2GBTA

C6a/c111a cuzn superoxide dismutase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
152
Chain Sequence
TKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 37
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2gbtA00
3F7LA 1JCVA 1ESOA 1TO4A 5KBLA 2VR6A 1CB4A 2JCWA 1PU0A 1DO5A 1IBDA 2LU5A 1HL5A 3SODB 1YAZA 1B4TA 3ECUA 1F1DA 5KBMA 3QQDA 4BCZA 3H2PA 2AQPA 1JK9B 1U3NA 4A7GF 2XJLA 2SODB 3CQPA 1JK9A 2WZ5A 4OJAA 1EQWA 1HL4A 4MCMA 1SXAA 1XSOA 2Q2LA 1SOSA 3KM1A 2XJKA 1S4IA 4A7UA 2Z7ZA 3GQFA 1E9PA 3GTVA 1BZOA 1Z9NA 2ZKYA 1XTMA 2K4WA 4FF9A 3F7KA 1P1VA 1SXBA 2VR8A 1B4LA 4BCYA 2AQSA 2APSA 3CE1A 3ECVA 1SXSA 3KBEA 1OALA 3L9EA 3QQDB 3T5WA 2ZKWA 2WKOF 5KBKA 3RE0A 1PZSA 4U4IA 4A7QA 3HFFA 1TO5A 4N3TA 1SDAB 1SXNA 3H2QA 3K91A 3GZQA 1XTLA 1SXZA 1E9PB 1F1GA 1IBHA 4N3UA 1N18A 2Z7WA 1E9QA 1SPDA 1UXLA 2ZKXA 3PU7A 2VR7A 2JLPA 1CBJA 2V0AA 2GBVA 1N19A 2ZOWA 3KBFA 1EJ8A 1RK7A 1OZTG 1SDYA 4A7SA 1Q0EA 1KMGA 1AZVA 5CU9A 2WZ6A 1E9QB 2E47A 3ECWA 3GTTA 2R27A 1F1AA 1SXCA 3S0PA 1F18A 3KH3A 2WZ0A 3L9YA 2C9UA 2WWOA 2WYTA 3LTVA 1BA9A 1E9OA 1IBBA 3MKGA 1IBFA 1QUPA 3MNDA 2C9SA 1Z9PA 2Z7YA 2AQNA 1YAIA 1UXMA 1OZUA 3KH4A 3GZPA 1SRDA 1YSOA 1COBA 3CQQA 4OH2A 2AEOA 2WYZA 2AQTA 2GBUA 4L05A 2Z7UA 1OAJA 2GBTA 2AF2A 2AQQA 4B3EA 4A7GA 4A7VA 3HOGA 3HW7A 2WWNA 2C9VA 2AQRA 1IB5A 4BD4A 2E46A 1FUNA 1DSWA 4MCNA 3KM2A 2WKOA 4A7TA 1E9OB 1OEZW 1PTZA 3GZOA 1L3NA 2NNXA 1MFMA
chains in the Genus database with same CATH superfamily
5FHBL 2DICA 5BJTA 3Q05A 1NUDA 5AVVB 4XB3A 3PDGA 2K4AA 4M48L 5LBGA 3VQ2C 5F3BA 1XH3A 3MLZH 2E5EA 4L4VA 1IE4A 5A43C 5DGRA 5ESQB 5LDSA 1D5ZB 1EWHA 1FGVL 1XAUA 4HEMA 5DCCA 1JPEA 4RLDA 4F33A 3O6LH 4MBOA 3CSYB 3AXLB 4FXGC 5JPNA 3RVVC 4BE6A 3BP4B 2QQNL 1TDQA 2FQEA 4XNDA 4E41E 1S7WB 3MGTA 5E8NB 4F8PA 5E2UL 5IHLB 1FZJA 1FO0A 4FG6D 1TQBC 1AXTL 5ICXB 3SDYH 1A8ZA 2HMIC 4ZTPL 4QWWD 3SJVD 3T3ME 1RIUH 4GAGL 4XNUL 1HT6A 3B9DA 3S98A 4GLRH 4QRRD 3SDAC 1QPXA 3SDDB 2BIQA 3TBTB 2I24N 4OCRL 4U1LB 3UYPA 4Q89A 3VG9C 2VQ1A 4U0QB 4NC2B 1FHGA 1AZZC 1NEUA 2DB8A 3FU0A 1E6JL 5FW8A 4PUBH 3FMGH 3RTQB 4NZFA 3ZUCA 1F4WL 5FF6A 4WDIA 3KZ8A 3RZWA 1SDAB 3L3GB 1G84A 4XNZB 1C1EH 3IT8D 1YN6A 1WWWX 2EE6A 4AYID 2XXMB 2ZSVB 3FO1A 4HWEL 2JB5H 4ODVH 3GWJA 4XP5L 4N2LA 1TMQA 4AVJA 1KJ2B 2CZNA 4ANWA 3P1VA 5ACLA 1LK3L 2WVVA 5ALCL 1NAMA 2R0WL 5I0DA 3VXTB 4JZJB 4FNQA 3U1SH 2Z93B 1DVYA 1DJXA 2ADIA 2GVYA 5E8OA 1BX2B 1MH5B 3T04D 3MUGA 3V52H 1E8ZA 5J0BA 1DBML 3BGMA 2WP3O 4BDVA 1ZWIB 1WHPA 2W94A 1F2XK 2YGNA 2KZKA 2R8SH 1YAIA 3QUGA 4FABL 4H4NA 1C1EL 1ZHBA 5AW2B 4E2OA 1KCLA 2L3BA 1MFDL 3R06B 4M7ZC 4EDWL 3N44B 1YNTB 1OB1B 3ATEA 3UBXB 3ARDA 1DVZA 3HOGA 2D7TL 2WWNA 4OCRH 3VSVA 2ZNWA 3DPDA 3NSXA 3CMOL 4UCFA 5J1AB 3PAUA 1BV8A 5AFAA 4XCFH 3ABKB 4P5KB 3FFCE 2DMBA 1I85A 4E9RA 3I3BA 2E3VA 5KBLA 2NR6D 4JY5H 3BKCH 1T89C 1ITCA 3FPXA 4RAUA 4M7LL 2EUVA 4FEIA 1JWUA 3BLBA 4PFEA 1RK0A 1JCKA 4E0RA 3APFA 5E2UH 2XQBH 1WAPA 4WKZA 4NKQB 5F7LB 1MSPA 2P26A 35C8L 4LPUA 5K9JL 1JNHB 1MREH 3LYRA 3TA3A 1QEXA 2N56A 2YD0A 3HHSA 5D8JL 5T3XL 2VITB 3IJEB 3C8HA 3KWUA 3HG0A 1OD7A 1OGAD 1CFSA 2ITCB 1WP6A 2Y5TA 