2GBTA

C6a/c111a cuzn superoxide dismutase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
152
Chain Sequence
TKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2gbtA00
2APSA 1SXCA 1E9QA 1UXMA 3PU7A 1JCVA 3GTVA 4B3EA 2ZOWA 2Z7YA 3GTTA 1PZSA 3HW7A 2AQRA 5KBLA 2AEOA 4A7GF 1IBBA 2E47A 1EJ8A 2AQTA 1E9PA 1SOSA 4L05A 2Z7WA 3GZOA 4A7TA 1E9PB 2Z7ZA 1Z9NA 2ZKWA 5KBKA 1SXZA 3ECWA 5CU9A 1N19A 2JCWA 1SXBA 3H2QA 2Q2LA 3QQDA 2GBUA 3ECVA 1F1GA 2C9UA 2V0AA 4BCZA 1JK9A 1SXAA 3H2PA 5KBMA 1IB5A 3F7LA 1SPDA 3HOGA 1COBA 2WYTA 4A7QA 2WKOA 1F18A 1B4TA 1E9QB 1XTLA 4BCYA 1YSOA 3KH4A 1S4IA 2NNXA 2AQNA 4MCNA 1CB4A 1QUPA 3KM1A 2E46A 3GQFA 2AQSA 1IBHA 2GBVA 4BD4A 1U3NA 1SRDA 2Z7UA 1XSOA 2ZKYA 3QQDB 1Q0EA 1HL5A 3CQQA 3L9EA 1JK9B 2WZ0A 1OAJA 1DSWA 4A7VA 1N18A 1UXLA 2WZ6A 3L9YA 2JLPA 1Z9PA 2AQPA 3MKGA 4U4IA 2WWOA 1MFMA 1TO5A 2GBTA 3SODB 4N3UA 1OEZW 1YAZA 3MNDA 3F7KA 1F1DA 1OZUA 2AQQA 2C9SA 3KH3A 4N3TA 3HFFA 1OALA 2VR7A 4A7GA 1XTMA 2C9VA 2SODB 3KBEA 3S0PA 2XJKA 1AZVA 1PTZA 4FF9A 1E9OA 2WKOF 1DO5A 3RE0A 2AF2A 3KBFA 3KM2A 1CBJA 1BA9A 2XJLA 1PU0A 4OJAA 3GZQA 1SXNA 2VR6A 3ECUA 1OZTG 2WYZA 4A7SA 1SDAB 4MCMA 1HL4A 1SDYA 1SXSA 4OH2A 2K4WA 3GZPA 3LTVA 1RK7A 1IBDA 2WZ5A 2ZKXA 2WWNA 3CE1A 2VR8A 1L3NA 1KMGA 1P1VA 1FUNA 3T5WA 2R27A 1ESOA 1F1AA 3K91A 4A7UA 1YAIA 1TO4A 1IBFA 2LU5A 1BZOA 1B4LA 3CQPA 1E9OB 1EQWA
chains in the Genus database with same CATH superfamily
4APXB 4NUPA 4XTRD 2WQAA 4NJ9L 1IAOB 3U4KA 4U1HB 2ADGA 2EDJA 4Z7QE 4OM0L 4H26A 2YA1A 4R4BA 2KDYA 1N5YH 5F88A 2Q87A 3QCUL 1BXUA 5E51A 4JGMA 3MCG1 5BQ7B 2V5SA 5D70L 3FUNA 4WUUE 4NO2B 1MEXL 3ZE0E 3IDYC 3RAJH 2WOBA 5TE4H 2K4AA 4GKZB 2VAAA 2EVJA 1KGJA 5FGCE 3C2SA 5B1KA 4B9ZA 3VWJA 1FVEA 3HNSH 3MJ7A 3RX5A 1LP9A 5ETUB 5F89B 3IT8D 4FJZA 3G9AB 2NY3C 1QLRB 2H0FA 4N2NA 3HC3L 4CC0A 3HZMB 1T0MB 5D71L 5FEBA 2VLLB 1HHKB 2DLGA 2RFXB 4I9XA 5F0LB 4D9QE 3FTWA 2ZUSA 2QJDA 1E4XL 2HTKD 3O6LH 5CU5A 3MYJB 2WLHA 1G9NH 5D72H 5JHAA 3KCPA 3LRLA 3GMOA 4K8RD 2DTML 2XY1A 3KPRD 2JCCB 1FVCA 2ADFL 3LS4H 3QZMA 3GBMH 2K9FB 4CJ1A 4J7RA 1IEHA 5F1SA 3KLHC 3O8XA 4WTWA 5HGDB 4P57B 1QFUL 3B2UD 4LIQL 1WZKA 5CINL 2ICEC 1HYSC 2VDQH 1U42A 3C6EA 4TNWF 2ETWA 3T3MF 3MTRA 3MRMB 4Z18A 3X1NA 3TBYB 5F3HB 2FEDD 3CC1A 1G1OA 3RILA 4J8RA 2Y07H 1HH9B 3F7KA 4GAYB 3S96A 3VI3B 2SEBA 3LRMA 2W88A 3HFFA 3IN0A 1IJ9A 3ZKNC 1KYOK 1WP6A 2EIDA 5CJ8A 4QPEA 1G5AA 2EIKB 3QORC 1RZKL 4QUOA 1NCBL 2WSDA 1BFTA 2SODB 1MELA 2XQYK 1W6WA 3KBEA 4XAWL 1CFMA 5IBUG 2DLTA 3GJFK 3WY3A 3ZIYA 2VMFA 4N8VB 1S9XB 1BMGA 1UZGA 3Q5OA 4J4PC 2R59A 2YBRB 3ZE1B 4PJEE 3RUGB 1NPNA 2Y3NA 3OZLA 1T89C 4OD2B 3S4SA 2J1KA 4BEIA 5EIIG 3SDAC 1A7OL 4A7SA 3SKMB 2QTVA 3N43F 5DQDL 1UWYA 1RIHH 5FV1L 5IUCA 3ZMNA 4AMKL 3AG2B 4AUUA 2WAQA 2ZF8A 4YXHH 3PAVA 4ODHL 2XZAL 2WNGA 3PHAA 1WT5C 3VXQB 1CFTB 2OZ4L 3FQYA 3ISYA 4NO0D 4OQ1A 5AW4B 1CURA 4FHKA 1NBYB 1TO4A 4Y5VC 1I1FA 1ZJAA 4YHNB 2HPOA 4QHUA 1FFOB 1EX0A 1FL6A 3MSPA 1E8YA 2HXAA 1N6UA 4NC1C 2RTTA 1IQWH 5D1QB 3SDDD 4P5MB 4R96A 3MI6A 3C6LA 3FO0H 4TLKA 5IOPB 1U95B 4JO3L 3OKYA 1DJSA 5FYJU 3IJHA 4PBVC 3B7UX 4QTIH 4B7LA 1XGUA 2ITFA 5DO2D 4PW3A 5D7JB 1FZJA 2EKSA 3DI3B 4TOYH 3QJUB 5ID0B 2HCZX 2LU7A 3B2DC 3MRHA 4N9OB 5GXBB 4KK9C 4DVBA 2VQ4A 5KBMA 1OB1B 5EZPA 1UWXH 4UU9A 2MIZA 3HUJE 3AGWA 4WUUD 1NUDA 5L0QC 3F65A 2HRPH 1NAKL 5EBLB 2YXFA 5B21A 4XNUL 2PR9A 2AEQH 2VO8A 1DN0A 3MGOB 1JV2B 5JOFA 4OQTA 4TXVB 3CFBB 4QHNB 2AZUA 4XP1L 2LU4A 3KNBB 3VFOA 2VN5A 2WYIA 2NRDA 2UY6B 4KDWA 5D2LA 1NDTA 4QRPA 4MDIA 2UYLA 3NVQA 3RWFB 3P11L 3I74A 5F7EH 1W15A 5EU3B 3VXUB 1HIMH 2WGNB 3T3MB 4MJ6A 3DX7B 5KVEL 3LSOB 4D9QD 4U1LA 4R9HA 2BP5M 4ENEC 4YSSA 4FQXA 4QHPA 1K3IA 3U4AA 2XCMC 2IH1B 4EUPH 3OXSA 4HJGA 4POZD 1ADWA 2ZWYA 1DCLA 1U58A 2JLPA 3AREA 1E28A 2VDKH 5ALBL 4N0UE 5KUMA 1GKOA 4HPYL 3IMUA 3BUDA 4H8WL 4HUXB 3RZWA 3V0IA 2NY4C 4IU3B 2XFXB 3GSXA 4HMDA 1YAZA 2BPBA 5CWSA 1SJEB 3FQWA 3P77B 1A0QH 1DVXA 5GSVB 4GMTL 3QHZL 3EF4A 2OS7A 12E8H 3FQ1A 3N43B 1ACZA 3NJVA 4XR8C 5DR5L 4NEHB 1D7FA 2GQHA 1DN2A 1A6ZA 4ZMAT 1FLRL 1AE6H 4YUEL 3D18B 3RPBA 3OMIB 2PCFA 4YPGB 1MPAL 1SFDA 5F6IB 5SWZB 4K71C 2HWZL 3GBNL 4XN5A 5TE6H 1GJUA 4LGPB 3SO3B 2DN7A 5JR1L 1BQSA 4AGMA 4X5PA 4I18C 1BX2B 2NUTB 4M7ZC 3U9UB 3HHMA 4OZGE 3ZOAA 1EVUA 1CUOA 3ARVA 5HVHB 3O3EB 3TIEA 4E5XA 1UA6H 4XRCA 4DGYH 1JBJA 1BFOB 4L3EE 3FRPG 2VUOA 5L2KE 2VYRE 4S1SL 4Z3FA 1DO6A 5AYQA 2OMZB 3JYCA 3WSQL 2CBPA 4QXUL 2GI7A 3Q9QA 4Y5YB 3SO5A 3L7EA 1KBGL 1RUAL 3DYOA 5DI8A 4YMPA 1SBSL 3MOQA 2PYEA 3RA7H 4P46C 3ZO9A 5IB4B 5JW5A 2Z4TA 3PABB 2G75A 3SY0A 2VXSH 1K5NA 4PGCA 4DNLA 5JIIA 5LAPA 3V4UH 2F54E 4GW1B 1KN2L 4I0KA 4KROB 2JE8A 1FJ1B 1MVUA 1TMQA 2NT1A 3C5JA 2NY7H 5IW3A 4FFYL 4AVKA 4BK4A 3QDHA 2HLEB 1VEMA 1JYWA 1UCBH 1UGKA 4AQAB 2D7PA 4H7VA 3ML8A 2N4IA 2ENJA 1O0VA 4PREB 1PJ9A 3LRSA 4YFEA 4PJFA 2VIRB 5DMJB 1UADC 3MLUH 2X38A 1T1ZB 5IKCA 2W9EL 1EEZA 3HBGA 3MR9A 3U1QA 4XN2A 4JDZA 3IFLH 3RWHA 4RRPG 2NY2C 1YO4A 2OK0H 5FKPA 3IXTB 5BUPA 4QLRA 1DBJL 3GYRA 3ZDXF 1D7DA 2ZOTA 1ZOXA 4Y1SA 3BW9A 5IW6A 2ARJQ 4MD4A 3AU1B 3WIHL 3K71B 3EJYD 3QWQB 2ENYA 