2GBTA

C6a/c111a cuzn superoxide dismutase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
152
Chain Sequence
b'TKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2gbtA00
4BCZA 3QQDA 1F1AA 2ZKWA 3SODB 1EJ8A 2AF2A 1ESOA 4U4IA 3GTTA 1SXSA 3KM2A 2ZOWA 1SXNA 1CB4A 1YAZA 2WZ0A 1MFMA 2AQSA 1BA9A 1OZTG 1N19A 2XJLA 1SDYA 1BZOA 1XTMA 1E9OA 2Q2LA 1SRDA 3S0PA 1E9QA 3RE0A 2XJKA 1SOSA 1AZVA 3ECWA 1SDAB 1YSOA 3GZOA 1E9PB 4A7SA 2AQPA 1FUNA 3MNDA 1OAJA 4OH2A 3T5WA 1KMGA 5CU9A 1Z9PA 4A7VA 5KBKA 4A7UA 5KBLA 1HL5A 2WYTA 2VR6A 3K91A 3KH3A 1OALA 2WZ6A 1SPDA 3CE1A 1F1DA 3HFFA 1QUPA 1B4LA 3H2PA 2AEOA 1JCVA 3F7KA 3HW7A 4FF9A 4N3UA 3GZPA 1F18A 3ECVA 4MCMA 4OJAA 1L3NA 3QQDB 1B4TA 5KBMA 3PU7A 2Z7ZA 1TO5A 2JLPA 2WYZA 2SODB 3CQQA 1RK7A 1HL4A 1XSOA 3GQFA 1JK9A 3MKGA 4A7TA 2ZKXA 1Z9NA 2JCWA 4MCNA 2WKOF 2Z7UA 1IBHA 1UXMA 2V0AA 1OZUA 1COBA 4A7GF 3KH4A 1E9OB 3KM1A 2AQTA 3H2QA 1E9QB 1SXBA 1TO4A 2GBUA 1U3NA 2C9SA 1CBJA 1IB5A 1EQWA 2Z7YA 1DO5A 2GBVA 2WWNA 2R27A 3KBEA 3L9YA 1IBFA 1DSWA 2C9VA 2NNXA 2AQRA 1P1VA 2E47A 4BCYA 1Q0EA 1E9PA 1SXAA 2VR8A 1XTLA 2WZ5A 2APSA 2VR7A 4N3TA 1PU0A 3ECUA 1OEZW 2ZKYA 1IBBA 1PTZA 1YAIA 1SXZA 1S4IA 3GZQA 3LTVA 2Z7WA 2WKOA 3L9EA 2K4WA 4BD4A 1IBDA 4L05A 4A7GA 2C9UA 2E46A 2GBTA 1UXLA 3KBFA 2AQNA 4A7QA 3F7LA 1PZSA 2WWOA 1SXCA 2AQQA 3CQPA 4B3EA 1JK9B 1N18A 3GTVA 1F1GA 2LU5A 3HOGA
chains in the Genus database with same CATH superfamily
3QQDA 4MCZA 2V6HA 4IRJB 4O2CA 4BH7A 1HNFA 1KGIA 3GTTA 4UIMA 1E28A 2J2ZA 2Q5BA 2HCZX 2RALA 2IQAB 3LZQA 3BWUF 4M6MH 3V0IA 1PCXA 1INDL 2IH1A 5G55A 4U49A 1SN2A 1N64H 2WSKA 4BQCA 5DT1L 3ML9A 2F1AA 4PJIE 5FO8A 2JIXB 5DMIL 3BRGC 2AVGA 1U42A 1XF1A 3T6XA 4R83A 1SDAB 1M7XA 4TSBL 3QUHA 4YZWA 3X12B 1CGXA 2L4OA 5KYUB 3RZCA 3HB3C 1QPPA 3MROA 1UWGL 5FOBB 4RGMB 2AK4B 5KS9A 1JGDA 1U93A 1QRNA 2DD8L 1T0MB 4BINA 1WZMA 3KLDA 3RX7A 4UQ2A 5C0JB 3S2CA 2OSLA 4XMZA 2APFA 3PAVA 4LBEA 4WGKA 3MRQA 1J1PH 1MOEA 2XV3A 4L5FH 3RVXC 4XR8C 2C4XA 3SE9H 3MA7B 1SM3H 3CN2A 2ILLA 1KTDB 3ARED 4LSDA 2G2RA 1N7MH 4L2LA 4I1NB 2ZUWA 8FABB 2JLPA 2WLMA 4GI9A 3U1PA 3SD2A 4G8GB 1T66C 4NUGH 4ETQA 3ULVH 4FI7A 3D05A 4LQFH 2NNRA 4QIRA 1LWHA 5C0CD 5IBLC 4FFZA 5D7LA 1WZ1L 4XNYH 3WFCH 2BXZA 5KVFH 2VDRL 3RKPA 1CF8H 4D9RE 1GGYA 3P0VH 5IKCA 4KKQA 1U8CB 1JE6A 4NYLB 4R5TA 3Q1EA 2ESVA 4KVNH 3CTTA 1V5JA 1J12A 1ORSA 2MQCA 1GHFH 4GIAA 1RKRA 3HG3A 1PY9A 3SE6A 3UTSD 1CK0L 4FAAB 5FM4A 2F18A 1WTLA 2IO5A 4M4PA 2WVUA 3EZ8A 3F7YA 1AKJB 2FHBA 3BT2H 2V2TA 3FK3A 3N1PC 3SBWC 1UC6A 4PJXF 4XMXA 1G0XA 4I9WE 3HG2A 4K3EH 3AG2B 1JNLH 2VLJD 2LAAA 1GS7A 4XH2A 2WKLA 4YHZL 2WXMA 3TA3D 1MXGA 2FLBT 1SJXA 3VD1A 4U1NA 5FM5O 4XCFH 2FUTA 4PW9A 2AV7A 1V3JA 4XVSL 4UQCA 1T0OA 4TLKA 3O45B 3CFQA 3RURA 3HOGA 2D4DA 3FSZA 3H55A 4EUPH 4F33B 3HRZA 4WUUB 3PQYD 1I8UA 3UTZB 4LCUA 3UTQB 4WK2B 4K7PL 4ODBD 2UZYA 3DGCR 1AIFB 4RDQG 2G60H 5F9WB 2AQSA 5AW4B 5D7KD 3VXOB 1K85A 1SBSH 1FH2A 3BC9A 4YXHH 2X0UA 1CFSB 4BK8A 3ERXA 4K3JL 3MUHL 4KRMB 5K1NA 3D85B 5DK2B 3MGOB 3CFJA 4JHUA 1PZAA 3MR9A 1J8RA 3CFKA 3IFPB 3SQOH 3BSZL 1YPZE 3TV3H 4EZMA 3SPVB 5FYKE 1FNGA 2AQPA 4IU3B 4P06A 5DHYB 5SWSD 4N0YH 5EG6C 2APXA 5DD5H 3SJVB 3O8XB 5LN4A 4XN7A 4OV5B 3N5AA 4GRWH 1F8TH 1OW0C 4HPOL 5IFJB 4G43B 4N85A 3UBHA 3FOLA 3I6KA 3VXSA 1JCVA 3P11L 4BFOA 5EO9B 4HCRH 1XQ4A 4TNGA 4AC4A 3L3HA 3TTSA 2C4FT 2J6WA 5D5MF 5I6MA 2CNYA 5L2KB 1C5CH 5I1AB 3TYFA 4H8UA 4ZW6A 4I77H 4XCYB 3X3GH 2WQVA 5E2TH 2XVGA 3V4LA 1HINL 4XC1L 4M61B 5ESAA 3MV9B 1OL0A 1AY1L 3MRIA 5HBBA 3W3BA 1J05B 1H6EA 1NLDL 1DUZB 1TVDA 4LXFA 5DI8A 2VXUH 3BPCB 5C0BD 3EGSA 3EJTA 3VXMA 4G7YH 4CMMB 3NCYP 1KGJA 5A40E 4H4NA 5LGHL 3FQRA 4Y1AD 3QK0A 5GS3A 1RZPA 1INEH 4UV4H 2FX9L 3P54A 3DTUB 4NO0D 4RDQF 4U1GB 3DTXB 3B1UA 4ZFFB 4KXBA 5KSUB 3EHBD 2ZF8A 3ABZA 3AU1B 3D2TA 1V54B 3DPDA 4ZNEA 5GS0L 4HIXH 1UGKA 5T33H 1U8NB 2F58L 4PGDB 2QMJA 3SBRA 1M71B 1YCSA 3MUZ1 2J6EH 2OMYB 4D9LL 2V2XA 4G9FD 1BVNP 3SGKA 4LLAA 3X11A 1W6LA 3OQRA 3N43F 2JI2A 4FL4B 3QIBA 1RUKL 2B1HH 4MX7A 4MHHG 1JL8A 1OAYH 4P23D 5KJ4A 3GMRB 1NKOA 3QHZH 4AMKL 1D5MA 4WDIB 3RPIB 3R0MA 1VAHA 3VG0H 3ZL2A 2JJSA 5CCGE 4PJGE 4KRLB 3RNKA 4QGTA 5C0AD 4P2QB 2JJTC 3FQUA 1J48A 4XWOC 2Q86B 3VI3B 2UZXB 3S37L 2X6BA 1CT8A 3X1BA 1TMCB 1XMEB 3P4NA 5DD0L 3WJLA 5AD0A 1U8IA 3MGTB 1ZVSA 4LT7A 3NG5A 4K9EL 3I3EA 1YN7A 4NT6B 4UQEA 3QO1A 4NB7A 4DKFL 1G7JB 3W0WA 3IS1X 1NL0L 1FNHA 1TITA 1BFTA 5DYOB 4P5MB 4L4JA 5C08D 2ZX6A 1E30A 3WAJA 4YX2L 3G6AA 1IARB 2YFNA 2J57A 5EIIG 1FL5B 3QWRA 5IHUH 5T1KD 4H20H 4QNPE 2CBQA 5F3HA 4PYGA 4JDVA 1QEXA 4UIKH 2I69A 5EU7E 4B0MM 4LL4A 3RWIA 4J3TA 4EBQH 1EIBA 3H8NA 4PJ7A 1MCPL 1T7ZA 3DMMB 2MTPA 3RP1A 3HC3L 3GK8H 3F04A 1FF5A 2AJXH 4C4UA 1S9YB 4MXQC 4MAYD 3BIBX 4QRBA 1LO5A 4DP8X 1QFPA 2AEPH 2ZOUA 3HS0A 4R0LB 3UYRL 3M1BA 4PRPD 1SBBA 3DX6B 2D0HA 3UZEA 4TUJA 3ZDWA 1BD2E 2UY6A 4PVNA 2DLTA 1RK7A 2VLRB 5E2WH 3CUPA 4DTGH 1MFEH 1NBVL 3OKNB 1F3JA 3AY4C 2VMDA 1SEBB 4OQTA 4LAQH 1JNJA 1PG7H 3FB6B 3T2LA 2AKRA 2P5ED 3LVTA 4OLEA 4PG2A 2ZUTA 4J6RL 3LKQA 1XGRA 4JCMA 4KX7A 7PAZA 2WIMA 1HEHC 1ETJA 2BRRH 3E8UL 3HUJE 3ZHDA 