5A 3VS3A 2YDLA 4LNPA 1UHCA 1CKBA 2DL4A 1GCPA 4OMPA 1FMKA 3KFVA 1K0SA 1WIEA 3QWXX 4R0KA 5FWBA 2RQUA 1QCFA 2KE9A 3VS2A 1UTIA 1YWPA 1JQQA 3VRZA 5I22A 1GFDA 3O5ZA 4ESRA 2MIOA 1VYVA 2DNUA 4JJBA 4RTYA 2GQIA 2W0ZA 3A98A 2K2MA 2F2WA 2A37A 3RNJA 4RTVA 1QWEA 2C0TA 2M51A 2PZ1A 2ESWA 4HCKA 1YNZA 3TVTA 2EKHA 3REBB 4IIOA 2L3PA 2GBQA 3H0IA 4J9FA 1GCQC 1BB9A 2KEAA 3M0RA 2DVJA 1K0XA 2CH4W 2PNIA 2FRYA 1UECA 3VS6A 2FG0A 1Z9ZA 3RBBB 2A08A 3M0TA 1SSHA 2EBPA 2NWMA 1UGVA 4ORZA 1WXTA 1JEGA 2J6FA 2K6DA 2KYBA 4RTTA 1B3QA 4DEYA 2O2OA 3EG0A 1I1JA 2LMJA 1UHFA 1K9AA 2AK5A 2RQVA 4JPBW 1PKTA 1ZBJA 2DYBA 5GJVB 4QT7A 3UATA 1WA7A 1S1NA 3QWYA 2DE0X 2K79A 1AZEA 2LQNA 2F2VA 1A0NB 4AFSC 2V1RA 2VWFA 1MV0B 5FW9A 4CC4B 2EPDA 2LJ0A 3THKA 2DBKA 4JJDA 1UG1A 2MCNA 3R6NA 5IHIA 2JMCA 2DL7A 2DL8A 4J9EA 1KSWA 1VYUA 2JT4A 4M4ZA 2KT8A 2LCSA 3VS1A 2LP5A 2IIMA 1TUCA 2FO0A 2AKLA 2P4RA 3JV3A 4JZ4A 2O9SA 2DILA 2D8HA 1ABQA 3I5RA 3H0HA 1RLQC 2LQWA 2YUNA 2BZ8A 2VVKA 1W1FA 1LCKA 2YSQA 1M27C 2YUQA 1E7OA 4J9GA 4RTXA 2GGRA 2J06A 4J9CA 3EHQA 2OAWA 1I0CA 1NEBA 2ABLA 1AWJA 1M3AA 2L2PA 5I11A 2ROTA 3VRYA 1V1CA 1K76A 1QWFA 4RTWA 2DL5A 5IXFA 2L3QA 3UA7A 1UE9A 3SHWA 1NEGA 2L3SA 2JMAA 3TSZA 3VS4A 2JW4A 2W10A 1T3LA 5IHKA 2KRNA 4J9DA 1E6GA 1MV3A 2FPFA 2C0IA 5EC7A 1M8MA 2EYXA 4K11A 1ZUYA 4AG2C 1SRMA 3REAB 2AZVA 2AKKA 3SEMA 2JM9A 1KJWA 3NHNA 1N5ZA 1U5SA 2DX1A 1UJ0A 4FSSA 1HJDA 2EYYA 1JO8A 1PRLC 4F17A 3VS7A 1RUWA 4LUEA 2LNHB 3M0SA 3FJ5A 2BZYA 2CSIA 2DMOA 1W6XA 2DBMA 2CDTA 3ULRB 2HCKA 2BZXA 2DJQA 1RLPC 2KR3A 1TG0A 2J05A 2RPNA 1AWOA 1K4US 2FPEA 3I35A 2BTTA 2EYWA 1GL5A 4AG1C 3M0QA 4RUGA 1UDLA 3CQTA 2OJ2A 2GTOA 2RQTA 4OMMA 1CSKA 2EW3A 4F14A 1NLOC 1PHTA 1X2KA 2K7AA 2KT1A 1M30A 4AFZC 4D8KA 2FPDA 2EGAA 2J6OA 3UF4A 2CUDA 1VYTA 2O31A 2HDAA 2YT6A 5IXBA 2L0AA 1ARKA 1XOVA 2LX7A 4OMNA 2A36A 2GTJA 1PNJA 5IH2A 2K9GA 1UFFA 3TSWA 2RN8A 2KNBB 1GCQA 1J3TA 3H41A 1Z9QA 3H0FA 4Z88A 2EQIA 2KBTA 1NYFA 2ENMA 2B86A 1WX6A 2KXCA 4JJCA 4CC3A 1PRMC 1SPKA 1QKXA 2D0NA 2EVRA 3ZL7C 2F2XA 2JTEA 1OV3A 5IHNA 2DRKA 2XMFA 1HD3A 2RMOA 4OMQA 4AFQC 4AFUC 2J7IA 5L23A 1X6GA 1UJYA 1H8KA 1ZUKA 3NPFA 1Y57A 2NUZA 2JS2A 4IIMA 1X6BA 3PE0A 4HXJA 1SHGA 4GLMA 2G6FX 1X2QA 2DL3A 1T0HA 1GBQA 4KRTA 1FYNA 1QLYA 1OOTA 3M0UA 2DM1A 4CC7A 1H3HA 1NG2A 2J6KA 1RI9A 4Z89A 4GBQA 1AWXA 4JZ3A 3C0CA 1AOJA 5FWCA 3U23A 4DEXA 2RNAA 2KRSA 1JXOA 2HSPA 1ZUUA 1M3BA 2ED1A 2KYMA 4F16A 1JXMA 2FEIA 2JM8A 1QKWA 2KROA 2RQRA 2LZ6B 1T3SA 1SEMA 1H92A 1B07A 1EFNA 2V1QA 2YUPA 4EIKA 4D8DA 2C0OA 2RQWA 2CH4A 1BK2A 1PWTA 2DRMA 5GJWB 2D8JA 2CUBA 1ZSGA 2ROLA 1IO6A 4LUDA 1PKSA 2HBWA 2LJ1A 2AZSA 2CSQA 1GRIA 1KIKA 3NGPA 3UA6A 2HEQA 2KGTA 1NYGA 4X1VA 4ZNXA 3EHRA 2RF0A 4OMOA 4LE9A 4HVWA 2DLPA 1U3OA 2X3XD 3PVLA 1ZLMA 1YN8A 3LH5A 3EGUA 1YP5A 2QDLA 1GBRA 1I07A 3EG3A 1OPLA 3GBQA 4Z8AA 1AZGB 1T0JA 4HVVA 2KXDA 1WXUA 3PVQA 2M0YA 1ABOA 4J9IA 1HSQA 1UUEA 2VKNA 4HVUA 2GNCA 2MOXA 2EGCA 2LJ3A 3NMZC 1GFCA 4J9HA 3I9QA 1CKAA 4Y92A 1X43A 2O88A 1AEYA 1SRLA 1ZX6A 3VS0A 3I5SA 5ECAA 1VA7A 2SEMA 2JS0A 2PTKA 1WDXA 3EG2A 2I0NA 2SRCA 2H8HA 2CREA 1WFWA 1WLPB 3M0PA 1AWWA 5HCKA 1W70A 4WCIA 1M3CA 1U06A 1BBZA 4J9BA 2D1XA 2A28A 1KFZA 2EGEA 4OMLA 2DF6A 1SHFA 2E5KA 2JXBA 1Y0MA 1NLPC 2ECZA 1WI7A 1K1ZA 1G83A 4CC2A 1G2BA 4A63B 3VS5A 2ED0A 2K3BA 2O9VA 1JU5C 1OEBA 1NM7A 1BU1A 1X27A 1YCSB 1E6HA 2EYZA 1AVZC 4E6RA 2KRMA 1WYXA 1YWOA 1OPKA 2FRWA 2CT4A 2OI3A 3EG1A 2YUOA 2CT3A 2X3WD 3IQLA 1TUDA 4RTZA 4RTUA 1WXBA 2DA9A 4LN2A 1X69A
chains in the Genus database with same CATH superfamily
3JCMV 5KCOA 1UHCA 3A8OB 2C06A 3CCUT 4GLKA 1WIEA 1XQHA 2RQUA 4EPCA 1KQ2A 1VQ4Q 1UTIA 5CK9A 3CCRA 3GLXA 4RTYA 3CCEA 2W0ZA 3OYBA 3QYHB 2F2WA 2LNVA 1QWEA 3F70A 2PZ1A 2CP7A 2ESWA 4A4HA 1BKBA 4A53A 4HCKA 3DB4A 4C92B 4JJNK 1KD1C 3PT9A 4NOYA 1OX9A 4OB1B 4J6YA 1BIAA 5AYFA 2L3RA 1NE8A 3QBYA 1GCQC 2VC8A 5D7UA 2GCXA 2DJZA 3M0RA 3C12A 2HAXA 2CH4W 1VUBA 2FRYA 3QYGB 2VV5A 4PJMA 1MMGA 1Z9ZA 1SSHA 2EBPA 2NWMA 2COZA 2DFUA 2K6DA 2RA2A 2EQMA 4DEYA 2CS7A 2O2OA 2LT1A 1K8AC 3FRNA 2AK5A 1WGSA 1PKTA 3QWYA 5KE3A 1YBYA 3L1AA 2FHDA 2H3JA 1W4SA 2XDDA 2DE0X 1VIFA 2EJGA 1WHJA 2KY9A 2RHZA 3EAEA 4TVRA 1BI3A 2F2VA 3MO8A 4EMKB 2NUPA 4C8QD 2RH2A 2F5KA 1VQ6A 3SB2A 2K4YA 2XU8A 4QW2A 4XTYA 1JB0E 2X51A 3WVEB 4R56A 5IHIA 1I8FA 3EFOB 4PFPA 3EFRA 2LC4A 2JMCA 4IUQA 4L5GA 3CCJT 2HBPA 1SG5A 2QQSA 4KGZB 3VS1A 3DKMA 3CC4Q 1YITA 1NBEB 1B7TA 4VUBA 1W2BS 4FU6A 3RKYA 1QW1A 2O9SA 2D8HA 1ABQA 3H0HA 1RLQC 1G3SA 3CCLT 4M77F 3MHXA 3CCQT 2NLUA 4J9GA 4HCBA 4J9CA 2OAWA 5LJ3j 1D1AA 5J26A 2HL5C 1M3AA 2L2PA 1PG5B 1V1CA 3WXMB 5GANd 2DD4A 1VQMT 5IXFA 2L3QA 3CCRT 1UE9A 3EH1A 4BI4A 4C92A 3VS4A 1JJ2A 2W10A 5IHKA 4HCCA 1E6GA 1MV3A 2FPFA 2KVQG 4QQDA 5EC7A 6AT1B 4BACA 1M1KU 4K11A 3CBPA 3SWNB 4Y91A 2QASA 1ZHIA 3L2ZA 2JM9A 2QAZA 3HFNA 2DEQA 2DX1A 1XJWB 3DB3A 4A4GA 2DPPB 3VS7A 1RUWA 3DLMA 2LNHB 2BZYA 2CSIA 3CPWA 5J39A 2CDTA 3SWNA 3L2QA 3ULRB 1YJWT 1TH7A 4J5YA 3BY7A 1K4US 1C6VX 1VQNQ 3I56T 5HK3A 1XTDA 1GL5A 4RUGA 5DM7R 5KYXA 3RR6A 5LJ5j 2GTOA 2RQTA 1VQ5Q 3OS2A 4E7KA 1PHTA 1VQ9T 1M1KC 7AT1B 4JRQA 4DA4A 2YRDA 4JRPA 2FPDA 2DTIA 2J6OA 2K5LA 3UF4A 1VQKA 4ELZC 2O31A 2YT6A 3CCJA 5GAMe 1D0ZA 3E2UA 4RG2A 1W2BP 1MGQA 3PGGA 2DETA 1RADB 5KYNA 1RI0A 1D3BA 2ZZDA 1UFFA 2EKOA 4CI0C 2KNBB 1WHMA 4M7DB 4PK4A 2E41A 1MMDA 2RI3A 3OMCA 1VQPQ 2EAYA 3JCMe 3X25B 2KBTA 1BCOA 2B86A 2G3RA 1H641 4BE0A 5LJ5g 1YJNA 1G3TA 1QKXA 3X24B 2R57A 3GF5A 1ZBXA 2AIRB 3A1PA 3D7SB 5CCAA 2DIQA 2FZGB 1M9SA 2ZPEB 4AFUC 2CP6A 2E6NA 1Q95G 4FYVB 4FYWB 3CPFA 1UJYA 2WACA 1ZUKA 1Y57A 1QP2A 4GLMA 2JUFA 4DBRA 1GBQA 4QVDA 4BDYA 1UEBA 2DM1A 2F5TX 2XDBA 3I55T 3SD4A 1IGQA 2E70A 2ZCFB 3OYNA 4HKEA 1HXDA 3UPUA 3CCEQ 4JZ3A 5FWCA 5GAN4 1KG1A 2HL3A 5DLQE 1QP3A 2K57A 5HY6A 2L89A 1PC0A 2MPXC 1YIJT 1H92A 1LJOA 4D8DA 2X4YA 1KHCA 3JCMd 5I2MA 1D09B 5GJWB 3E19A 2D8JA 2MF2A 3BFMA 3CCLQ 1F1BB 1K9MR 4M75C 1W2BA 4X1VA 2MI6A 4ZNXA 5GAN6 5FU6C 2ZPGB 2DLPA 1U3OA 3CCQA 4M7AA 2X3XD 4C8QB 2H3EB 5A0GA 1ZLMA 1VQKT 5CVIA 1QVFP 4FT2A 2QDLA 5FRNA 4CRIA 1RAEB 3J7AF 1KQSS 2K5FA 3GBQA 1BYMA 4Z8AA 5LJ5h 1M5Q1 3QDRB 2M0YA 2CP2A 2ZGWA 1K73U 