4N2GA 3HMWH 3L3OB 4Z76B 5JIHA 4PRNA 1DFBL 5PAZA 5D1XE 4WTZG 4RGNB 1KB5B 2EDMA 4YDZA 5LG1A 4F8OA 1W6LA 3D2UB 3CK0L 2FYVA 2HH0H 1QTSA 5C0CA 5IK3B 1BQHB 1BM3L 1U92A 4IBLT 4KZCA 5IP4A 1G7HA 1PZ5B 2A77H 1Y0LA 2E75C 1HOEA 2WKOF 4LPTA 4E9VA 1SJXA 4NPYB 5J06A 3IJ9A 4E41B 3BKCL 4W68A 1Q1JL 4ZYKA 4ODVH 3FOLB 4TV3A 2VDOH 1TJIH 4HETA 3ILQD 4KI5E 2WINB 3UCQA 5BUAA 3WL9A 4LDCA 2OMVA 1IRAY 1K6QL 5GPRA 3O3UN 4PAZA 2XIIA 5C0ND 2QSVA 2QHRH 3FO2A 5IJCC 4B9JA 2XQ0A 3QI9A 3L48A 2B4CC 2G9HB 2KPWA 5E5MA 3WFBL 1AAJA 1J9CT 3WS6A 3NCYP 5I2IB 2H0JA 2F58L 1AI1H 2VZ3A 3TV8A 3B9KC 4YQXL 2A38A 2DQCH 5FYLE 2V5MA 3FO1A 4GUOA 1O7DE 3QEQE 4F20A 3SKNA 3ZDWA 1LHZA 4K5LA 3WBDA 4PJDB 3JV5A 5I6XB 3ILEA 5E94B 2H3NB 5JXEA 5HGBB 5DD3L 3QIUD 5HYJB 2AEPL 2E74C 2M26A 3N44F 4X5LA 2DWYA 1SDDB 3FRUB 4L3ED 2XTSA 3FQXB 3FB7A 5L2KD 2PP9A 3LZOA 4PSPA 5I1DB 1FVDB 4WJG3 3UC0L 1IAII 4BKLB 3QCTH 3IKKA 3L3DB 5TH2A 1EDHA 3DX1A 2FHBA 2ZX6A 3ARGC 4UOQA 5IF0B 2BS71 2OTWA 3TVMD 5I1EL 3DA0A 1SUHA 2OW7A 4LKCA 4M6OH 3R19A 4QYOA 5F3BB 2KS0A 2WMPB 3FT9A 1DVFA 1A4BA 4NO5B 3ZDXB 3MRNB 3QQ4A 5L8LB 4QOKB 4JDEB 3NJIA 3VMOA 4NQDD 4HXAH 4ETQB 2Z9TA 5C6PB 1WISA 2B9AA 4JNXA 1OO2A 2P45B 5KYXB 3CVIH 3PDOA 3GSWB 5F9DC 4I4WA 3MRKB 1A1MB 3ETTA 3T6WA 3BVNA 4S1DD 4Y4FC 1RIUH 5DYFA 5DEZA 3V4PA 2UY7B 4IRJA 2GSIA 4OQTH 5J7CC 2CO7A 4R7VA 3F12A 1NCAH 1R24A 3CBJB 3MRGB 1WZMA 4KKCD 5K9OA 4ZUSA 5A2CA 4GIOA 4M6MH 1BPLB 1A64A 3BYYA 3CLFL 1H3XA 3M46A 3QZWB 4J3OF 5HGGS 2B1OA 3HS0C 1RK0A 1MFDH 1HOCB 3VH8A 4P3CL 3TBVA 1MNUH 1LEIB 2C7FA 4GBXA 1E90A 4BZ1A 1KLGA 4MNHA 4PVBA 3BZEA 1MAMH 4LPXA 1CTMA 2H8PA 3EBIA 4I77H 4OW6A 5D1XD 1YN7A 3IDJA 1B9ZA 2VH5L 4M7LT 4UINL 1I7UB 1R1CA 1TCRB 1GZHA 1KGWA 1OSPH 2XVGA 3DTDA 3IS1X 4M1DL 4U3CA 3EKCA 3T6XA 4KAQH 5DLLA 1QA9A 3OKEB 3S3JA 2J88L 5DD5H 2VZ1A 1MDAA 3HPJA 3LKPB 1TEFA 1XGRB 4LHUG 3QARA 4ZOAA 1E3FA 4HVBA 3VXPA 2VL4A 1RZJC 1CXLA 5AZ2H 1WIOA 1TR7A 4GG6A 4NQVA 3JWNE 5ECJE 4PJXE 4MWFA 2LHAA 1X6NA 4LCCB 5DHMC 5JMRA 3ALXA 2AAVA 1MFEH 1CR9L 4CN4A 3N44B 4DJMA 3QYNA 4Z7VF 4DIXA 3H3BC 4KI5D 1INEH 4X6EA 1MFBL 2HKHH 1PLGH 1L7IH 4NM8L 5EMYA 4UNTA 3Q5YA 1QRKA 1S3RA 2NOYA 1TZHB 5DZNA 3CMGA 4AL8L 4GUPB 1B4LA 2XA3A 5J12B 1LWJA 4XVTL 3AXHA 3DPBB 5F70A 5FCSH 1FI8C 1TZIB 4OCWH 1KIQB 5J6HB 3CC5A 3NEOA 1FV1B 3BSZA 5FYLD 2DEWX 2BJML 3KPRA 3QEQD 2B3RA 1OE2A 4XCCH 3UL4A 3CX5K 3ULAB 3D07A 1ZHLA 3K2IA 4OCXH 1IZJA 1N2RA 2MOQA 3MACL 4X99B 4NBYB 4Y16C 5CU9A 2NNFA 1J8SA 2IALA 3GXPA 4FFVC 5E6ZA 4NRXB 4TUUA 5CZVL 4EUPG 1E2WA 4AY0A 3FQUA 2OL3A 4U3XA 5DD6B 2EKJA 1Z7JA 1OIOA 2VR4A 2EILB 4AVHA 3P9WB 2J71A 5DC4B 1PQZA 1F3RB 5IWLC 5IHHA 1JFQH 2R0LL 3M8OL 3QDJA 3VXTA 4KTDL 4LOVA 2WBJD 4M6NH 3UJTH 1P7KB 4NQSB 1OANA 9CGTA 1S7UB 4W9JC 4XP6L 3G6AA 3DLQR 4Z7OE 5E1GA 1EXUA 4LVHB 5H2BB 3GLDA 5H8DA 5SX4H 3O9WB 3IDIB 4V1DB 3VGAB 3W9DA 5E56A 2ZCLH 4LCIL 4WENB 5LGJA 2W60A 4U7KA 3SPVA 4PIRF 1NINA 2WQSA 1F56A 4KUZL 4MA3B 3LN4A 4FP8H 3VXNA 5DUPL 1P69B 3AMLA 4K2UL 5SV3A 2VDNH 3EYFB 1R4XA 4KK5D 1YMMD 3T77A 1UWFA 5DDHA 3PDDA 5LB1A 2MPAL 4LT7A 4XXWA 4UIMA 3DO4A 4FXTA 3V0VB 5EO9A 3BLPX 1PDKA 5ADOL 2JWYA 2IGFL 2GCYB 1NEZA 4KOCA 4G8IB 2VRKA 4NO0A 4G7QB 2QKIB 5KSAC 1NJ9B 3KYOB 2VABB 1L7TL 3QDAA 4OM1L 2WTRA 1FORL 2XZQL 1YNKH 4GLRI 1MOEA 1XTMA 3QJZA 3OG6B 4FQIH 2VNCA 5EOTA 1GH7A 1RU9H 3QJFB 2OR8A 2R2CA 2O30A 2WLKA 2B4CL 5LDUA 3SDDA 2NSXA 3WKNA 4LNRB 3KPQA 3QXAB 4OZIF 4PLKD 1XIWD 5BZWB 1YECL 4Z7VB 2NNAB 3ESPA 1SXNA 2EEFA 4L4TE 4XMVA 2YQGA 5TQ0H 3RHWK 4JHWH 1XF2B 2B7DT 3H9SE 4M48L 4DP5X 3G5ZB 3HPLB 4QRRB 3RY6C 3L5HA 4L8SC 2Z31C 2Z0UA 4YC2C 4IJ3C 3UPRA 4JDVA 5I8EB 4Q6IA 2DAVA 3MLTA 4XBMA 2YKLH 4YHOL 2QDWA 3C5XA 4QR7A 1AS6A 2KQMA 3MJ9L 1AGFB 4Z78A 5JUEH 1X9RA 1QKZH 2FB4L 2IGLA 3RWJB 4ZXBB 4U0RB 3HZKA 1VPOH 3RL2B 3OGOE 2HFGH 2J72A 1FDLL 1WRFA 3TBTB 3BKJL 2CR3A 2AW2A 1FRGH 2DQGL 3EADA 3DX6B 3L08A 4LKXB 3VXSE 2PTTB 4IGBA 5MENA 3T4AC 5ID1B 2J44A 2XX0A 3LQAC 4A67A 1BJ1J 1NDGB 4A7TA 4GKZA 3T8VA 4Y19B 2FO4B 4O51A 1G7QA 3HG2A 4JFZL 4ICXA 5FKAA 4JFVA 3P3YA 1RAMA 5F89A 3GSNB 4L1BA 4HT1H 3PYCA 3O2VL 1AXTH 3BXNB 1ONQA 4K3HA 1BYNA 1AQKL 4I0PA 3V5KA 3FN3A 3QNFA 5I1CL 4KXZH 5EUKA 1HHKA 1G7MA 1XAKA 3TA4D 3CU7A 5AOLA 5J6GA 1GAFL 2VXTL 2B39A 3MYJA 5KG9A 1E6OL 1M7UA 4JHUA 4X0KA 2IQAB 1F3DJ 4NQCB 4JN1H 4AZ8B 2YWZA 3GQFA 4D0BA 3MA7B 1BEYL 5HYQA 4D8PB 3O3DB 1Q9OA 2JKTM 1JVLA 1XCQA 5DVMA 3RVUC 1JZGA 1T21B 2HFEA 1T4KA 1JHLL 4IS6B 3T09A 5HGDA 5I73B 2BIPA 3EH1A 1HL5A 1MCHA 2CH8A 3K72B 5EOQL 2H3XC 1OSZA 2HJLA 3UGXA 1NM4A 4FQJH 3SCMD 3ZRCC 1YPZF 4G8GD 4MX7A 1FLTX 1E30A 3NPZB 3RVTC 3TBYA 4TSCH 1ZLVH 5IMLA 4XP5H 2BC4B 3PFUA 4HSQA 5LAXB 4OZIB 1EHNA 2VQ1A 4CILA 3CPUA 4KVCL 3S4SG 5I74B 1XZ0A 3V4PH 2CR6A 1QSZA 2ZYSA 2JH2A 1RZJL 2OPCA 5EEZA 3CAFA 3G6JF 1OGAB 4UIKH 3ULUH 3C5ZB 3ZE2F 4N8VA 1WQVT 1S9XA 3TWYA 3U79A 1CICD 4XVJH 4MZ2A 3ULVL 1EJFA 3PLYA 1BAGA 2DKUA 1AHWC 3CFEA 1OE3A 1S7VB 1SF3A 1AIFA 3NA4A 3AAZA 4NHUA 3NSJA 3CHOA 3MGTB 3QXWA 2BWIA 3ESMA 1SOQA 1ZA3B 1DFXA 3UYRH 4BZ1H 4MCYA 3BFQG 1HL4A 2GTZB 4B41A 5GISL 2EVFA 4S1QL 3WKML 3MRCA 4HCRL 