3CC5A 3CVHA 4OBRA 1RURH 3TS8A 3BN3B 1FNAA 1GC1C 5ALCH 2OL3L 1BQHG 4U1IB 4NZTL 1DSYA 3A6CH 4JFZH 1NJ9B 4ENEC 2DIBA 1GY2A 4FZEH 4UM9A 2CK2A 3TEWA 1QNZL 4JFOA 3PWNB 4RIRA 5TH2A 3QP3A 3FUNA 2B4CL 1QBMH 1QFWL 4U1LB 3KHQA 4G80B 1DR9A 2NRDA 4QRRA 5C09B 3H9SE 4X9HA 1ZLWH 3LHPL 4Z7VB 4QRQB 3AM8C 2WYHA 1BQSA 1BOGA 4DK6A 4BK5A 4NAJA 3WIHH 1NANH 4ZMZA 5JIMA 2WP3T 4Y19D 3OKEB 4DW2L 3BP5B 3WJJC 3G5YB 2VH5H 2BWQA 4LARL 2O61B 5E7BA 1AD9A 2F19L 4IOIB 5GQBA 5ADPL 3D87B 4EVNA 4AK1A 3Q48A 2C9QA 3RGVD 4S10A 1GZHA 1MKFA 4FEIA 4RVBA 4OZHE 4Y5YB 2CCWA 2AXHA 2P5WA 2WZ0A 4N1CA 3EDJA 3BAIA 1PEWA 2ERJB 4C8XA 1ORQB 3TH4T 4IW4C 5BVJB 4J6IA 2W65A 3KPSD 1TQWA 3OR7A 4PP2A 3HE7B 4ODVH 4Q4EA 2OPCA 4QYAA 1JHTB 5TE6L 3QZWA 4H1LA 4PJDA 4KZCA 1NC4D 3QEUA 1AVAA 3O4LD 1GJIA 1I7TA 1T04B 5GRYA 3I9GL 4NENB 2QSCL 1L4IA 4LLVB 5J3HD 3FBKA 1RUPH 4Z76A 1D9KA 1D5ZA 1IAKB 4HH8A 1IGIH 3W82A 4QWWC 1XZWA 3ESPA 3LEYL 5C97A 3PHSA 3GIVB 2Q1EA 3M1CA 4GBXD 1CI3M 3UZQA 3CSYA 5BS0E 4TQHA 5I1DB 2R69A 2ED9A 2KYIA 4GB9A 1HT6A 4GW1A 2VUKA 4CC4A 5I6LA 3TU6A 1ZXKA 3D39B 4H5SB 3P4LA 1GRWA 1AG0A 5J4MA 2VDOB 5K5YA 2ZT9C 2Y72A 3LNDA 4PIBA 1ZK9A 2RQEA 1E2ZA 4HCIA 4ZX5A 3UL4A 4AEIL 3A67H 2Q0ZX 1WCBA 3P4OB 5BNXD 4N87A 1G9NC 3OZLA 3UEZA 3B7RL 3D0AA 3U9UB 4JVPA 2MCMA 4GXUM 4Z7UA 1GJWA 3SDYH 1F4XL 4A2FA 2OJZL 1EEZA 1IAIH 1TJGL 1C08A 2GAZB 4ODWA 5B3JE 5CJQH 3RPBA 1UEMA 4E41A 2EE3A 2XTLA 1TO4A 4PV9A 2AJUH 5C0ND 4D7PA 4JZOA 3O9WB 3T8MA 5KBPA 1GPOH 4FQQB 1SFDA 1MLCB 2GSIA 1KG0A 3OX8B 1JD9A 4R7NA 4XVUC 2C3HA 1KXTB 1A7PH 3NIGB 1CVRA 1PJ9A 4N2MA 3HNTH 3QDMD 4YHMH 2EIZA 4HK0B 2CJTA 2G2NA 3FPXA 3D25A 1SF3A 3MBXH 4I0PB 4JPWL 4QO1A 5BRQA 3L5XH 1ACXA 5E1AB 3C6LB 2XXGA 1GTFA 4TVPH 3BZEB 4UOZA 3MLRL 3U0PB 5C0RH 4HZAA 2ZUXA 4XX5A 3ARFD 4X6CE 2EDQA 2WNXA 1RU9H 3HZMA 3FT3A 2AC0A 4PTTA 1CFTB 3FMGL 3B7TA 2NYYC 2WZPD 3RDTC 3MN8A 4RLDA 4FHBD 1CR9L 5I1LB 1UYWL 3D69B 4Z3GA 5AFAA 2W07A 3LNFA 4S1SH 4DNLA 4X98A 2KI6A 2EDEA 4FXGA 3L3GA 1V27A 4BFFA 4RESB 4LEBA 3EOYG 3HG1B 3WIAA 1UWEL 1E5ZA 1YEJH 3GS7A 5D7IE 5L4FA 5F7DA 4MB1A 3GSVB 2V3DA 3HE6C 1TZAA 3P77A 1UZ8A 4M48L 4OGZA 5D2LE 2KC0A 5JHDE 4NAMA 4ZOBA 5IOKA 3L3DA 1OCRB 2OR9H 3QJSB 1QSFA 3HKFA 2VDNH 1OGTA 5KG9B 4AYFB 4DCQB 4PJ8C 5E8PB 5EEWA 4ALAL 1FBIL 1KBKA 1YMMB 1MAMH 1JPST 1KIPB 1QWNA 2HJFA 5GIRA 2PYEB 2X4NA 1KTBA 4WTQA 1ANUA 4GUCA 5E5UB 4PR5A 3SDAC 2XV6B 4KRPB 3WNJA 4K23H 4N0CC 5DRNA 3DNKA 1MZYA 5SWQB 3B2VL 3R06A 4KKCC 1B4JH 4LDCA 3L3KB 2FT8A 2V8MA 1BYOA 2UYLA 1H0DB 1QRNE 2YS4A 1RCYA 1THCA 1R33A 3G5WA 2X89D 2EH7L 4JKMA 4N90E 5ESQB 5F7BA 1KTLB 4XP9L 1UA7A 2ZXEB 4YHNB 2KHAA 1DLHA 1H5BC 1J9CT 1OGSA 1HHIB 4NQED 2OMUB 2HKHH 1LWJA 2RJMA 2PABA 3KJ4C 5EN2A 5F96H 5FYJD 1EWHA 1AGFB 4XN1A 1MWAA 2X6UA 3PFQA 5DTFB 3QUXB 2QHRL 4NQCA 4D8PB 1J86A 2EYTB 3K2MC 4K73A 3I9IA 1TJHL 2JB5H 3KR3H 3QQ9D 2W92A 3D07A 1CFQA 2WCSA 4WV1A 4AZ8B 5ECJE 3CJJA 4AYID 3V7AE 2Z1KA 5HVHC 5L4JA 5T3XD 2PP8A 5D7LE 3GMNA 2A0LD 3G3LA 2QT6A 3SDCA 3EKCA 2WGXA 3K4DA 1MCWM 3V10A 4JR9H 2BW5A 3EDDA 5K39A 4AL8L 4AIZA 3H3KA 5ICZA 1FZOB 3ULUH 4UZGA 4GAGH 2WLYA 1BXUA 4Y16A 3POCA 5AVVB 1E3ZA 3IJHA 5MEPA 4GSRA 4OZFA 1E67A 1MJ8L 3QPQC 4KY1H 5A43C 4ZTPL 4BH8A 3RVUC 4CNIA 1ODUA 3RIAF 5DUPL 3GSOB 3JTTB 2FWOA 3QUZD 5L8KB 2XICA 2WBJA 3VWJA 2YWYA 4QYOB 3WN5A 1XCWA 3WHXA 2MQGA 1MNUL 3BDXA 2EUZA 4UBDC 1MI5B 1NEZG 5IVZB 4K5LA 2KT6A 3D2UD 4ZYKB 2UY7A 2WUBH 3MUUA 4G70B 4GG6B 1O7SA 2NW3B 3LHAA 2CGYA 3WEXB 3MMEA 5LJYH 3FONB 3RVTC 2EINB 1RZJH 2IPTH 4K0OA 5CJBA 1CB4A 5DQ9B 4AIOA 5BV7B 2R83A 4G6FB 4HZLA 3IXAA 2VDMH 5CSZA 4H44C 5HPMA 3HLAB 1XTMA 3F58L 1E9OA 1FGNH 4WEEA 4X42A 3VD0A 2IAMC 3EYOB 2CJ3A 3WTXA 5I6PA 3WELA 4UZSA 5DC0A 5IROC 2WP3O 2XKNB 3GXNA 4NHUA 4WKZA 2ADIB 3H9HB 1Z1WA 3W57A 3PHQB 1H8LA 1CG9B 1GW0A 1VFBA 4I89A 4PVMA 5A16B 1U30A 3ZUNC 1ULVA 1LJMA 2GTWB 3OR6A 2NCEA 4JN1L 5AVYB 2DYSB 4GQRA 4XO3A 3NSJA 4EI0A 2GITB 4P9MH 3T1FA 4UOJA 5JLZA 3BE1H 1RQ5A 4YLCA 5FHBH 4D9QE 3IJSA 4ZMXA 2XCMC 1X5XA 1QUPA 2Y36L 2DDQL 1BIHA 5SWZA 3WEOA 1XF5B 3X3FL 4WFFD 5T1MA 4FQLH 4PB9H 2R1YA 4OB5L 5ALBH 3BQUD 4X7CC 2A4EA 4LFHD 3VXSE 1QBBA 4DVRL 1K5NA 3QDJD 4E9QA 4Z7IA 3FO9A 4F2MB 2G30A 3GHEL 1BZ7B 3PCYA 1XR8B 3AG3B 4P5SA 1XH3B 2V17L 4JB9H 3VI3F 1LXMA 3VA2C 1EMTL 4TL5A 3DGDA 2XN9A 3FYIB 4U1JB 2DTMH 3WNNA 4L3EB 1XSKA 2LU7A 4YZFE 1I1AD 4AX3A 4Q89A 1PBYA 4GI8A 5CLTA 3VXME 4URTB 2AV1A 4ZXBB 2FD6L 4N9GA 1XCTB 4M43H 4Q7DA 3MRKB 1EHXA 5AW2B 2LE9A 3C6EA 1ADQA 3L95A 1SJEA 2IDQA 3OF6D 2ODIA 2OMZB 2IPKA 1W0YT 3BT0A 2GHZA 1Q72L 5C07D 4LKCB 3ZT5A 5D1QA 2KBGA 2FATL 3D7PA 4ZNEE 3EBHA 1ES0A 1YY8A 4X9IA 4OBSA 2C9RA 4F7PA 1JPTL 2JK5A 2R2EA 3D3VB 4YDKL 5H35B 5LBSL 4XPAL 3VCLA 1WEJL 3BH9A 1FYTD 2C3WA 4HJJH 1CQKA 4PJ8D 4OU3A 4DQOL 2E6PA 1TTUA 1NQBA 4NQSA 2VQUA 4ZX3A 1U8QA 4A67A 5JHDD 2CO6A 3VFNB 4CU6A 2R7EA 2CK0L 1QO3B 1M6UA 4KK5D 1O6SB 1CTNA 2IGFH 4K7FB 4F7MB 3TEUA 3UGUA 4U4IA 1N4XL 4XNBA 1N68A 1KFGA 4EQ2A 3I84A 5CZXC 4ODHH 1DDHB 3PY9A 5F1NB 2ZCHL 4XBGA 1N19A 2WJ5A 5EUOF 5AUMB 2BOLA 1T5XB 3PPEA 4JFHE 2ZIDA 4PWEA 3ZL4H 3A47A 3QUYB 2LW3A 5T1LD 