4BE1A 2K3YA 1PD1A 1HSQA 2VKNA 4HVUA 2VB6A 3QPHA 3RESA 1NPRA 2YWWA 3CC7T 3OYAA 3DLLA 4LDYA 3A8GB 1ZX6A 1VQ7T 3I5SA 3JCMh 4PFOA 3JCMJ 3FDRA 2JS0A 2PTKA 2X4XA 3BDLA 1VQ9Q 5CAIA 1WDXA 5CKFA 1VQ8Q 2SRCA 2DD5A 1M1KR 4R55A 1D0YA 1W70A 1U06A 1BBZA 4N4GA 3OSVA 5LJ3g 4QQGA 2EGEA 2COWA 3RKXA 2JXBA 1Y0MA 2ECZA 2YLBA 4C8QA 2JN0A 2HMAA 1K1ZA 4FL6A 5GANe 2IVWA 2JVVA 3CC7A 1M8VA 2K3BA 1JU5C 1VQ7A 3SFMA 1X27A 3P8HA 2P0QA 3EG9B 3M55A 4HT9A 2LQ8A 3L42A 2HQXA 1AVZC 1WYXA 3PNWC 2EJ9A 1OPKA 2FRWA 5GANg 1FMVA 2CT4A 3CMEA 2OI3A 1O75A 3OYGA 4UC4A 2CZ6B 2BIVA 3LWHA 2GFAA 4LN2A 3JAME 4XU3A 2PUOB 2DL4A 1QVFA 1BI0A 1GCPA 4OMPA 1FMKA 4FCYA 2FZKB 4KGXB 5FWBA 1RACB 2V8IA 3VS2A 1YJNT 3VRZA 5I22A 1GFDA 3O5ZA 1QVFS 2DNUA 4JJBA 5LJ5d 3A98A 2FZCB 3RNJA 2A37A 2COYA 4KUDK 4MZTA 5AT1B 2M51A 1MNDA 1YNZA 1YITQ 3REBB 4N4IA 3LGFA 3J81E 2GBQA 3H0IA 3RMQA 4M7AF 2K3XA 4JS5A 5J3BA 2PNIA 4J83A 4M7DE 1UECA 3VS6A 2VYTA 3HRSA 5KYYA 2FG0A 1WHLA 3M0TA 1QCOA 1UGVA 3URGA 1JEGA 3OYHA 2KYBA 4RTTA 5GAMh 5CQXA 2LCCA 1D1CA 3H8ZA 2LMJA 1UHFA 4J8OA 4JPBW 1ZBJA 1D3BB 2E12A 1S1NA 2XD0A 1WJQA 3E9FA 4OB2B 2YHTA 3OYLA 1M90C 1XNIA 3RMSA 3QG1A 4AFSC 1JJ2S 2BE7D 3FJPA 4A4FA 2VWFA 3QSUA 4QQ6A 2M0OA 2F1LA 2EPDA 2LJ0A 1NJIR 1D1BA 2DXBA 4XTVA 1KC8R 4OP0A 3R6NA 4ZN1A 4M78C 3GNFB 2HSEB 1N8RU 2DAQA 1NZ9A 2DL7A 5GAN5 2DL8A 1YI2T 4M78G 5FU7B 1KSWA 1VYUA 4M4ZA 2LCSA 2LP5A 4ELYC 2IIMA 1Y71A 2FO0A 1OX8A 1I81A 4N4HA 2AKLA 2CP5A 2P4RA 3JV3A 2E10A 3V8JA 2OTLA 3CMET 3I5RA 3G6EA 4E7HA 2LQWA 2MYSA 3G4SA 2V8JA 2YUQA 4XTXA 5GAN8 3ZFJA 2GGRA 2J06A 1I0CA 1AWJA 4RG8A 5M9OA 1K76A 2DL5A 4M77A 1D0XA 2BKDN 1BIBA 1NPPA 4IUUA 1K9MC 1NEGA 4C5EA 2L3SA 1UB4A 3V7CA 2KRNA 2C0IA 3EGDA 4M7AD 1B34B 3JCMQ 2E64A 4M75A 2HQEA 1ZUYA 3REAB 5L8RE 2AZVA 3NTKA 1C1AA 1KJWA 3NHNA 1VQPA 3QZ5B 4KGVB 2NUPB 1EZZB 1HJDA 5LJ3h 2EYYA 1JO8A 1U1TA 2A7YA 3TCJA 4LUEA 1AHJB 3FJ5A 3QKJA 4M7DA 1YHQA 1QVGA 4X34A 2DJQA 2E3IA 2RI5A 2J05A 2RPNA 4BDZA 2FPEA 5CKHA 3OYEA 2DXCA 2EYWA 4AG1C 1TOVA 1K73C 2QEXQ 3CCVQ 1CSKA 2K7AA 2ZPIB 2E65A 1NJIU 5C6SA 3R6OA 3C94A 3META 1VOMA 3TREA 3HL8A 4NL2A 5KYXB 3CXCS 4JLGA 1YJ9Q 2CUDA 4HA8A 2OTJQ 3OYCA 2R58A 3KBGA 4QVCA 1B34A 1ZA1B 5IXBA 4ZTJA 1UGSB 4RCCA 3ER0A 4PJOE 3OW2A 4PFZA 4NS5A 2CZ0B 2V26A 3HP9A 1OQKA 2QYZA 5IH2A 1Q86R 3JCMc 2QQRA 3OSSC 4M78B 1YJ9T 2OTJT 1J3TA 3M4YA 2CYZB 5CR2A 1RAGB 1Z9QA 4Z88A 3JRZA 2ENMA 4JJCA 2EQKA 3CCUQ 4ZTFA 3G4ST 3HRTA 3CCVT 1SPKA 2ZPFB 2EVRA 5IHNA 1I5LA 2XMFA 3BDUA 2RMOA 3S3NA 4AFQC 2QTXA 2QA4T 4E7IA 1IXDA 2QDYB 1K8AU 2NUZA 2JS2A 1X6BA 1X2QA 4M77G 1KD1R 3LLRA 1FMWA 2KDSA 5LL6S 4MZMA 3FEOA 4FYYB 1OOTA 3MPUB 1H3HA 4ATOA 3S6WA 1WPYA 1HK9A 1LPLA 1KQ1A 3C0CA 4JUVA 1AOJA 4AMCA 4KH0B 4EMKC 3CCVA 4M75E 5HKCA 4JS4A 1VQLQ 2F69A 2KYMA 2HNIA 3CMEQ 3M54A 1JXMA 1QKWA 2KROA 5EG2A 5GAMf 2QA4A 4C8QE 2LZ6B 4MDXA 1OZ3A 4ME7A 3RKWA 1YI2A 2LX9A 1R0BG 4JLIA 1BI1A 4M7DD 2RQWA 3C4SA 3MCAB 4PJOG 4KULA 2CUBA 1ZSGA 2ROLA 1IO6A 4LUDA 3BW1A 2DXUA 3GNGA 2LJ1A 2AZSA 2B8AA 2QI2A 3NGPA 2XIDA 1IHWA 2KGTA 3EGXB 4F04B 4JRIA 4OMOA 3CCQQ 3FIFA 1MNEA 3PVLA 2D0QB 3E1SA 1YFNA 1YN8A 5KYUA 5C0MA 3EGUA 2JTMA 3JCMW 1YP5A 1OZ2A 5GMKi 3VYHB 3X20B 3J80E 4PLIA 1AZGB 3BE3A 1O9SA 2KXDA 4HVVA 2AT1B 1UUEA 4ZGDB 2GNCA 1PM3A 2EGCA 2MOXA 2GFUA 3NMZC 4J9HA 3OYJA 2AHJB 2KK4A 1FWZA 5D6YA 2LVMA 1QQJA 4C92E 3L2RA 5FU6B 2DVEA 2Y90A 3VS0A 4C5GA 1PSFA 5LJ3e 4XAXB 2SEMA 3VKIA 3EG2A 2I0NA 1Q81C 3EGDB 2H8HA 5A2QE 1WLPB 1AWWA 5GAMd 1M3CA 2E1HA 1M4ZA 1C0MA 2D1XA 4PJLA 4E7JA 1KFZA 4RCBA 2DF6A 2P84A 4P5NA 1NLPC 1WI7A 3HPWA 4DBHA 1H3ZA 4CC2A 1G2BA 2M16A 4MMLA 1VQ8A 3OS5A 4F7UE 3QJ6A 1SKUB 3LW5E 1OEBA 1NM7A 1KC8C 3V8LA 4C8QF 1PCXA 1YCSB 3PIOA 4E7SA 3ASKA 1E6HA 2EYZA 4E6RA 4KBMB 1U8RA 2BUDA 3CD6T 8ATCB 4M78E 4DBFA 2X3WD 4II1A 1TUDA 2DA9A 1UGPB 1X69A 4KH1B 1MUZA 3JSCA 4QKUA 4LNPA 1CKBA 3KFVA 4PLLA 2RM4A 1WNLA 3QUIA 2QTVA 4R0KA 2EWNA 2XI9A 5GMKm 3VUBA 3QZ9B 3FC3A 4F7UG 1QCFA 1KC8U 2EIFA 1BI2A 1WHHA 1YI2Q 2RHUA 1VQ5A 1VYVA 5CIUA 2QA4Q 1Q81U 4PJNA 2K2MA 1G3YA 2RI2A 2C0TA 3HRUA 3JB9D 3UWNA 1Q82C 3JB9I 1YHQT 3CCSA 3JB9F 4PKCC 4IIOA 2L3PA 1EIFA 4M77B 4J9FA 4C0FA 3AT1B 1FX7A 1K0XA 1QVPA 4HCZA 3RBBB 4DOVA 1WJRA 1G3WA 2A08A 1M2VA 4ORZA 1WXTA 1KQSP 2L5QA 4J6XA 3S3MA 1I1JA 4N0AA 1N8RC 1IZ6A 3CCET 2RQVA 1Q86U 2QEXA 9ATCB 1N9RA 3I56A 4KT0E 2E4HA 2RJEA 4RMOA 3HSBA 2LQNA 3M4GA 5GAN3 3CBOA 2V1RA 4Q5WA 3CC2T 1MV0B 5FW9A 4M75F 2CZ7B 3QDFA 3EFSA 2DBKA 2RB6A 3QO3A 3QJYA 4JJDA 4OMFB 4B6MA 3OA6A 5D6XA 4J9EA 2JT4A 2KT8A 4LD6A 1TUCA 3SWNC 3G71A 2M1HA 5CKBA 1Y7XA 4M75D 1JBMA 2VUBA 4BY6B 5GAOp 8AT1B 4J6WA 4OB0B 1R0CB 3A8HB 2LDMA 3CCSQ 2BZ8A 2VVKA 1YJNQ 2K2VA 1W1FA 1LCKA 1M27C 1V76A 4RTXA 3CCMQ 4XQ3A 2FL7A 1NEBA 2ABLA 3VRYA 2EQJA 2FB7A 3GP8A 2JNGA 4C0DB 1YJWA 1YITT 2JW4A 5CKDA 1T3LA 3G71T 5GAOr 1KQSA 3I56Q 2VXEA 2A0FB 1QMCA 2KI7A 2MMPA 5I2SA 3CCST 1ZSZA 4M77E 4F7UF 5KYUB 3OBWA 3LYIA 2CGHA 4E2FB 1VIEA 2HKQB 1SRMA 4LDUA 3SEMA 2AKKA 1KK7A 1N5ZA 1VQ4T 1UJ0A 2RHIA 4XU2A 1IB8A 4FSSA 1PRLC 4F17A 2Y4XA 1X6OA 3MEAA 1RAFB 3OYYA 4C92D 2DBMA 5CQYA 2DEUA 2NYSA 3VV0A 1RLPC 3FB9A 2KR3A 3JCMb 1LNXA 3EG9A 1N6AA 2O4XA 3I35A 3LGLA 4L59A 1KHIA 3M0QA 3CQTA 2OJ2A 3UT1A 3G4SQ 2YRCA 1N8RR 3NTIA 3MKDA 4OMMA 1NLOC 1X2KA 3M9QA 1M30A 5GANh 4AFZC 2RD1A 5IN1A 1Q82R 2XDPA 3MP6A 2EGAA 4C92F 1V29B 1VYTA 1MMNA 4B9XA 3G7ZA 2L0AA 1ARKA 5DLOA 1YJWQ 2LX7A 4OMNA 1ZA2B 5LJ5e 1PNJA 4XTZA 5GAOm 2RN8A 1GCQA 2QK0A 2WSFE 4FYXB 3H0FA 2HKNA 5I21A 2EQIA 1Y96A 3V8KA 1NYFA 4FSXA 5KYYB 1IREB 2GF7A 2JZ2A 4E7LA 1PRMC 1VQ9A 4D6WA 4MDWA 3QIIA 3OS1A 4M75G 3UDCA 1RAHB 2QGFB 4JRKA 1WHGA 1M1GA 2JTEA 3MJXA 3GPLA 2DRKA 1HD3A 4DBQA 3OS0A 4OMQA 5L23A 1ACMB 3JCMg 1IRXA 1H8KA 3NPFA 3S3OA 3KXTA 4IIMA 2HQHA 2G6FX 3HFOA 2JTFA 5GMKj 1VQ6Q 4KRTA 4LD9K 1FYNA 1QLYA 3M0UA 1M90U 1VQKQ 1NG2A 2J6KA 5IAYA 1RI9A 5KE2A 4GBQA 3JB9J 4Z02A 3CD6A 1FXXA 4C5IA 3GOXA 4DEXA 2RNAA 2KRSA 1JXOA 1EX4A 2NUTB 3CC2A 3HKSA 1ZUUA 2YRVA 1VQ4A 2ED1A 1UGRB 3CCUA 2YLCA 4F16A 3VYGA 2FEIA 3I55Q 2RQRA 3OMGA 1SF9A 1SEMA 1EFNA 2V1QA 2YUPA 4EIKA 1RL2A 1VQ5T 2CH4A 4J7FA 3M56A 3CCMA 1QVGP 1PWTA 4O5VA 4PJOD 3JB9G 1R8OB 1PKSA 