4X80L 4NKQB 1E65A 2Z4QB 5CM1A 2G2RB 3L3GB 2XWXA 5L9DH 2GJRA 5ACLA 3S8GB 1GGIL 1HS6A 1IAKB 3MCKB 5J11C 2OFQA 4EF3A 1AKJD 3H9SD 1PY4A 4TLSA 2JJTC 3DTUB 3E1F1 3NRPA 4JQVC 4FKEA 2AMGA 4OLZH 3TBWA 1LGVA 3HUJA 4MQXC 3IRZA 4HKXB 4EJ1C 4JFDB 2QVKA 5EWIH 3WJMA 4KO6A 2EINB 4UNVA 3SDCD 4JG9A 3DECA 4M61A 3IDXH 4LSQH 3GI8L 2QZQA 3CQFA 1L0QA 4Y2DC 5AEAA 1TDQA 4MA7H 4BWUA 4ZMYA 4NRYA 1OAQH 3NZHH 4BDVA 4MD5A 1MLCB 2ERJB 3IGFA 4HK3J 3VXSD 2E0PA 1ZS2A 3D05A 1R3HA 3QCVL 4JRFA 4K8RH 5HYEA 5HVFB 3BSZH 2YRZA 3CVDA 4K4KA 4UM9D 4AK2A 4NUMA 2D8KA 3IFPB 1EAOA 1OCZB 2ED6A 2ZCHL 5DD1H 4NP9A 5GZND 3I75B 4XNZC 4MCNA 1DBBH 3LVTA 3MODH 1YPZB 3WXWL 2JJWA 3QWNA 4FLQA 1NMCB 4WSGA 3VFMB 3KYNB 3ZTNH 1Z5HA 1QW9A 3NA9H 4Q6KA 2CUHA 5C6WH 1KBKA 3ZE2B 3O6MH 5KVFE 5C0EB 4PJ5E 2Z35B 3U4BL 1K5WA 1I1AB 3P77A 4CW1B 2OV0A 1Q0XH 2QELA 4LGRB 2MQ0A 5GSVA 3UP6A 5GRUL 1JPTH 3EXLA 3D33A 4JPKL 2IADB 3HKZA 1AQMA 2VMJA 3WEXA 1EHLL 2V9QA 3CHSA 3QIUA 1OAKH 1FZKA 1P4BH 3DNKA 5T1LA 3FQNA 3SJVE 5TF1L 4L3EA 5EBMB 1QSFE 3H6JA 4AX3A 3RGVA 1DQTA 1XH3A 4E5XG 5L2KA 1S78D 3QNYB 1GMIA 1QP1A 5F9WB 5DEFA 1KYDA 4JO1L 4NKIL 4KY2A 4M7KH 1W0VA 2WXMA 3S2CA 4XI5D 3NSFA 5D7IE 25C8H 5AOKA 3VXRD 1SF5A 1BX2A 1HZHH 5C0GB 4MVBC 5CKGA 4HGMA 4NPKA 1WC7A 4JQXA 4Q74A 43CAA 2Y69B 3A21A 4Y5XA 1DE4A 4M8VA 4JZJB 2EUVA 1FYTD 1BFOA 2P26A 1TZAA 3KG5A 5AZUA 1PAZA 1N6QH 2I85A 1ZTXE 1J5HA 5A2FA 5CZXC 3BHBA 1DHKA 4F8NA 4NQDA 5I19L 4P5SA 2QGCA 2IIJA 1H0DB 2VLJE 5D1ZD 1MCNA 3O6FC 4FG0A 4PRAB 4PGDA 2DM7A 5IB4A 4PTUB 4PUBH 3S5YA 3PU7A 2Z91B 4KU1A 1EPFA 3Q6FA 2R83A 1QX1A 2AQRA 3AUVA 4XO8A 2X6BA 5JLZB 2X0WA 4C4BA 5GJSL 1JYVA 4FKKA 1CYXA 1TQCC 3BAEH 1IL1B 3S97C 5CGYD 1IEBA 4J3VA 3K6SB 1BZ8A 3HEIB 5EUOA 3D25B 4QRSB 3CFDB 3TJEL 2CKBA 4PREA 5HPOA 2H41A 4LQFL 3STLB 2IPTL 4ODUB 2DIJA 4MXQC 4NLHA 2Y22A 2FECI 2V2WB 2WVTA 4ISVB 4MCZB 3SYOA 2DWEB 2J8OA 3U2IA 1BOYA 2PR4L 4LLQB 3L54A 3MBXL 2EYSA 1PLCA 3QUZC 1DJXA 5JPNB 3REVB 1GYVA 5D1XA 5FYKE 3DROB 3TL5A 5DFTA 1T2JA 1VADB 1L9PA 3HVNA 3O3AB 3NABH 2R29H 5JHDE 5CJXC 3K71A 1Q0YL 5F7DB 2EEXA 4WQOA 2DQEL 1LO5A 1AZCA 5FXCH 1UKQA 4DK5A 4Z76A 5K9JL 5CFAA 1B90A 3KW7A 3H9HA 5K33A 4Z3GA 2EUZA 5F1IA 4HX1A 1IGTB 4F7PB 3NTCL 5HGAB 3HJ0A 5L6YH 1S5IH 1FFQA 3QWRD 3UABA 2PKDA 2P48B 3A3YB 4X7SH 2B0SH 2Y2WA 1PKQB 3EOAB 2ESVE 3VQMA 3V5HB 1X5FA 5IZ7A 3SYAA 3P0YH 1MRCL 4M8RA 1WV7T 4RFEA 1V7NH 4LLUB 5IK3A 4OLVH 4EVNB 2UXFA 3EO9L 3W11C 3MLWH 2X41A 1P6AB 3PY9A 4PJ5D 3KPLB 4WGWB 3BEWB 2OQJB 4PP2A 2AAAA 4KWUA 4E41A 3VWJC 4NCC2 4GSRA 3FOLA 4G59C 4QXVA 3VWKD 2X70A 1O7VA 4N87A 1N8ZB 5DQJB 1OCWH 4OKDA 1XDTT 4PB0H 3RPIA 1YYLH 1REIA 1SDYA 3SJVD 2JI1A 4TULL 4JS7A 5DUMH 1ITCA 2G9HA 2BCKA 5BV7B 2ZKXA 2E7DA 1CLOH 1SMOA 2GAZA 2DQFA 4JRYE 3L4XA 4HJJL 4QRBA 4KFZC 4Z7UE 5FA3B 4HJIA 2E8ZA 4AEHH 3P40A 2HT3C 3WNJA 2X6VA 3BAJA 4OV5A 1WHOA 1TQTA 2H3NA 2EIEA 1CGWA 4EKXA 4IRSB 3H9ZA 5HYJA 3M17A 3O8XC 3QH3A 2DM2A 5I16B 2QR0A 3QUXD 2VC2H 3EO1A 5KS9F 4HKJA 1DQQB 2FBJH 4Z0XA 3V8CA 3FQXA 1ZIAA 3I9PA 1ZLUK 3NIFE 3GJFB 2XXFA 3LZLA 1D5IL 4PS4L 4AUJA 3L3DA 1DBKH 2ZOUA 2VLJD 1Z1WA 4JO5A 5BW7A 4A6YL 1QI5A 5IF0A 1YMMA 3R1GH 4M7LL 1JK9A 2I9LB 2OSYA 1NC4D 5AKSA 4GW5B 2WMPA 1BECA 4G6AD 3EYSL 1P2CB 4YK4B 4HWEL 2H47C 1MCCA 3KCWA 1OP3H 1J12A 1NCUA 4GS7B 4HC1A 5CJOL 4ACPA 4FHJA 4RGOL 6TAAA 2VTFA 4NZRL 4R2GC 1JI1A 1N59A 1ZEAL 2KI6A 4ANXA 1MRDH 3RTQB 5J3HD 4WIQA 5AD0B 3MMEB 1ETB1 1A1OA 4UDTB 5JDSA 1JNNL 4K55A 2AQSA 3GSQB 5E8OB 3O2DL 1EZLA 2ZXGA 1XIWA 4JG0L 4XCFL 2UY7A 1SRDA 3VH8G 4ENZA 4JL1A 4P4KB 5F97E 2F74B 1TTGA 3RWIB 5FYKD 4UV4H 2Y7SA 3SKOA 3MRGA 3KZ8A 1PL3A 3L5XH 4FZ8H 1TZ8A 5JHDD 3QDME 1NLDH 1NQBA 2ZYRA 3O41A 4ZK8A 1MIEL 1DUZA 5EU5B 3F58L 1HSAA 1XR9B 1R3JA 4UF7C 2OMTA 3F85A 5DZOA 2UWEF 2DI9A 1QSEE 4UB0H 4G82A 2NXYD 1TYJA 3C6LC 4WWKB 3WU1A 5C09E 4OB5L 4B9IA 3VXOB 4FI7A 4HS8L 4YPJA 2XJKA 3HBQA 2EDFA 2ORBH 1TCRA 1HSBA 1ETZA 2ESVD 4MNQA 5AAWA 4Y1AA 5K9QI 3CSTA 1HILB 2F53E 2W91A 5D2NE 4JBSA 3D8MA 1NLBH 1CFQB 4RFOH 5CF3A 3RVVD 3CN3A 5CMAB 2CM5A 4LU5L 3VRIA 1EZVX 3QP3A 4WU5B 2XX1A 5IMOB 4UYPA 2Q7YB 2HT4D 1INQB 3FYEB 4PB9L 1DJWA 5KS9B 4K94H 1QZ1A 1AZZC 3WO4C 2JKSA 1YEIL 2O6DA 1J0KA 3ELQA 4U6XB 5CFHA 1E9OB 1HINH 3DXAB 5I0DA 1G1KA 3OLEA 4FQXC 1BAWA 4OBRA 3MOAL 5A7BA 1HEHC 5EA0L 3RKDD 4LARL 2J3SA 3AREC 3KW8A 4OCSH 1UZ8A 4GT7A 3SZKC 2WYHA 5LXGL 1GZPB 4PLNC 4HWBL 3RIFK 3FXIC 4PBDA 4F7MB 3SCMA 4OCNC 1N0LA 3BP7B 2ENSA 4OT1H 6FABL 5IB3A 3DYPA 4G8GA 4N2DA 1SXAA 4E9RA 4X4XA 3SYPA 1BVLA 1DQVA 2XYCA 3D09A 3E80A 3FPXA 1MIMH 4Z5RB 2OJ1A 4G5AA 3SDXE 5I1IL 2QQKH 4AI7A 4WO4B 3EJJX 1L9OA 5A3ID 2DMGA 5AOJA 5TDNB 1OD7A 4XWOC 3X3GL 2PPDA 5D6CB 2FVNA 2P8MB 2CKBH 1CICA 3B7RL 4FQCL 4IIQA 2O5YL 3VU2A 4YXKL 1KBBA 1AXSB 5IVXF 4B0MB 1U8QB 2UWEB 3K46A 3HI6H 5MEQB 1Q0EA 2W0FB 3EYFA 1UFGA 4QTHB 2WJ7A 4P2QB 3HR6A 3LD8B 4NZUH 2PO6A 3SOTA 1OCRB 1I3RA 5HHVL 1I7TA 3CU1A 3V0VA 3U1SH 1SJHA 2BFVH 2OX5B 3UBXB 3E2HC 1TUPA 5CILH 3IFLL 1N68A 3I02A 1YC8A 3FHAA 2ICWI 3WIFA 1Y6MR 4FMFA 4EIUA 2YRBA 1KTBA 2I5YH 2EDWA 5LWYL 3FFCE 5C9JB 1I82A 1AKJA 3H9SA 3RDTD 5INDB 