4PJEA 1Z5LB 4XAKD 1YN6B 3DX1A 2PW2A 4DJMA 2YD4A 3FQTA 3U9UB 5AL8A 1QQDA 1ZV5A 5C0CA 2IG2L 2DWDB 1DQMH 1BOGB 4L4TB 2V7HA 1HZKA 1SY6H 3IFPB 3HZVA 1S7RB 2R15A 3P3UA 4HZAA 3WENA 5EORL 5IVXA 1KACB 4Q0XH 3SJVA 1UH4A 1J0YA 1CR9L 3F12B 3FO9A 2WQUA 3RURA 4KRMB 1TTCA 3DNKA 3VXMD 1MFUA 5L88H 3S3JA 1HHGB 3O2VL 5DJ6A 2R7EB 4IU2A 1IT9H 5JIPA 2IDSA 4W9ZA 5CCHE 3UOAB 1HEHC 4H20H 4QOKD 3GBML 4F27A 1MCWM 3VFNA 1IL1A 4NI6A 3KE0A 5E1HB 5BUAA 2E7DA 1BJ1H 5LXGL 1TLKA 2NXYB 1AZNA 5HDQH 4X8GA 3LRHA 3MLSH 3A6CH 2WCPA 2O93L 4YBLC 5LXGH 2G3NA 5ESQA 3ARFD 4GRWH 4I5BB 3RPBA 1A6AA 1V55B 1E4HA 4K9EH 5DK0B 3HC3L 1CGSL 2YD8A 3ILDA 3CV5A 3FT4B 4YXHL 3GDCA 5B3NA 1I1AC 2PP9A 3D0LB 2WCSA 5D2NC 5I0VA 1RZPA 2WVSA 1JK8B 5E4AA 4MDJA 3U4BL 5LGJB 2BHZA 1NBZB 3MXVH 5JR1H 4E42B 3AABA 3LQAH 3VRJA 4N8VB 4A7GA 2AANA 4DGVH 3NJNA 5DZ9A 4OZFB 4W4OC 2XZQH 2MNJB 3IGLA 3QEQD 1JUFB 1AZRA 1OLZA 1PG7H 3FO2B 1GTFA 3ZN6A 5I6XB 3HMXA 5MI0B 4WFGD 3D0AA 4PI2A 3V0EA 5IHUH 5CEXA 1JMXA 1ILUA 1E8YA 5I6KA 5LCVH 1IL1B 3DC0A 3LVEA 1A9VA 5D96C 2DLHA 4M8QB 1KTDB 4FP8H 4LL4A 2ORBH 3KDMA 3ZXAC 3S2AA 2Z65C 4KFMA 1A1NB 3L17A 1HHGA 3HE7C 5DJ6B 5FCUH 3NFSH 5AVQB 1TQVA 2XJKA 1S4IA 5I28A 4JFTA 1HDMA 1NGQH 2R2EA 1FFOA 3V8CA 1M53A 4JN2B 3MR9B 5EEWA 4V1DD 43CAA 5KJ4A 5EU6B 5KYXB 3D1MC 2X4NB 5B22A 3MRDA 2PTTB 1X4YA 1EJOH 1F3RB 1RU9H 4XAWL 4CMMB 3QQDB 4CSPA 1R34A 4F2FA 1JXFA 3QXDA 2HJKA 3FJTA 1J9SA 4QXTB 2FEJA 3MO1B 5D4HA 2JKTM 4EVNA 3BUYB 3BZDA 1LWRA 2OULB 2YMOA 4W9JC 4JL1A 3BP6A 3BUDA 1OPOA 1BVLB 5E8PA 2P42B 3HI1B 3VWKC 4D8PB 3IDGA 1IQDB 2GIXA 2EC9U 5FB8A 3KPRA 4IOIB 1A9EB 5I1IL 3T9WA 1A6TA 5CJOH 1X5IA 2F53E 2G4GA 2X2HA 1UJ3C 2V5YA 3UTTB 2O61A 5DU7A 1DEEB 4AQ1A 5SWSD 3T0EE 1NAMH 3V52L 5KS9A 3EYUL 2XN1A 1KCRL 4KZEH 4AM0Q 3CDCA 1EO5A 5IROC 1G1KA 2QKIC 5IT2H 4OCXL 3Q06A 5EU3A 1ZTXL 4XN7A 3G5ZA 3N06B 1Q38A 3NZ8A 2VUOA 3HZVB 5T5FA 3WEBA 4RGOL 4Z7VF 2HG0A 4YBHA 1IC7H 1A7OH 1MIEH 3TVMD 5F9AC 5ID0B 3OPUA 4A04A 2IANE 3AU1A 4HLZG 3AT9A 4KC3B 2NX5A 4P8QA 3WIAA 2ZP0T 2CLZB 3O4OB 5GS0D 1NWPA 2HFGH 2NR6A 3Q5OA 4APXB 2WYZA 2MPAL 1IKNA 2Y36L 3CBJB 4R6UA 2FRGP 2WO2B 4P9HL 4AUUA 5M94B 4NQCE 5D72L 4N2DA 4WNJA 1MAMH 3U25A 3O6LL 3WY1A 2OL3B 1V8HA 2EVHA 4FL4C 5DLLA 2XWTA 4R7DB 2FLMA 1MQKH 4I0CC 1QWNA 2GC4C 3UAJC 2CPUA 2W65B 3EO1B 1H9DA 3HRZC 3T6QC 1CK0L 1P7KB 1QSFA 3C8KB 2QEJA 3LJ3A 4Y5VB 1FO0H 2VR6A 4OKVA 3T71A 5FHBH 1J1OH 4OGAC 2XWBB 3QULA 1ML0A 3CFCH 2ENYA 1YMMD 3OWEA 5CBEA 4CN6A 5F7FA 4HUKB 4NFBA 3RY4A 1SFHA 1U36A 1RK1A 5FK9B 2IBZX 4CKVX 1T5XB 3VXOB 2H5UA 1QLRA 1F3DJ 4WI4A 4LCWA 3ME0A 3B9KA 3VB8A 4XMKL 5I6MA 5IQ7H 2CR6A 3OC8A 2OMNA 3NZHL 1EA9C 1UA6H 4S11A 7FABL 1P4LA 3G5VA 4LHQB 1AR1C 2APSA 3ARDC 2FDBP 2WLNA 3UERA 2CD0A 1OE2A 4U0RB 4YDJA 4EAEA 2KHAA 3DECA 3TBSB 1VRSA 3H6AA 3ULVE 2BP8A 4PJ9C 1J12A 4L9DA 2NY7H 4AM0B 4NRYA 1CS6A 4XNAA 4YHPA 4P5MB 2ZPKL 4WEBH 3SBRA 3VXTA 4BFJA 1ZGLM 1NAML 4JM2C 4KVCH 2BH0A 1PLGL 1DR9A 3VWJA 4HYTB 4YSCA 4K73A 2J56A 1L6PA 3MYZA 1C7SA 2VOTA 1G7PB 1FFNB 2X9ZA 4K2UH 4OZFG 1CYGA 3RA7L 3DSNB 3BP6B 4H1LH 3E2HB 5D7JD 3R18A 4YL4A 2VO8A 1T1WB 2WQSA 3F00A 1RHFA 4LDLB 2HJKB 