1WJSA 4PNOA 2CSQA 3M5AA 1GRIA 4C5HA 1KIKA 2WSCE 3UA6A 3CPWS 2HEQA 2KSSA 3OY9A 3MEWA 2RF0A 5CO7A 4HVWA 2KAFA 1X01A 1Q82U 2CP0A 5HK0A 4ANJA 2D6FA 4C92C 1S72A 3A8LB 1I5OB 4N0AC 4M75B 3LH5A 3JCMP 1YIJA 1I07A 3EG3A 4LDVA 5KYWA 3LH0A 3CC7Q 3CCMT 1T0JA 3PVQA 1WXUA 2DERA 5GAOq 1ABOA 4J9IA 3RIRA 2VGMA 2PVDB 2FYKA 1WQ7A 4L6V5 2LJ3A 3ME9A 3OBYA 2JOYA 3CXCP 1TWBA 2XKOC 1CKAA 2EJFA 1GXIE 1K73R 4OVAA 1N27A 2MK5A 1VQ6T 5ECAA 1VA7A 1Q81R 2M9UA 1OULA 2V8KA 4ZGEB 4A4KA 2CREA 1WFWA 1M90R 2QXFA 3M0PA 5KYWB 4XK8E 5FU7C 4IUTA 1BCMA 2VXFA 3LWIA 3H9NA 2XHCA 4M77D 1YHQQ 1G83A 4M7AC 2E6ZA 1PD0A 4AT1B 3VS5A 2ED0A 1PSEA 3L2VA 2O9VA 2Z0WA 4M78F 1YIJQ 1BU1A 2ZPBB 2D9TA 2JJ9A 4XU0A 2OTLQ 5CKEA 4M7DC 1VQMA 3PIPA 1WHKA 1Q7YU 2A3LA 4A4EA 1ZSZC 2CT3A 3G6ET 4BB7A 3IQLA 4RTZA 4NL3A 3M58A 3CMAT 4RKUE 1AD5A 1IGUA 3T9NA 2YDLA 3VS3A 3A5ZB 4ZN3A 3E9GA 1K0SA 3QWXX 4DOWA 4OB3B 1OU9A 1HYOA 5GMKl 2KE9A 5LJ5f 1X75C 1YWPA 1JQQA 4M78A 4ESRA 2MIOA 2ATCB 3X26B 2GQIA 1VQOA 3NFCA 2DTOA 4RTVA 3VU3C 1M1FA 2YXYA 2RK2A 4EMGA 3TVTA 2KMTA 2EKHA 4FW2A 1LVKA 3CCRQ 2X4JA 3FLGA 5KH6A 3CMAA 2P0KA 1BB9A 2RHXA 2KEAA 1VQPT 4IUVA 2DVJA 2PUKB 3NTHA 4DQ2A 4FT4A 4YTLA 5GMKh 5GAOn 3VJPA 2OX7A 3WVDB 3TU4K 4C92G 2J6FA 2IPOB 2OAUA 1B3QA 3EG0A 1VQOT 1K9AA 1ZQ1A 2DYBA 5GJVB 3UATA 4QT7A 1WA7A 3JCMf 1TS9A 2K79A 3KUFA 1AZEA 4IUPA 1M2OA 2DZCA 3M53A 3SDZA 4WTOB 1A0NB 1Y07A 3JB9H 4ZGJB 4M7DF 4M78D 4EDUA 4C0ZA 4CC4B 3EH2A 4F7UA 3THKA 1N9SA 3EGXA 2MCNA 1UG1A 3HHTB 4EMKA 2X9HA 1ZSZB 3QXEB 3CBMA 2PVOB 4PJOB 2O4XB 3JCMX 4M7AE 2I2LA 2EQUA 4A54A 4JZ4A 4XU1A 2DILA 5IT9E 2YUNA 1Q86C 2QQ9A 1DJ7B 3EFOA 2YSQA 4M7AB 4PL6A 1R77A 1E7OA 2QQAA 3LX7A 1KD1U 1TTHB 1AT1B 3EHQA 3CEYA 4FW1A 3V7RA 2LCLA 2QGGA 2P4TA 5I11A 2ROTA 1QWFA 4RTWA 2RHYA 3M59A 1K9MU 3UA7A 3SHWA 2ZPHB 2JMAA 3TSZA 2X4WA 4C0GA 2LT4A 4KUIA 3GIBA 2DXTA 4J9DA 3RDVA 5A0LA 1M8MA 2EYXA 5DY9A 2RJFA 4C8QC 4BI8B 4PJJA 2E3HA 4AG2C 1MMAA 1U5SA 2E5QA 3OYDA 4B9WA 3QHSA 3H6ZA 3ZBDA 1UGQB 2KQWA 3M0SA 2DMOA 1W6XA 3CMAQ 1OYXA 4OGEA 3CCJQ 2HCKA 2BZXA 3TEEA 1S72T 4PJOF 1OU8A 1TG0A 3MEUA 4J7IA 1AWOA 3OQ5A 5GAN7 2BTTA 4GY5A 2DKGA 3RUXA 4IKFA 1UDLA 3O8VA 5GAMg 1WZOA 3VUZA 2EW3A 4F14A 4HT8A 2RJDA 2KT1A 4QVZA 1VQ8T 4OF1A 5D6WA 4D8KA 1VQNA 1JJ2P 2M02A 5GAMj 2DYIA 2XICA 1LOJA 3CXCA 1JRIA 3CC4A 2HDAA 2PU9B 2MWPA 1Q7YR 4PJOC 4C0DC 1XOVA 4WF2A 2A36A 2GTJA 4PJOA 2K9GA 2PVGB 4LXCA 3TSWA 2VGNA 5GAOl 3H41A 2K5IA 5GANf 1WX6A 2KXCA 4CC3A 2MAMA 4F7UB 2EYQA 1VQMQ 1QVGS 3M57A 1TU0B 2D0NA 3ZL7C 1RABB 2F2XA 3G6EQ 1OV3A 2EFIA 1G8XA 4E47A 2FVUA 4BY6C 3CD6Q 2J7IA 5GMKe 3RERA 3PMTA 1X6GA 1I4K1 4LDXA 3P8BB 3OYIA 3P8DA 1U1SA 3Q1JA 2XG8D 4HXJA 3PE0A 1SHGA 2DL3A 1T0HA 3ZEHA 2O01E 5LJ3f 2CZ1B 4CC7A 1YJ9A 2OTJA 1YCYA 4Z89A 1AWXA 1VQOQ 4X9DA 3U23A 5A0DA 3PMIA 3N5BB 2BE9B 2HSPA 2DK3A 4XTWA 2P0PA 1M3BA 1Q7YC 3OYKA 1VQLT 2DIGA 1Y96B 2L8DA 2JM8A 2GQVA 4C8QG 2QG9B 1T3SA 3CPWP 1B07A 3MP1A 2C0OA 3MP8A 5LJ3d 4BD3A 2DTHA 4EMHA 1BK2A 2DZ9A 2DRMA 1IHVA 4BI3A 2HD0A 4E7ZA 1RAAB 2LQKA 2HBWA 5GANj 5KCHA 2VASA 2OTLT 1M2VB 4LDWA 3OYMA 3OW2P 2IG0A 1NYGA 5FROA 3EHRA 4LE9A 4M77C 2CKKA 4O6JA 4MMKA 4JDSA 2RJCA 3PFSA 3CC4T 1OI1A 1GBRA 4MZPA 1OPLA 1SSFA 4V2SA 1G5VA 2RK1A 3PTAA 2R5MA 5FLXE 3CCLA 1MHNA 2R5AA 1GFCA 3A8MB 3I9QA 4Y92A 1X43A 2CP3A 2O88A 1AEYA 1TXQA 2QQBA 2DO3A 3L2WA 1SRLA 2XK0A 4OGCA 3V7SA 4M7DG 1VQ7Q 3MEVA 2Y4YA 4XTUA 2HZYA 2PQWA 3OYFA 2QEXT 2X35A 1S72Q 2WSEE 5HCKA 5GAN2 4WCIA 1NJIC 1WQWA 3L2UA 4J9BA 4FM4B 2A28A 3OB9A 4OMLA 1K8AR 1TUGB 1SHFA 2E5KA 2LTOA 4BUGA 3HTRA 2LRQA 4FIBA 2NUTA 3G1JA 4A63B 5FRMA 1RAIB 1VQNT 1VQLA 2RO0A 1QCNA 4X9CA 4Y28E 3AHUA 3X28B 2KRMA 3TQ7P 3I55A 3INZA 4BE2A 1YWOA 2ZAEA 4M7AG 4IURA 3EG1A 2YUOA 3G71Q 1TSFA 1P92A 3CC2Q 4RTUA 3C95A 1WXBA 3OW2S 2MWOA
chains in the Genus database with same CATH topology
1MUZA 1AD5A 3VS3A 2YDLA 4LNPA 1UHCA 1CKBA 2DL4A 1GCPA 4OMPA 1FMKA 3KFVA 1K0SA 1WIEA 3QWXX 4R0KA 5FWBA 2RQUA 1QCFA 2KE9A 3VS2A 1UTIA 1YWPA 1JQQA 3VRZA 5I22A 1GFDA 3O5ZA 4ESRA 2MIOA 1VYVA 2DNUA 4JJBA 4RTYA 2GQIA 2W0ZA 3A98A 2K2MA 2F2WA 2A37A 3RNJA 4RTVA 1QWEA 2C0TA 2M51A 2PZ1A 2ESWA 4HCKA 1YNZA 3TVTA 2EKHA 3REBB 4IIOA 2L3PA 2GBQA 3H0IA 4J9FA 1GCQC 1BB9A 2KEAA 3M0RA 2DVJA 1K0XA 2CH4W 2PNIA 2FRYA 1UECA 3VS6A 2FG0A 1Z9ZA 3RBBB 2A08A 3M0TA 1SSHA 2EBPA 2NWMA 1UGVA 4ORZA 1WXTA 1JEGA 2J6FA 2K6DA 2KYBA 4RTTA 1B3QA 4DEYA 2O2OA 3EG0A 1I1JA 2LMJA 1UHFA 1K9AA 2AK5A 2RQVA 4JPBW 1PKTA 1ZBJA 2DYBA 5GJVB 4QT7A 3UATA 1WA7A 1S1NA 3QWYA 2DE0X 2K79A 1AZEA 2LQNA 2F2VA 1A0NB 4AFSC 2V1RA 2VWFA 1MV0B 5FW9A 4CC4B 2EPDA 2LJ0A 3THKA 2DBKA 4JJDA 1UG1A 2MCNA 3R6NA 5IHIA 2JMCA 2DL7A 2DL8A 4J9EA 1KSWA 1VYUA 2JT4A 4M4ZA 2KT8A 2LCSA 3VS1A 2LP5A 2IIMA 1TUCA 2FO0A 2AKLA 2P4RA 3JV3A 4JZ4A 2O9SA 2DILA 2D8HA 1ABQA 3I5RA 3H0HA 1RLQC 2LQWA 2YUNA 2BZ8A 2VVKA 1W1FA 1LCKA 2YSQA 1M27C 2YUQA 1E7OA 4J9GA 4RTXA 2GGRA 2J06A 4J9CA 3EHQA 2OAWA 1I0CA 1NEBA 2ABLA 1AWJA 1M3AA 2L2PA 5I11A 2ROTA 3VRYA 1V1CA 1K76A 1QWFA 4RTWA 2DL5A 5IXFA 2L3QA 3UA7A 1UE9A 3SHWA 1NEGA 2L3SA 2JMAA 3TSZA 3VS4A 2JW4A 2W10A 1T3LA 5IHKA 2KRNA 4J9DA 1E6GA 1MV3A 2FPFA 2C0IA 5EC7A 1M8MA 2EYXA 4K11A 1ZUYA 4AG2C 1SRMA 3REAB 2AZVA 2AKKA 3SEMA 2JM9A 1KJWA 3NHNA 1N5ZA 1U5SA 2DX1A 1UJ0A 4FSSA 1HJDA 2EYYA 1JO8A 1PRLC 4F17A 3VS7A 1RUWA 4LUEA 2LNHB 3M0SA 3FJ5A 2BZYA 2CSIA 2DMOA 1W6XA 2DBMA 2CDTA 3ULRB 2HCKA 2BZXA 2DJQA 1RLPC 2KR3A 1TG0A 2J05A 2RPNA 1AWOA 1K4US 2FPEA 3I35A 2BTTA 2EYWA 1GL5A 4AG1C 3M0QA 4RUGA 1UDLA 3CQTA 2OJ2A 2GTOA 2RQTA 4OMMA 1CSKA 2EW3A 4F14A 1NLOC 1PHTA 1X2KA 2K7AA 2KT1A 1M30A 4AFZC 4D8KA 2FPDA 2EGAA 2J6OA 3UF4A 2CUDA 1VYTA 2O31A 2HDAA 2YT6A 5IXBA 2L0AA 1ARKA 1XOVA 2LX7A 4OMNA 2A36A 2GTJA 1PNJA 5IH2A 2K9GA 1UFFA 3TSWA 2RN8A 2KNBB 1GCQA 1J3TA 3H41A 1Z9QA 3H0FA 4Z88A 2EQIA 2KBTA 1NYFA 2ENMA 2B86A 1WX6A 2KXCA 4JJCA 4CC3A 1PRMC 1SPKA 1QKXA 2D0NA 2EVRA 3ZL7C 2F2XA 2JTEA 1OV3A 5IHNA 2DRKA 2XMFA 1HD3A 2RMOA 4OMQA 4AFQC 4AFUC 2J7IA 5L23A 1X6GA 1UJYA 1H8KA 1ZUKA 3NPFA 1Y57A 2NUZA 2JS2A 4IIMA 1X6BA 3PE0A 4HXJA 1SHGA 4GLMA 2G6FX 1X2QA 2DL3A 1T0HA 1GBQA 4KRTA 1FYNA 1QLYA 1OOTA 3M0UA 2DM1A 4CC7A 1H3HA 