3IDGA 3QDMD 5HHMB 4JDTH 2XYBA 1GR7A 4LVNC 3TNNA 5C0JA 4RDQG 3RNKA 2CMRH 3VXMB 3VFGH 2VUYA 3B7SA 2N7BA 5J89A 2WVVA 3C08H 4HCGA 4ORGA 2V2XB 5F1KC 4Q9RH 4KKAC 3V9CA 3S37L 1AGDB 4J1UA 1QSED 3C2AL 1KCUL 3BH4A 3HE7B 2VDRB 4PV8B 3TIDA 1JF1B 4Z0BL 3EJPA 3A22A 1N6VA 2ZP8A 4QXGL 2VISB 3NK4A 1Q72H 3HPLA 5DS8A 4YVUA 4OI7A 1UENA 5DHEA 4KPHH 1KJ2L 4WV1C 1JWMB 4H0HB 3IMVA 1QUNB 4G43A 4LLMA 5ANMA 5FYLH 2DD8L 2F53D 5AL8A 1X5ZA 1AGFA 2CXKA 4UM9A 5DGQA 4KOBA 4OCRH 1NCCL 4JPWH 4PRPB 3CPLB 4YEEA 2OJZH 2V7HB 4F27A 5D9SA 3TBTA 4Z8FL 1M71B 2YD3A 4DN4H 2H2SD 2DDQH 2PTTA 4OVVA 4GXFA 3EG9A 1I8KA 1KLUA 5LBSA 2E27H 1AACA 4FS0A 4L9DA 4NOBA 3QNXB 4J3BA 3H2WA 3KYAA 2NX5B 2WWKO 5FECA 3QJXA 2DQCL 3QG6B 4MGXA 2B16A 5FUCE 4XXDA 3GSNA 3F6JA 2OMYA 3FUEA 4WWOA 3BXNA 5DMGD 4I7ZC 1GTNA 1T2XA 3VSUA 3Q06A 1QFWL 3EH3B 4HKZA 4DZ8A 2QLYA 4UMGA 1BJ8A 3HHSA 1G7LA 5IVXB 4CSPA 2WO4A 3T2PA 1GOGA 4YFDB 4W4OC 5LGHH 3BISA 2HA1A 2HLFC 1U3HC 1WA1X 2KLSA 5KSBF 1D5BB 1A6UL 1PCXA 2DBLL 3BAKA 1DQML 2VDLB 3T8XA 3WGVB 3LIZA 4IS6A 4OF6A 3QI9C 4YBHA 4HC1H 5ERWA 4BD4A 3H3PL 2PMZA 4BFIB 1YNLH 2MOVA 4WUUB 3QQNA 3WS6C 5H35A 3UAEA 3ZE0B 5IR1A 2XZZA 3BP5A 4LSVL 3VXRA 4DP4X 3WFEH 1RVFL 3N3EA 4LFHD 1VFAB 3G5XA 1FYTA 3RWCA 4F7EA 3BQUC 2X88A 1H3UA 3S8WA 4GXUM 4JR9H 3W82A 5DJYA 3B56A 4PU2A 1CDCA 4JREC 3B34A 4NDMA 4JO2L 4NYLA 1U8NB 1X5YA 3BP6A 5D1ZA 1FNGB 1X9QA 4DW2H 4Y4HB 3UO1H 2VGLM 2FR4B 4D3CL 1CGTA 2GTWB 1QI4A 3MRRB 4UUJA 3P02A 3BKML 2EE2A 3BN9D 2W38A 4H20H 2WQWA 5BMFL 2BNRB 1ZA3A 1GGUA 3PWLB 1HNGA 2VOTA 2WY3B 1DVFC 3L1OH 2WXJA 5FA4A 4J12A 3KPNB 1HJCA 2OMUA 2EO9A 4OGYL 1U8JA 3ZGHA 5DZLA 5EH1A 5I76A 1JAEA 3KYKH 5JHMA 2VN3A 2ZUQC 3VMNA 4BINA 5ICZB 3MCKA 2HX8A 3INUL 3EJTA 5C2BL 2ZP0T 3BIAX 3LB6C 4LPWA 3F84A 4NNXB 4YDIH 3D2TA 3G7TA 4ODSH 5HY9B 4I3RL 1GPOL 4IRJC 3PGCA 4KZ0A 2VN7A 1HXMA 5LNEA 4CNIA 2MTAA 2V17H 4I1RA 5IHBA 4UTBL 4A37A 1BAFH 4PJAF 5INCB 4KO7A 2BVQB 4O00A 4H5SB 3KPSB 3KLLA 2BRQA 3H6AA 3QFDB 1INEL 1KCSL 5KVDH 4L8DA 1CTOA 3SBPA 1ZWIA 1OM9A 3BMVA 3VM5A 4DZBA 5I0XA 2E7LC 3OD3A 3ZL4H 4NN6C 4KQ4L 4FA6A 4ZO6A 4GBXC 1TJMA 3MJ8A 3QWRA 5DJ0B 2EXWD 2Y2TA 5KSBB 1F6FB 1F0LA 4NUQA 5B3JF 3ZTEA 2NUPB 1A6VH 4NT6A 5TFSH 1RCYA 2AVGA 3IFPA 1T7YA 4XBGB 3HBZA 4PS7A 5E4OA 5K39A 2AJSH 1S7XB 4GJTB 1UUNA 4X8XA 3A5VA 4OCXL 5HGHB 1YPZA 2ICWB 3KM1A 4PJ5A 4OZGF 3MO1B 3CVCA 4FG6C 3DETD 3ORJA 4YL9A 4O2CB 5IQ7H 3Q6GH 2VM3A 1ZA6B 1LK2A 1XSOA 4GQZA 3CFIC 3OLDA 4F8TA 4X7TA 3VX1A 3LRHA 5C0IB 1XGTB 2DQDH 3G6JA 1BFSA 2IPKA 5DMYA 4H4NA 3VQ2C 5ABDE 4MLSA 4PRHE 3I3BA 2WXNA 1RK1A 3RKPA 1B3IA 3RP1A 5BVPH 2GBTA 1T3FB 3EGSB 2UZXA 1UD8A 1D2PA 3D0LB 4P5TD 1BZ9B 4C56B 3HC2A 2CWRA 5DJZB 5D7IA 3ASNB 1CE6A 2NY0D 3O45B 5PCYA 1SN5A 1BQLL 1P5UB 2W94A 3SD5A 3DK2A 1UD5A 5CBAA 3BIKA 5CNHA 5DK2A 1JUFB 1A6TB 1BD2D 4UTAA 4WI2A 1MVFA 3QUXA 4TF4A 4X4ZA 2A6IB 3B2UC 1INDH 1VAHA 4ODWB 4GSUA 2XY2A 3QNYA 2X2HA 3S34H 3QJRB 1JSYA 1F4WH 1T1YB 5JW4Q 1BVOA 3KL0A 5B8CB 5KVGE 4ESKA 1DTUA 1NC4A 3NJFA 2A7BA 1JF6A 2EZ0C 3EBHA 5GJTH 4N0UB 1IV8A 1CJYA 3MGAA 4XB3A 4GG8B 3DWTA 3WTSA 1HZLA 2HP4A 4PJAB 4A7UA 3FT3B 1CFVL 3MNVA 2DW5A 2XICA 2I7OA 1KPRB 3IAGC 1JGLL 1VIWA 5J9PB 4KGJA 4G3YH 3MRLB 3S2AA 3KDPB 4XWGH 2ITEA 5BS0E 4PWJA 2LVCA 3OF6D 1KFGA 5EOCH 1Z2KA 2X1WL 2BVUA 3GSVA 2DH3A 2JKJA 4AZUA 2P5WE 4UQ3B 4XXWC 1MJ7L 4JL2A 5IVZB 4D9LL 2CM6A 5BXFA 1J5CA 5D8JH 3GLAA 4WY7H 4NCC1 3GK8H 1TSHA 4FMVA 4YNYA 3CXHJ 4FFWD 4LPVA 4G9FD 1ZE3H 3UDWA 4OZGB 4PWEA 1SVCP 1BIIB 2MQ3A 2YGVA 3OKLA 5LBSH 1MCRA 4N26A 4CU6A 1R5IB 1U36A 4KJPC 4TQPA 4N8CH 4R6UA 2X1OA 1XGPA 3CFTA 3I85A 5I1AB 3GHPA 3GSNH 4LXFA 2EYTB 4HMCA 2VMEA 3I9IA 4G7VH 4ONOA 3IJYA 5F7DA 5TD4A 5T5NG 3T8MA 2NXZD 3L16A 1PZ2A 2FWLB 2F54B 5E6RB 1UUSA 1MAKA 1KGCE 3BAIA 2DYPD 4TQEL 4DH2A 4FYTA 2HRLA 4JKLA 1KT2B 1S3KL 5E24E 4JFFB 4JFEB 4F7PA 4LLVB 1QFPA 3Q2NA 5I18L 2N0MA 3BLKA 4RAVA 2WZ6A 4NBZB 2Y7LA 1VENA 1DJGA 4PGZA 5KN5B 1U21A 4H40A 2P24B 3DRQB 5E2TH 5DHVH 3LIZH 4F7TA 1DVZA 4YDKH 3HAEA 1SNRA 4K7FA 3MRPB 4LLUA 4I5BA 2J1XA 4IGBC 3UTPD 2B59A 1OP5H 2JELL 3QEGH 1AS8A 4J2QA 4PRHD 1QO3B 4AT6A 4PWFA 3FQRA 2XRAH 4XP4H 5SWSD 3BYTA 3S5ZA 5EZJB 2YUZA 1W0YT 1JPSH 5DQJA 2BFGA 1TTUA 2C26A 4LSPL 5AYUL 2KZ1B 4I0PC 5CCHE 2R39A 3CDFA 2C1OA 3CN2A 3CSGA 1B4JH 2ZPKL 1JS4A 5CR8A 3O4LD 2AJ3A 3MRJB 4FCAA 2X44D 4HOXA 3MLRL 2K45A 3VFWA 5GRVL 4L1HA 3DPDA 2JKIS 2R4SL 5GGRY 4NRZA 5C0AD 3RWDB 3U0PA 2X0UA 1LLAA 2FJFB 1T2QL 4G72B 4C4KT 1H5BA 4WUKL 2DJSA 5AWNH 1VJSA 3CQPA 1F4HA 4PR5A 4AH2A 4EI5B 3ZMRA 2ATPB 3NCBB 1FGNL 1G6RL 4XPHL 2CHZA 2X9ZA 3FTGA 1KOAA 2CUAA 3CDYA 3NJJA 5IHWA 1OTSC 1JNLH 1BG9A 2Q6WB 2E47A 3HNVL 3EFFA 4PD4J 2H4EA 3DV4A 1AD0B 1SYSB 2YK1L 4AYGA 4M4RB 4M5YH 1AQDA 1M2OA 3KEHA 4UNIA 2I9LA 4YE4H 4ZPTB 2P5WD 4HBCL 1MY5A 2ATKB 2HKFH 4FNLL 2CR0A 4G8EA 4JY5L 2FBRA 3V9EA 3RDTA 3QEQB 1JN6B 3CFCH 3IDXL 3LX9A 2CU9A 3QUYB 4LASH 4N2MA 1ZLWK 4FG4A 4Z6AT 2EE9A 5J56B 3CZKA 3KJ6L 3WY1A 1C5BL 1TVBB 5L4JA 2Q3XA 3D4GA 3WJLA 2QPEB 3VM7A 2E4FA 3OWRA 3H1ZA 1K3ZA 4AIXA 4ALAC 4W9KC 3CDGA 4NZ8A 2G5BB 4K3JL 2F5BL 1NAMB 1K4CB 2P5PA 3VFNA 