4QXTA 3LTVA 2QMKA 3D0VA 3FTYA 3JVGA 5IJKA 2WUBL 4KXZH 1YYLH 2BNQD 5GZND 5L4JA 5HJ3A 2NMSA 1DO6A 4HIXL 1YC8A 3DPBB 4LFHG 1OW0C 4FQHB 1URIA 4PJHB 3TPUA 1KN4L 5IOPB 3GSVA 2NXYD 2Q6WA 1I9IH 3FH8A 1UM4H 1FYTE 4NJAL 1H8NA 1MZYA 1NKOA 5SWQB 1XL4A 2QZQA 5EIIB 5HI3D 2OMZA 4LEEA 5FWRA 5FUZH 2WY3B 4NC1C 1FZJB 1Q9OB 2EJ1A 3LH9A 4MMXB 4TYUA 1LD9B 1IVLA 3ARPA 1GYWA 4HWZA 5A2LH 4GI9A 2BW5A 1MHPH 3KPPA 4O2FA 5CP3H 3TBYB 1RCYA 4TQEH 5TD4A 1JV2B 3WUWA 4A2LA 3J27A 4RGNE 4DKTA 5A6LA 4PLOB 3G04B 1TF4A 3QUKA 1N2RB 15C8H 4YK4B 3BKML 3RRQA 3TN0D 2YUZA 1IIIA 5HI5D 3VCLA 3WS3A 1TPXB 3PUUA 2RB8A 3V6OE 3HMWH 5C0IA 5GGUA 1XD0A 5E70A 4DTGH 2G9HA 1QBMH 2W9EL 2X6MA 4G8IA 1P4UA 4OGXL 1UVQB 3CG8A 2MHAB 1YHPA 4HDIB 4JHAH 4RA0C 5D55A 4EOWH 4JY4B 1M4KA 4XP4L 2VXVL 2VN5A 1T21A 3R0NA 4KOCA 2J55A 3FN3A 5C6PB 3G5YB 5GS1A 1RP9A 2VT0A 3IMBA 3O3AB 1BFTA 2HKFL 3NIFB 3ZIYA 1BM3H 4G2AA 2EIMB 5BRZE 3ML9A 1L6XA 2JKJA 4UNIA 1RULL 1G4RA 3VFTB 2D2CC 2Y24A 5F21B 5J6GA 4ICWA 3WIFA 3RE0A 1J87A 5TQ2L 4QY8B 1BD2E 3DX8A 1BD2D 2YOCA 3PWUB 4LSVL 4X6EA 2XXCB 3OC5A 5HVWA 1UD8A 3RPIB 4N3UA 4G9FE 4X4XA 3EXJA 1CD1B 1P1ZB 2JJVA 2N3JA 2Z7WA 5E1AA 1NM9A 1XGQB 4KKQA 4BH8A 4FXLA 1G9NL 1WS8A 3I6LD 1RPUA 4IBTA 5DK2B 5FYKU 2NUPB 1ZANH 4B7LA 3IF1B 5D7SH 3O2VH 3QWOB 3CFTA 1TEGA 2KPWA 5JHDD 1IJ9A 2NX5D 1EBAA 4HZ1A 3FTXA 5IBTH 4NN6B 1NOFA 1SVCP 5C09B 4G3YL 3KYAA 4HUWA 3KWVA 4K15A 3MRCA 1NOAA 1ZE3C 1GGIH 1OTUC 1EGJL 1UGNA 3CN3A 4JO3H 4CSSA 3C2AH 4J3OD 4C83B 3KYKH 4JFDA 5JW4N 4D0BB 4I2XB 3MCLL 2OAAA 5K9OA 2Y7SA 4L8CB 3IETA 5EOCJ 4GKSA 3LRGA 4RGMC 4N0FA 1BWMA 4EI5D 2YZ1A 2CKBH 1OGSA 4F7PB 1MHHB 3BVUA 1NGYB 2GIYA 4RDQF 3JV4A 5J11C 4XXWC 2WWKT 1LO4L 5CUSL 2JV6A 4ONHA 5B1JA 2GJ6E 3LZLA 1KNOB 5I66B 2ENJA 4XPTL 5L0QC 5HVGB 2JXMB 2KL6A 1JNJA 4GQQA 1J5CA 4NQEE 3KYNB 3D09A 4W9FC 3B34A 2R29A 3PNWB 2CBOA 2CQVA 2H3KA 5ALBH 5IFJA 3AUWB 3MZTA 5F9JA 1PX3A 3VD3A 4JRFA 4ODHH 3UBXI 2XY2A 3DX6A 5TPWH 3NJKA 4LDEB 3X3FH 3HMXL 1E8WA 3QDGE 4XP4H 4EUPA 2X0VA 4Y5XA 5DMGD 4UILL 1AQDA 2O72A 1AI1H 2P4AB 5CLYA 3IBEA 2OW6A 1HILA 4O58L 4PJHF 2EDEA 5BQDA 4ZW7A 4LVOC 2P52A 4QNPE 2YA1A 4HJEA 5HYJB 4HPHA 3IFNL 1E9PA 4QJ3B 1PAMA 4K5LA 4XMWA 4YHYC 4FFTA 4MJIE 4K7PX 4GKLA 3VW3L 4Z7VE 4Y1AE 4DPCX 1TYRA 1Q0XH 2EICA 5TQ0L 3H9SD 3L9EA 1DJZA 3GXFA 1I3GH 3O6FB 5CCGE 5BCAA 4AMKH 2JQZA 4UT6A 1HESA 3RWFA 5L2JA 2DQJH 2VDRH 4LMQI 1WVZA 4XPFH 4ZRGA 3DIVA 4RZCB 3OJDB 4KRPB 1BZ7B 4BQ6A 4XN8A 2K0RA 3HC0B 2ISDA 2YXWA 5TDNA 4OQTL 3Q01A 1FFQA 1MFEL 4LSSH 4MB4A 5HGAA 3R1GH 3ML8A 2WYHA 3MV11 4KJWD 5IQNA 4H8WH 4KNSA 1JN6A 1N0LA 1UWYA 5G5DB 2FATH 4HV8B 1NFKA 1ZLEA 2J8UE 1HXYB 5DS2A 2NNRA 2NNAB 4NWUH 4P2RB 2AABL 3DVGB 4UQDA 2VN4A 3SDCB 3II1A 1ZEAH 4OF8A 1I1CA 2ZT9C 1X7QA 3EJPA 4CW1B 1ND0A 3UZVB 3MJ8A 4TVPD 1OAXL 1YNLH 2TAAA 4KJPC 4XMTA 1MCBA 4AMKL 5FLVA 3P4NB 5D2LA 3I02B 3OKNA 1ORQA 4JO1H 1CI5A 2GSGA 3QUYA 2BNQE 4MHHI 4QRPD 1OAYH 7FABH 4RDQG 2K9UA 5L8LB 4WWKA 1NMBH 3MODH 4MD0A 2IADA 1DJGA 3GZPA 4XHJC 2WBWB 3TASA 1UT1A 2Q76B 5I0ZA 2AV7A 5JNYB 5EH1A 3NIDB 1BJ1J 4ZUUB 4H88L 2AV1B 1EO8H 1SJVA 1UB6B 1D5ZA 2WKOA 2AI0H 2D2OA 2ZUQB 1CFMA 3GXTA 