3FXIC 4B97A 4GI6A 5FWQA 3DROA 2DQUH 1TLKA 1WGVA 4PJ9B 3W0WE 4HIPA 5CJXA 5CEXA 3V6FA 4L4TA 3OAZH 1AP2A 3BWAA 4EN3D 4R4BB 2XZQH 3K4AA 1KIUA 3II1A 3NFPB 3QUKA 5LCVL 3QW9A 2UV3A 1KGCD 3IFLH 1JPGA 4JN2B 1KT2A 2GBAA 3P73A 4QOKB 4KV5F 5F6IB 4IBQA 5H4ZA 3DX8A 1UM5L 1F4WH 2PTVA 4CGTA 3EDEA 4PJ7E 4RRPA 4U33A 1R5VA 5KVEE 1DJHA 2A9ML 4HEMA 1BVLA 5IB5B 4NI6A 3BAJA 2FYYB 5JO5A 1W72A 4GFXA 1A65A 2F53A 4KO6A 1HJCA 2CIKA 4PV8A 2BY1A 3J07A 5EOCJ 1HYSD 1R17A 4FXTA 4KJYA 2PR4L 5GS1A 5CP3H 3ZDYE 3WE1A 1KN4L 4OFYA 4JO2H 5GJSL 2X4TB 4RGOL 1FHNA 5I30H 2DQIL 1NAMH 3CN3A 1KDIA 4Q56A 1UOKA 2GBUA 2W0PA 2PN5A 1V3MA 3C8DA 4ZTOH 1IVLA 3LKSB 1F0LA 4X5LA 2Y6SD 2MSPA 1YQ2A 4NKQB 3MLTB 3QUML 4ZFZB 2XU9A 2YEVB 4R4FL 2CO4A 5B7MA 1OQXA 1TCRB 1LO4L 3UBFA 2CGZA 4G71B 3RY6A 4FQ1H 4JHZA 2E8YA 4U1MB 1U2HA 3SE4C 5BVPH 4NN6C 4WNQB 1UACL 1HIMH 3W2DH 1N3NA 2WXPA 4MBOA 5HD8D 1UENA 1M3IA 2JCCB 2VW4A 1SGKA 5K93A 2DQGH 3OC5A 3C2AH 5TQ2H 5KUKA 4ERSL 3WJMA 4XI5D 4EI5D 5F1KC 4WFHE 4OCYL 3UIYA 3B5HA 4P99A 1Q94B 1CGUA 4KJQC 3QCTL 4QRRE 3A6BH 1G6RL 3VFGL 2DI7A 5DD3H 4J3OH 4OLUH 1RZFL 2RMNA 4AE0A 5JHLH 1NCCH 2LFGA 3LZPA 2C3VB 2NY2B 1AO7A 1CZ8L 4U05A 4Z77A 5I6NA 3V5DB 1N8ZA 4LBAA 5JPMB 5H4YA 4UV7H 3PNWB 3SGJC 3BLPX 3ROOB 4Q6YA 1CUOA 2QFPA 1GYWA 2IAAC 4L29A 1FZJB 4TF4A 4PJAB 3MRCA 1OSZA 4AQAA 3P2TA 5DLMH 2P5WE 2ETWA 5GSVA 4IRSD 3S3JA 4JRLA 1Z32X 2HTKC 5HYSG 1SYSB 1BF2A 4A7SA 3V9EA 3CVIH 1A7OL 1FSKB 2A6JA 4U3SA 5F3BA 3UCQA 1Q9OA 3ES6B 4G11A 4PJDE 5MEND 4UF7C 3CLWA 1ET5A 1IGFL 3U25A 4YDMA 1AR2A 1HL5A 4K8RD 5CBAB 4F7EA 1HQ4B 4P2OB 3RPKA 4ZFGL 2GJ6D 5I5MA 1UQSA 4LASH 1N9PA 4I13B 1WA1X 1A5FL 1AD0A 4JM2A 4PREA 4P46A 3VJ6B 2CR6A 2CUIA 1FZKB 1RVFL 1B2YA 1FA4A 5EDXA 3LDBC 4UQAA 4PJBA 5JR1H 1W0WA 1AYRA 3ESVF 2GEEA 1WBYB 2FEDC 5C1MB 3MV7B 5INCA 4UU9A 1P5VB 2FHCA 1HHHB 4XOBA 1LEGB 2WOYA 2AJYL 4JO3L 4KMLB 4BKSC 4I1PA 3TJPA 3VFOB 1RIHH 5F3FA 3S5LA 5F7AA 3FQ1A 4OLYL 4AV4A 5KEZA 4Z7UE 2B20A 5DQDL 3O3DA 1UJ3A 4P4KD 1CBJA 5ERWB 3JVGA 3IGAA 4JFPA 3PWLB 4WY7L 3IMWA 4E41E 4JFDA 1AXIB 1KTRL 1RZKC 3MODH 5I1JL 1H9VA 1OSPL 2FHFA 2VE6A 2IC2A 1RK1B 5AB9A 1ZLUK 4PYHA 4FLSA 5FGBC 2YGPA 1UASA 1NWPA 2NY5C 3OZ9L 4PB0H 4MNQA 1IAOB 2HRLA 1N0XL 5AB0A 3OXSA 3DX9A 1W9XA 4N6RA 4YWGH 5FK9B 1CFBA 1ZTMA 3V5KA 3TGXA 4EUPA 1GYAA 3K74B 2P1YA 4IRJD 2JXMA 5AB1A 1F02I 3V4PB 3QEQB 3GXPA 1N12A 5EZOH 4BUGA 1R4XA 5JA9A 1JV5B 1O9WA 5GGRY 3D08A 3HAEB 3ARDC 2XWZA 3GIZH 3TT1H 4QY8B 5E6YA 3T3PB 3RWHA 3MRJB 2JIXD 3KGUA 3VXPA 4AYMC 1LDPH 4U6XB 4PJHA 1L0YA 3VFPB 5IJBC 1WAAF 3UAEA 1W8OA 3PIQA 2RACA 3QCUH 3HA0A 3BZFB 3DVFA 4HLJA 4ZUSA 2BCMA 1OO2A 3I50H 3QWOA 2AK4D 4LU5L 1Y18A 1CCZA 3IDGA 1YN6A 5F1IA 2QPEB 1QSFE 2MOQA 3HHSB 2FQGA 2QELA 4IS6A 1WA2X 1NUDA 1S9WB 1MHHB 4HCRA 3PHOA 4UQ3B 1UH4A 2K6ZA 2NW2B 4G7RB 1F3DH 4Y0GA 3Q9QA 5ACMA 4LPTA 4J2QA 2PWEA 1GZPB 5KYXA 2H9GB 3RIKA 4DJMA 2ZUVA 1MHCA 2PNDA 4RNRB 2VC2L 5TDNA 1IZKA 3RDTB 4AIXA 4N2BA 5ILTL 5E8OB 1YJDL 3KH3A 2Q8BH 3FQTB 2CHNA 1BOYA 2DL9A 3DOSA 4PRIA 3Q05A 4G8GD 3SDXB 2WVVB 1FNFA 4NWUL 2NTFB 1X7QB 2E4TA 3G9AB 2A77L 4QHNA 1TQTA 1I8IA 4ZZFA 3RGBA 5BUAA 3ZYIA 1MCWW 4JCLA 1PNCA 3AB0B 4BFNA 5KTEL 1J9RA 4LSRH 4GG6F 43CAB 1FJ1B 1YECL 2IPUK 3BUQA 1OQOA 2XA8H 1DEDA 5D55A 1YNTA 2P49B 3HE6B 4QAMB 3VFTB 4PJIB 3GXMA 5TD4A 3UG3A 4Y2DB 2P43B 4TUOA 4NQDA 3B9KC 4KKPA 1BJ1H 1NIFA 2FZ3A 1B2WH 3UJIL 5C3IA 3NPSC 4X83A 3VGEA 5H8DA 4Y5VA 4KMQA 2WWKT 1NLBL 2ZUYA 3MJ9L 5HI4D 3V2AR 1U3NA 4FFYH 1AKJD 1BXAA 5T3ZD 4ZO9A 4JEGB 5FFGA 4PLOB 4EI6A 5A6LA 1YYLH 3PRZA 4J3UA 4PV1C 4S1RL 3CZEA 4L2YA 5JW4Q 1NBYA 3KPNB 3HNSL 3Q01A 3MJWA 5E2VL 5HDQL 3UG4A 4DVBA 4PEEA 5DJ0A 1TXKA 1K4CB 4FTDA 1LK2B 3CZFB 1ZDSA 1CN4A 3SE3A 3PLYA 3BXNB 4XNUL 3FT9A 1KCLA 1KXHA 4X7TB 2VN4A 4X6EB 1G6VK 3BMVA 4LK4A 2FGZA 5AAPA 3EOBB 2FEEL 2CLZA 4LESA 2V8LA 3GB7B 3MRFA 3FUEA 4WUUD 5AW7B 5LAXB 1OHQA 1A6UL 5MHSD 2EZ0D 1UM4H 2HJKB 1RMFL 3HC4H 2QPUA 1D6EB 4KX9A 1EX0A 1UD2A 1MRCL 3EZJB 4IKKA 4WI0B 4AMXA 1M57B 2Q9OA 4B9GA 4JPIA 3D85D 5B1JA 5I76A 2VDKB 5F7WC 3HRZC 4LLUB 4DPBX 4NQUA 4K5NA 2XY1A 4XCNB 4Z7OE 3SKOB 1E8ZA 3KYKH 4K7PX 1RZ8B 3ATDA 3OZKA 4GAYA 5HVHB 2TAAA 1WC7A 3BGAA 3SJVD 4AYDC 3O8XD 1WIPA 3B56A 3FFCA 5CILH 4NC2B 1E4XH 1OAZH 2DBJA 2BVOB 1WFUA 2F1BA 1LO3L 2YD1A 2V5SA 2HG5A 3E2HC 4NKDB 5KANG 1VDGA 2FAUA 4DEPB 5DRXA 5L88H 4N25A 1JNHA 2K7PA 4RGNE 2B9BA 2VLKD 3LQAC 4JHVA 4NP4H 3UPRA 1TTBA 1NGYA 3L3IB 3LJ3A 1U8JB 1DBKL 5F44A 1NMBL 1BSIA 2Y23A 4H8VA 3C5SB 1ZLSL 4Z7NB 3QI9C 3PREA 1KENH 2WSPA 4IJ3C 3L6FA 2WBWB 2QGEA 1B6UA 2VL5A 5GGVY 3EO0B 3GJEA 4BSVB 5L2KD 5IW1B 5GRUH 5FCUH 4AJVA 1MCRA 3O11B 4B3VA 4YIQB 3SN6N 3C09C 4ANXA 4A2LA 3KLQA 1OM9A 3MV9D 3QIWA 4QHUB 1PDKB 5T5NG 2NUTB 3G5ZA 4HS8H 1II4E 1T80A 3N42B 3P9LB 3V0EA 4X4YA 5IFHH 4KK8C 1B0RB 4XPGH 5SWZE 4X80H 3C60A 4FEMA 1AR1B 3EBAA 1BG9A 3Q8BA 4B9PA 2IMNA 3CMOH 3P0GB 4GAJL 4JKKA 2CHZA 4XXCA 1IEBB 3U0WH 3B2UC 4CBZA 4IGBD 5C2BH 2EDTA 5KYNA 4R97B 1R3KB 1YPZB 5FUCE 4UTAL 3H9YA 2BP8A 4UTCA 2YZ8A 4JJ5A 1NC2B 2V2WA 1S9XA 4PGCA 5AWNL 1YDPA 3MNVA 2FQEA 4E42A 2D3NA 2R1XB 4TQ8A 1O0VA 