4JPIB 5IT2H 4KJQC 3E8UH 5I17B 3FSWA 1VKXB 2X4UA 1RUKH 5ALCL 1HHGB 4OLYL 3HLAB 3DVGA 3LN5A 4ABQA 4XO3A 3U9WA 4H1LB 3HS8A 3LKOB 5T1KD 2QEJA 2VDPL 3UJIH 4ZMOA 1ZT7B 3Q0HA 3BZ4A 2MCPL 2F53A 4KY1H 4LCWE 2OL3L 5DRXB 1DBBL 5F96H 1X5GA 1KGCD 5J1AA 2D7NA 3PGFL 5AKTA 5FO9A 1U93B 3NCYS 1Z0NA 3VXOA 2D31B 2X1PA 3GO1H 4KQ3H 2Q8AL 3WLBB 3EJYC 2BNQE 4LOUC 3DO7A 2YN5A 1AJ7L 3NP4A 5JNYA 5ESAA 5GSRB 1SHMA 3HCVA 1HILA 3GPSA 1JTOA 1UT2A 1F4YL 2LR4A 2BXYA 1CLYH 2ZJSL 3MBED 5FFGA 3QQ9D 5CMAA 3K6OA 5C0DB 1USZA 3AS2A 2EDYA 2DMBA 2BSEA 4Z7OF 1J7VR 1T5WB 5B7FA 4UTAH 1INQA 1V05A 3WKQA 3ZR6A 4C58B 1L5GB 2ENPA 4IBZA 5ICYB 3DVNB 4W9FC 2XXMB 1ZTXH 1JNHB 4LE8A 3ROLA 1KJ3L 2ADYA 4EBQH 3BD4A 4U6XA 4YIQB 3N50A 4UAOB 5KVEE 1IX2A 3AU0A 1CG9A 3MYZA 4FFZL 2APSA 3G3LA 5GGVL 4LL1A 5JOPE 2BRRH 2R4RL 3UJJL 2XV3A 2AJZA 3VVWA 2QGDA 2GFBA 3I6SA 3EYOA 5C0NC 2EH8L 3OPUA 1YG9A 2YARA 4XPAH 3ZUCA 3L6FA 4APQD 3X1FA 3T0VA 2WLIA 1HTYA 1N7MH 3F05A 4L8CB 1DL7H 2C3XA 3E3QC 3EBAA 1UWEH 1W0WA 3NCFB 4BUQA 4F7MA 4UDUA 3L1EA 1MZYA 1U91A 4MS8D 5JPMA 1I3GL 4WW1A 4OZHA 2BX5A 2FIKB 2YR3A 4PJXB 4NAQA 3Q48A 4AXWB 1ND0B 4AYEC 3RG1C 2HRGA 4LF3B 4OD1L 2XOTA 4IK6A 3QYMA 1ID2A 1MI5E 4N8PA 1TT6A 2VXQL 3BFWA 3RGVC 2PPEA 3T6QC 2FH8A 1E4WL 3KWVA 4K94C 5F6IC 5AVWB 3UTTE 3SBQA 1ZV9A 3WFCL 3GMRA 5F0MB 4P4RA 3SO3C 1CE1H 5L7XH 1GZQB 4OKVA 3ZHDA 2ZCKH 5AW0B 5GRXG 2V2TA 2CHNA 1U8QA 3JVFC 5MEQA 5HVHC 4JM2F 4KVNH 1M3IA 2FNWA 4MMXB 2ITCB 4XC1L 4P2QA 1AO7E 3CD4A 3UBXA 5A16A 4HUNB 1AOZA 1A3LH 1F4XH 4NN5B 4L1SA 2AQPA 3NJNA 3WN5A 1JXGA 4Y5YC 2FQDA 4X83A 1LO0L 3Q8AA 3DOIA 4HH9B 4B50A 5CEYB 2K3HA 5GS3A 1DBAL 5DK0A 1CC3A 4QXWA 3ZYOA 1AGEA 4DPCX 3VXMA 3T2NL 4ZTEA 4X0NA 5C0BB 4Z7OB 5K5YA 5KSVB 2D7MA 4LCWD 3BGMA 1CVRA 1Z5YD 3L4TA 4MQSB 3BDXA 3KBFA 1IGJB 2QPSA 4Q2ZB 3RDJA 2JIXD 2BP8A 3D52A 3NDZE 4AEIL 4ZQTA 4ZTOL 1IVLA 3NCMA 3AY4A 5E1IA 3BC9A 1NL0H 3HAEH 3UGEA 4QNPE 2R0KL 4GQQA 2YD1A 3VACA 2BNQD 4C54A 3I6GB 4P2AA 2WIIB 4QRQA 1HHJB 2FX9L 1A3ZA 1F00I 4GAGL 4WDIA 2Y3AA 4NNPH 2IANB 3CHQA 3LHPH 1TYEB 3FTXA 2WNWA 3FN0L 3T6ZA 3FB5B 4ODXA 1HDMB 3T3PE 5C6TH 1A3QA 4HXBL 2EUXA 4XZUB 2VITA 2FYYB 5E2JA 2PW2B 4R4FL 1IGFL 2D03L 4U4BA 5AZEH 1AY1H 5DA4A 4QJ3B 2CLRB 2OAAA 1WEJL 3R06B 3S3BB 4JJ5B 1U6AL 2RH0A 3WNIA 1WWBX 2CBTA 5KBLA 3GXUB 3K2UH 2HG0A 3EJQA 4RGNC 1YEHL 2H32A 1DP0A 2X4NA 4NWTL 5CGBA 3ZK0A 4L4TB 2X12A 1GGTA 4AW4A 4FNSA 4ONGL 4UILL 4E0RA 3ZHLA 4K9EL 2QADB 3K74B 1MWAB 4FEMA 1IM9D 5DTFB 1W8NA 3QZPA 1I1RA 2FWOA 2QMJA 5DRWA 1RI8A 4ALAL 2LLLA 2EABA 5DSCB 3QDGA 2RQ8A 4P5TA 3SDCB 2JKLA 2O5XH 4JM2B 3MNWA 3P0VL 4M7JH 1GA2A 3OQRA 1BD2A 4FQLH 3UIZA 4TS6A 3II1A 1JZDC 1RJLA 5DVOA 4N5ED 5IGXH 2N7SA 4NC1E 2ADIA 1VGEL 3TV3H 1OF2B 4WK2B 4OF8A 2XG4B 3LNIA 5C07B 1UH4A 3ASOB 3IKCB 1NWPA 1ANUA 4U6TA 4YLQT 4AJWA 3FN9A 1IILE 4HGKC 3DYMA 1K8IA 4QT5A 5EG6C 4LSRL 2K6WA 4HJSA 2B2XH 3DV6B 4EIBA 1NGXB 3PHQA 2EIBA 5E8EB 5DYOB 5I6XC 4PJ6A 1AMXA 3HN3A 2AJYL 4TLUA 2CHWA 3ZQXA 3IETB 4G6ML 1ROWA 3QUMA 4NS0A 1CDHA 4PRID 1Z5LA 2CDGB 3N55A 3FCSA 5D5ME 1R3LA 2H1PH 2XN9E 1JFHA 3BH9A 3PXLA 5EB9A 4X4YB 1AO7D 1WJ3A 4S0TD 5E8PB 2JB6A 1JRHH 1O6SB 3V2AR 2YD5A 3RU8H 1UD2A 3GHBH 4LLWA 3HN8A 3RIFF 1G1YA 4FLHA 2X2JA 5BW7C 3OF6A 4GRWF 5AOMA 1PZBA 3H55A 4ODBD 4ZFFB 1DJHA 3W0WA 2R2BA 5LXVA 3UTSE 2BNRA 4NSKA 3MUGB 2NY3D 1BZ7B 1M4KA 2IPUK 2D0FA 2IWEA 2Y36H 3EFOB 5EO1A 2HN7A 3K6IA 4LCVA 4UB0L 3IAPA 2X40A 1YRKA 3LEXA 3BE1L 1NDMB 2EE3A 4QJ4B 1GJIA 2N56A 1FWXA 3UX9B 4IDJL 1NFIA 4G9FA 5IEHA 5ICZA 5CLXA 1N3NA 5FIEA 3U0WH 4XNMB 1FCCA 1ZDSA 3DHUA 3V5DA 3UIYA 2YGOA 1BDYA 4ZAKB 1T5KA 3LKSB 1XIWC 3KLHD 1WAPA 1L9NA 1PSKH 4OI8A 1HYSD 4B96A 4P2RB 1NLBL 2ZTBA 5I1KL 2YJLA 1E43A 3U25A 4A04A 4OJFH 2VLME 1Z9LA 2Q76B 4AQOA 2VXUH 1XR8B 1QRNA 2HVKB 2J6WA 1D6EB 3D9AH 3OKDA 1ASOA 3QFDA 4XPTH 1ZY9A 1E9PB 3K1DA 1NCNA 3A67L 1QOKA 4MJ5A 4P5KB 3ZKND 1KEMH 4I48B 5FW8A 1QLFB 4RIRB 2WTOA 3SE4A 5EOCJ 1A4KB 2FWUA 3AFLA 3NFPB 4J4PD 1FZMB 4CBZA 1EO8H 1MFUA 3EGDA 4JN2B 2EEAA 2ZD0A 3UYPB 5CSGA 5AAWC 1H3GA 2DV6A 2BP0B 3GXNA 3SDAD 4M1GL 4PRHA 2CLZA 2ICWA 2YKKA 3MO1A 2WWKT 2RALA 1JJUA 1FP5A 4OJYA 4LSDA 1MHEB 3EOBB 2GC4C 2QKSA 4YDVA 4HU2A 1KN4H 5SWSA 4LCCC 5ITBL 4JKWA 3FU3A 4TUOB 5E9DE 1ZA6A 4KUCD 4DZ8B 3MFFB 4JZNB 3P9MA 4K3EH 1I1YB 1X5KA 3WDJA 3DRTA 2QLVB 3AM8C 1Q9KA 4Y2OB 4QRAA 1JGIA 4GOSA 1FZOB 2J4WH 2L0DA 3JVGA 5I30H 1J0ZA 5J12C 3O4LA 1FNSH 4GRWB 1O7SA 3EGSA 5CD5C 4EN3D 5JQIB 4GPVA 2WLMA 1ILSA 4F5CE 5C0AA 3WAKA 1OEZW 2EDXA 1AFVH 4BGLA 4DP6X 2QVFB 4JLRB 5KOVC 3EZ8A 5GS2D 3PS6A 15C8H 4K23H 1KENL 4FL4C 4LQ1A 3VO0A 3L9RB 3Q01A 4R0LA 2PPCA 3BMWA 4ODWA 1CD1A 1T0OA 1VB9A 1FO0B 3KLKA 4F3FA 1BIHA 3LKQB 3EHBB 3DUUA 1X5LA 1DQDL 1E40A 5TDPA 1OK0A 4F2ME 3V6FB 1KIUB 4EN2A 3IB4A 2X87A 3NH7L 2WYZA 2F15A 3I9AA 3RWEA 5F7FA 2NTFB 4OH2A 1ETJA 3H0TB 3HMXA 2P5WA 2HKAA 4L3AA 1ZT4A 4LVHC 3QT2A 2VDRH 1RL1A 1BYPA 3FT3A 1RUQL 3HHRB 3O9WC 3VGAC 2YD0A 2LABA 4GEIA 1KEGH 1KPRA 1WD8A 2VWEC 4J3OC 5GGSB 2NSMA 5LQBL 5FDWB 1KB5L 2WBWB 1IFHL 4GRLB 1QBMH 3VWKB 4K7PY 4ENED 4LLDA 1QR1B 2FX7H 1E7UA 3X12B 1LQSR 3BCFA 3BWAB 