4QHLB 5KSBB 3IMTA 2FX8L 2EDNA 3BH8B 4B0MB 4QY8A 1GYCA 1CK0H 1P9MA 3ARBA 4H0GA 1HHKA 2DQGL 4MASA 4X5LA 3MRBB 3ARQA 1SJHA 2GJPA 3F83A 4N8CL 4MD4B 2HAZA 2OJ1A 4PGZA 3P9MB 3FU7A 5AD0B 1XSOA 2ICWA 4RIRA 4M7JL 2H1PL 5CM1A 43C9B 1L9PA 4ZD3L 4NENB 5J3HD 3MAWA 5FM8A 4J3BA 3HR5B 4Z78B 1URLA 5CLWA 3BJLA 5ITBH 3HUJA 5DMIL 1ZT1A 5FYKE 5EC1B 1IQWL 5C6TH 3L7EA 3TZVD 4FTDA 1YY9C 1G94A 3FT3A 5C9JB 2CO2A 1QSZA 3MZGB 2AMGA 3B43A 2A0LD 4JJOA 1RZGB 4YHZH 3SDAA 4F20A 3RJOA 1ZCRA 3PHQB 3CZFA 3ULUH 1J10A 1L0QA 1UKSA 2ITFA 4UQEA 3FTWA 4ISVA 1W80A 3I9IA 4L1DA 1V05A 5HDWA 3V2AR 5I8EA 4PVNA 5EC2A 2W1NA 5DJ8B 4ZG1A 5E99H 5E5RB 5GISL 4AG4L 2EE9A 2IALA 4P0DA 1JS4A 4Q7DA 4BJLA 4O2EA 1UWGL 1Y1UA 3NACL 3QCUH 2RALA 4PJXB 4WWKB 3TV8A 4HU8A 5EIIA 4Q9RH 1B4JL 5DSCB 4PJBF 1FJ1A 3ZDZE 2D7MA 4PJFF 3P4NA 5D2LB 4B9GA 1KCSH 2AJXH 3H7LA 3LHPH 4FG0A 1S5HB 3QS2A 3PP3K 4HUXB 4E9WA 1KCSL 4YAQA 1U58B 3U7WL 1C5CH 2A9NL 5DVOA 2D9CA 3NA9H 2GG1A 4FTVA 2H45A 4Y1SA 3RWHA 5JORB 5D1ZC 4JDZA 5FKAB 5C07D 2Y2TA 1DZ0A 2VDLL 4R4BA 2DI8A 2E6PA 1RUMH 2Y7NA 5J6HB 2BERA 4J2XA 1MCOH 4JFYB 2H9GA 4QI3A 2AK1H 1OT1A 1JF1B 5DHYB 3SGEI 5JQHC 3TBVB 3NP4A 4P4KA 2TSAA 1U91B 1YEGL 2WB1A 3V4PA 1WDAA 4GUPB 4LF3A 3UGXA 1XCXA 2DIAA 4RZCA 3VI3A 4YHZL 3FBQA 3VGEA 3NK3A 3DGGB 4MWFA 4HUNB 4OF6A 1EHKB 1I8MB 2D0HA 3WO3B 5JXAL 2NY1C 4UOJA 4YIQA 5CIPA 2RCSL 3ZL4H 5J3HC 3V79C 4HKXB 4LCUB 2XYBA 4WV1C 5DZAA 3TBSA 4HJJL 3QI9C 3BUQA 1PZAA 3GBEA 5MENA 1QWHA 1HIML 4F7CA 1DJIA 1E4JA 1ECZA 1HINL 1ZS8A 2XN9A 4XX1E 3ATBA 1V3KA 3F7VA 5F7WC 2DMGA 2FAUA 2GBAA 4NWUL 5L7XL 1HTYA 5EO9A 2E7LC 3VFGH 4R8WH 1S7XB 1NEPA 3KPOB 4JREC 4QO1B 3IKCB 1ACXA 3WNJA 3OAZH 5I71C 1CXKA 3Q8EA 1NIFA 3D50A 1RH8A 3HJEA 1UTDA 3BAKA 3NGBC 2VR3A 1HH9B 3MRHB 2DY2A 4JN1L 2IFFL 5AW4B 1CO1A 5BOJA 2DD8L 2OZ4L 3HC4L 3P3RA 4FKEA 4IRJB 3MGAA 4J1UB 4GLRI 4ZMXA 1YUKB 4OKVB 3BN3B 3B6SB 1ZK9A 4N3TA 2VAAA 1P5UC 4FYRA 4PJAE 4Y1AB 3CH1A 4MCZA 1T5WB 5AKTA 3BAEH 1XF5B 5SX4H 3V0AC 1VFUA 3Q5YA 4Z0BL 1ETB1 4EBQH 5FYLD 3L4VA 1D9KB 3KEHA 3RUGF 1V3LA 2PCFA 5FYLE 3OD3A 3W0WA 3NPSC 4PJCB 2Z35B 4HIPA 4ATWA 5K9KA 1TCRB 3WG7B 3AT0A 4N28A 5IESH 4APXA 1JV5B 3QDGB 3K7UA 3IJ8A 4IIQB 4OCSH 3OXSA 2X0WA 2CDEB 3GHBL 3MRJA 2ADGB 4G72B 4UU9A 4OM0H 4PJAA 4WSGA 3E1ZA 4G59C 5J13C 4ALAH 2N1TE 4X9BA 4FRWA 3GSXB 4QNPF 3BE1L 2VH5L 2OTUA 2G5RA 3MKGA 2JKIS 4NO5A 5HVHC 1FG2A 1BJ8A 1INEH 4FOMA 1DP0A 1ZSDA 3PGDB 2XFXA 4B0MM 4JFPA 4Y2LA 1IAIH 3AFLA 4FS0A 5L7XH 4XTRD 4NZTH 3MSPA 2IFGA 4UZGA 1OVZA 4WKXA 4JFYA 1SJHB 3EUDA 4NQDD 3RUGE 4BUHA 2AQTA 4XGZB 3LKPA 1NGPL 4CDHA 3FN9A 1KY6A 4QWWC 5FUOL 2HPOA 2A3TA 3W39B 1AKJD 2NYZA 3UTTA 5J4MA 2O61B 1G7LA 2UY7B 3VFRA 4JDZB 4G8EA 5FKAA 4M29A 4HP5A 3S36X 5KSAD 2W0FA 3I9AA 3UYOD 4PRDA 1Q72L 2J21A 4HMEA 4FQLH 4D8PA 3OAYH 1ZGLB 1IEHA 2JJSC 2X2IA 4N24A 2J6EL 4BA0A 5C8JA 2NNXA 2GY7B 1RZKH 2W81C 3DX3A 4F5CA 5IMMB 4XTRC 1NUFA 5C0CE 2MWCA 2R2CA 1ZKAA 4L23A 4UTBA 4URTB 4BH7A 5IVNA 4APQA 3RZCA 2VDOL 4OTXL 3QXDB 3VB9A 4YEFA 1YEJL 2HRHA 4LT7A 4PV9A 5F89B 1A47A 3UTTE 3LZPA 3VM7A 3N85L 5IIEA 1NL0L 3GXIA 3OLIA 3MA7B 2NY5H 2VLKB 1DLHA 3EYQD 2H8PB 4YHKH 