1NG2A 2J6KA 1RI9A 4Z89A 4GBQA 1AWXA 4JZ3A 3C0CA 1AOJA 5FWCA 3U23A 4DEXA 2RNAA 2KRSA 1JXOA 2HSPA 1ZUUA 1M3BA 2ED1A 2KYMA 4F16A 1JXMA 2FEIA 2JM8A 1QKWA 2KROA 2RQRA 2LZ6B 1T3SA 1SEMA 1H92A 1B07A 1EFNA 2V1QA 2YUPA 4EIKA 4D8DA 2C0OA 2RQWA 2CH4A 1BK2A 1PWTA 2DRMA 5GJWB 2D8JA 2CUBA 1ZSGA 2ROLA 1IO6A 4LUDA 1PKSA 2HBWA 2LJ1A 2AZSA 2CSQA 1GRIA 1KIKA 3NGPA 3UA6A 2HEQA 2KGTA 1NYGA 4X1VA 4ZNXA 3EHRA 2RF0A 4OMOA 4LE9A 4HVWA 2DLPA 1U3OA 2X3XD 3PVLA 1ZLMA 1YN8A 3LH5A 3EGUA 1YP5A 2QDLA 1GBRA 1I07A 3EG3A 1OPLA 3GBQA 4Z8AA 1AZGB 1T0JA 4HVVA 2KXDA 1WXUA 3PVQA 2M0YA 1ABOA 4J9IA 1HSQA 1UUEA 2VKNA 4HVUA 2GNCA 2MOXA 2EGCA 2LJ3A 3NMZC 1GFCA 4J9HA 3I9QA 1CKAA 4Y92A 1X43A 2O88A 1AEYA 1SRLA 1ZX6A 3VS0A 3I5SA 5ECAA 1VA7A 2SEMA 2JS0A 2PTKA 1WDXA 3EG2A 2I0NA 2SRCA 2H8HA 2CREA 1WFWA 1WLPB 3M0PA 1AWWA 5HCKA 1W70A 4WCIA 1M3CA 1U06A 1BBZA 4J9BA 2D1XA 2A28A 1KFZA 2EGEA 4OMLA 2DF6A 1SHFA 2E5KA 2JXBA 1Y0MA 1NLPC 2ECZA 1WI7A 1K1ZA 1G83A 4CC2A 1G2BA 4A63B 3VS5A 2ED0A 2K3BA 2O9VA 1JU5C 1OEBA 1NM7A 1BU1A 1X27A 1YCSB 1E6HA 2EYZA 1AVZC 4E6RA 2KRMA 1WYXA 1YWOA 1OPKA 2FRWA 2CT4A 2OI3A 3EG1A 2YUOA 2CT3A 2X3WD 3IQLA 1TUDA 4RTZA 4RTUA 1WXBA 2DA9A 4LN2A 1X69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUZ A;  1AD5 A;  3VS3 A;  2YDL A;  4LNP A;  1UHC A;  1CKB A;  2DL4 A;  1GCP A;  4OMP A;  1FMK A;  3KFV A;  1K0S A;  1WIE A;  3QWX X;  4R0K A;  5FWB A;  2RQU A;  1QCF A;  2KE9 A;  3VS2 A;  1UTI A;  1YWP A;  1JQQ A;  3VRZ A;  5I22 A;  1GFD A;  3O5Z A;  4ESR A;  2MIO A;  1VYV A;  2DNU A;  4JJB A;  4RTY A;  2GQI A;  2W0Z A;  3A98 A;  2K2M A;  2F2W A;  2A37 A;  3RNJ A;  4RTV A;  1QWE A;  2C0T A;  2M51 A;  2PZ1 A;  2ESW A;  4HCK A;  1YNZ A;  3TVT A;  2EKH A;  3REB B;  4IIO A;  2L3P A;  2GBQ A;  3H0I A;  4J9F A;  1GCQ C;  1BB9 A;  2KEA A;  3M0R A;  2DVJ A;  1K0X A;  2CH4 W;  2PNI A;  2FRY A;  1UEC A;  3VS6 A;  2FG0 A;  1Z9Z A;  3RBB B;  2A08 A;  3M0T A;  1SSH A;  2EBP A;  2NWM A;  1UGV A;  4ORZ A;  1WXT A;  1JEG A;  2J6F A;  2K6D A;  2KYB A;  4RTT A;  1B3Q A;  4DEY A;  2O2O A;  3EG0 A;  1I1J A;  2LMJ A;  1UHF A;  1K9A A;  2AK5 A;  2RQV A;  4JPB W;  1PKT A;  1ZBJ A;  2DYB A;  5GJV B;  4QT7 A;  3UAT A;  1WA7 A;  1S1N A;  3QWY A;  2DE0 X;  2K79 A;  1AZE A;  2LQN A;  2F2V A;  1A0N B;  4AFS C;  2V1R A;  2VWF A;  1MV0 B;  5FW9 A;  4CC4 B;  2EPD A;  2LJ0 A;  3THK A;  2DBK A;  4JJD A;  1UG1 A;  2MCN A;  3R6N A;  5IHI A;  2JMC A;  2DL7 A;  2DL8 A;  4J9E A;  1KSW A;  1VYU A;  2JT4 A;  4M4Z A;  2KT8 A;  2LCS A;  3VS1 A;  2LP5 A;  2IIM A;  1TUC A;  2FO0 A;  2AKL A;  2P4R A;  3JV3 A;  4JZ4 A;  2O9S A;  2DIL A;  2D8H A;  1ABQ A;  3I5R A;  3H0H A;  1RLQ C;  2LQW A;  2YUN A;  2BZ8 A;  2VVK A;  1W1F A;  1LCK A;  2YSQ A;  1M27 C;  2YUQ A;  1E7O A;  4J9G A;  4RTX A;  2GGR A;  2J06 A;  4J9C A;  3EHQ A;  2OAW A;  1I0C A;  1NEB A;  2ABL A;  1AWJ A;  1M3A A;  2L2P A;  5I11 A;  2ROT A;  3VRY A;  1V1C A;  1K76 A;  1QWF A;  4RTW A;  2DL5 A;  5IXF A;  2L3Q A;  3UA7 A;  1UE9 A;  3SHW A;  1NEG A;  2L3S A;  2JMA A;  3TSZ A;  3VS4 A;  2JW4 A;  2W10 A;  1T3L A;  5IHK A;  2KRN A;  4J9D A;  1E6G A;  1MV3 A;  2FPF A;  2C0I A;  5EC7 A;  1M8M A;  2EYX A;  4K11 A;  1ZUY A;  4AG2 C;  1SRM A;  3REA B;  2AZV A;  2AKK A;  3SEM A;  2JM9 A;  1KJW A;  3NHN A;  1N5Z A;  1U5S A;  2DX1 A;  1UJ0 A;  4FSS A;  1HJD A;  2EYY A;  1JO8 A;  1PRL C;  4F17 A;  3VS7 A;  1RUW A;  4LUE A;  2LNH B;  3M0S A;  3FJ5 A;  2BZY A;  2CSI A;  2DMO A;  1W6X A;  2DBM A;  2CDT A;  3ULR B;  2HCK A;  2BZX A;  2DJQ A;  1RLP C;  2KR3 A;  1TG0 A;  2J05 A;  2RPN A;  1AWO A;  1K4U S;  2FPE A;  3I35 A;  2BTT A;  2EYW A;  1GL5 A;  4AG1 C;  3M0Q A;  4RUG A;  1UDL A;  3CQT A;  2OJ2 A;  2GTO A;  2RQT A;  4OMM A;  1CSK A;  2EW3 A;  4F14 A;  1NLO C;  1PHT A;  1X2K A;  2K7A A;  2KT1 A;  1M30 A;  4AFZ C;  4D8K A;  2FPD A;  2EGA A;  2J6O A;  3UF4 A;  2CUD A;  1VYT A;  2O31 A;  2HDA A;  2YT6 A;  5IXB A;  2L0A A;  1ARK A;  1XOV A;  2LX7 A;  4OMN A;  2A36 A;  2GTJ A;  1PNJ A;  5IH2 A;  2K9G A;  1UFF A;  3TSW A;  2RN8 A;  2KNB B;  1GCQ A;  1J3T A;  3H41 A;  1Z9Q A;  3H0F A;  4Z88 A;  2EQI A;  2KBT A;  1NYF A;  2ENM A;  2B86 A;  1WX6 A;  2KXC A;  4JJC A;  4CC3 A;  1PRM C;  1SPK A;  1QKX A;  2D0N A;  2EVR A;  3ZL7 C;  2F2X A;  2JTE A;  1OV3 A;  5IHN A;  2DRK A;  2XMF A;  1HD3 A;  2RMO A;  4OMQ A;  4AFQ C;  4AFU C;  2J7I A;  5L23 A;  1X6G A;  1UJY A;  1H8K A;  1ZUK A;  3NPF A;  1Y57 A;  2NUZ A;  2JS2 A;  4IIM A;  1X6B A;  3PE0 A;  4HXJ A;  1SHG A;  4GLM A;  2G6F X;  1X2Q A;  2DL3 A;  1T0H A;  1GBQ A;  4KRT A;  1FYN A;  1QLY A;  1OOT A;  3M0U A;  2DM1 A;  4CC7 A;  1H3H A;  1NG2 A;  2J6K A;  1RI9 A;  4Z89 A;  4GBQ A;  1AWX A;  4JZ3 A;  3C0C A;  1AOJ A;  5FWC A;  3U23 A;  4DEX A;  2RNA A;  2KRS A;  1JXO A;  2HSP A;  1ZUU A;  1M3B A;  2ED1 A;  2KYM A;  4F16 A;  1JXM A;  2FEI A;  2JM8 A;  1QKW A;  2KRO A;  2RQR A;  2LZ6 B;  1T3S A;  1SEM A;  1H92 A;  1B07 A;  1EFN A;  2V1Q A;  2YUP A;  4EIK A;  4D8D A;  2C0O A;  2RQW A;  2CH4 A;  1BK2 A;  1PWT A;  2DRM A;  5GJW B;  2D8J A;  2CUB A;  1ZSG A;  2ROL A;  1IO6 A;  4LUD A;  1PKS A;  2HBW A;  2LJ1 A;  2AZS A;  2CSQ A;  1GRI A;  1KIK A;  3NGP A;  3UA6 A;  2HEQ A;  2KGT A;  1NYG A;  4X1V A;  4ZNX A;  3EHR A;  2RF0 A;  4OMO A;  4LE9 A;  4HVW A;  2DLP A;  1U3O A;  2X3X D;  3PVL A;  1ZLM A;  1YN8 A;  3LH5 A;  3EGU A;  1YP5 A;  2QDL A;  1GBR A;  1I07 A;  3EG3 A;  1OPL A;  3GBQ A;  4Z8A A;  1AZG B;  1T0J A;  4HVV A;  2KXD A;  1WXU A;  3PVQ A;  2M0Y A;  1ABO A;  4J9I A;  1HSQ A;  1UUE A;  2VKN A;  4HVU A;  2GNC A;  2MOX A;  2EGC A;  2LJ3 A;  3NMZ C;  1GFC A;  4J9H A;  3I9Q A;  1CKA A;  4Y92 A;  1X43 A;  2O88 A;  1AEY A;  1SRL A;  1ZX6 A;  3VS0 A;  3I5S A;  5ECA A;  1VA7 A;  2SEM A;  2JS0 A;  2PTK A;  1WDX A;  3EG2 A;  2I0N A;  2SRC A;  2H8H A;  2CRE A;  1WFW A;  1WLP B;  3M0P A;  1AWW A;  5HCK A;  1W70 A;  4WCI A;  1M3C A;  1U06 A;  1BBZ A;  4J9B A;  2D1X A;  2A28 A;  1KFZ A;  2EGE A;  4OML A;  2DF6 A;  1SHF A;  2E5K A;  2JXB A;  1Y0M A;  1NLP C;  2ECZ A;  1WI7 A;  1K1Z A;  1G83 A;  4CC2 A;  1G2B A;  4A63 B;  3VS5 A;  2ED0 A;  2K3B A;  2O9V A;  1JU5 C;  1OEB A;  1NM7 A;  1BU1 A;  1X27 A;  1YCS B;  1E6H A;  2EYZ A;  1AVZ C;  4E6R A;  2KRM A;  1WYX A;  1YWO A;  1OPK A;  2FRW A;  2CT4 A;  2OI3 A;  3EG1 A;  2YUO A;  2CT3 A;  2X3W D;  3IQL A;  1TUD A;  4RTZ A;  4RTU A;  1WXB A;  2DA9 A;  4LN2 A;  1X69 A; 