1H6TA 4NGHL 2Z7YA 3SJVB 2PO6C 1QSFB 2GK0B 4FNTA 2VN4A 3EFDL 3GRBA 4NNYB 4XB7A 1PFCA 3DARA 3NN8B 4IJTA 4ELDA 5ISZE 1QWUA 1QVOB 1NPUA 5HI4C 3AT0A 2EDDA 3CBRA 3ABKB 4QHMB 1BBJB 3FB8B 3GEFA 2VM9A 4H88H 4KZEH 3FONA 1FAKT 5DJXA 2ALWA 5JQ6L 1AG0A 4YHLH 2WYTA 5EC2A 4YWGL 1DANT 4K5MA 5IG7A 4OLEA 5DU7A 4NWUH 2H32H 1XEUA 3BDYL 4M8UA 3W57A 1RJYB 1U8CA 4LESA 1XMWA 3QULB 3IS0X 3TCXA 3U2JA 1NOFA 4JO4H 4B9FA 4RMRA 5I1AA 2M1KA 3JUYA 4I1PA 3HG1D 2VLJB 2ZX7A 1E0OB 1RSYA 4DKEH 3AWGA 4KFMA 4Z7UF 5F1NB 2AI0L 4BFEA 2J2ZB 4AM0B 1J11A 3HAEG 2O6FA 3MBEA 2NZ1A 3CQQA 4JFFA 3L5WB 1E27B 4QJ5B 1U8PB 3CVHB 3GRWA 4S0HA 1U3JA 4IOIA 1A14H 1N18A 3B1TA 2A6DB 4KJYB 4U0RC 2R1YA 4ZFOB 3MNZA 3LXCA 4GW4A 4JFTA 4JRXE 4P46D 3NIFF 3NFSL 1NFDF 3FDWA 3JT2A 5A43C 3AZUA 5FUZL 4AQ1A 3KBPA 1ZE3C 2C7UA 5B3SB 1RJZA 4GKNB 4OIIL 1TIUA 2BZDA 3U1PA 1BCIA 1MCJA 3TEUA 4A7GA 3I84A 3VFTB 3TPUA 2IDSA 3IU4H 1RULL 2B1AH 2EDEA 1FHNA 3P2TA 4WFEE 3QUMH 2ZNXA 3JZ7A 3ARBB 3ZX1A 4GI6A 2XG5B 1I1CA 5KSUB 3O4OC 3S35X 1I4FA 2JK5A 4UQ2B 4TNVK 3WFHB 4G80A 3DX4A 4M1CD 5AW3B 1OPGL 1ZV5A 1UT1A 1L6ZA 2DOCA 3MRJA 4D7BA 1P7QD 4F57L 4QRUB 2NY2D 4F37K 3POCA 5E7BA 5LLIC 4GSDH 3U46B 1RZ8B 3TYGL 2B15A 5IROC 3UG5A 5GS1B 1YUKB 2ESVB 3L1GA 2ZX9A 1O9WA 4OU3A 1YEFL 2CCLA 4EI5A 3FK3A 2AJXH 2FJHA 4DFHA 4P04A 5I73C 1A7RH 1C16B 3B2XA 4IRZL 2OSLB 3E6HB 1JCKA 1Z66A 4L4VB 4NBXB 4X6FB 5HDBF 4XI5C 3AUWB 2VXVL 3U7AA 1X7QA 3DGDA 3KJ4B 2Q6WA 4XOEA 3THMH 3ZXAC 3KYKL 4M62L 1SN0A 4NAMA 4ZPVB 2EVIA 4AWJC 1FG2B 5I1HL 1P0SE 5I74C 4YSPA 2Q0ZX 3IMSA 2Y9RT 1XBRA 1UM6H 2WOYA 4ZPTA 2UVFA 4Z77A 3C5ZC 1TQBB 5DJ8A 3MZGB 5D1ZC 4JRYB 4HEPA 2DB8A 3U9PL 4BH8B 4Z7UB 2OZ4A 2AQ3A 1XZWA 3MRQB 5GGQL 3UP1A 1FIGH 5IUSA 4WK0B 2W07A 3K8KA 2NDGA 2TSAA 1U3YA 1LMIA 2Z8RA 4GQ9L 3TASA 4ZMWA 5CGYC 2YFOA 3T1FB 2X10A 1T5XB 4MMZA 3OPZL 5KW9L 3N85L 1SLUA 5DD0H 1HQRB 1U8MB 3NIFB 4MAYB 3GSUA 5DVNA 1NFDB 3G08B 1C08A 3L4CA 3O2WL 3UADA 4C55A 2VCOA 4O02B 3KPPB 4N2BA 4H1LA 5DJ2B 3FCTB 3SOBL 1WFIA 3TO4A 2UZIH 2AJSL 1V5JA 1FSKB 3EOTL 4JM4L 1XF5B 4P3DB 2YPKB 3F3HA 1CF1A 4YDJB 3EO0A 4NQXB 1EMTL 2Q1EA 5I8CB 2D2OA 7FABH 4N1HB 5FWQA 3PWJA 3S3DB 4AE0A 1L3WA 4NKDB 3ARGD 1B4RA 4JRXD 1CZ8L 4FQ1L 3RBSA 3SE8L 2Y7NA 4KJWD 1DVUA 1AS7A 4LSUH 4LAQH 3ES6B 3GIZH 3ZQ9A 4RBPK 4FHBD 2E9JA 3OKNA 3L45A 3VYOA 1DR9A 5KVGH 3LEVL 1G87A 2DLEA 5IVOA 1J05A 1E5CA 3ILPB 2FEEI 3MRIB 2BHUA 3Q1SH 3G9VA 3RL1B 4DQAA 4WFED 5B39B 1IM9A 1D9KD 1N0XL 3B3BA 5TQ2H 3PV6A 4WI6A 4E9QA 5BUGA 5ICYA 5HDBB 4QTFA 2VR8A 1DDTA 3PWVA 4M43H 4HLJA 1PFOA 4TUJB 4UYQA 2WSKA 1VFUA 1NMCC 4Y4FD 1YEDA 2R0ZH 4ZUTB 4ANKA 1F2XK 1SOKA 5C09B 5E0QA 1A3RH 3E6FB 5DRZA 3B5TA 3I50H 4XCYB 3HMXH 4LFHG 4BRVA 1NMBL 2LAGB 1MREH 4V11A 1PZSA 1FIEA 4BFKA 3GI9L 4G8FA 1NEUA 5FCUH 8FABB 1PNDA 3PHSA 1LEKB 3VD3A 3VD2A 4NZTL 3L3IB 2C5DC 2R23A 3H42H 4MJ2A 1ZHKA 4YSQA 5CN2A 5D2NB 5AL0A 5KYWB 1SXBA 1TVDA 5C3TA 4YBQC 3MTXA 3LKNA 4LF3A 4P23B 1LD9A 4PRIA 4GAJL 1WZ1H 3QUXC 1P7BA 1XMEB 2P44B 3V6OA 5K9KB 3Q13A 5GHWH 4AJVA 1IAIL 5IJDC 2H6UA 4L9LB 3OAYK 4LMQE 4DKFL 1YSOA 5F9WC 4GAFB 4H8UA 3GINA 1L6PA 4X9FA 2RQEA 3SPJA 2A1WL 2VZVA 4PJCF 4BH7B 1EHXA 4Y9BA 1KJVA 5GRWA 3OX8B 3ESNA 2Y7QA 5EZOL 4DP9X 3ULVD 4JZJC 5CR1A 3H85A 3TFBA 3BWUF 3GMPA 4G9DA 1BVKA 3Q43A 3OWEA 4FFYA 3QFJA 3GRGA 5AOIA 4G1MB 4NJ9H 2OXGA 2NY1B 3QZNA 4TNFA 1PZ3A 3VFRA 1K2DA 3CLEL 4OM0H 4X98B 4OLWL 3QCUH 1GTFA 4RQQA 4XMXA 1IVTA 2N7AA 1UZ6E 5D70H 5SV4A 5DHYB 4CSTA 1MEXH 3LAFA 2IC2A 4IEFA 2EECA 2L7UA 4J23A 1AP2B 3GRWH 1MW0A 2WSPA 4Y16D 4FFVD 1IM3D 5C0BA 4PY8I 2WXHA 4HV8B 1HQ4B 5HJGA 2X6AA 1KNOA 1NBZB 2G3MA 4Z7NE 1I9IL 1M7IA 2YD7A 3QUKB 4HWZB 4A2DA 4U1JB 5CN1A 3GM0A 5AYTA 5EZIL 4HK0A 4JHZA 1CU4L 5GGRA 2E56A 3IVKB 3CDZB 3DBXA 2XU9A 4HF5L 3HC3H 3HA0A 2NT0A 1MJJB 2EC9T 4JM0A 3WIHA 4YHIA 1T04B 4KGLA 4E42B 2GJ6E 4XHJD 4F1ZA 2BSCA 1E4XH 2IANA 2IH8A 4QKXB 3RVWC 3CE1A 3G5YA 1K8DB 2X2YA 4J4PA 1KELL 2DTMH 2WXLA 2BVTA 1ESOA 4NX0A 1T89A 1OKEA 3NOIA 4AM0Q 1HE7A 3JTTB 3FFCB 1IBFA 2ADFH 3BCDA 3IFOA 1CIUA 8PAZA 4CC4A 2HX9A 4N5UA 2DIEA 1EFXD 1LO3L 2GT9B 1TJXA 4LIQH 1KG0A 2MKWA 2GITB 5CINH 2X7LB 3DGGA 2A99A 1FG9C 5T3XL 4RDBA 4PGBB 4DAGL 3GLEA 4NKMA 5E2WL 1S5HB 1NGZA 3P30L 1RFDH 1QNZL 2AQTA 1SOSA 4NZDA 2Y72A 3GJEA 1MF2L 1Z9NA 3LNEA 3NJXA 3IJSB 4YSRA 3PHOB 3RY5A 3NCJL 1KYUA 3FQ4A 1AYOA 2B5IB 4XPBH 3OC8A 1RZKH 4XCNA 1NCBH 4ZO9A 4PJ9B 4XAWH 4PLOB 4MJJA 2CJUL 4PJCB 4EN3A 4L1DA 5IJBC 1BLNA 4PVLA 5JORA 2K0RA 1GS6X 2V7NA 3C09B 5TDOA 3VI4F 4GT0A 1UB6B 1ORSA 4QRTB 1BHGA 4ZUUA 2NLJB 2XN0A 3RKDC 4P9ML 3ULSB 1B0IA 3K6NA 1A7OH 4POUB 3D7PA 4Z7WA 1NUNB 5DQDH 4W6XB 4JPVL 4R4NC 3TWCL 4AMKH 2NYKA 3EDEA 4Y2LA 3TZVB 2Z31D 5MI0B 1VCBC 4EOWL 4ODHH 2XZAH 2BNUA 1OF2A 2ZX5A 1O75A 2ZSWA 3IJEB 3OL2A 4CMMA 3FTUA 1V7ML 1NCWL 2OZ4H 3IKCA 3BGAA 3VD9A 4XMKL 3L2MA 1ACYL 1MWOA 2BVYA 4RMWA 3PP3K 1FE8L 2J55A 3ARFB 1H5BC 3US1A 2OM5A 3RVXD 5JO5B 4OAWB 3QZOA 4A66A 2AKRA 1GRWA 3TH2T 3OVUB 4R7LA 4KNQA 3VYPA 2YMOA 4N0CD 2QVTA 2VSDA 4X4YA 4KK8C 4JO3H 4H13C 4ZDHB 5ITFB 1E5ZA 4W4NA 2NMSA 5H94B 1E5AA 5E4EB 2OMXB 3QFGA 3TESA 4N9GA 