3SE8H 1A1MA 1KEGL 1BZOA 3ZTJG 1N8ZA 4NWTH 4WSKA 1SZNA 4PRHA 1N0XH 3ULUD 3U1PA 4PJ9A 1N2RA 1AGCA 1ZIAA 4BCYA 1J0HA 4IGBC 5DXWA 3NG5A 3RX9A 4L4JA 2X44D 2BFGA 1R17A 1LO5B 1IKOP 2NW2A 3NFNB 1HQ4A 4XCFL 5KS9E 3HE6C 2F1AA 3IPBA 3B2PA 4B9CA 2QL1A 4M62L 4NM8H 2CA3A 5DWUL 4PRBB 4XI5D 5A1AA 5AG8A 3NCMA 3PDOA 2WWMD 2KKQA 1C5DB 1NUGA 2ATPA 4UT6L 4N9OB 5H8DA 4MNHA 3UG3A 3MCLH 5IOPA 4TPRL 2H3XC 2PR4L 3CNKA 1T6VN 2J44A 5AD0A 1N6UA 4L1LA 4BFRA 1TZGL 3MOQA 4K07A 3OG6B 2NSXA 3LMJH 1MY5A 1I8KB 2J5LC 1ADQH 1JK8A 1PLCA 3H4HA 4WY7L 3O6FA 3C6SA 4M7KH 5T5NG 5E9NA 1KV7A 3FT4A 4UT7H 3U6RB 4XP6L 4K3EH 3W37A 4KO5A 4MFHA 1F18A 1MAJA 4KZDL 3BGFC 3K8KA 2R4SH 3T4YB 5I15H 2V2XA 3OWRA 2AJXL 3LHPL 3NQIA 4H1LG 1MG3C 1XHHA 4XAWH 4YDVA 3LIZA 3FQUB 4BZ1H 5DMIH 4DP1X 2V2TB 2Y6SC 4R9HA 5AVSB 2Q3ZA 3QRLA 2X6BA 2OSYA 4XBGA 4CVXA 3TWYA 4WI8A 3CBRA 1KENH 3L3KA 4XBEL 3C9NA 5DJXA 5HDBE 5IVXF 3SOBH 3TPKA 2QVIA 4UB0L 2KC0A 4G8GD 1TYEB 3DJ9A 4HGMA 2ZQKA 2FQDA 2OR8A 4AZ8B 5BV7B 4UDTA 1I1AD 2DYPB 5ESAA 1GCFA 3FSVA 1H3TA 2ESVD 3EGSB 25C8H 2X1QA 2ZWNA 4MZIA 2YEZB 4QAMB 4PV8A 4UM9A 3GRWH 3Q3GB 4XVTL 3SDCA 4C57C 3GBNL 1UKTA 1PU0A 4JAMA 5ICYB 1MNUL 3AT8A 1I3VA 1YDPB 4LPWA 5EU5A 2J88H 3DURB 5T1LD 2PW2B 4U1HB 4OLYL 3H0TB 2B14A 3VD9A 3B3IB 2RIKA 3EOBA 4NQCA 3SDYL 1INDL 1AMYA 4JFQA 2MSPA 5FM5M 3WFZA 1WG3A 4ODBD 3TIEB 3C5JB 4A68A 2JVUA 4Y8DC 3PV6B 4HKJA 2K78A 4HIHA 1QUNB 5IMOA 4QTFA 2ENQA 4FFZA 1MI5D 4B41A 3B9VA 5FUCE 1EEQA 1XD1A 2YO3A 3DYPA 1CVSC 4E0RB 2W65A 3EO1A 4W81A 8PAZA 2EVJA 1ZEAL 4X8XA 4PJXE 4Y4FA 4FFZL 2YIHA 2X4SB 4X0KB 2CIKB 1XF3B 3CU1A 3HI6H 4X80H 3NPZB 1B0RA 4KI1A 4LCWE 3UMTA 4PH8A 3L4ZA 2QQLH 4HOXA 4P5KA 2AK4B 3Q48A 3LSOB 2GJZA 3ABGA 3OZ9L 4UQ3B 1J0JA 3EYOB 1G0YR 3SYAA 3DXAB 4HGWB 1NGZA 2Q3AA 3VRLE 1MCPL 2ERJC 2G5UA 2ZX9A 2FBJL 1ADQA 4X7SH 1T1XB 2XWJB 4X5WA 1TTGA 2VMDA 4Z1PA 4Z7VB 3JYCA 2EECA 4AGOA 4TSCH 3AGVA 1PVHA 5EU3B 1OF0A 1S3RA 4M7LT 1DN0A 1XBDA 3H8NA 4JPSA 4MJ5B 2PPFA 3QUZC 3UJTH 1N3NA 2GY5A 3MUGB 4J12A 2FBOJ 4HF5H 3SDXE 3EO9H 2D9QB 2R83A 3BSZH 1QA9B 2Y07H 4XODA 1M3JA 5K1VA 3SKOA 1JPFB 1JTOA 4X6BA 2AQNA 3W9DA 4FKKA 2WINB 3TOPA 1XWVA 4HZLA 5IHZA 5MERA 1K5NA 2OSWA 2B8OT 3T8XA 2Z8RA 2WHVA 5KVDH 1HVXA 4D9RD 3QYCA 3VGAC 4JZJC 2XICA 5JHBA 4XNYH 3O0LA 1FORL 3QEUA 4G5AA 4FI6A 4PJAF 2BOCA 4RFEB 5AB9A 4EVNB 4OR1A 2Y4SA 3L5WA 1T7XA 3Q8FA 1ZLWH 4JCLA 2X6CA 1TVBB 2YPLB 3QVAA 4PYGA 3O0RH 4FC3E 4ZAKA 2BIHA 4YR6A 3DIFB 1Y7VA 4IMKA 1TFHA 2CUIA 4PI0A 5DHVB 4YOKA 3BO8A 5C7ZA 3SE8L 5TFSL 5IV2A 4UI2A 4P3WA 1LMKA 7TAAA 4GRWF 4LSQL 4DH2A 4KJPD 4JBSA 2B1AH 3QGVA 4XN9A 2DM2A 4DPBX 3QG7L 1CMOA 2ED6A 4M93C 1BSIA 5E2WH 2NY4B 5C9KA 4UT7L 4IRSD 4OI9A 3STLA 4NAMA 1PX4A 5FHAH 3E3QC 3P02A 4NLAA 4B5EA 4DGYH 4GIOA 1KCRH 4P2RE 5AWNH 1IM3D 3MA9H 3UPCA 4BUGA 3EJQA 5JOPD 1X44A 3HE6A 3A4EA 3QJUB 4MAYD 4YSDA 3GTNA 1HHIA 1DBMH 5SWZE 2WN3A 4LLDA 3BWAB 3EH3B 3KPNB 3LEYL 1YNKL 4IEFB 1NA8A 2VNCA 4JX0A 4WW1B 5L9DL 3H3PL 4JZNB 2AJUH 5GS1B 2NY2D 4FTVD 5IB2B 4HMDA 3TVMC 3MFFB 2K6YA 4HG4J 3FB6B 1XTLA 3O6MH 2DTMH 3DXAD 3IFOA 5A2AA 5FO9B 2R2BA 1MFCL 2FNBA 1BD2B 2EXTA 2X6VA 3FONB 3KYMB 4U1MB 