#chains in the Genus database with same CATH topology
 3JCM V;  5KCO A;  1UHC A;  3A8O B;  2C06 A;  3CCU T;  4GLK A;  1WIE A;  1XQH A;  2RQU A;  4EPC A;  1KQ2 A;  1VQ4 Q;  1UTI A;  5CK9 A;  3CCR A;  3GLX A;  4RTY A;  3CCE A;  2W0Z A;  3OYB A;  3QYH B;  2F2W A;  2LNV A;  1QWE A;  3F70 A;  2PZ1 A;  2CP7 A;  2ESW A;  4A4H A;  1BKB A;  4A53 A;  4HCK A;  3DB4 A;  4C92 B;  4JJN K;  1KD1 C;  3PT9 A;  4NOY A;  1OX9 A;  4OB1 B;  4J6Y A;  1BIA A;  5AYF A;  2L3R A;  1NE8 A;  3QBY A;  1GCQ C;  2VC8 A;  5D7U A;  2GCX A;  2DJZ A;  3M0R A;  3C12 A;  2HAX A;  2CH4 W;  1VUB A;  2FRY A;  3QYG B;  2VV5 A;  4PJM A;  1MMG A;  1Z9Z A;  1SSH A;  2EBP A;  2NWM A;  2COZ A;  2DFU A;  2K6D A;  2RA2 A;  2EQM A;  4DEY A;  2CS7 A;  2O2O A;  2LT1 A;  1K8A C;  3FRN A;  2AK5 A;  1WGS A;  1PKT A;  3QWY A;  5KE3 A;  1YBY A;  3L1A A;  2FHD A;  2H3J A;  1W4S A;  2XDD A;  2DE0 X;  1VIF A;  2EJG A;  1WHJ A;  2KY9 A;  2RHZ A;  3EAE A;  4TVR A;  1BI3 A;  2F2V A;  3MO8 A;  4EMK B;  2NUP A;  4C8Q D;  2RH2 A;  2F5K A;  1VQ6 A;  3SB2 A;  2K4Y A;  2XU8 A;  4QW2 A;  4XTY A;  1JB0 E;  2X51 A;  3WVE B;  4R56 A;  5IHI A;  1I8F A;  3EFO B;  4PFP A;  3EFR A;  2LC4 A;  2JMC A;  4IUQ A;  4L5G A;  3CCJ T;  2HBP A;  1SG5 A;  2QQS A;  4KGZ B;  3VS1 A;  3DKM A;  3CC4 Q;  1YIT A;  1NBE B;  1B7T A;  4VUB A;  1W2B S;  4FU6 A;  3RKY A;  1QW1 A;  2O9S A;  2D8H A;  1ABQ A;  3H0H A;  1RLQ C;  1G3S A;  3CCL T;  4M77 F;  3MHX A;  3CCQ T;  2NLU A;  4J9G A;  4HCB A;  4J9C A;  2OAW A;  5LJ3 j;  1D1A A;  5J26 A;  2HL5 C;  1M3A A;  2L2P A;  1PG5 B;  1V1C A;  3WXM B;  5GAN d;  2DD4 A;  1VQM T;  5IXF A;  2L3Q A;  3CCR T;  1UE9 A;  3EH1 A;  4BI4 A;  4C92 A;  3VS4 A;  1JJ2 A;  2W10 A;  5IHK A;  4HCC A;  1E6G A;  1MV3 A;  2FPF A;  2KVQ G;  4QQD A;  5EC7 A;  6AT1 B;  4BAC A;  1M1K U;  4K11 A;  3CBP A;  3SWN B;  4Y91 A;  2QAS A;  1ZHI A;  3L2Z A;  2JM9 A;  2QAZ A;  3HFN A;  2DEQ A;  2DX1 A;  1XJW B;  3DB3 A;  4A4G A;  2DPP B;  3VS7 A;  1RUW A;  3DLM A;  2LNH B;  2BZY A;  2CSI A;  3CPW A;  5J39 A;  2CDT A;  3SWN A;  3L2Q A;  3ULR B;  1YJW T;  1TH7 A;  4J5Y A;  3BY7 A;  1K4U S;  1C6V X;  1VQN Q;  3I56 T;  5HK3 A;  1XTD A;  1GL5 A;  4RUG A;  5DM7 R;  5KYX A;  3RR6 A;  5LJ5 j;  2GTO A;  2RQT A;  1VQ5 Q;  3OS2 A;  4E7K A;  1PHT A;  1VQ9 T;  1M1K C;  7AT1 B;  4JRQ A;  4DA4 A;  2YRD A;  4JRP A;  2FPD A;  2DTI A;  2J6O A;  2K5L A;  3UF4 A;  1VQK A;  4ELZ C;  2O31 A;  2YT6 A;  3CCJ A;  5GAM e;  1D0Z A;  3E2U A;  4RG2 A;  1W2B P;  1MGQ A;  3PGG A;  2DET A;  1RAD B;  5KYN A;  1RI0 A;  1D3B A;  2ZZD A;  1UFF A;  2EKO A;  4CI0 C;  2KNB B;  1WHM A;  4M7D B;  4PK4 A;  2E41 A;  1MMD A;  2RI3 A;  3OMC A;  1VQP Q;  2EAY A;  3JCM e;  3X25 B;  2KBT A;  1BCO A;  2B86 A;  2G3R A;  1H64 1;  4BE0 A;  5LJ5 g;  1YJN A;  1G3T A;  1QKX A;  3X24 B;  2R57 A;  3GF5 A;  1ZBX A;  2AIR B;  3A1P A;  3D7S B;  5CCA A;  2DIQ A;  2FZG B;  1M9S A;  2ZPE B;  4AFU C;  2CP6 A;  2E6N A;  1Q95 G;  4FYV B;  4FYW B;  3CPF A;  1UJY A;  2WAC A;  1ZUK A;  1Y57 A;  1QP2 A;  4GLM A;  2JUF A;  4DBR A;  1GBQ A;  4QVD A;  4BDY A;  1UEB A;  2DM1 A;  2F5T X;  2XDB A;  3I55 T;  3SD4 A;  1IGQ A;  2E70 A;  2ZCF B;  3OYN A;  4HKE A;  1HXD A;  3UPU A;  3CCE Q;  4JZ3 A;  5FWC A;  5GAN 4;  1KG1 A;  2HL3 A;  5DLQ E;  1QP3 A;  2K57 A;  5HY6 A;  2L89 A;  1PC0 A;  2MPX C;  1YIJ T;  1H92 A;  1LJO A;  4D8D A;  2X4Y A;  1KHC A;  3JCM d;  5I2M A;  1D09 B;  5GJW B;  3E19 A;  2D8J A;  2MF2 A;  3BFM A;  3CCL Q;  1F1B B;  1K9M R;  4M75 C;  1W2B A;  4X1V A;  2MI6 A;  4ZNX A;  5GAN 6;  5FU6 C;  2ZPG B;  2DLP A;  1U3O A;  3CCQ A;  4M7A A;  2X3X D;  4C8Q B;  2H3E B;  5A0G A;  1ZLM A;  1VQK T;  5CVI A;  1QVF P;  4FT2 A;  2QDL A;  5FRN A;  4CRI A;  1RAE B;  3J7A F;  1KQS S;  2K5F A;  3GBQ A;  1BYM A;  4Z8A A;  5LJ5 h;  1M5Q 1;  3QDR B;  2M0Y A;  2CP2 A;  2ZGW A;  1K73 U;  4BE1 A;  2K3Y A;  1PD1 A;  1HSQ A;  2VKN A;  4HVU A;  2VB6 A;  3QPH A;  3RES A;  1NPR A;  2YWW A;  3CC7 T;  3OYA A;  3DLL A;  4LDY A;  3A8G B;  1ZX6 A;  1VQ7 T;  3I5S A;  3JCM h;  4PFO A;  3JCM J;  3FDR A;  2JS0 A;  2PTK A;  2X4X A;  3BDL A;  1VQ9 Q;  5CAI A;  1WDX A;  5CKF A;  1VQ8 Q;  2SRC A;  2DD5 A;  1M1K R;  4R55 A;  1D0Y A;  1W70 A;  1U06 A;  1BBZ A;  4N4G A;  3OSV A;  5LJ3 g;  4QQG A;  2EGE A;  2COW A;  3RKX A;  2JXB A;  1Y0M A;  2ECZ A;  2YLB A;  4C8Q A;  2JN0 A;  2HMA A;  1K1Z A;  4FL6 A;  5GAN e;  2IVW A;  2JVV A;  3CC7 A;  1M8V A;  2K3B A;  1JU5 C;  1VQ7 A;  3SFM A;  1X27 A;  3P8H A;  2P0Q A;  3EG9 B;  3M55 A;  4HT9 A;  2LQ8 A;  3L42 A;  2HQX A;  1AVZ C;  1WYX A;  3PNW C;  2EJ9 A;  1OPK A;  2FRW A;  5GAN g;  1FMV A;  2CT4 A;  3CME A;  2OI3 A;  1O75 A;  3OYG A;  4UC4 A;  2CZ6 B;  2BIV A;  3LWH A;  2GFA A;  4LN2 A;  3JAM E;  4XU3 A;  2PUO B;  2DL4 A;  1QVF A;  1BI0 A;  1GCP A;  4OMP A;  1FMK A;  4FCY A;  2FZK B;  4KGX B;  5FWB A;  1RAC B;  2V8I A;  3VS2 A;  1YJN T;  3VRZ A;  5I22 A;  1GFD A;  3O5Z A;  1QVF S;  2DNU A;  4JJB A;  5LJ5 d;  3A98 A;  2FZC B;  3RNJ A;  2A37 A;  2COY A;  4KUD K;  4MZT A;  5AT1 B;  2M51 A;  1MND A;  1YNZ A;  1YIT Q;  3REB B;  4N4I A;  3LGF A;  3J81 E;  2GBQ A;  3H0I A;  3RMQ A;  4M7A F;  2K3X A;  4JS5 A;  5J3B A;  2PNI A;  4J83 A;  4M7D E;  1UEC A;  3VS6 A;  2VYT A;  3HRS A;  5KYY A;  2FG0 A;  1WHL A;  3M0T A;  1QCO A;  1UGV A;  3URG A;  1JEG A;  3OYH A;  2KYB A;  4RTT A;  5GAM h;  5CQX A;  2LCC A;  1D1C A;  3H8Z A;  2LMJ A;  1UHF A;  4J8O A;  4JPB W;  1ZBJ A;  1D3B B;  2E12 A;  1S1N A;  2XD0 A;  1WJQ A;  3E9F A;  4OB2 B;  2YHT A;  3OYL A;  1M90 C;  1XNI A;  3RMS A;  3QG1 A;  4AFS C;  1JJ2 S;  2BE7 D;  3FJP A;  4A4F A;  2VWF A;  3QSU A;  4QQ6 A;  2M0O A;  