2XN9E 2BVPB 2VN5A 4U6HA 1GIGL 1I7UA 3LH2H 3BP4A 1KCUH 4ZMAT 3STZB 3P3SA 3ETBF 4LEEA 3WIHA 5SX5K 4AI7A 3NOIA 1BFSA 1D7CA 1OD9A 5AZ2L 1MW2A 5TTRA 4IBUA 3UIZA 4JPQA 2A1WH 3RWEB 3WNMA 3BH4A 1BFVH 3K72A 4UQ9A 3JV6B 2OFQA 3GZKA 1J8HA 3GI9H 3IDJB 4LOFA 3KPPA 5FYLH 1M2VA 5HI3D 3GKWL 3CFEB 1HCFX 4A2GA 1KB5B 4P2QD 4JKWA 5IEHB 3BUYA 5JIKA 3V7MA 3QYNA 1FFQA 1JVKA 5D1QE 1A7BA 1TETL 4Y5XA 1QASA 2AQNA 4Z9KB 5IWLC 1GY1A 2E75C 3HMXA 3V0GA 3FB5B 4FN0A 2DJ4A 4OZIF 1PLBA 1HXYB 1JWSA 2EDXA 1XV8A 3N44F 4XP5L 5T5NF 1W15A 1TTCA 2PTUA 3S37X 43C9B 3MLVH 4WI2A 5HVGB 5C2UB 2J3SA 2XI9A 4KOCA 4WHYG 3PHAA 4GKSA 4XCEB 3UYPA 2CWRA 4HF5H 1ETZB 4L9DA 3NIFF 3GSRB 4YK4C 2H3NA 2GCYB 3D12B 4YFDB 4MSWB 5CUSH 2OCFD 4IIQA 5DVKA 2F0CA 2G3MA 3KEHA 3T2OA 1M7IA 5FV2A 3FJTA 3DMMD 3KYNB 3LXCA 2HH0L 2P52A 3BEVA 4HD5A 1LMKA 3S34L 2BVEA 4YPGB 4JKLA 4PRDA 3ZKMD 2EYSA 2WQRA 4LE8A 2G75B 3VXNB 1UT1A 1WA0X 5J1AA 5CINL 2OXGA 4PGEB 2GTQA 1RIVL 3CZLA 4L4TE 3UC0H 1E4JA 2VLRD 3FPYA 2R0WH 4PJGB 3LNGA 5AEAA 3H2PA 1OP5K 5CS7A 2HTLD 4JUTA 4NBXB 1G7MA 1JS4A 3GZPA 4NQQA 3BI9X 4NKMA 1IC5L 3U4BL 4BZ1H 1AXSA 2WXKA 4X4ZA 2XDHA 3FN3A 1NCIA 4O02H 4MQSB 1F6AB 3EJYD 1EZVX 1XAUA 4N2HA 4S1DD 4KU1A 4FQHA 2F53E 5AW6B 5CP7A 5DF0A 2G9HA 1ZV9A 2ID5A 2CMRL 3LXUX 4PG2C 4AXWB 2J88L 1YUHB 4JPKH 5IMMA 4F9LC 4WO4B 1AQDB 2A6IA 3WLWD 2W38A 3CVDA 4WWID 4YEEA 5IQLA 4ZPTB 5C0GB 3P0YL 3P2BA 2V7NB 5HGDB 1FL3A 1X9LA 2LVEA 1SY6H 5C09D 3ZTNH 1KCRL 3C5JB 2DQTL 5E9DB 4KO9A 4JREB 4OLZH 4GH7B 5ETUB 3MO1A 4R3SB 1W16A 5I1CH 2JB6B 1NFDB 1EJOL 5I8EB 2HB0A 4JY6B 1U8HA 2XETA 4H8PA 4QF1B 4AKPA 2PCFB 3QR2A 1Y1UA 32C2B 4LOUC 1JDAA 4UOW1 3HAEG 1PAMA 3SIKA 3L2LA 3HI1B 4PJ5B 1X5FA 4ZW7A 4DP6X 4G82A 2ICWA 1OAKH 1BD2B 1RK0A 2P48B 3GRBA 4P3DA 5DUBB 2PW2B 3OTTA 4FQ2H 2RR3A 1G1YA 4O51B 2NSQA 3TO4B 3TZVA 2WVTA 2HT4D 3TFKD 4NRYB 4HJ0D 2BFGA 2DM7A 4D94A 3QNXA 3VMNA 2B59B 4MA3A 3HE7D 4ZK8A 4KJPC 5IM7B 2E0PA 3KDPB 3WFBL 2XQYG 4MYPA 2V7HA 5D1ZC 4HWEH 4QXWA 4FA6A 4MJ6B 3HUJB 2HA1A 3OPUA 2Y7QB 2Z31B 3GUTA 1I8MA 1AO7E 2GUYA 4U1SA 2XY2A 4GAFB 4EJ1C 1OT2A 4JFYA 1UZGA 2QLYA 4CJ1A 3WS3B 2XG4A 1EUTA 3KWWB 3MRRB 3W9DA 3DX0A 4W6XB 5BZWA 1NM9A 3NH7L 3RIFF 4KK9D 1RLWA 2X1QA 4Z95L 3W37A 4MMYA 3H9SB 4N0RA 2UUDK 4C83B 3D39D 2YPLB 4KH2A 5ENWA 1ZXQA 1W0VA 5I8KL 5A6MA 2VR4A 2DIEA 1PSKL 3EG9B 2COQA 2BVQB 2BFVH 2DYPA 3FCSB 3U7AA 1YNLL 1GH7A 4QHKI 4QMEA 1FFPA 5ABDE 1HAWA 1F58L 4MCYA 4ZJ9A 4C56A 2ZKHL 4D0CB 5D6DC 3QJXA 3TBYB 3F85A 4R96A 3ULVE 2LV4A 2EXSA 3DC0A 1VADB 4ZUUB 1ZK5A 1ASPA 2PP9A 4PJBE 5FLUA 3O9WD 3PU7A 5KVFE 3DUSA 3VXTA 4AWJC 5L9DH 2QADB 5E70A 2OQJA 4YXKL 2ARJA 1IBHA 4KNQA 4G83A 1EA9C 4WWKC 4I0PD 1FH5H 3D18B 4HWBH 1VGKA 3SKNA 5CIPB 3EOTH 9CGTA 2VW7A 3STLA 2ZSVA 3PXHA 3WD5L 3VFWA 1D5BB 4G42B 1EQWA 4KHTH 5HHNA 1YEEL 3LPFA 5CD3B 5HYQA 3NT0A 4EN2A 3LZOA 5BS0B 1YQVL 2R0KH 5CZKA 3QH3B 4XHJD 1YEHL 3V4UH 1WS8A 5JIDA 1ZD6A 3NRFA 2D7QA 4W81A 3NGBB 5E6UB 2ICEA 5GPRA 2K9UA 4KQ0A 3NABH 3MLYL 3DRTA 3MQIA 1DANT 3HG1D 4RFEB 2FWSA 5E8NB 3SDXF 4MNQE 1J0YA 2N3JA 2OI9B 2UWEF 3F6LA 4I1RA 4YDLC 4QLWA 3VX0A 3TJHC 2Z7WA 2MCPL 4IKJA 3BESR 2JI3A 4G6ML 4PP1C 5MERA 5E5LA 3F7LA 2OW7A 3QXVA 4NZUL 4JY4A 3ZUCA 5J56B 1F1GA 3B7UX 4B41A 1XGTA 3GLEA 4OI8A 1DZBA 4P59L 5E2UH 1MCQA 1TU2A 5B8CA 1YMMD 2JJVA 1WBZB 2WUCL 2YD8A 1CE1H 4LB8A 5EPMB 2PYED 3UDWC 3AGVA 1S5IL 1JERA 1I3GL 4KJWD 1QLRB 3GBNH 4BKLA 5I15L 2CLVA 4KRPD 2W91A 1BJ8A 2CJUH 2MKWA 2UX6A 4R2GC 1MW0A 4IU2A 4DUVA 2XWTB 4DT2A 4HOZA 2V3EA 3IETB 1E9QA 3NSXA 3O2DH 5TQ0H 1CI5A 2X4RB 4X6CB 2NZ9C 3QUGA 1IILE 1B3IA 5BJTA 2FQFA 1A66A 4K3HA 2WO4A 3GXIA 3TBSB 4LSUL 2VRAA 4B95C 5I16B 2Y2YA 3L4UA 4XN9A 5GGSB 4NC1E 1HEZB 5DJXB 1CYXA 3BVVA 3AAZB 1BDYA 2V9QA 4FX5A 1WJ3A 1HHGA 1QZNA 4WJKB 1A64A 5I5RA 3RVVD 3MREB 5TFSL 3QUXD 5E0QA 1OAUL 4LCCB 3U2SB 3RBSA 3TWCH 1OPGL 4PRIE 4ADJA 4F8TA 5JHDB 3IDIB 3OB0K 4U7MA 5D2LB 1WHOA 3BAXA 3QQDB 1ZE3H 4BH7B 1FO0H 4O2CB 5DR5H 1ODAA 5EEUA 1I8AA 2HLEB 4UIMB 1E28B 3QA3A 1Z3GL 1HL4A 4YE4H 5BXFA 5JYLA 5HHVH 2WLJA 4E9VA 4FA8A 1T22B 1L7IL 2QKIA 4OY9A 3KPRA 2IH1B 4XB7A 4W1TA 1TYEB 4KI5F 1JN6A 1GGCH 5FO8B 5LNEA 2G3XA 3OD3A 3TBWA 5I1KL 2CSPA 4NQDE 2GKIA 1AS6A 3I75B 2ZG1A 1U3HA 5IVXF 4YHOL 3RZCB 5KJRH 3JYCA 3JV4A 4JFFA 3SCMA 3MROB 2GUOA 4WCYL 3WIFA 3LEVL 4R90L 4KTEH 2FNWA 1C7SA 1JGDB 1U93B 1QRNB 5DD6A 3WE6A 5GGTL 5KS9B 3QBTB 3MRGA 2OP4H 4LAJH 4UQ2B 2FQDA 4NERA 4AK2A 1MI5D 4OD2A 4PIRF 4MJ2A 5J11C 2OSLB 5KZCB 1U95A 2Y1YA 4QXUL 2K3HA 2OULB 2YQBA 5C7XH 4OCXL 5D2NA 1IBBA 3MRQB 2Q8AH 3LRKA 5E9NA 1OY3B 1TZIA 4FLHA 3BPNB 1K8DB 4H0HB 3FT1A 3MZGB 3CZJA 1NAKL 2OTWA 3N42F 2G2RB 3BYTA 3ATAA 1KIRA 4AYEC 4G6FD 3UAJA 4ATWA 4MXWH 3MLZL 3OAYK 2BZ7A 4ETQB 3CH1A 4F15C 3FQ4A 2XV2A 5B7EA 2A6KA 4KKNA 1OE3A 5D7LB 3RI5K 4M5YH 5GZOD 4W9JC 2DH2A 3NIDE 3N41B 3H4HA 2CM6A 3G04A 3KGRA 3TPUB 4UQBA 2XQ0A 4FNLH 3V4VL 4K3DL 5SV4A 5IKCB 4BZ2A 3K6SA 1NIAA 2ESVB 2QQLL 4U6YA 2F9BT 2DQFA 4XT1C 1AI1L 1DVZA 4PH8A 1ORSB 1OARH 3FFCE 3B34A 1JXJA 2VZ3A 1MVUA 4I0CC 1J9SA 1W8EA 4OTXH 3BKYL 2DI9A 2YMOA 2RB8A 2WQ8A 3MLWL 3ZU8A 5IQ7H 1HDMA 