3C8KA 2F1AA 2JTYA 3E8UL 4MJHA 1XL6A 2LV4A 4ZFFA 3TTSA 1BZ7A 4HKBB 1V3LA 2L04A 3VFUA 1S9VA 1DEEA 4HIHB 1NAKH 3VCLA 4XNUH 3EGXB 3EW3B 4GS7C 4KTYA 5ANHA 1OPOA 4OFYA 4XP1H 3GZPA 3GKWL 3X3FL 1OARL 1NGWB 4HUUB 3P11H 5D7LE 1KB9J 2FZ3A 3DIFB 4GXVL 4MNGA 3US9A 4EE2A 1A1NA 4ZUVB 2GJ6D 3RVUD 5I24A 4LSTL 5KVEH 3QAZB 1I85C 4P4KC 4ZOCA 4C83B 4P2RA 3HG1A 2E9BA 3ECBB 1TQWA 3VG0L 2BSSB 4I18A 2FATL 2CLVB 4BBWA 1XR8A 5ALBH 3BGFB 4H8WH 4ELME 1JDAA 3MBWA 3PP4L 4MB4A 1E9PA 4QHLA 3T65A 4OCMC 3VI4B 3DHMA 2NCMA 4GMTH 3QHZH 1NCDL 1EJOL 3V6BR 1A4KA 2A6JB 3GKZA 5DR5H 1J48A 4FTVB 3VTMA 1FLRH 1FZMA 1I8MB 4YUEH 4MJIE 1CGSL 2AP2A 2HJKB 3QXTA 3QR1A 1MPAH 3UYPA 1ZANH 3T2QA 3OXRA 2C3WA 5JYMA 3FCGA 4PM1A 1WZLA 5BOPA 1JZ8A 3TN0D 2HWZH 3GBNH 1VDGA 4U1IA 3CZLA 1EZUA 1N7ML 3MLXL 1H6UA 2NW2B 3DURB 3RFRA 1IGML 4JRLA 1HHHA 1SLWA 4PJIE 5JR1H 3DDGA 4F5CA 3D06A 1G7IA 3PWUA 1BBDL 4CVZB 4RMUA 3IBOA 3KDMB 5BVJB 3QIBD 4JZNA 2WBKA 5F7KC 4LPYA 1FFRA 4S1SH 3OR7A 1FZOA 5B1BB 4LRNL 3R4DA 1OAJA 3BX7C 3WSQH 4M9OA 4ANVA 1P7QA 2A0LD 3QO1B 4HS3B 4X2UA 2FSDA 1NGYB 1KBGH 1EH9A 1RUAH 4F2MA 5J1SC 1SBSH 2CK0L 4FCHA 4QRFA 1CXFA 1DUYB 2CNYA 4HW6A 4PJBA 3T08A 3GLZA 2Z93B 1KN2H 2NXZB 4Y2DD 4HJUA 4KRMB 5LN8A 3G5VB 4FFYH 5CCJA 3NSCA 4PQXA 3LKQA 2JMRA 3RE0A 3G04A 1THAA 3VA6A 1A8JH 1BM7A 3V6FA 5TGBA 1PU0A 3PRZA 2HVBA 3QEUB 1UTDA 3D30A 4WI5A 3MV7B 4XGZB 2W9EH 3H4FA 1S7QA 2GHWB 5L2JA 4WO4C 3WTWA 4XPFL 5IB2B 1W91A 3H0TA 1FQ9C 2BDNL 1MCOL 3US0A 4RNRB 3CMOL 1UOKA 1C12A 4XXCA 5GGTL 2DWSA 3A6CL 5I5RA 1DBJH 5GGSA 3JQOB 2OTPA 2AK1L 2WGXA 1O9ZA 5AOZA 3W39B 3M1BA 4BFBD 5GIRB 3WIHH 3VSQA 4W93A 1SHWA 1SY6L 3BN9C 1F58L 4NI6A 5IMKA 4WO0A 4O2EA 3MNMA 1DFBH 1BW8A 2HJFA 35C8L 3GTTA 2CGRL 4OVUA 4CBPA 4F24A 2X4SA 4UZUA 5HI5C 3H4HA 3WN5C 3T1WA 2DI7A 4JFXB 4M5ZL 3MUY1 5T5FL 4KTEL 1R6VA 2BSTA 2ZWLT 3CK0H 1LP9E 3GM8A 3MRDB 4NC0B 3UPAA 1BM3H 5G2NA 4OR1A 1UKSA 5BV7L 3PJSB 4FQPA 1JERA 1RZGA 5EU4A 4PY8J 3BKCH 1NEPA 1Q1JH 2ZSVB 3HE7C 1UYWL 3MJ9A 3SGJA 3AY4C 1AKPA 4WAFA 2I7SA 1IC5L 1ZVHA 1V10A 2G2NA 1K6QH 5C8JB 4FDWA 5BS0B 1PG7L 4MVBD 1NANH 2VDMB 3ZDZF 4QY8A 4IBSA 1H8SA 1KV3A 3WFBH 1F3JA 1JHTA 5AENA 1PX8A 4HZLB 2F58H 2A74B 1KGUA 2MPVA 4YQXH 5GS2H 1U8PA 1CQYA 1AGBA 2XKSA 3BUPA 2AMUA 1MH5B 3LQZA 4U3SB 3CSPA 3C9NB 4NHCL 1PD1A 4KJYA 4PJGE 3O6FD 5FB8A 2GJPA 1D9KA 4NZFA 5I71B 5DD3H 4ERSL 3HC4L 1NM9A 2AEPH 2VT0A 4MQ7A 1S7WB 4R7NB 2AEIT 1H8OA 2CA4A 1OAZL 4Y4FA 3NG5A 3DETC 1FL5B 3NSXA 1XAUA 3QXDB 3UC0H 1BGXL 1GYUA 2WUCH 5T1MB 2CALA 3OB0K 4DEWA 1M05B 4YSTA 2OYKA 5C0FA 3OHXB 5I1EH 3ARBA 1OD9A 1PIGA 4MHHI 2GJZB 3PWNB 4Q9QL 2H26A 5T1KB 5DEGB 1J8KA 4MXQD 4OJAA 4UQBA 3ESOA 1WIPA 5TPWL 1CVSC 3W5MA 4JGUA 3ESVF 3QUZD 3OR6B 1R19A 2D3LA 3GSRB 1JWSB 4HIEB 1XF3B 4DGWC 4XHQA 3U46A 1RZ8A 2WZPD 2D2CC 5GRJL 1A7NL 1R34A 5DVKA 2W65A 4RMBA 4XNDA 2AXGB 3JWOL 5GRYA 2A73A 5DRNA 1Z9SA 1CI5A 5IM7B 3VU1A 4WWPA 3KPMB 3TCLB 1SXCA 4JVPA 4LZKA 4HDIB 3WJJC 4FYSA 3ROOB 2J57A 1KJMB 3RFZA 5HDRA 5J5EA 3ZZ1A 3CLFH 1TPXB 3U4EA 1SLVA 1G9MC 4HEPG 3GXDA 1D7BA 5FYKU 4YFLI 3CNKA 4P3CH 2WCGA 4N6RB 5F9AC 5AUMA 5I5JA 4YHYC 4TVPL 2XFGB 1DYZA 2DS4A 2WLJA 3H2PA 2D0HA 4XC3L 2VH5H 4GO8A 4HCRA 1ZCRA 3ZZLA 4UINH 4Y4HC 1WAAF 4RMSA 5T8IA 3ZDZB 1R3IL 5EBGA 3MRQA 1ODUA 4M1DH 5I6PA 5IEKA 1M57B 1AHMA 2CBOA 4Q6YA 5M7QA 4FLOA 4YDLB 2J88H 1JL8A 3QQ3A 2NYYC 5D2LE 4APQB 4QRPE 4XPBL 3PNRB 3PWPE 1IM3A 1JOIA 1PIFA 3S5LB 1NOLA 1S9YA 4NXSA 4HGWB 4JKMA 3AXLA 4KHXL 2CDFA 2GSGA 4TSAL 1CR9H 1N5AB 2FECL 1J0YA 2GBVA 4L5FL 4JGNA 2DM4A 5IWLA 1MFBH 1GW0A 1CT8B 1VZIA 4LP4A 4NM8H 3OGCA 4O02A 2HT3D 2C4FU 4AL8H 2BY2A 4JY6B 4G1EB 4F15B 4XVTH 3KLDA 2BM3A 5C08E 3JT0A 2WCPA 1RMFL 4MSWB 4Y4KB 3O8XD 4L8BA 1E8ZA 1LQBC 4NUGL 5DZPA 4JZOB 3V95A 3BUYA 4CKQA 1LWRA 4GIPD 2YLHA 4UM8B 4M5SA 1KTLB 2ITDA 2BJMH 3NACL 3SBRA 4CSZA 5I8CA 1LE9B 1TSRA 1PLAA 1KN4L 4OZFA 4IMKA 2FBOJ 4LCUB 1VCAA 3MACH 4U7MA 2Y6TE 1EFXA 4BZYA 4KX7A 5CZVH 2ZXQA 1AZVA 4GRWH 5E08L 4EMZA 5IMMA 1IIKA 1IT9L 3FUMA 3IE9A 3MJWA 1T6VN 3KM2A 2OXHA 1SYVB 4NFBA 4PG9A 3D0AA 4WCYL 1IBZA 4P2CG 1U8LB 3SE4C 2XPGB 2P5EE 4OCYL 4HJ0D 1C5DA 2R0LH 3M8OH 4KTDH 2AZAA 3GGWA 3LNFA 4L37B 4R2GD 1P4UA 4RZKA 1ASQA 3ILPA 1B6UA 1R33A 3K5RA 2NR6C 3OKOB 4DP0X 4F92B 4GFXA 4XP6H 1MHCA 3K3QA 3MLVL 4MKMA 1ZKAA 5A2BA 4LLYA 4BCXA 4W81A 4HS6B 3BUIA 5HHQB 4LCWB 4LCIH 5AW1B 3K91A 3OJDA 4U1SB 1TKWB 1DSFL 5LO7A 1IGYB 2ZZUT 1ID5I 4KUZH 5HHXL 3JWDL 1JHKL 4KK6C 2YC1B 5DUPH 1Y1DA 2OSXA 3SGDH 1HX0A 4GO6B 1OSEA 1A9BA 3PL6B 2OP4L 2BNQB 4K2UH 2GYSA 2D73A 2P80D 1M2VB 2H2PC 2MPAH 2ZG1A 4DWHA 1Y6NR 3JVGC 3K7UA 5ADOH 2IGFH 2EH7H 2YMXL 3UPCA 5H4YA 2P8PA 3GF8A 1ORQB 3TT1L 3C6LD 1L7TH 2WIMA 4OM1H 5ABAA 4N2OA 1GS7A 1FORH 3B6SA 2XZQH 4PJFE 3COOA 2DWDB 4N2EA 2X6UA 2B4CH 2MEJB 4R0LC 4NENA 3FCBA 2WNKA 4M5TA 3T4AA 4FABL 1YECH 4L9LA 3NEXA 1OCCB 4LPUA 5EEXA 2BSRB 3PAUA 3T04D 3L81A 4TNVF 4M48H 5E6IB 4U1MA 2NY6B 2EIZA 3Q7JA 3WEOA 4JFOB 3UMTA 1D5ZA 1EEYB 3OX8A 2YPLD 2VZUA 3SGEH 4NCDA 3QXUA 5C2UB 4YGAB 1WHPA 2EDTA 4F37F 5F6HI 3WELA 5IQ9A 3T3PF 4QRPD 1IGIL 4YHOH 1KCWA 3PWPD 1P5VB 3MJ9H 