2F1L A;  2EPD A;  2LJ0 A;  1NJI R;  1D1B A;  2DXB A;  4XTV A;  1KC8 R;  4OP0 A;  3R6N A;  4ZN1 A;  4M78 C;  3GNF B;  2HSE B;  1N8R U;  2DAQ A;  1NZ9 A;  2DL7 A;  5GAN 5;  2DL8 A;  1YI2 T;  4M78 G;  5FU7 B;  1KSW A;  1VYU A;  4M4Z A;  2LCS A;  2LP5 A;  4ELY C;  2IIM A;  1Y71 A;  2FO0 A;  1OX8 A;  1I81 A;  4N4H A;  2AKL A;  2CP5 A;  2P4R A;  3JV3 A;  2E10 A;  3V8J A;  2OTL A;  3CME T;  3I5R A;  3G6E A;  4E7H A;  2LQW A;  2MYS A;  3G4S A;  2V8J A;  2YUQ A;  4XTX A;  5GAN 8;  3ZFJ A;  2GGR A;  2J06 A;  1I0C A;  1AWJ A;  4RG8 A;  5M9O A;  1K76 A;  2DL5 A;  4M77 A;  1D0X A;  2BKD N;  1BIB A;  1NPP A;  4IUU A;  1K9M C;  1NEG A;  4C5E A;  2L3S A;  1UB4 A;  3V7C A;  2KRN A;  2C0I A;  3EGD A;  4M7A D;  1B34 B;  3JCM Q;  2E64 A;  4M75 A;  2HQE A;  1ZUY A;  3REA B;  5L8R E;  2AZV A;  3NTK A;  1C1A A;  1KJW A;  3NHN A;  1VQP A;  3QZ5 B;  4KGV B;  2NUP B;  1EZZ B;  1HJD A;  5LJ3 h;  2EYY A;  1JO8 A;  1U1T A;  2A7Y A;  3TCJ A;  4LUE A;  1AHJ B;  3FJ5 A;  3QKJ A;  4M7D A;  1YHQ A;  1QVG A;  4X34 A;  2DJQ A;  2E3I A;  2RI5 A;  2J05 A;  2RPN A;  4BDZ A;  2FPE A;  5CKH A;  3OYE A;  2DXC A;  2EYW A;  4AG1 C;  1TOV A;  1K73 C;  2QEX Q;  3CCV Q;  1CSK A;  2K7A A;  2ZPI B;  2E65 A;  1NJI U;  5C6S A;  3R6O A;  3C94 A;  3MET A;  1VOM A;  3TRE A;  3HL8 A;  4NL2 A;  5KYX B;  3CXC S;  4JLG A;  1YJ9 Q;  2CUD A;  4HA8 A;  2OTJ Q;  3OYC A;  2R58 A;  3KBG A;  4QVC A;  1B34 A;  1ZA1 B;  5IXB A;  4ZTJ A;  1UGS B;  4RCC A;  3ER0 A;  4PJO E;  3OW2 A;  4PFZ A;  4NS5 A;  2CZ0 B;  2V26 A;  3HP9 A;  1OQK A;  2QYZ A;  5IH2 A;  1Q86 R;  3JCM c;  2QQR A;  3OSS C;  4M78 B;  1YJ9 T;  2OTJ T;  1J3T A;  3M4Y A;  2CYZ B;  5CR2 A;  1RAG B;  1Z9Q A;  4Z88 A;  3JRZ A;  2ENM A;  4JJC A;  2EQK A;  3CCU Q;  4ZTF A;  3G4S T;  3HRT A;  3CCV T;  1SPK A;  2ZPF B;  2EVR A;  5IHN A;  1I5L A;  2XMF A;  3BDU A;  2RMO A;  3S3N A;  4AFQ C;  2QTX A;  2QA4 T;  4E7I A;  1IXD A;  2QDY B;  1K8A U;  2NUZ A;  2JS2 A;  1X6B A;  1X2Q A;  4M77 G;  1KD1 R;  3LLR A;  1FMW A;  2KDS A;  5LL6 S;  4MZM A;  3FEO A;  4FYY B;  1OOT A;  3MPU B;  1H3H A;  4ATO A;  3S6W A;  1WPY A;  1HK9 A;  1LPL A;  1KQ1 A;  3C0C A;  4JUV A;  1AOJ A;  4AMC A;  4KH0 B;  4EMK C;  3CCV A;  4M75 E;  5HKC A;  4JS4 A;  1VQL Q;  2F69 A;  2KYM A;  2HNI A;  3CME Q;  3M54 A;  1JXM A;  1QKW A;  2KRO A;  5EG2 A;  5GAM f;  2QA4 A;  4C8Q E;  2LZ6 B;  4MDX A;  1OZ3 A;  4ME7 A;  3RKW A;  1YI2 A;  2LX9 A;  1R0B G;  4JLI A;  1BI1 A;  4M7D D;  2RQW A;  3C4S A;  3MCA B;  4PJO G;  4KUL A;  2CUB A;  1ZSG A;  2ROL A;  1IO6 A;  4LUD A;  3BW1 A;  2DXU A;  3GNG A;  2LJ1 A;  2AZS A;  2B8A A;  2QI2 A;  3NGP A;  2XID A;  1IHW A;  2KGT A;  3EGX B;  4F04 B;  4JRI A;  4OMO A;  3CCQ Q;  3FIF A;  1MNE A;  3PVL A;  2D0Q B;  3E1S A;  1YFN A;  1YN8 A;  5KYU A;  5C0M A;  3EGU A;  2JTM A;  3JCM W;  1YP5 A;  1OZ2 A;  5GMK i;  3VYH B;  3X20 B;  3J80 E;  4PLI A;  1AZG B;  3BE3 A;  1O9S A;  2KXD A;  4HVV A;  2AT1 B;  1UUE A;  4ZGD B;  2GNC A;  1PM3 A;  2EGC A;  2MOX A;  2GFU A;  3NMZ C;  4J9H A;  3OYJ A;  2AHJ B;  2KK4 A;  1FWZ A;  5D6Y A;  2LVM A;  1QQJ A;  4C92 E;  3L2R A;  5FU6 B;  2DVE A;  2Y90 A;  3VS0 A;  4C5G A;  1PSF A;  5LJ3 e;  4XAX B;  2SEM A;  3VKI A;  3EG2 A;  2I0N A;  1Q81 C;  3EGD B;  2H8H A;  5A2Q E;  1WLP B;  1AWW A;  5GAM d;  1M3C A;  2E1H A;  1M4Z A;  1C0M A;  2D1X A;  4PJL A;  4E7J A;  1KFZ A;  4RCB A;  2DF6 A;  2P84 A;  4P5N A;  1NLP C;  1WI7 A;  3HPW A;  4DBH A;  1H3Z A;  4CC2 A;  1G2B A;  2M16 A;  4MML A;  1VQ8 A;  3OS5 A;  4F7U E;  3QJ6 A;  1SKU B;  3LW5 E;  1OEB A;  1NM7 A;  1KC8 C;  3V8L A;  4C8Q F;  1PCX A;  1YCS B;  3PIO A;  4E7S A;  3ASK A;  1E6H A;  2EYZ A;  4E6R A;  4KBM B;  1U8R A;  2BUD A;  3CD6 T;  8ATC B;  4M78 E;  4DBF A;  2X3W D;  4II1 A;  1TUD A;  2DA9 A;  1UGP B;  1X69 A;  4KH1 B;  1MUZ A;  3JSC A;  4QKU A;  4LNP A;  1CKB A;  3KFV A;  4PLL A;  2RM4 A;  1WNL A;  3QUI A;  2QTV A;  4R0K A;  2EWN A;  2XI9 A;  5GMK m;  3VUB A;  3QZ9 B;  3FC3 A;  4F7U G;  1QCF A;  1KC8 U;  2EIF A;  1BI2 A;  1WHH A;  1YI2 Q;  2RHU A;  1VQ5 A;  1VYV A;  5CIU A;  2QA4 Q;  1Q81 U;  4PJN A;  2K2M A;  1G3Y A;  2RI2 A;  2C0T A;  3HRU A;  3JB9 D;  3UWN A;  1Q82 C;  3JB9 I;  1YHQ T;  3CCS A;  3JB9 F;  4PKC C;  4IIO A;  2L3P A;  1EIF A;  4M77 B;  4J9F A;  4C0F A;  3AT1 B;  1FX7 A;  1K0X A;  1QVP A;  4HCZ A;  3RBB B;  4DOV A;  1WJR A;  1G3W A;  2A08 A;  1M2V A;  4ORZ A;  1WXT A;  1KQS P;  2L5Q A;  4J6X A;  3S3M A;  1I1J A;  4N0A A;  1N8R C;  1IZ6 A;  3CCE T;  2RQV A;  1Q86 U;  2QEX A;  9ATC B;  1N9R A;  3I56 A;  4KT0 E;  2E4H A;  2RJE A;  4RMO A;  3HSB A;  2LQN A;  3M4G A;  5GAN 3;  3CBO A;  2V1R A;  4Q5W A;  3CC2 T;  1MV0 B;  5FW9 A;  4M75 F;  2CZ7 B;  3QDF A;  3EFS A;  2DBK A;  2RB6 A;  3QO3 A;  3QJY A;  4JJD A;  4OMF B;  4B6M A;  3OA6 A;  5D6X A;  4J9E A;  2JT4 A;  2KT8 A;  4LD6 A;  1TUC A;  3SWN C;  3G71 A;  2M1H A;  5CKB A;  1Y7X A;  4M75 D;  1JBM A;  2VUB A;  4BY6 B;  5GAO p;  8AT1 B;  4J6W A;  4OB0 B;  1R0C B;  3A8H B;  2LDM A;  3CCS Q;  2BZ8 A;  2VVK A;  1YJN Q;  2K2V A;  1W1F A;  1LCK A;  1M27 C;  1V76 A;  4RTX A;  3CCM Q;  4XQ3 A;  2FL7 A;  1NEB A;  2ABL A;  3VRY A;  2EQJ A;  2FB7 A;  3GP8 A;  2JNG A;  4C0D B;  1YJW A;  1YIT T;  2JW4 A;  5CKD A;  1T3L A;  3G71 T;  5GAO r;  1KQS A;  3I56 Q;  2VXE A;  2A0F B;  1QMC A;  2KI7 A;  2MMP A;  5I2S A;  3CCS T;  1ZSZ A;  4M77 E;  4F7U F;  5KYU B;  3OBW A;  3LYI A;  2CGH A;  4E2F B;  1VIE A;  2HKQ B;  1SRM A;  4LDU A;  3SEM A;  2AKK A;  1KK7 A;  1N5Z A;  1VQ4 T;  1UJ0 A;  2RHI A;  4XU2 A;  1IB8 A;  4FSS A;  1PRL C;  4F17 A;  2Y4X A;  1X6O A;  3MEA A;  1RAF B;  3OYY A;  4C92 D;  2DBM A;  5CQY A;  2DEU A;  2NYS A;  3VV0 A;  1RLP C;  3FB9 A;  2KR3 A;  3JCM b;  1LNX A;  3EG9 A;  1N6A A;  2O4X A;  3I35 A;  3LGL A;  4L59 A;  1KHI A;  3M0Q A;  3CQT A;  2OJ2 A;  3UT1 A;  3G4S Q;  2YRC A;  1N8R R;  3NTI A;  3MKD A;  4OMM A;  1NLO C;  1X2K A;  3M9Q A;  1M30 A;  5GAN h;  4AFZ C;  2RD1 A;  5IN1 A;  1Q82 R;  2XDP A;  3MP6 A;  2EGA A;  4C92 F;  