3F7YB 3IMUA 5D1ZI 3FQNB 4LDLB 4NN5B 2V2TB 5FHAH 3IEAA 5E8EA 3US1A 1VLXA 3NJIA 1CWVA 1OSEA 4HEPG 3UEQA 1BWMA 2FIRT 4AG4L 2CA4A 3CN1A 1RUQH 4OGYL 4XH2B 1WS7A 4Y2LA 4ZMWA 4XN5A 5GISL 2YRZA 5LN8A 1T03L 3O0RH 1UA6L 4FQJH 4LLYA 4R8WL 4U1NB 3BKML 5CP3A 1N6UA 4ZPVA 3POHA 2AV7B 5JXEA 1HX0A 2G4GA 4XNZC 1NAMA 3HC2A 1JZ3A 1DFBH 5C92A 1UH2A 2FK9A 1NM4A 4MCMA 1U91A 4L3ED 3DXAA 3HRZB 4LHUA 4UAOC 3OL2A 5FUCC 4LCUB 3TVMC 3T9WA 4KTDH 3N9GL 4ZXBD 3UAFA 1JHLL 2UZYB 1F90H 2XQBH 5LNGA 2RTTA 3OMIB 2CD0A 4MJJA 4L5FL 3CFJB 1SM3L 5J8OA 2XC8A 3MR9B 3CFKB 2KQNA 3C5ZA 2ROXA 1KPVA 4BQ8A 2F7RA 4GMSL 5JZ7C 1L6PA 1LO0H 3QARA 1BGXH 1DCEA 1OGPA 2C3GA 4NZRH 5HDLA 4A68A 4G3YH 4AQ1A 2QVIA 3D3VD 3ZRFC 1HU8A 4LHJB 3UXFA 5C6TL 5E6SB 3CZUB 1JGIA 3FOLB 4YHIA 2FUQA 3I6KB 2AP2A 5F7LB 5BO1H 3QFJA 1JAEA 3T2QA 3VXSB 3FT2A 5FO9A 4V1DA 5I66A 3LRHA 1GOGA 1CTOA 3L3HB 1J8HE 2HSIA 2Z91A 1FVEA 2MQ0A 1PZ5A 5GRWA 2BK8A 3TYFB 4MB3A 1KF9B 3AQZA 2PXYA 3RNQA 2ENYA 2R29L 2WCGA 1HL8A 2ZUQC 2R0LH 2YRLA 3BT2L 3LS4L 5ESAB 3MRIB 4JO1L 5DI8B 1JTOA 1DBMH 2XXFA 3BIKA 2LOEA 4PJCE 2KMWA 1UGNA 1O7DE 2FH8A 3EGSB 3VD5A 2QZ5A 3QUYD 3VXMB 1JXGA 2ED6A 2F54E 4RZCA 4JGMA 5DVLA 1P7KA 3FQRB 2V4LA 5AVWB 4O00A 3K5RA 4XP1L 4F37K 5C0FA 1RZQA 2EVJA 1M2OA 4XNXH 5IEKA 4MB4A 4Y4HA 4CDGC 3FRPA 1GTNA 4XX1E 2EDJA 1OTTD 3ML8A 3ZX1A 1LP9F 3S88H 1EXHA 1H8OA 3AT0A 1OGAA 3GSNH 4LVNB 5BW7C 4MMZA 4QOKD 1P4IL 2WYIA 4HJIA 4I3SL 4K9EC 1JFQH 3V8OA 1HWGB 1BCIA 2P4AB 5AKVA 5B3SB 5J12B 1PX3A 3RWGA 1X4ZA 2V2XB 3X11B 1U8KA 4POZC 3ZTCC 1GJUA 4NFCA 4O2FB 3QIBB 4KGJA 4MX7B 3VXTB 1WVZA 3T4YA 5EORH 2WQWA 4NN7B 3SKMA 1D5MB 2J56A 3U6RA 5DO2C 4L18A 3I6LE 4KQ4H 5DD5L 3B7YA 1V10A 2N1TE 1NMCB 3L54A 3RNKB 3H2WA 3APDA 3B83A 1BIIA 3UERA 4BIKA 3FQUB 3GBLA 3VMPA 4HG4J 1A22B 1WZLA 1KYDA 2GJRA 1CT8B 2XN0A 5DVOA 5AD0B 1U8IB 1ZVSB 1P4BL 7FABH 3ESOA 1YN7B 1ECZA 4HCRL 1JYVA 1RUMH 4JFQA 3RX5A 3QO1B 4ABUA 5I17A 1I3VA 3W0WB 5DZOA 2CIIA 3B9VA 2EEFA 1GC1H 2N4IA 2ZYRA 3DWTA 4BBWA 2NUPA 4MA8L 4DGIH 3DDGA 1IT9L 3K2KA 4LL1A 1KWGA 3G6AB 4ODUA 3UZVA 2WC7A 4NKIH 3HZVA 1JF5A 1ZHNA 4QRTA 1G9EA 4HU2A 1DBJL 5F3HB 1UWXH 1VF5C 5IB2A 4JDVB 2BSED 3MOQA 2V33A 4G7YL 3U30C 4EZKA 3GO1H 5FB8A 3HNVL 3G9VA 4UTBH 4X7SH 4PJ7B 1SZNA 2X70A 2WXRA 1KGWA 1MAKA 4A37A 4UV4L 2CDGA 4M8UA 2NY2D 4AVHA 1SXZA 1LO5B 2PYFA 2J1XA 3HS0B 2BHYA 4NNYA 5I74B 3OAUH 4L3AA 2NY4C 4TUJB 1NPNA 3QDGA 3ZDYB 2UY6B 2Q6WA 1JWMA 3HI6L 4YSRA 5L7XH 1P4UA 1QTYT 2B4CC 3CUPB 4L1LA 5D7EA 1FGVH 3HPLA 5FYJU 1JZ7A 1I8KA 2VXSH 3VM5A 1F3JB 2J6EL 1J87A 1I9JL 3UCRA 1IGTA 2A6DB 4MNHA 2AKRB 2BSSA 5L6YH 4LSVH 3ISWA 1XSIA 1LEKA 3LKQB 3QHZL 3VFRA 5K9QI 3VQLA 4APQC 2O93L 3LKNA 4HT1H 4DPRA 3CC5B 2HKFL 3CVHB 4PG9A 1KACB 4P2OD 1N5YH 1GMIA 3ECWA 3T6QC 2MWCA 3RTQA 4JFOB 3N1MC 1HKLL 4KAQH 4PI0A 2C4FU 4RIRB 4DGVH 5TH2B 3NFSH 4JO4H 4JDTH 4OUUA 4OM1H 2XZAH 1U8MA 2HVKA 1E2WA 4PUBH 3ZE2B 5IUCA 5AL8A 3A4FA 4QRRB 3WEBA 4TULH 3IMBA 2AJSL 5HGBA 1VGEH 3TBVA 1BOGB 4ODTH 3V4PH 2ORBH 5G4NA 3HRPA 1UH3A 4FLRA 4DN4L 4HKZB 4FMVA 5DXWA 1ZSDB 3KCPA 3HW7A 3VXQA 4NIYE 1AD9B 2J8UF 7PCYA 1UOLA 4IRZL 1E0OB 1F3DJ 2B14A 4H20L 1F42A 3NDZE 4FFYA 1RZ7L 2UX7A 3WKMH 4YUEL 1G9NH 4EVNB 4UIKL 2CCLA 2GW5A 3VXRA 4XCCH 4LRNH 4W6YB 1IC4L 3H0TA 1T0NA 1MJUH 2VDQH 2VSKB 5CLYA 2P5WB 4A7TA 4OCWL 4LSTH 4Y9BA 2I9TA 3BEWB 1C1EL 2YXFA 5DWUH 2W65B 2JJWA 5LWYH 1TJIH 3OR7B 1MRFH 4PP2B 3H3BC 2BSCA 3QZWB 3ULUE 4H1LB 5H37H 4PJDB 5DUMH 3QEUB 3MRNB 5DQJB 1I7TB 4OF0A 3MAWA 5KVDH 2MNJB 4LLMA 4Z76B 1IC1A 1D9KB 2ZOOA 1D5ZB 3CV5A 5GS0D 3NN8A 5HHOE 4ZMOA 2H32H 4XOEA 1NCAL 5I8CB 3VE0A 4LAQL 1TEFA 3QEQD 1PG7L 1BJ1J 5F7UA 2CRIA 2FJUB 3UZQB 5I75B 3CSYB 3T0EC 1Q90A 4KTGA 2H45A 4GW1B 2BRRL 1TQBC 2FL5B 5AW1B 1XWVA 4FMKA 4P2RD 4F8QA 2PCPB 3H85A 2HAZA 5EIVA 4F2FA 2EVIA 4Y9FA 1U3JA 2AFNA 1IGCL 1Q0XL 3AQDA 4GXVH 2P8MA 2WCPA 5IFAL 1H15A 2WTPA 3LSOA 4BA0A 3MFFA 4Z7UB 1QBML 1HNGA 1VFMA 2FBOJ 1IC7H 1C08B 4K7PY 4ODWB 1ESOA 1MF2H 4E41B 5J0BA 4XZUA 4PV9B 4F9PA 4Y4KA 4JZOB 4LSQL 2GSIB 4HWNA 4PLNC 4R7NB 2CG9X 2HVBA 3UBGA 4UINH 1EAOA 2EIZB 4UYQA 4M29A 1A6AA 3NP4A 2BSTA 2RD0A 3D25B 3T04D 1J8KA 4QO1B 3ZRCC 3KWXA 1CD1A 4M7LT 5KS9F 4XAKD 3TASA 4I9XA 3PDGA 5EULV 1ASQA 1N8OE 2OCJA 4OLVH 4Y9GA 4ZFOL 4MS8C 5CU9A 3HZMB 3FT3B 5DJAA 4HCFA 4PTTB 4AVKA 4JFEE 4U3CA 3REVA 4NI3A 3APMA 4ALAC 1I3RA 3GHBH 5HDWA 4C4KT 3KYOA 1FG9C 2OV0A 2W07B 3HFFA 4X98B 4FXGB 5EBWA 2VM4A 1CXHA 3LRLA 2A73A 2EEDA 1NUGA 1RUPL 4OVVA 2X6CA 1HHKA 3FTUA 1IGIL 4KKLC 3US9A 5F7DB 1A6VL 4FABH 5KBMA 1ZSHA 3P77B 1UZ8B 1XCQA 2Q3ZA 3CQQA 3VCLB 1NGWB 3IXTA 3L3DB 3Q1SH 1XDTT 1S46A 4PLKD 1QSFB 3N41F 2MIZA 5IQMA 4KKAC 1CBVL 2HG0A 5EU3B 4MJIA 3UBXG 1Z9OA 4Y5VC 2B5IB 4WUKH 3KPRE 4JS7A 1LO2H 2HJFB 3BVWA 1E4WH 5GIRB 4DKAA 2X4NB 2XSKA 2ZX7A 4WF7A 5HPOA 4GIOA 5GJTL 2GBVA 5F7FA 1OTSC 4LLWA 1G43A 1CGYA 1O75A 2A3TA 3DRQA 1DBAH 3DSNB 4PR5B 3SDYL 5DRNB 5TDPA 1C12A 1IAIL 2V3FA 4GQ9L 4JFFE 3R06B 5IBTH 1HTYA 4AE1A 4D0BA 3S3PA 4M7JH 2WV3A 2WD0A 4EKXA 3QC6X 1JJUA 1AHMA 3ZLQC 2AQ2A 5HDBF 3L3OC 4CADA 1T1WA 1O6TA 1MAJA 2VSDA 3HNTL 4HJTA 4AL8C 3M7OA 