4OD3L 2AK4D 4FG6C 5A6IA 1KIUB 3UX9B 5IB2A 4PS8A 4IBWA 5E23A 1OSZB 5CR1A 4N90E 3FSZA 4H8VA 3SO3C 3A6CL 3ETBF 3OMIB 4F7KA 1ZTXH 3DROA 3OHXB 4I1PA 3SY0A 1H3UA 2Z31C 2VSCA 1E9QB 4S1DC 5JIDA 4E68A 4JFXB 1NLBH 3KGUA 1NZRA 1C8PA 4LVEA 1G9MH 2VRKA 4WY7H 4FN0A 5CGTA 4OUUB 3LKOB 3QPXL 4N2MA 4BXSV 1OHZA 4PRNB 4XWGH 2FK9A 5EEXA 3GO1L 1UH2A 2GJZB 5L2KD 2CJTA 3UZQB 1D2OA 2BCKB 2R7EA 3S35H 2WYIA 1DANU 4S10A 5FHAL 3MTXA 3QRGL 4PJCF 4QLWA 1U93B 3UH8A 2D31B 4WW2A 2ZX6A 4MXQD 1MEXL 3SSGA 4HEPA 5D9SB 3PXJA 2HYMA 4KJQC 3GS4A 1MVUA 2LLLA 2J4WH 5F9WB 5FYJH 2WOYA 4NBZB 4LSVH 5A2CA 4QHMB 2AEQH 4JK0D 4PJ8D 2XWCA 1NBYB 4FQIL 4LRNH 2QQNH 4YGVB 4QHNB 1L9SA 3L3JA 4YPJA 2LLGA 5M95B 3G08A 3UC0L 1QQDB 1CICA 1ONQB 1UCBH 5C0ND 5ACMA 3PV6A 4HKJB 3U9WA 1T03L 1XR8A 5KANI 3CU7A 4QRTB 5D71L 4L5FL 4PJEB 5GRZA 1F1DA 2FIKA 3D9AL 1I1AB 3OR6B 2J12B 3BWUC 3IRZA 5E7FA 1T03H 2DQIL 1LNUB 2QMJA 2VITA 2QR0A 3QT2A 1JK9B 4JDEA 1CXFA 4QXUL 4KK9C 2XACC 1E5BA 1UZGA 3O45A 4P46B 3SKJH 5ID0A 3UTSB 5LGHH 1KXTA 1L7IH 2VKWA 3IKKA 1FDLH 1EEUA 1A02N 4YSPA 3MLXL 1GGBL 3JWDL 1WFOA 4UM9B 3EKCA 4W68A 4J3TA 4Y19A 4W4NA 3C5XA 2RCSH 3CE1A 4K94H 1I31A 5GGVH 1M6OB 3TO2A 3W9EA 1QX1A 3K2KA 4XNXH 3CXDL 4WCYH 4AEIL 3JUYA 3QI9D 2CLRB 4PJIE 1AE6H 4EDWH 4J23A 3UJIH 1KXTB 4G7VH 2O6EA 3MXVL 5LJYH 5F1IB 3SBPA 3FH5A 1DSFL 5AEAA 3ZR5A 4OLEA 3MV7A 2APVA 5DFWH 5I5JA 1BG9A 3WD5H 1IKFH 5FB8B 1IAIL 3ZE2B 2E0PA 4KO9A 3EG9A 5E6YA 4X5PA 5GRVL 1A0QL 1DL7L 1HI6A 3AB0B 4WEBL 1KPVA 2VAJA 3SE6A 4F9PA 2EO7A 3T0BA 3UO1H 3QQ3A 5BO1L 3G08B 4RA3A 2AVFA 2EXWC 2WUCH 1VEOA 3TURA 1GC1H 2R27A 3BZEA 1NCCH 4R7XA 5ALCH 1A7NL 2ZG3A 3C8KA 4AVIA 5CILL 2WLIA 4Z77A 5I5MA 3FUIA 1M05A 3NVQA 2GB2A 4NP9A 3BIBX 3WKNA 2QVKA 4RMSA 3PG2A 4E41D 2IMNA 3U46A 1BFSA 5KYYB 4RBPH 4UYPA 4HIHB 4PBXA 4RZKA 5KBPA 3TO4C 2BRRL 4EI6A 1H5BB 4M61B 4R4FL 3WEXA 3W82A 5IQ7L 1YSOA 3LH8A 1OGPA 3FUNA 1Q9LA 1G9MC 3HN3A 4HOZA 4OUUA 1OGTB 5CLTA 2DLFL 2Q8BL 2X12A 3WGVB 2KPNA 1U8KB 4ZAKC 3WL9B 1IB5A 2IPTL 1F0LA 4N0YL 3DROB 5AZ2H 2OZNA 4PV8B 3UYPB 1HZHH 2CUHA 3FUEA 3INUL 1ZLDA 4OM1L 5I8OH 3CLWA 4M5YH 5EO0A 2P5WE 4NBYB 1MRCL 2YR3A 4Y2OB 5I75C 3P73A 4I77H 4H5SA 1TTFA 1HNGA 1IILE 3VU2A 1YY9D 1RZQA 5C0NC 2R2BB 1OQOA 1N5AA 3D2UD 4MXWH 4AYFA 1HL4A 2V8LA 4M8UA 4X99A 1BZ9A 3T8MA 2YPLD 4Y2DB 4HS8H 4HBCH 1OY3B 4HETA 1T66D 1NCHA 3U4AA 3X14B 3MLUL 1IQDA 1SUJA 1BMZA 5DJZB 1Q1PA 4HWBL 4Y9FA 3SBWA 4XWOC 5C8JB 4J3OH 1TYJA 1XH3B 4PYHA 4PY8I 3S5ZA 4KRLB 4BQ8A 2ZCLH 2R0LH 4NKMA 3GMQB 4NSKB 4YHIA 1GAFH 1A6PA 1QRKA 2D7TH 3O41A 2J72A 3SBQA 2XIBA 1MWAH 5KBKA 2CWRA 4IU2B 1I8AA 3QORA 3RNQA 4PUBL 3FYEB 3GS0A 1N3NB 1ES0A 4N1HB 2DYPD 2YN5A 1PAZA 4KGLA 3FU5A 4NO5B 4ZOEA 2V5TA 4FI8A 3QNZB 2Q87A 4ICXA 1L0XA 1KN2L 1ULVA 1YUHB 3BO8B 4O02L 2C7FA 4PJ7E 4TOYL 3IRCA 4X4MA 4EQ3A 3QNXB 2R1WA 3T3PF 1HWWA 2EYRA 3FQTB 4TVSa 3IAPA 2H32A 4JANB 4KY1H 3UJJH 1XIWA 3R0MA 2YSTA 2I9TA 1WT5A 1U6AH 3CXHK 3AROA 4FLRA 4G42B 5K93A 3A67L 1MCLA 1K8DA 4N85A 4PD4K 4UM9D 4PG9A 3VI3E 5ETUB 4JPVL 3THML 3X1NA 1XF3A 4CC4C 4LE8A 1ACYH 1JZIA 4FA6A 2VDKB 1FYTB 4IOFC 4FFYL 4IS6B 4ZQKB 1CURA 3CH1B 3O11B 3NSDA 