1CXKA 4E9LA 4W9HC 4WU7B 2YSTA 5EO0B 2FB4H 2KZWA 1KBPA 3ZVVA 1VACB 4KKNA 3QPQC 4TM9A 4X98A 1MCDA 1FDLH 2VM4A 3QJHA 2BVOB 3BKJH 4JKKA 3F5WA 2P43B 2DQGH 1Q90A 3MV9D 2PWDA 5C0CE 1SVZA 1MI5B 4YHML 2GJ6A 4WJKB 4Y9FA 6PAZA 5IHUL 1R75A 3KH3A 4B9PA 3FH8A 4OIAA 4R84A 5C08D 2X4RB 2FWSA 5ENWA 3UTTB 1UB5B 4HV8A 4JFZH 1ZVSA 2WVSA 1Q4NX 1BVNT 3X14B 2AF2A 1OVZA 1OGTB 4YEFA 3O2VH 3O11A 3IVKA 1CBJA 2QGEA 1AQKH 4MYWB 2VDLL 1MJJA 3V6ZA 5B38G 5I1CH 3WUWA 5EEVA 4BQBA 2AFNA 4UZSA 1DLHA 5EBWB 3BP4A 1GAFH 4HA1A 4N22A 4ECNA 2VXTH 3A0OA 4TQ8A 4H25A 2YPVL 4XWOD 3IDYB 4ZTPL 1E6OH 1JV5B 3GSOA 1ZSDB 4RWYL 5HBBA 3HG5A 1GHFL 4AQEA 2P5ED 2M83A 2IH3B 3WFDL 3L3KB 4ZS6C 3Q8BA 1G9ML 1Q9WB 3RZCB 3T5WA 1A6WL 1BEYH 2JQZA 4WGKA 1AHWA 4OD3L 3A4FA 2BCMA 2AQ1A 3L4ZA 2VMDA 3TN0A 1JHLH 4F7KA 4CMHC 4QXTB 1LWHA 3QJVB 1ZGLA 3GMLB 2NY5L 5EOQH 3W9EA 2X7LA 4IBWA 1E9QA 3CGTA 3QR2A 1MCPL 1ODAA 3QPXL 5E1AB 2AGJL 2WM0A 1UGNA 2I07A 3ARUA 5D5MF 3ENEA 3QIBA 3DUSA 1G0XA 2K7PA 2UX6A 3QRGL 3QO0B 4HFWB 4KVCH 4LEXL 2OR9L 3IJSA 3SE9L 1J1PL 4OLXL 1RZJH 2LOEA 1XH1A 5CEZL 4EXKA 2C9UA 5BO1L 1JZEA 3KYMB 4IHOA 1PLBA 3F7YA 3MV8D 3M07A 1YN6A 2ICEB 2XZCL 4KKAD 4QF1A 4OFKA 1LE5A 3ULVH 2XVLA 1Z3GL 4X9HA 2J1YA 2VLKD 1XGQB 2CIIA 2CRYA 3L7FB 3T3PB 3I2CL 2QQLL 1ET7A 3TFKD 5IIEB 5DS1A 1A22B 1CB4A 2QHLA 5GISH 3X13B 3WMSA 1ZGLP 4S1QH 3WKMH 1G6RB 4HCRH 4X80H 2P1YA 3ETBJ 3QORB 1JZ2A 1UQSA 2F7QA 4PY7B 3SQBB 4RWHA 4I8DA 1UJ3B 1A2YB 5FLUA 2HLAA 4XO4A 5ICXB 1GGIH 3KXFB 2ZOOA 3SPHA 1TG8A 1QG3A 5TJWK 3GIVB 5AG9A 1R5VA 4ZFZB 3U36A 4PWGA 1AD9B 4A6YA 3OJ2C 4F7CA 5ESVB 3SDAB 4EI5C 1MCWW 1K85A 1D6VL 4K5OA 5JXAL 3LYRA 3VE0A 3O0RL 3ZYJA 5HTSA 3RRQA 4KKZA 1X7SA 2QTEA 2JXMB 4LDEB 2IAMB 3GI8H 1IIIA 3KWXA 2YEQA 5LBGA 4YSUA 1BOGB 4IBUA 3BD5A 5L88L 3L95A 2NCEA 1XH0A 5D4IA 3WHXB 4JFPB 3APNA 1FFNA 2EDBA 4KNUA 4Y5VB 4L1TA 2MCG1 4J3SA 1F8TL 2BS9A 4QMEA 3T71A 5IB1A 4B9CA 3QCVH 4G83A 3O2DA 5KOMC 4FXKA 1B0GB 1DVSA 4TVSa 5EEYA 1W8OA 4GG6E 5DT1L 4OZFH 1FAIL 2A9ML 2ZCHH 3D85B 4DGUA 4FXLA 2Q86A 1U3HD 1A65A 3ME0A 4ELMA 3WXWH 1H9VA 3KGRA 3BVUA 4RAUB 5CEXA 5D5MB 1D5XA 2XN9B 1I7RB 2YMTA 4MMZC 5J8OA 2A9CA 3OC5A 3VJ6A 5L0QB 1BZOA 1C1EL 2WWMC 4N2HA 3H7BB 3WEMA 4D9RE 2WLLB 1OT4A 2ZE0A 2ZKMX 1MUJB 4OLUL 3KPRE 3OHMB 3P4OB 1UATA 4OGZA 3HR5A 3TO4C 4QDGA 2QT6A 3BQUD 3UTSB 3U4BH 1IE5A 2VZOA 3STZB 2DLFL 5AVXB 5GRUH 2A83A 4N0RA 4PJIA 4I89A 1FC1A 4JPKH 3HB3B 2W8CA 4CADA 2K78A 1EHLH 1HHIB 1KB3A 2IV9A 3QDJE 4I2XA 4WW2F 1RHHB 3LVEA 1UXSA 3FPYA 2P49B 4HHAB 5TF1H 1WFNA 2JB5L 3TEWA 1XH2A 2Y5TA 1FBIL 3MN8A 4FQHB 2GBAA 1X5JA 2NY4B 3FFDB 4JANB 4NJAL 4JO1H 4NKIH 4G11A 2NW2A 4YGVB 1AMYA 1TTAA 3L3JB 4HCIA 1QUPA 4J6RL 5HVGB 4CVZA 1E6JL 1ED3B 1TQVA 3PAZA 2L7QA 4KBPA 5BVJA 5GGUA 3P3SA 5KAQF 1YVLA 3WAJA 1SMDA 4U1NB 3TF4A 2PETA 2XKNB 2DICA 3LB6D 3N1PC 5E95B 5E2UL 3QUZA 3SSGA 4HWBA 1RUPL 4YHKL 5I19H 2DF3A 3GB7A 4UAOC 1A7QL 4IRJD 1DDHB 4RMQA 3DTXA 4PYHA 5DK3A 3GMQB 2D3NA 3Q2LA 4LDLB 5DVPA 2WZPA 1DUYA 1GGYA 3WHE0 3QNZB 2Z93A 3EYUL 5BJTB 5CJ5A 4AYMC 5HPMB 2R2EA 1D5MB 2FX8L 3RNQA 1XT5A 5F1OB 3V0JA 5IVNA 5GJSH 5L8JB 1KXTA 3BJLA 2AXWA 3EYQD 5KYYB 5G5DB 3BRFA 4YOKA 5IBTL 1HXYA 5FC9A 3TJEH 3IMRA 1PNCA 4GBXD 2DQIL 4AC2A 4LQFH 2IPTH 4Y9CA 1BQ5A 2BOCB 3CV5A 3TBSB 5E9DB 3MV7A 4I9WD 4U1GC 1JPFB 4XGZA 3MC0A 3TYFA 5EORL 1SM3L 3HG3A 1CFNB 1JGDA 2APBA 2PR4H 1F6AB 2KERA 3PQYB 3TJPA 3V6OC 4N0FA 5ES4B 3MBXH 1P1ZB 1ZS8A 2WQ8A 3RY4A 3C8HA 1TU2A 1IBDA 2AV7A 3B3IB 3GRWL 4H2AA 4AIEA 3MXVL 4FG6D 2WW8A 3CSFA 4EZLA 4QO1A 3LY6A 5E00B 3U6RA 5A2AA 1Q0YH 1IC4L 3IGAA 1YNTF 3DUHA 2DQEH 3ILDA 5EN2A 5K9JH 4WI0A 3ERXA 4MMXC 5F6HJ 5MENE 3NTCH 3OZKA 4FNUA 1Q94B 3JV4B 3PFQA 4WW2B 3C60B 4WKZB 5JMOC 5I0WA 1OQOA 3L4UA 3P4NA 3VD7A 3P4MB 1X9UA 2XN1A 4D9RD 5GZOA 1VFOA 2XA8L 1TOXA 1AGCB 2YLKA 1MRCH 3SGKC 3U83A 4TTDC 4ZX6A 3MUUA 1OWWA 2YRLA 5C86A 3TCTA 3EO9H 2BMKA 1KJ2A 3T0EB 5ICUA 3FUFA 4QHKJ 1JZ5A 1T1XB 1KIRB 2OMNA 2R7EA 2WBXA 2A6KA 4K9JA 5BNXD 3IF1A 1FN4A 2FL5B 3VFSA 1T7ZA 1LO4H 4XOAA 2YXVA 3B7TA 5I5IA 3CH1A 4ZG1A 1NIDA 1RFDL 2UZYB 4PJGA 2DMCA 3QDJD 5HHOD 2JCCE 1QQDA 4TULH 3AG4B 3LIUA 2EZ0D 3WNOA 5KZCD 2MHAB 3LV3B 5F9JA 3MV11 4X7EC 4HJJH 2MFNA 4JY4B 2BSBA 1XBDA 4XMWA 4U3SA 2ED9A 3FB6B 4PRBB 5ISZB 1PZCA 1IQDB 4ZZKA 5KJRL 1T0NB 3VI3E 1TFPA 2J8UF 2WXRA 4CC4C 2F1EA 3ZKSD 4R7NA 4PI0A 4ADGA 3L3HA 4PJ7F 5F8QC 2JFCA 4BHUI 1D5IH 1RERA 4E36A 4PS4H 3CWGA 4XOBA 4ZUWA 3S3PA 1OL0A 1W72B 2OBGA 5B7MA 5BOJA 1Z6JT 4OJDH 2B1HL 2V37A 4PMFA 3RUGE 3B9KB 3ZE1E 3D08A 4A6YH 2IOIA 4G42A 2P80A 2KPNA 5CIPB 1YA5A 4G7SB 4M7LH 1XCTB 1QHQA 2QADC 4EI6A 1L9SA 4JQIL 5HDWA 2BVPB 2OMWA 3EYSH 5T1DL 1PVHA 2IXQB 3T0BA 4HWEH 1QTPA 4EN3C 5CJOH 2D3JA 4RGOH 4NZRH 1YNTB 1H15A 4G71B 2YGPA 1OWRM 5E6YA 1NAML 1G0DA 1KXHA 1ZEAH 4KJPD 4PV9A 4XX5A 3QC5X 4JM2C 3NSDA 4LMQI 2YA2A 2YSSB 1I8AA 4X9IA 2DPKA 4OUUB 3ARGB 1JNNH 4JRXB 3FBKA 4TKWA 2C1PB 3O2DH 4JG0H 1A9EA 1KDJA 4XCFH 5D96C 2C9AA 2C4FT 5IM7A 1MLBA 1S7TB 3TCLA 4C59B 3VRLF 2BOBA 4PFEA 1JGEA 1ZHBB 4XMLL 3IDNB 4ES9A 5EU6B 2DQUL 1KJMA 2I9TA 1KCLA 2YPLA 5HYSG 2X2UA 4YXLL 3AJ7A