4FHKA 4KRNA 1NCBH 2OSYA 3MBXL 4AVJA 5D2NE 1NPUA 3L5XL 5EN2B 2WXIA 3BVNA 3P3UA 3S5ZA 2NY1B 5K9KA 2X2JA 1MWAB 4P3WA 4G1MA 4TVPL 4KI5D 3MLPA 1MIEH 3NA9H 3SDDC 1ERNA 2KDYA 4NQCB 3RVWC 3F7QA 5D93B 5KBDA 4FFWD 1IBGH 5AYQA 1OCZB 5I6KA 3TF4A 3P4MB 1CFQB 1MQ8A 4WV1B 5AOLA 3GRWH 3H7BA 2YMXH 3Q6GH 4KGLA 5FYKH 4I9WD 4RH4A 1GS8A 3CDFA 4XWGH 3GMNB 3P30L 1MFBH 5E0FA 3SDCB 2OX5A 4ONFH 5LAPA 1Z3RA 1XB6A 4IYKA 3GS0A 2XX0A 5K39B 4AIZB 5ICZB 2AHIA 3QCVL 2X6VA 5ABZA 3SKUD 5IZ7A 1QFWI 2AK1H 1CDHA 1XIWC 1A9BB 4FKEA 4Y16B 3WKPA 1V7MH 2W5PA 5MEPB 1KMGA 4Q6IC 4OZFB 5SV3A 4BZ1A 1BFOA 2VDNL 4BH8B 4CNIB 2YSTA 2HFEA 2X40A 3BKCH 2FWOB 1CF1A 1AR1D 2WBJB 3VWJB 5KN5A 2PO6C 1IKNA 3WN5B 3WHXB 5I5IA 2B1AH 3ZKNC 2DTSA 3OAZK 3PGFH 3APCA 4GYBA 2UY7B 3T0VA 3PNRB 2YR3A 4Z7OB 3TIEA 5T3XL 1FC2D 3AREA 1G0DA 4G7QB 5KSBB 3FUFA 4GG8A 3C60C 1N6QL 4K23L 1W80A 4JQVC 4ZS6C 3G5XA 4Z3JA 4H7VA 1ET8A 2EABA 1JVLA 2X4QA 2KZBA 1CIDA 2NZ1A 3GQFA 3ABMB 4N6QA 4A6YA 4HZLB 3DXAE 2VT0A 2E27L 5CSZB 4BFBD 5HPMB 4HHAA 1E9OB 3PE9A 3MC0A 4RGNB 3RRQA 3WOVA 2HKHL 2B77A 4BWWA 3LN4A 3CU7A 4WKZB 1Z6JT 4JDZA 1SVBA 5CJOL 3L2NA 1VFBB 4JVUA 2UZPA 3ARGD 3DHUA 1LL1A 3TN0A 1O5DT 4L8BA 3OR6B 4L1BA 4PPTA 1OP9A 3KR3L 5I1EH 4FYSA 4NQXA 4CMHB 3ECBA 1UUSA 1ZS8A 3T1FB 5JLZB 2WLZA 3IJSB 5ICUA 3U6XS 2YGNA 1QYGL 3MLSH 5SWZB 1LNUA 2H7WA 2LTQC 5T1MB 5D7JA 4OFPA 4XNZB 4JR9L 4HLZG 4FQXC 3JTSA 5JW4N 4F27A 2RAMA 2AW2A 1K5NB 3U7WL 3QQ3A 3FO9B 4RAVA 4V1DE 4ESKA 4GAGL 2XV0A 1CGSH 3JWNG 4UAOB 4WTZA 2KKQA 4E5XB 1O7DC 1I4FA 1Y6KR 2VXTH 4L9LC 1U36A 3ILDA 2X05A 3NUKA 2IANA 3QJVB 5DC9B 3FKUS 1A3LH 3OKMA 1EK3A 2QJDA 4YBLB 4YHYC 4BSWA 2R56H 4WFEE 3P3TA 2FJFA 1E4KC 2AV1B 1BZQK 3FAWA 3GM8A 3KLHC 2BSBA 4N9GB 5F9OH 4Z3TA 2BVYA 3MLUH 2MNWA 3IF1A 3J27A 2WQSA 5SWSA 1QBLH 4IIQC 2HLFD 4X7FC 1BM3H 2CPUA 5F71A 1OP3K 3L95B 1F4AA 1SJEB 2IPTL 1PKOA 3P2DA 2ADGA 1GCYA 3B7SA 1ETB1 3L4YA 4ZMYA 3X1NA 5I73C 5K9JH 1OGAE 5D1QB 3CZSA 1WH0A 3VDBA 1M7UA 4KZ0A 5JDSA 1WT5C 1ES0B 1YY8B 1I9RH 3GSQA 1HILA 1UHVA 2JK5B 3VM7A 3EDKA 2R2EB 2ADYA 3VX1A 2ITEA 1JGVH 5DJ6A 2GPZA 3ELQA 1GYUA 3BH9B 2A9BA 4RMSA 4HWBA 3TA4D 1XB8A 1NCDH 4NQSB 1NBCA 3WXWL 1NIEA 2H2SD 2CO6B 2EDLA 1E5UI 2R7EB 2QQKL 3CDCA 4FP8H 4N5ED 4R7LA 1TVBA 5GGVH 3W39A 3AC0A 3QZWG 4K5MA 4UDUA 3S36L 1AANA 2Q7AA 4H1LG 3ILQD 4NM8H 1HS6A 3TM6A 4WO4D 3BE1L 2A9NH 4YL4A 3FDWA 1I9EA 1MRDL 4OF6A 5KOMC 3GMQA 3FSOA 3OHXC 2QTEA 4ISVA 4XBGB 4NKOA 5E9DD 3Q3GA 3MLXL 4I5BA 1USQA 5IHLB 3CXDL 4JO5A 4C4KO 3X17A 2Y25A 3ZZQA 3P3YA 2I85A 4UT6L 2QZQA 4RCAA 5EWIH 1VZIA 3DROB 2E7LC 4NO0A 5B39G 5HHPA 1TQCC 1IMHC 3VYPA 4PJ5D 3IBEA 2CKNA 5CEXB 1TPXB 4DAGL 5HYEA 1BD2D 3V6FB 3KEDA 3CFCL 3KW7A 3BWAB 3EGDA 3OPZL 4LSSH 3MJGX 3ZE2F 4GKZA 4AQ8C 5IY5B 1EO7A 3O6FB 1KIUB 3QUKB 1PNDA 3TO4D 4IBTA 1JPGB 2F5AH 4FYRA 3RJQB 1KT2B 4RFNC 1GYVA 5DZAA 2VITA 2VDLH 4G9FA 1BEYL 1CDUA 5I28A 4P23A 4A2DA 1M6OA 4Y2OA 5FPIA 4ODXA 4Y7OC 5CEZE 1E5AA 1R5VB 4FTVA 1BVLB 4RMBA 1SOQA 2Z31D 3L8QA 5JO5B 1KBPA 1A1OA 1W72B 1UXLA 2F53B 4Q58C 4WVRA 5HYJA 2CIKB 5PAZA 3O4OC 4HPYL 4PV8B 4WU7A 1D3CA 3MVSA 5C0AA 2HLAA 3SKJH 4KJYB 4I3RH 4X6BA 4AEHL 2I9LA 1BPLB 3QDGE 4TLUA 5GS1B 1C7TA 2BJMH 2CCVA 4ELMA 2V5RA 4GSXA 4P2CG 2BNRA 3H9SD 2FTAA 4TNFA 3LIUA 1T7YA 2YPLD 4EIGB 4YVNA 4XBPA 5CSBA 1E50A 2BCKA 5TJWK 4WK0B 3R0NA 5GGUA 4RMRA 3VGBA 3CN4A 1IRAY 3EOAA 1E40A 1U2YA 1GZQA 1WISA 5HHQA 2LU3A 2VLME 3VRIA 1OAJA 2IQ9H 2X87A 3QQXA 3V0WH 4FCAA 1N3NB 4JZNA 4P5TC 3O6ML 1AFVH 5EA0L 1F00I 1K4DA 3C75A 3QRBA 1FO0A 1T1ZA 3I6GA 1Q0YH 4EE2A 4WI4A 3R8BB 1OAQH 4MD4A 1ZS2A 5F7EH 4P2AA 4U1HA 1S7QA 2ZYIA 4MJ4A 3RU8H 2N01B 3RUGA 3ZE0F 2QADD 4KITB 2O26U 1JRHH 2KH2B 2DF3A 3AS2A 3F7KA 4X5WA 2DQUL 1WUNT 2ZWKA 5DJDA 5ECGA 4F7KA 4MASA 3ZBMA 5AG9A 2BIIA 1A4BA 4Z77B 1AO7B 1N8ZB 1CO1A 1IUZA 5D1XD 4HIEA 5BRZA 2IWKA 5ITBL 3IFLL 4OCNC 4QTHA 1G7QB 4Q8BA 4L29B 3PGDA 2E7DA 2MMXA 4BFGA 5BS0D 3MRCB 1YY9D 1OSZB 3SBWA 4AQAB 2NQ3A 3PS6A 4OJFH 1TZ8A 3FN0L 2AZAA 4WJG3 1CXFA 4NJAH 5GSVB 3ZOAA 3BP6A 4F8NA 1ED3A 1RZKH 2WAQA 4LGRB 3CX5K 4FXKC 1D5RA 3MXWL 2A6JB 4R26H 3SOBH 2Z6FA 3LXAA 4U3SB 4U3HA 5F3BB 1Q9OB 5BUPA 2R51A 2NY5H 4BGLA 1AHWA 1DJWA 2BDNH 4HUWB 4JQIL 4F7EB 2DM2A 4QEGA 2ICEC 4LEXH 4MKMA 4PTUA 3GNMH 3RWJA 3C12A 4JM2B 3RLSA 1AD0B 2P42B 4PREB 1OWWA 3BDYL 4P46B 4ZTOL 4XBEH 2WQXA 4YQXL 3RKDD 4L8DA 3K80A 4ZSOA 1DQKA 3ABLB 1NCWH 1W0WB 4PJBB 1X5YA 2OYPA 1MFAL 3BSGA 2FECI 3DK2A 4AUYA 1P9MC 4NO2B 3R4RA 5INCB 4FQ1L 2GIMA 4UU9B 3B8YA 4MZ2A 1C5DA 3EBIA 4ZODA 1HIML 2Z8RA 1JTPA 4FJ6A 2DQGL 2ZWNA 3ASOB 5DMGC 2XN1A 3RGVA 3MYJA 1S7UA 2H6PA 3FU0A 2ZKWA 3I74A 5LGYA 2F7PA 3P40A 4KUZH 1LVEA 3VWKC 3S5LB 1A4JA 1YEDA 3ZK0A 1OW0A 4MQXD 2CKBH 4WI6A 5INDA 2WQAA 3O3DB 3A6BL 4K8RL 1UJ3B 3E1ZA 4YFLI 3D0LA 3IGAB 4JFPB 3WDIA 4LCWA 1FNEA 4JFDB 5DD3L 1PY0A 2DWEA 5JHLL 1NCCL 2VE6B 2YUVA 4P05A 5EF2A 1E6OH 3S5YA 2Y1AA 3GZOA 1R5WA 2ZXDA 4UB0H 4OH2A 4MNQB 3L4ZA 3ZSSA 4ZD3H 1JHKH 3OXSB 4YL9A 5BPPA 3DX9B 4I7ZC 1JPSL 4EMZA 1TTRA 4N6RB 2V37A 3V5KB 5F7YC 4PSRA 4AOFA 1PD6A 3FQWA 4EUPB 3FT0A 1ZDQA 5F0PB 4U2YA 2DS4A 4NUPA 4KC3B 2KDGA 