1V29 B;  1VYT A;  1MMN A;  4B9X A;  3G7Z A;  2L0A A;  1ARK A;  5DLO A;  1YJW Q;  2LX7 A;  4OMN A;  1ZA2 B;  5LJ5 e;  1PNJ A;  4XTZ A;  5GAO m;  2RN8 A;  1GCQ A;  2QK0 A;  2WSF E;  4FYX B;  3H0F A;  2HKN A;  5I21 A;  2EQI A;  1Y96 A;  3V8K A;  1NYF A;  4FSX A;  5KYY B;  1IRE B;  2GF7 A;  2JZ2 A;  4E7L A;  1PRM C;  1VQ9 A;  4D6W A;  4MDW A;  3QII A;  3OS1 A;  4M75 G;  3UDC A;  1RAH B;  2QGF B;  4JRK A;  1WHG A;  1M1G A;  2JTE A;  3MJX A;  3GPL A;  2DRK A;  1HD3 A;  4DBQ A;  3OS0 A;  4OMQ A;  5L23 A;  1ACM B;  3JCM g;  1IRX A;  1H8K A;  3NPF A;  3S3O A;  3KXT A;  4IIM A;  2HQH A;  2G6F X;  3HFO A;  2JTF A;  5GMK j;  1VQ6 Q;  4KRT A;  4LD9 K;  1FYN A;  1QLY A;  3M0U A;  1M90 U;  1VQK Q;  1NG2 A;  2J6K A;  5IAY A;  1RI9 A;  5KE2 A;  4GBQ A;  3JB9 J;  4Z02 A;  3CD6 A;  1FXX A;  4C5I A;  3GOX A;  4DEX A;  2RNA A;  2KRS A;  1JXO A;  1EX4 A;  2NUT B;  3CC2 A;  3HKS A;  1ZUU A;  2YRV A;  1VQ4 A;  2ED1 A;  1UGR B;  3CCU A;  2YLC A;  4F16 A;  3VYG A;  2FEI A;  3I55 Q;  2RQR A;  3OMG A;  1SF9 A;  1SEM A;  1EFN A;  2V1Q A;  2YUP A;  4EIK A;  1RL2 A;  1VQ5 T;  2CH4 A;  4J7F A;  3M56 A;  3CCM A;  1QVG P;  1PWT A;  4O5V A;  4PJO D;  3JB9 G;  1R8O B;  1PKS A;  1WJS A;  4PNO A;  2CSQ A;  3M5A A;  1GRI A;  4C5H A;  1KIK A;  2WSC E;  3UA6 A;  3CPW S;  2HEQ A;  2KSS A;  3OY9 A;  3MEW A;  2RF0 A;  5CO7 A;  4HVW A;  2KAF A;  1X01 A;  1Q82 U;  2CP0 A;  5HK0 A;  4ANJ A;  2D6F A;  4C92 C;  1S72 A;  3A8L B;  1I5O B;  4N0A C;  4M75 B;  3LH5 A;  3JCM P;  1YIJ A;  1I07 A;  3EG3 A;  4LDV A;  5KYW A;  3LH0 A;  3CC7 Q;  3CCM T;  1T0J A;  3PVQ A;  1WXU A;  2DER A;  5GAO q;  1ABO A;  4J9I A;  3RIR A;  2VGM A;  2PVD B;  2FYK A;  1WQ7 A;  4L6V 5;  2LJ3 A;  3ME9 A;  3OBY A;  2JOY A;  3CXC P;  1TWB A;  2XKO C;  1CKA A;  2EJF A;  1GXI E;  1K73 R;  4OVA A;  1N27 A;  2MK5 A;  1VQ6 T;  5ECA A;  1VA7 A;  1Q81 R;  2M9U A;  1OUL A;  2V8K A;  4ZGE B;  4A4K A;  2CRE A;  1WFW A;  1M90 R;  2QXF A;  3M0P A;  5KYW B;  4XK8 E;  5FU7 C;  4IUT A;  1BCM A;  2VXF A;  3LWI A;  3H9N A;  2XHC A;  4M77 D;  1YHQ Q;  1G83 A;  4M7A C;  2E6Z A;  1PD0 A;  4AT1 B;  3VS5 A;  2ED0 A;  1PSE A;  3L2V A;  2O9V A;  2Z0W A;  4M78 F;  1YIJ Q;  1BU1 A;  2ZPB B;  2D9T A;  2JJ9 A;  4XU0 A;  2OTL Q;  5CKE A;  4M7D C;  1VQM A;  3PIP A;  1WHK A;  1Q7Y U;  2A3L A;  4A4E A;  1ZSZ C;  2CT3 A;  3G6E T;  4BB7 A;  3IQL A;  4RTZ A;  4NL3 A;  3M58 A;  3CMA T;  4RKU E;  1AD5 A;  1IGU A;  3T9N A;  2YDL A;  3VS3 A;  3A5Z B;  4ZN3 A;  3E9G A;  1K0S A;  3QWX X;  4DOW A;  4OB3 B;  1OU9 A;  1HYO A;  5GMK l;  2KE9 A;  5LJ5 f;  1X75 C;  1YWP A;  1JQQ A;  4M78 A;  4ESR A;  2MIO A;  2ATC B;  3X26 B;  2GQI A;  1VQO A;  3NFC A;  2DTO A;  4RTV A;  3VU3 C;  1M1F A;  2YXY A;  2RK2 A;  4EMG A;  3TVT A;  2KMT A;  2EKH A;  4FW2 A;  1LVK A;  3CCR Q;  2X4J A;  3FLG A;  5KH6 A;  3CMA A;  2P0K A;  1BB9 A;  2RHX A;  2KEA A;  1VQP T;  4IUV A;  2DVJ A;  2PUK B;  3NTH A;  4DQ2 A;  4FT4 A;  4YTL A;  5GMK h;  5GAO n;  3VJP A;  2OX7 A;  3WVD B;  3TU4 K;  4C92 G;  2J6F A;  2IPO B;  2OAU A;  1B3Q A;  3EG0 A;  1VQO T;  1K9A A;  1ZQ1 A;  2DYB A;  5GJV B;  3UAT A;  4QT7 A;  1WA7 A;  3JCM f;  1TS9 A;  2K79 A;  3KUF A;  1AZE A;  4IUP A;  1M2O A;  2DZC A;  3M53 A;  3SDZ A;  4WTO B;  1A0N B;  1Y07 A;  3JB9 H;  4ZGJ B;  4M7D F;  4M78 D;  4EDU A;  4C0Z A;  4CC4 B;  3EH2 A;  4F7U A;  3THK A;  1N9S A;  3EGX A;  2MCN A;  1UG1 A;  3HHT B;  4EMK A;  2X9H A;  1ZSZ B;  3QXE B;  3CBM A;  2PVO B;  4PJO B;  2O4X B;  3JCM X;  4M7A E;  2I2L A;  2EQU A;  4A54 A;  4JZ4 A;  4XU1 A;  2DIL A;  5IT9 E;  2YUN A;  1Q86 C;  2QQ9 A;  1DJ7 B;  3EFO A;  2YSQ A;  4M7A B;  4PL6 A;  1R77 A;  1E7O A;  2QQA A;  3LX7 A;  1KD1 U;  1TTH B;  1AT1 B;  3EHQ A;  3CEY A;  4FW1 A;  3V7R A;  2LCL A;  2QGG A;  2P4T A;  5I11 A;  2ROT A;  1QWF A;  4RTW A;  2RHY A;  3M59 A;  1K9M U;  3UA7 A;  3SHW A;  2ZPH B;  2JMA A;  3TSZ A;  2X4W A;  4C0G A;  2LT4 A;  4KUI A;  3GIB A;  2DXT A;  4J9D A;  3RDV A;  5A0L A;  1M8M A;  2EYX A;  5DY9 A;  2RJF A;  4C8Q C;  4BI8 B;  4PJJ A;  2E3H A;  4AG2 C;  1MMA A;  1U5S A;  2E5Q A;  3OYD A;  4B9W A;  3QHS A;  3H6Z A;  3ZBD A;  1UGQ B;  2KQW A;  3M0S A;  2DMO A;  1W6X A;  3CMA Q;  1OYX A;  4OGE A;  3CCJ Q;  2HCK A;  2BZX A;  3TEE A;  1S72 T;  4PJO F;  1OU8 A;  1TG0 A;  3MEU A;  4J7I A;  1AWO A;  3OQ5 A;  5GAN 7;  2BTT A;  4GY5 A;  2DKG A;  3RUX A;  4IKF A;  1UDL A;  3O8V A;  5GAM g;  1WZO A;  3VUZ A;  2EW3 A;  4F14 A;  4HT8 A;  2RJD A;  2KT1 A;  4QVZ A;  1VQ8 T;  4OF1 A;  5D6W A;  4D8K A;  1VQN A;  1JJ2 P;  2M02 A;  5GAM j;  2DYI A;  2XIC A;  1LOJ A;  3CXC A;  1JRI A;  3CC4 A;  2HDA A;  2PU9 B;  2MWP A;  1Q7Y R;  4PJO C;  4C0D C;  1XOV A;  4WF2 A;  2A36 A;  2GTJ A;  4PJO A;  2K9G A;  2PVG B;  4LXC A;  3TSW A;  2VGN A;  5GAO l;  3H41 A;  2K5I A;  5GAN f;  1WX6 A;  2KXC A;  4CC3 A;  2MAM A;  4F7U B;  2EYQ A;  1VQM Q;  1QVG S;  3M57 A;  1TU0 B;  2D0N A;  3ZL7 C;  1RAB B;  2F2X A;  3G6E Q;  1OV3 A;  2EFI A;  1G8X A;  4E47 A;  2FVU A;  4BY6 C;  3CD6 Q;  2J7I A;  5GMK e;  3RER A;  3PMT A;  1X6G A;  1I4K 1;  4LDX A;  3P8B B;  3OYI A;  3P8D A;  1U1S A;  3Q1J A;  2XG8 D;  4HXJ A;  3PE0 A;  1SHG A;  2DL3 A;  1T0H A;  3ZEH A;  2O01 E;  5LJ3 f;  2CZ1 B;  4CC7 A;  1YJ9 A;  2OTJ A;  1YCY A;  4Z89 A;  1AWX A;  1VQO Q;  4X9D A;  3U23 A;  5A0D A;  3PMI A;  3N5B B;  2BE9 B;  2HSP A;  2DK3 A;  4XTW A;  2P0P A;  1M3B A;  1Q7Y C;  3OYK A;  1VQL T;  2DIG A;  1Y96 B;  2L8D A;  2JM8 A;  2GQV A;  4C8Q G;  2QG9 B;  1T3S A;  3CPW P;  1B07 A;  3MP1 A;  2C0O A;  3MP8 A;  5LJ3 d;  4BD3 A;  2DTH A;  4EMH A;  1BK2 A;  2DZ9 A;  2DRM A;  1IHV A;  4BI3 A;  2HD0 A;  4E7Z A;  1RAA B;  2LQK A;  2HBW A;  5GAN j;  5KCH A;  2VAS A;  2OTL T;  1M2V B;  4LDW A;  3OYM A;  3OW2 P;  2IG0 A;  1NYG A;  5FRO A;  3EHR A;  4LE9 A;  4M77 C;  2CKK A;  4O6J A;  4MMK A;  4JDS A;  2RJC A;  3PFS A;  3CC4 T;  1OI1 A;  1GBR A;  4MZP A;  1OPL A;  1SSF A;  4V2S A;  1G5V A;  2RK1 A;  3PTA A;  2R5M A;  5FLX E;  3CCL A;  1MHN A;  2R5A A;  1GFC A;  3A8M B;  3I9Q A;  4Y92 A;  1X43 A;  2CP3 A;  2O88 A;  1AEY A;  1TXQ A;  2QQB A;  2DO3 A;  3L2W A;  1SRL A;  2XK0 A;  4OGC A;  3V7S A;  4M7D G;  1VQ7 Q;  3MEV A;  2Y4Y A;  4XTU A;  2HZY A;  2PQW A;  3OYF A;  2QEX T;  2X35 A;  1S72 Q;  2WSE E;  5HCK A;  5GAN 2;  4WCI A;  1NJI C;  1WQW A;  3L2U A;  4J9B A;  4FM4 B;  2A28 A;  3OB9 A;  4OML A;  1K8A R;  1TUG B;  1SHF A;  2E5K A;  2LTO A;  4BUG A;  3HTR A;  2LRQ A;  4FIB A;  2NUT A;  3G1J A;  4A63 B;  5FRM A;  1RAI B;  1VQN T;  1VQL A;  2RO0 A;  1QCN A;  4X9C A;  4Y28 E;  3AHU A;  3X28 B;  2KRM A;  3TQ7 P;  3I55 A;  3INZ A;  4BE2 A;  1YWO A;  2ZAE A;  4M7A G;  4IUR A;  3EG1 A;  2YUO A;  3G71 Q;  1TSF A;  1P92 A;  3CC2 Q;  4RTU A;  3C95 A;  1WXB A;  3OW2 S;  2MWO A; 