1WWBX 3FU9A 1EXHA 3HLAA 4MDJB 3LNEA 5EZIL 2HB0A 5G4MA 3UAJD 4E5XA 3FC8A 1DJSA 4PJ7F 3FT2A 3VFOB 5C7XL 1LP9A 4YHML 4XMVA 3HLKA 3CXDH 4WCYL 4AEIH 2XG4A 1W2KT 3JWNG 3DTUB 1T22A 5JYMA 2B1AL 3QXAB 2GUYA 3U36A 5FUCC 4YS4A 1UXWA 1RZIB 1PTZA 2HVKA 1IRAY 1AIFA 3TZVA 2HMID 2PXYC 2CK0H 3F7LA 3WFBL 2Z34A 4ZMZA 4LLMB 2ZUSA 1RMFH 1DO5A 3ZVVA 3WXVH 1NGZB 5CD5D 2XRAL 3O8XC 4Y4FD 3GDBA 2KI6A 3OXRB 5CSGA 3AG4B 4RESB 4O58H 4HBCL 1KTLA 2BNRD 1RZ7H 4WFED 1M7IB 6PCYA 5K59F 3QQNA 3M07A 3AREC 3CVCA 4KXDA 3UZEA 1FSKB 1OTUD 5TPWL 1B0RB 5E5UB 5BQ7B 1OK0A 3LDBC 3IDIB 5IVXE 5MENB 4ZPVA 3QIBB 3OL2A 3PL6A 5IJBC 1GGCL 3HG1E 3GTVA 1ILSA 2F7IA 3V8OA 5DZPA 2OTUB 2C9XA 2OTWA 1J8HD 5E6ID 1S9WA 3WY2A 5IGXL 3ES6A 4F58L 4MGXA 4O9HL 3W0WE 2UWEF 3L3KB 3EBIA 4N2IA 3OLEA 4BIKA 4U3CA 3RVWC 4FQXB 2X41A 2CAKA 2D3LA 4N1EA 4AGPA 4PJCE 4TUKH 5DHXB 1K4CB 2B20A 4NKDB 3QJHA 4PJ5D 1W0WA 3CDZA 3BFQG 4H8HA 2VXUH 1DVTA 3UAFA 4DAGH 4KO6A 2D73A 4XC3L 3FFCD 3NIGE 4H8UA 3PAZA 3H0TA 1QAWA 3T1FA 3U6RA 4BWWA 3FQ4A 1KUMA 3LMJL 4ZFOB 3KS0J 1X5HA 2I7OA 4GG6B 5EU5B 1GGTA 4YSOA 5D93C 4BINA 3QA3B 5T3ZD 3HC2A 1FCGA 4OZHB 3VD4A 4L9LC 1ZK5A 3D4CA 3F6IA 2OYLA 4GO6B 4AYBA 1MVUB 1U0QA 2RA1A 4OT1H 1X5GA 2BDNH 2E27H 3JXAA 2P9RA 2DYPA 3PJLA 3ZU8A 3M86A 1MCHA 3QUMB 1R24A 4L1TA 4TN9A 3P11H 4PRBA 3QAZB 4P05A 2WSDA 3HIZA 4BZ1L 4PRNA 4JQXC 3X12A 3VXNB 3B7UX 5AALA 5FYLH 5GSVB 2VLRA 2BINA 1WZKA 2WPGA 1CIUA 1UXMA 1U8QB 3ABMB 1DJWA 2IGLA 1SJMA 1ODUA 2GC7C 4OD2B 3GXDA 2GTZA 4JKPL 4PRHB 2P8MB 4NAJA 3FTZA 3VH8A 2M1KA 1CD8A 4R90H 4R96B 2GTQA 4HPYL 5E8OB 3S4SG 1MG2C 4MA8H 3C5ZD 2VDOH 4JY5L 4P06A 4N5EC 1TOXA 2CRYA 2X6AA 4HJUA 4YC2B 2JIXA 1EPFA 3WJLC 3JWDH 4P2QD 1YAZA 2BHUA 3O4LE 2VXVH 3IJ7A 2LLNA 1B88A 1A65A 3V5KA 1S7QB 2WCGA 4ECNA 1CDBA 5CO1A 1EDQA 1YJDC 1BXAA 4WW1A 3VD0A 1DDHB 1VESA 1I75A 1MREL 4OFDA 4POUB 1JNLL 5I16B 3KVQA 1O6SA 2UV3A 5JW3L 1HHIB 5CP3A 5IBTL 2Q3XA 1KZYA 1I4FB 2F2HA 2W9DL 4KROB 5FYJU 3WKMH 2OSXA 4NUGH 2VABB 1AJ7L 1FIEA 4F5CE 1BVOA 2ADJA 4TNGA 1CC3A 5GJTH 5ILTL 2V5RA 4RVBA 4D7PA 5AW8B 2VZUA 1SFDA 2FGZA 1OP4A 2WSKA 4Z3IA 3HZKB 1OF2B 3IU3A 1N67A 2NQCA 4J6RH 5DWPA 4B9PA 3BUPA 1ZHNA 4ZZFA 2VJ0A 1ZSHA 5BS0D 3LNHA 3BRDA 2PN5A 2EZ0D 4KVNL 1KB5H 1FI8C 3AJ7A 1NANH 4LVOB 8FABB 1T04A 4JHWL 4R97C 1FQ9C 1X5YA 1ORQB 3QFDB 4OUOA 5AVYB 3S35L 2ADGA 1AGBB 4L4TE 5DJ0B 3IGUA 4L1BA 4ETYA 1I8IB 2JLPA 4HPYH 4MYWB 3HZKA 4YXKH 2OQJB 2YD1A 1OGAA 3ZX1A 2C3WA 2EIZA 3UTQB 3KJ6H 3KWWB 5SX5H 1GRWA 2ADJB 3CPLA 3PGCA 3VRLF 4P2OB 3O8XD 5JO5A 1D9KA 3EFOA 3HKFA 3FUFA 3KJ4B 2EQDA 3BEVA 4TQIA 1CICD 4AT6B 4YDIL 2HVJA 2DMCA 3MJ9H 5HYQA 2OMYA 3LKPB 3S8GB 3IGAB 4DQOL 1G1CA 4GSDL 4FFVD 3RZCD 4ELDA 4I48B 3HC0A 5FYKD 3RGBA 3UPRA 2VC2L 1YN7A 5GZOC 3ATAA 4XXWA 5GJTL 2QGBA 4ZMYA 4DKAA 4P9HC 1DBKH 1SHSA 2FTAA 3RDTC 1TEFA 1F4WH 1M42A 4O02B 2AMUA 3C08L 1IAII 2VLJD 2NNFA 5AAMC 4OLXL 4A66A 5FUZL 1EHLH 2IBGA 1E65A 5DD5H 3MXWL 3S34L 2JK5A 2KMWA 4RMRA 4UAHA 5KSBA 1ZT4A 2NY3C 2D03H 1E6OH 1L3NA 4OD2A 2XV0A 4OZGE 2HT2D 4OZ4B 1Y6NR 3CC5A 4KUZH 2OJZH 4R3SA 1MHCB 1MJ8L 1U8QA 5FS5A 3DOSA 3NCEB 1XF4A 4Z7QF 2J8UF 2O5ZL 2J5WA 3AS2A 1RZKL 