4R84A 2E56A 2P44B 1UD3A 5AW9B 1HHJA 5FUZH 2Y9RT 1ZVHA 3IGLA 2PCXA 1Q8MA 3LB6D 1Z5HA 3RWHB 3VXPB 4OJAA 3O6LH 2NX5E 3ZDXF 4PJHB 3PL6C 3OKDA 1N70A 2OMTA 1DEEA 3QSKB 4KI1A 4KBPA 2QSVA 1KY6A 4P3CH 2YPVA 3EH2A 4ZUSB 3RZCD 4GRWB 3KJ6H 4FDWA 5A3IC 2IH9A 1PW3A 3FU3A 1JWUA 3QRGL 3QWOB 4P57B 4PS8A 3TT3H 3VNZA 4A7GF 1X5MA 5JR1L 2EO9A 1KOAA 1YN6B 5F1IB 3N85L 4N90D 4FULA 1NGXB 3V0JA 1KFAL 2JE8A 1X5HA 3L5WA 2ZXAA 4IS6B 1MCNA 2ADJA 4MJIE 4X9YA 5KZCD 4OI7A 3PHOB 1NCUA 4WEBH 2Z0BA 1IBZA 4FGMA 3DV6A 2XFGB 5FYLE 3U0TA 5KYXB 3AZUA 1KEGH 1MHCB 2W81C 1SXAA 3MJ8B 4KVPA 4YHPB 5FC9A 4PRIB 3RWDA 4ANUA 2EDMA 4MWFA 4E5XG 2Z8WC 1CQYA 4QHNB 2A9AA 2Q10A 1I8IB 5J6HA 5DRZA 3C08H 5D7LD 4K2UH 2IBBA 3OLDA 2IBZX 4KVCH 3VXUA 3KAAA 4G8FA 5KSBF 3G6JF 5D71H 2HFGL 3LIZL 2DQEL 5A2KH 1PZSA 1YNTB 3II3A 4F92B 1Q4NX 4CW1A 3DIDA 1PLGL 1L6ZA 3C5XA 3CBRA 3V0VA 3EO1A 2ESVD 3FN9A 4PJEE 4TUOB 4NQDB 1PLAA 2FZ3B 1DUYB 3GSNA 5KAQF 1H3PL 4XP4L 2J25A 1XO8A 3ET9F 4ZO6A 1KJVB 4Y5VB 4XP6L 4MDRA 2ICWI 1P69B 25C8L 2CDEA 3FFDA 5EZOL 1CDCA 4EI6B 4ECNA 1P5UA 4PRHD 1NBYB 4JAMA 1WCQA 2XG5B 3FZUC 3JWNC 3CK0L 3GIZL 3TV8A 3LQAH 3ZE1B 4B60A 4DVBB 3TIDA 2WWMC 5DJ0B 2A99A 1LDPL 4IOSA 4PMEA 4PSPA 3E6HA 3SB3A 3F05A 4KX8A 3QCUL 4HWUA 2B7DT 3IVKA 4L1DA 3VI4E 2IG2L 1JTTA 1O7VA 1YEIL 4Z3IA 2WM0A 2CLZB 1D5IH 2CU9A 3LPGA 3AY4A 3F65A 4ODSL 3IRPX 1YLBB 3DBSA 4XVTH 3WAKA 1SPDA 1FNSH 1OV8A 2B15A 3UGXA 3E6FA 2BIOA 2VQ1A 2J21A 1F2QA 3MUGA 3QJZA 4RMWA 4JPIB 3NIDB 5HY9A 1CLOL 1N0LA 5I76B 5BRPA 2H0JA 3CAFA 3F7RA 3EFDL 4PS4L 3CXHJ 4NNPH 4GAYB 5J6GA 2FJGA 1WC7B 2HX8A 2I5YL 2L8AA 3FFCB 4TLTA 4Q9CA 3KL5A 1CL7L 5FKAA 1MCLA 4ANWA 2ZOKA 1UB5A 2HG5B 2C3XA 5CCKL 5M7QA 3NP3A 4QCIA 4LSRL 4DH2A 4UTBA 3AM8A 5ITFA 5DRXB 4FHJA 2IXQA 4KOBA 1VACA 1JNHB 4GW5A 3ZXAC 3UPRB 2EIMB 1NGYB 3VXSD 2L0DA 2AJVL 3WSQH 3BAKA 4LPWA 2UXGA 4HAGA 5E00A 4AQ1C 4RRPG 4U0RB 3L6FB 2YA1A 3GJEB 5AYTA 2WOBA 1ASOA 2PWGA 2EXWC 3RJDA 4ZUVA 1J1OH 3Q6FB 3ZDZF 4JM4H 4J39A 3UJTH 3VYOA 3NTCH 2OCCB 2VXQH 3QIWB 1I8LC 4FA7B 1SEQH 1YYLL 3O41B 3G5ZB 4ZX4A 4H0LC 3ABKB 3DOIA 1NINA 2XVKA 3HN3A 3PAZA 1TLMA 4X4YB 3TP4A 5D8JH 5I2IA 3QC5X 2PXYC 2KZWA 1HI6A 4TQPA 1MHEB 5J13C 2HWZH 2BP5M 2DBLH 2Y6TE 3GDCA 4BUQA 1MY5A 2B08A 3IWVA 2H8PA 4IM8A 1ETA1 2XA3A 3VACA 2BP8B 1H8SA 4JJ5B 4PGCB 2V2WB 1S9XB 2WK2A 5IESH 1YDPB 3MNVB 3V8CA 4E42B 4I18C 4KK6C 3GI8H 4UNTA 1ZHLA 5E24E 2IANE 4U6HB 4S0TD 1I7UB 3BP4B 5D7KE 1UM6H 2QFRA 3VTMA 5IJKC 3MOAL 3VD7A 5IR1A 3CLEH 3H9ZA 4D0DA 1JZ4A 4PJXA 1I3UA 2LR4A 3QPXH 4QRPA 1L9NA 3QIBD 2J8OA 3ARBC 4OCSL 3U1SL 1QFUL 2NQDA 5E56A 1U9KA 5D96B 1AXTH 4TKWA 3K72B 4U1KA 5SWSE 5DJCB 4TNVF 1J8HB 4FG0A 3KPPB 2J5LC 1MCEA 2JFCA 1M2VB 4H8QA 5CILL 1OAZL 4N2EA 4A7UA 1OM3H 4PRNA 5KVEH 4LEOA 3I3DA 3BUYB 3QORC 5L2JA 3HCVA 2XTJE 4HLEA 2R2CA 1OPOA 4Y5XB 1WUZA 1X7SA 4GW4A 3HZKA 4YAQA 5EZIL 1IQWL 4FERA 2V9TA 2WXHA 4OR1A 1BVZA 1D7DA 3ZT6A 3NJNA 3JT2A 1AJ7L 1JWSB 4AQEA 4ZMNA 3VSQA 2NNFA 5JOPE 2IV8A 3W0WD 4OQTH 3U7WH 2FJSA 4XMPH 4YSDA 2E5EA 3FBQA 2YSSA 3D5OF 1L0XA 4WW2F 4MQTB 5FCUL 1U8PA 1Z9SA 2H32A 2VZTA 3HVNA 1D5XA 4YS4A 2Z7UA 4MA1C 4GKSB 3QWRD 3WI9A 2YKKA 5C0EA 3DX7A 3UYPB 1CGTA 2WW8A 3DBXA 2H1PL 5DRWA 2H3NB 5IFHL 1T4WA 4M1DH 1WD8A 3S8GB 5C0BE 4XPGL 3L9BA 2OTPA 5HI5C 1M7IB 4PD4J 2W8CA 3MRBA 4WI5A 1PIFA 3K3QA 3SE8L 3N3EA 3BEVB 4R5VA 2NY7L 2H47C 3TWYA 3EYSH 3MRDA 1XR9B 4PRDB 3TBBA 5I73B 5FF6B 2EYSB 4YDIH 5FAAA 2O6DA 1WGOA 4NNXB 4AGOA 2Z65C 4GMTH 5J1AB 1MFCH 5CHNA 5B4MD 2OXGB 4F8LA 5C07A 3ZTEA 4B7LA 1SOXA 3JWOL 1E5YA 4XAWH 5D5MA 1HZHL 1BG1A 3WGVB 4YSSA 4Y4FC 3GT6A 1AE6L 1L6XA 2VGLM 4YSUA 1FHGA 1FL6B 1G7MB 1RLBA 3C8KA 5CGYC 4J23A 4NKMB 4G9FE 2M2DA 3DYOA 5DVPA 4PJ8A 1AXSB 2C7UA 4BYHA 4JG1H 4Z7QE 2A1WL 3N40P 4OJCA 4JGNA 1IKFH 1BFVL 3CC1A 1ECYA 1JZIA 5EFIA 2FB4H 1AGCA 1JZDC 3KWTA 3G6DH 5I1GL 1JYWA 5CP7B 2G9HB 3VRLE 2EUVA 2YD3A 3WO4B 4ZAKC 5C0AE 3HZ3A 4YBQD 5E4EB 4W9FC 5G4OA 1G4MA 5IMMB 4QDGA 3I2CL 2DKUA 2PWFA 5K1VA 4AM0A 4K4KA 2XPGA 1TEYA 2A6IB 2VXVH 4OGXL 5DHEA 3TYGL 2L3BA 2OW6A 4QRRD 4EUPG 1FL3B 3KVPA 1H5BA 2EC9T 3S35H 4I4WA 4OZGE 2NR6D 1KJ2H 1E42A 3EF4A 3MO1B 1R34A 5AZEL 2EE2A 3EDFA 1QA9A 3MNDA 2OSXA 4NJ9L 3T5WA 1FN4A 2A9CA 1KUMA 4HMDA 1U8HB 3TBTA 3OKKA 4DFIA 4EN3A 1PJWA 4HMCA 2N59A 2ICWB 4N20A 1RK0B 3L13A 5ISZD 3QJFA 4X8JA 1F3RB 4P3DB 5G5DA 1AOZA 2DI8A 1JGLL 1ZLUH 2EKJA 2P5WD 2QVKA 2WINA 2IDTA 2VDNB 2K70A 4HS3A 4NS0A 3L7FA 5E95B 2R2BA 3TZVB 5CR1A 4RRPM 2WNGA 3QNXB 3RUGE 1FDLH 4MA3B 3PV6A 1FLRL 3ECVA 1UA3A 5DDHA 1A6WH 1CICC 2V7HB 3BX7C 4EOWL 3LKPA 4V11A 3MNWA 1I1CA 4UT9A 1JMZA 1EDQA 3VDCA 3OSKA 4M5SA 3VGAB 4M7ZB 1I8MB 3UC0L 2AERT 4U1SB 4YJZL 4JFYB 1D9KD 4LVOB 3S98A 2AGJH 2XG4B 5BRZE 2OKMA 3H2QA 4M1CD 3W9DB 2J12B 5BZWB 4J7RA 5LDUA 1JZEA 4O02L 3VH8B 3EYQC 2NTSP 2Q3XA 4MMYB 4DK3A 4HULB 2D7NA 2R59A 1M7DA 2O5ZH 1XEUA 1JD7A 1ZMYA 5ENWB 2VR5A 1W0VB 4NUJA 1PG7X 4TM9A 4FG2A 3FQ2A 1UD5A 2DYPB 3C6SA 2GJZA 4IDJL 1LLAA 1FFPB 2ZAIA 3VDAA 2ODHA 3SYPA 5ADOL 4EI5A 4MCYB 4JFXA 5I26A 4R4NC 4JHWH 4C56B 5L8LB 3W11D 5LKNA 5MEQA 3GRWA 4XOAA 1SY6L 3ZSTA 2IAMA 2O6FA 