#chains in the Genus database with same CATH homology
 1MUZ A;  1AD5 A;  3VS3 A;  2YDL A;  4LNP A;  1UHC A;  1CKB A;  2DL4 A;  1GCP A;  4OMP A;  1FMK A;  3KFV A;  1K0S A;  1WIE A;  3QWX X;  4R0K A;  5FWB A;  2RQU A;  1QCF A;  2KE9 A;  3VS2 A;  1UTI A;  1YWP A;  1JQQ A;  3VRZ A;  5I22 A;  1GFD A;  3O5Z A;  4ESR A;  2MIO A;  1VYV A;  2DNU A;  4JJB A;  4RTY A;  2GQI A;  2W0Z A;  3A98 A;  2K2M A;  2F2W A;  2A37 A;  3RNJ A;  4RTV A;  1QWE A;  2C0T A;  2M51 A;  2PZ1 A;  2ESW A;  4HCK A;  1YNZ A;  3TVT A;  2EKH A;  3REB B;  4IIO A;  2L3P A;  2GBQ A;  3H0I A;  4J9F A;  1GCQ C;  1BB9 A;  2KEA A;  3M0R A;  2DVJ A;  1K0X A;  2CH4 W;  2PNI A;  2FRY A;  1UEC A;  3VS6 A;  2FG0 A;  1Z9Z A;  3RBB B;  2A08 A;  3M0T A;  1SSH A;  2EBP A;  2NWM A;  1UGV A;  4ORZ A;  1WXT A;  1JEG A;  2J6F A;  2K6D A;  2KYB A;  4RTT A;  1B3Q A;  4DEY A;  2O2O A;  3EG0 A;  1I1J A;  2LMJ A;  1UHF A;  1K9A A;  2AK5 A;  2RQV A;  4JPB W;  1PKT A;  1ZBJ A;  2DYB A;  5GJV B;  4QT7 A;  3UAT A;  1WA7 A;  1S1N A;  3QWY A;  2DE0 X;  2K79 A;  1AZE A;  2LQN A;  2F2V A;  1A0N B;  4AFS C;  2V1R A;  2VWF A;  1MV0 B;  5FW9 A;  4CC4 B;  2EPD A;  2LJ0 A;  3THK A;  2DBK A;  4JJD A;  1UG1 A;  2MCN A;  3R6N A;  5IHI A;  2JMC A;  2DL7 A;  2DL8 A;  4J9E A;  1KSW A;  1VYU A;  2JT4 A;  4M4Z A;  2KT8 A;  2LCS A;  3VS1 A;  2LP5 A;  2IIM A;  1TUC A;  2FO0 A;  2AKL A;  2P4R A;  3JV3 A;  4JZ4 A;  2O9S A;  2DIL A;  2D8H A;  1ABQ A;  3I5R A;  3H0H A;  1RLQ C;  2LQW A;  2YUN A;  2BZ8 A;  2VVK A;  1W1F A;  1LCK A;  2YSQ A;  1M27 C;  2YUQ A;  1E7O A;  4J9G A;  4RTX A;  2GGR A;  2J06 A;  4J9C A;  3EHQ A;  2OAW A;  1I0C A;  1NEB A;  2ABL A;  1AWJ A;  1M3A A;  2L2P A;  5I11 A;  2ROT A;  3VRY A;  1V1C A;  1K76 A;  1QWF A;  4RTW A;  2DL5 A;  5IXF A;  2L3Q A;  3UA7 A;  1UE9 A;  3SHW A;  1NEG A;  2L3S A;  2JMA A;  3TSZ A;  3VS4 A;  2JW4 A;  2W10 A;  1T3L A;  5IHK A;  2KRN A;  4J9D A;  1E6G A;  1MV3 A;  2FPF A;  2C0I A;  5EC7 A;  1M8M A;  2EYX A;  4K11 A;  1ZUY A;  4AG2 C;  1SRM A;  3REA B;  2AZV A;  2AKK A;  3SEM A;  2JM9 A;  1KJW A;  3NHN A;  1N5Z A;  1U5S A;  2DX1 A;  1UJ0 A;  4FSS A;  1HJD A;  2EYY A;  1JO8 A;  1PRL C;  4F17 A;  3VS7 A;  1RUW A;  4LUE A;  2LNH B;  3M0S A;  3FJ5 A;  2BZY A;  2CSI A;  2DMO A;  1W6X A;  2DBM A;  2CDT A;  3ULR B;  2HCK A;  2BZX A;  2DJQ A;  1RLP C;  2KR3 A;  1TG0 A;  2J05 A;  2RPN A;  1AWO A;  1K4U S;  2FPE A;  3I35 A;  2BTT A;  2EYW A;  1GL5 A;  4AG1 C;  3M0Q A;  4RUG A;  1UDL A;  3CQT A;  2OJ2 A;  2GTO A;  2RQT A;  4OMM A;  1CSK A;  2EW3 A;  4F14 A;  1NLO C;  1PHT A;  1X2K A;  2K7A A;  2KT1 A;  1M30 A;  4AFZ C;  4D8K A;  2FPD A;  2EGA A;  2J6O A;  3UF4 A;  2CUD A;  1VYT A;  2O31 A;  2HDA A;  2YT6 A;  5IXB A;  2L0A A;  1ARK A;  1XOV A;  2LX7 A;  4OMN A;  2A36 A;  2GTJ A;  1PNJ A;  5IH2 A;  2K9G A;  1UFF A;  3TSW A;  2RN8 A;  2KNB B;  1GCQ A;  1J3T A;  3H41 A;  1Z9Q A;  3H0F A;  4Z88 A;  2EQI A;  2KBT A;  1NYF A;  2ENM A;  2B86 A;  1WX6 A;  2KXC A;  4JJC A;  4CC3 A;  1PRM C;  1SPK A;  1QKX A;  2D0N A;  2EVR A;  3ZL7 C;  2F2X A;  2JTE A;  1OV3 A;  5IHN A;  2DRK A;  2XMF A;  1HD3 A;  2RMO A;  4OMQ A;  4AFQ C;  4AFU C;  2J7I A;  5L23 A;  1X6G A;  1UJY A;  1H8K A;  1ZUK A;  3NPF A;  1Y57 A;  2NUZ A;  2JS2 A;  4IIM A;  1X6B A;  3PE0 A;  4HXJ A;  1SHG A;  4GLM A;  2G6F X;  1X2Q A;  2DL3 A;  1T0H A;  1GBQ A;  4KRT A;  1FYN A;  1QLY A;  1OOT A;  3M0U A;  2DM1 A;  4CC7 A;  1H3H A;  1NG2 A;  2J6K A;  1RI9 A;  4Z89 A;  4GBQ A;  1AWX A;  4JZ3 A;  3C0C A;  1AOJ A;  5FWC A;  3U23 A;  4DEX A;  2RNA A;  2KRS A;  1JXO A;  2HSP A;  1ZUU A;  1M3B A;  2ED1 A;  2KYM A;  4F16 A;  1JXM A;  2FEI A;  2JM8 A;  1QKW A;  2KRO A;  2RQR A;  2LZ6 B;  1T3S A;  1SEM A;  1H92 A;  1B07 A;  1EFN A;  2V1Q A;  2YUP A;  4EIK A;  4D8D A;  2C0O A;  2RQW A;  2CH4 A;  1BK2 A;  1PWT A;  2DRM A;  5GJW B;  2D8J A;  2CUB A;  1ZSG A;  2ROL A;  1IO6 A;  4LUD A;  1PKS A;  2HBW A;  2LJ1 A;  2AZS A;  2CSQ A;  1GRI A;  1KIK A;  3NGP A;  3UA6 A;  2HEQ A;  2KGT A;  1NYG A;  4X1V A;  4ZNX A;  3EHR A;  2RF0 A;  4OMO A;  4LE9 A;  4HVW A;  2DLP A;  1U3O A;  2X3X D;  3PVL A;  1ZLM A;  1YN8 A;  3LH5 A;  3EGU A;  1YP5 A;  2QDL A;  1GBR A;  1I07 A;  3EG3 A;  1OPL A;  3GBQ A;  4Z8A A;  1AZG B;  1T0J A;  4HVV A;  2KXD A;  1WXU A;  3PVQ A;  2M0Y A;  1ABO A;  4J9I A;  1HSQ A;  1UUE A;  2VKN A;  4HVU A;  2GNC A;  2MOX A;  2EGC A;  2LJ3 A;  3NMZ C;  1GFC A;  4J9H A;  3I9Q A;  1CKA A;  4Y92 A;  1X43 A;  2O88 A;  1AEY A;  1SRL A;  1ZX6 A;  3VS0 A;  3I5S A;  5ECA A;  1VA7 A;  2SEM A;  2JS0 A;  2PTK A;  1WDX A;  3EG2 A;  2I0N A;  2SRC A;  2H8H A;  2CRE A;  1WFW A;  1WLP B;  3M0P A;  1AWW A;  5HCK A;  1W70 A;  4WCI A;  1M3C A;  1U06 A;  1BBZ A;  4J9B A;  2D1X A;  2A28 A;  1KFZ A;  2EGE A;  4OML A;  2DF6 A;  1SHF A;  2E5K A;  2JXB A;  1Y0M A;  1NLP C;  2ECZ A;  1WI7 A;  1K1Z A;  1G83 A;  4CC2 A;  1G2B A;  4A63 B;  3VS5 A;  2ED0 A;  2K3B A;  2O9V A;  1JU5 C;  1OEB A;  1NM7 A;  1BU1 A;  1X27 A;  1YCS B;  1E6H A;  2EYZ A;  1AVZ C;  4E6R A;  2KRM A;  1WYX A;  1YWO A;  1OPK A;  2FRW A;  2CT4 A;  2OI3 A;  3EG1 A;  2YUO A;  2CT3 A;  2X3W D;  3IQL A;  1TUD A;  4RTZ A;  4RTU A;  1WXB A;  2DA9 A;  4LN2 A;  1X69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...