5GGRA 1S7RA 4YDZA 4ZSOE 5IROA 3VU2A 5I1CL 3DUSB 5K59E 4L4VA 2HRPH 2OQJB 2ZG2A 1JBJA 1XVSA 3IFNH 1KB3A 4MZIA 1NCGA 2ARJB 3RWFA 5LO7A 1Y6MR 1YEGH 2FBJH 3QVAA 4E9WA 4URKA 1ID2A 4QRUA 1OAKL 1VGKB 2DW5A 3OVUB 3AT8A 3SKNB 4AYSA 1SXSA 3O2WL 3STLB 4KKBD 3NCJL 3WXVL 2ZSVB 4ZOAA 1MFMA 4FQ2L 4F24A 1BMGA 5FDWA 3VFWB 2VDOL 5HHNB 3GLAA 3NCXA 4MVBC 4U6VL 1TYRA 5HYQB 5E23A 2ZOTA 4HC1L 2Q2LA 4IRSA 3E8VA 5CJ8A 1EBAA 2EP6A 4WEUD 5DJ8A 1OCOB 4LCWE 4MJHA 1INDH 3HKZA 2LAGB 3QAZC 5EIIA 2NNCA 2ICEB 4G8AC 5DT1H 2D9CA 4TS6A 5DMIH 1RP8A 4Z7QF 3DRTB 3SZ6A 2C9AA 4GOSA 4GRLC 5CD5D 4HUVA 2GJ6A 5A2IH 5HHXL 2X9YA 4EDXA 4EZLA 5A1AA 2QEJA 1BPVA 3O81A 1UWGH 3QG7H 2VDMB 4K71C 3WGUB 4NO3A 1ILSA 2DD8H 2B1OA 5MERB 1QSFD 3RL1A 4QKTA 3ZRSA 4EAEA 3PFUA 3IWUA 1XGTB 3F00A 2NXYC 3VRJA 1I82A 5BZZA 5B8CB 1TU2B 4P2YA 3R8QA 1UURA 3QQ4A 2APWA 4OZGF 3HMWH 5ELIA 1UZ6F 2X9WA 3TL5A 1AG6A 2F5BH 3IM1A 2BHZA 1DZ0A 1XD1A 2CLVB 2D7TL 4M3JA 1COBA 3S97C 4IU2B 5GZND 3ZJAA 4UNVA 1E9QB 1IFRA 3CHPA 5B22A 3AFLA 1H6TA 3ZE1F 3KD4A 1OKEA 5IJDC 4XPBL 1KLFA 1P84J 5BJTB 3VD3A 1S9KC 4ORGA 2VDRH 3ZYZA 3QDME 1JXFA 1EHKB 1WZKA 3IJ8A 1TIUA 1FH5L 3DETD 4LSPL 4XPHL 4JJHA 2NY1D 4K5OA 1HHGB 1O9VA 1MNNA 1RJZA 3OLIA 1CMOA 2DICA 4J4PD 1OEZW 4N2IA 2W0LA 4NQCD 3TF7C 4H25A 4IJTA 3U4EA 1CK0H 2XWDA 4AQZA 4QTIH 2ZX9A 4Z7WE 3SO5A 5E6IB 4JFUA 2R0KL 3IMVA 2ARJQ 1E3FA 4G6AD 5F93C 4BD4A 3PUCA 2EUXA 1IGML 2H2PD 3DARA 3QA3B 2NY3D 2RH0A 3SDCD 4ONGL 5BXFB 1S8DA 3NABL 2NY6B 1TQSA 4YHZH 1BVOA 2QKIB 4YC2C 2DQHH 2EQDA 3KPRB 3LOWA 1E8XA 1JN6B 4W9LC 3BPLC 3TBWB 4W9CC 2GHWB 4Q9QL 1R3LB 2UXVA 2X41A 4FYQA 4Y16D 1U3HB 2Y69B 4JFFB 3JV4B 3EJCA 3SCMB 2GUOB 3WIFB 4K7PH 2LFEA 3WE6B 2WBJD 2D9QB 5E2UL 1MFNA 5CMAA 3MRGB 3VWJD 3W56A 2DQ6A 3LVEA 4K3JH 4OD2B 1U95B 5IQ9A 4WHYH 2EACA 1S3RA 3AABA 5D2NB 3BSZH 3T4AC 2APVA 5DLLA 2CJUL 3QEGH 4YR6A 3DJ9A 1TZIB 4LRIA 1MQKL 3O2DL 5SX5H 5FM5M 2OTWB 3BD4A 1XGQA 4IK6A 1KIRB 5D72H 5L0QC 3AREC 1DSFL 3CH1B 4IBSA 2UXFA 5EOTA 2A6KB 3DVNA 3NEEA 3P11H 3B37A 2KLRA 3S48A 1FORL 5FYJE 2HJLA 4NPJA 3SE4A 3G04B 1R1CA 1EAQA 4PWKA 1A7RL 4EXKA 3K6SB 3MTRA 2WLIA 1YYCA 4U6YB 3ZMEA 4HUXA 1DANU 1EFXA 1HINH 2J72A 4XC1H 1MREL 2PPEA 2W88A 3FCBA 4LOVA 1MVUB 3BUBA 4NQVA 1NLDH 4JQXA 4DFHA 2FLMA 4ACTA 1T2XA 2D4FA 1DO5A 3VSTA 1ADQH 1HDMB 2R27A 2XBDA 3THMH 4Z8FL 4HALA 5CU5A 5SWZD 3TLRA 5E8EB 5CBEA 1IJNA 5BV7L 3N50A 4OZHA 5LGHH 1GGCL 2CM5A 4O9HL 4U3XA 1VA9A 5K33A 1U4EA 5EF3A 1J5OL 1UCBL 4L0YA 3O45A 2IFFH 4LLYB 5E8DH 3CVCA 3SGJA 4F33A 1PTZA 1UWXK 3TA3C 4GP5B 4N0FA 4OFKA 1NAMB 3FCTA 5CGBA 1E2VA 5DD1H 2F58H 2ZWSA 4KTEL 4GO9A 4DZ8A 2VZ1A 3DXAB 3PABB 4LHUB 3NSCA 1B6DA 2F8XC 1CFSA 1JXDA 4D9LH 2AABL 2X12A 3D85A 4TSCH 4IOFD 1M56B 4NFBA 1RUKH 2UVFA 3IGKA 5FV1L 5C7XL 5F6HJ 4HS6A 4AMKH 1OP5H 3EUDA 2RIKA 3M45A 4OVUA 2ZZUT 1NICA 2WXJA 4P5KA 2EIBA 3C5ZB 2BOBA 1M4KA 2I7OA 1KPVB 1NWOA 4KPHH 5AVUB 4ZFQA 1E4XI 5D1QD 2ZYSA 5KSAD 4LIQL 2VQ4A 3NEXA 3S37H 1LHZA 1ROCA 3F7VA 2VLKA 5DD0H 4PJ6A 4HKXA 2DLFL 4AQ1B 4K9EH 4M5YL 4EEEA 4ORZC 4N0UE 3TESA 1VERA 3LD8C 4PJXE 2AI0L 2DMGA 4QRPE 1ZV2A 4YHIB 2MH4A 3QFJB 5LBGA 1NL0H 5JMRA 2N7AA 3FT2B 5FO9B 4V1DB 5I66B 1EHLH 1JZ2A 2Z91B 1OARL 1FVEB 3GS4A 4OTXL 4JRFA 4BM7A 4RMUA 3CVBA 4DGYL 2AVFA 3RNQB 2I60L 3VMOA 2YKLH 4TLSA 5IQ7L 4AJYV 4WJ5A 4LF3A 3IPFA 4FQIL 4XO4A 3VTAA 1F18A 2AEWA 1KCSH 3S36X 3CBKB 1EZLA 4W9GC 3RBGA 2X10A 1RUQL 4TTDD 4DESA 4LGPB 2R4RL 4M6OL 5FGBA 5T5FL 4IGBA 3VH8G 1KELH 4RZCB 1P7KB 2JQAA 1MCBA 3UYRH 2WKOF 3GMPA 3AU1A 3U6XA 5C0FB 4QGYA 5IEKB 4Y4HB 1QHQA 3H54A 4HQQH 3FRPB 4ILDA 3CG8A 3O6FD 2E4FA 1NBVH 1PCSA 4WSGA 4RBPK 5MI0B 3W5MA 5IHZA 4MMZB 3HEIB 2WWNA 2ZP8A 5D7IA 3K1DA 1XBDA 3EHBC 3QISA 4HUNB 2R23A 3TO2A 1F90L 2XIBA 2XQBL 3QIUB 4L8SC 5E4OA 3ARDA 4F58L 3RWGB 2VDPB 3E8UH 1U8KB 3F7PC 1XTLA 3V5HA 2NXZD 1DVSA 1T21A 2F53D 4NGHL 1YEKL 2H1LM 3SO3C 3T4YB 2OL3H 1H3GA 3SKMB 3V52L 3D48R 4NZ8A 3QZBA 1KLUA 4OGAD 3U6RB 2YXVA 3UAAA 3IMTA 2P8LA 3FSAA 3E3QC 4P23C 1QNZH 5C07E 5L4MA 5D5ME 3WHE1 2IWEA 1J1XL 2UUDH 2CKBA 4OFYD 1Q1JH 2ZNWA 3VI3A 1FCCA 2HXAA 1NEZA 1QKZL 3CSFA 2B4CH 2BNQA 1BIIB 1QFWH 4OLXL 2BRQA 5CGMA 3AU0A 1OHZA 3LHPH 3WIIL 1CYWA 4N5UA 5BO1L 4FNRA 3K8LA 2K6YA 5B1AB 4DW2H 4JFQB 5E1HB 5I17B 1E43A 4BHUA 2CIIB 4LVHC 4YHLH 4WQOA 2F19H 2PPFA 1A8JH 2O1AA 5ADPH 2NUPB 4NBZB 3NSYA 2E9WA 3FL7A 4Q52A 2EIDA 4QT5A 3UZVB 1LDSA 1MFDH 3U36A 3HZVB 1AQHA 1OANA 1ZHNB 2W9EL 4QRTB 4JMXA 5DFWH 2OK0H 4IDLA 4QHLA 5IB2B 3ELAT 4HOMA 3IRZA 2VN6A 4LFHG 4EXPX 3GSUA 3SY6A 1V7NL 3WDJA 1R3IL 4CILA 3FU7A 1Z9PA 4PJFF 4NXKA 2X70B 3CNKA 2CUMA 2YD5A 1LTXA 2RA1A 2CDGB 1AO7D 3I9GH 3B9KA 4GIPD 2PYFB 1P1ZA 2VLRA 2BSRA 1IAIM 4NNYB 1D7BA 4FLOA 1MIMH 2Q20A 4M8VA 1WV7T 4MAYC 4CVXA 1XGZA 1L0PA 3QDGB 5KYWA 2JLLA 1JWMB 1RJYA 2AQ1A 1ZLEA 3HPLB 2HPTA 3ASNB 4FNTA 4Y88A 1I8KB 3KXFA 4MA7L 3S8FB 5EUOA 4MNHB 4WTWA 2BSSB 5FFLA 3E38A 1D2OA 1LEKB 4LCIH 2VISA 3VFRB 3BPOC 4ACPA 3LKNB 3EJZD 4KQ4L 4YSPA 5LGJA 1RY7B 3KM1A 4UI2A 4KZEL 3AROA 4PG9B 4AEIH 3VW3L 4HHGA 3BLBA 4Z3HA 4HKBB 3J7HA 4AW7A 2EDBA 4JM2D 2D0GA 3RTQB 3WEAA 2FIKA 4P46D