2WAHA 4IMLA 3KD4A 3K6NA 4HJ1A 2HSIA 2ZX5A 4HWBA 5DJDA 3RB5A 2X89A 2WIIB 3FT1A 1K9TA 3WNMA 2ZOKB 2ATKA 3B6SA 2K3HA 3WJJA 5CJ5A 3RWJB 4CGUB 2F53A 3WN5B 1MJ7L 4Q6IB 2J88L 5ABAA 1UXSB 4X83A 5DJYB 5EWIH 1X9QA 3KNBA 2OS7A 3A6BL 4DPRA 1YCSA 1Y0LA 4GQ9L 5C0EB 4ORGA 3O9WB 2H9GB 4Z7UF 1DVUA 1N6VA 1S9YB 3B3IA 1WYJA 5GS3A 4KKPA 5JORA 4R7NA 2A9BA 1SBBA 2MPAH 2X53A 4Z7IA 5HYSB 4UOW0 1KEMH 4I2XA 4ZMLA 3ALWA 3MV8E 3FQRB 1U21A 3BCDA 4K8RL 2Z31A 1U4FA 2UXTA 4AUJA 4GXFA 1YVLA 3CD4A 5EBMA 1BZ7A 3W56A 3OHMB 4JFHD 1UATA 1AQHA 1F4YH 1CL7L 2A6KA 3JWNE 1JZFA 2VDKH 3JTSA 4NQVB 4A7SA 1F86A 4P9MH 4YIQB 4IQHA 4OCXH 3KDPB 3EFFB 5JPMC 5HHNA 1W72H 3KPTA 4IHOA 4L3EB 5K59E 3BSZA 4NBXB 4CVXB 4P9ML 1BVKB 5IF0B 3NABH 4N20A 2PPEA 2HT3C 2IBZY 3SDCD 1SEBB 2DD8H 3HC4H 5L4FA 1IBFA 3N43B 3ZTJH 4U1GC 4ODXB 2R0LL 3KPRD 2GCYA 3NRPA 4AWJC 3UYRH 2PLTA 2ESVB 1T4KB 3D18A 4X6EB 1HILB 1OZUA 4DP5X 3KLHD 1XSKA 4OI8A 4MAYB 3REWA 5FW7A 2P24A 3T09A 3WE1A 4ACPA 3TV3L 4AYGA 2Z4TA 2ZWLT 3VFTA 1LE9A 3MXWH 3T0AA 4HIIA 2W60A 4PTUA 5IMKB 1MCFA 1FH5L 3BD3A 5LLIC 2C9VA 2VDPB 1XCQB 1T22B 1U42A 5IG7A 4XMLH 4N26A 5LKNA 4W9EC 3PDDA 3TO4D 4ERSL 1NCAH 1DQJB 2UX7A 3J07A 1UZ6F 3DLQR 4PS4L 5D4IA 3NCXA 4MNHB 3F58L 1CI3M 3ARVA 3V4PL 1BVZA 1KJ3L 2XFGB 1IFRA 1ASQA 5E99L 1AS8A 3BP7A 3GXNA 3W2DH 4PJXA 4M00A 3OZKA 3QIWC 1C08A 1E2WA 1DLFL 2OMYB 4K5PA 4MAUL 1Q1JL 3GXMA 3PWPA 4TLTA 5F97E 2N7BA 4ONGL 4HJ0D 1WEJL 2OYPA 1B0IA 4BYHA 1WWAX 4LBEA 1A1OA 2X1WL 3CFQA 2Y6TE 3CC5B 4BFIB 1CFQA 1UB6A 4G42A 1UB5A 2ROXA 1OGAB 2DMKA 3FQXA 4XVJL 3OF6D 3RJDA 3V95A 4Z0XB 1E27A 1Q94B 3GD1C 4F7EA 4ABUA 4ZFOL 4X9HA 3AREA 4WV1B 2XWEA 5IY5B 1N6QH 5F1KC 4YFLI 3BOVA 1XGRA 2VDLH 2HH0L 5E08H 4L3FA 4L3ED 1XH0A 5IFAH 3D08A 3QXWA 4RWYL 4G3YH 3QNZA 5J9PA 1CF8H 2B1HL 3L3HB 3P30H 3ZSSA 5TK2A 4I48A 3T2QA 1NEZG 4G6KH 3KGSA 1D9KD 4JW3A 3MJ8B 4K3JL 1XV8A 3IU3B 4HUUB 4MX7A 5B1AB 4QXGH 2NNAA 3L4UA 4R4ND 4JRLA 4V2CB 4DHLA 5ICZB 3S9DB 1R3JA 5C0BE 1Z0NA 4BV1A 4UDUB 3IWUA 4OJCA 5GIRB 1WBXA 4XXCA 1IM9D 4JVWA 2NY6C 1E5AA 3SQBA 4QRRA 3CC1A 4J8RB 2DKMA 5HGBA 1A4KB 4TQ8A 4KZDH 2ZICA 2GCYB 3LIZH 3B8SA 4BZ1A 2G0LA 5HGAB 5I17A 2Y7QB 3HB3B 3LPWA 3HG5A 1KELL 2G75A 2XZAH 3S97C 2HLAA 2L8AA 2MFNA 4JQVA 3N85H 5FC9A 5F6IB 1FG2B 3PHAA 4GG8A 1I8LA 3SJVE 2O26U 4YDZA 4CU7A 2IV9A 5J9PB 4X2UA 4WLCA 4PP1D 3S36L 4MJID 5DS1A 3Q9QA 1NCWL 2R23A 2F8OA 5F7EH 2BFVL 5E51A 1T0OA 1GPOL 5FKPA 2H3NA 2K45A 4I9XA 4KX9A 4Y7MA 5HDBB 2F1EA 4RGNB 2WKLA 2E6QA 2H6PB 2J43A 5INCA 1E40A 3RKDD 4DZBA 4WF7A 1CYXA 4MQ7A 1OP5K 2X3CA 5K9KB 2NR6C 4MXVF 4OZIF 2GITA 2ITDB 5J13B 2BSEA 5KSVB 4OLVH 1A6WH 3GSNL 4F58H 5HHQA 5SWZA 5BRZA 2HRLA 3A4FA 3SPGA 3NIFF 1D3CA 2YGPA 4Y1AA 3D25B 2P5WD 4NEHB 1NC4A 3TH3T 1X7SA 4MNGB 3EXLA 5KJRH 35C8H 1MHEA 5J06A 5HPMB 3TF7C 2COVD 5DLML 5LWYH 2WXFA 3CQPA 5I0YA 2OJEB 4DOHE 4AXWA 4N0YH 4XCEB 3P11L 5INDB 1J8RA 3DV4B 3QARA 2Z7ZA 3FZUC 4ONHB 2YAFA 5I0XA 2KLTA 3L95B 3LKNB 1ET7A 1LE9B 3VSTA 2OCCB 3BI9X 1RVFH 1PKQB 2ALAA 5DJDB 1X9RA 5AB2A 5LGKA 3BFWA 2B39A 4N0CD 1T1WA 3SIKA 3VGFA 1FRGL 1KYUA 2F7OA 1PQZB 2IV8A 3H7BB 3VWJD 3CX5K 2Y72A 2PO6A 1OAXH 3PREA 3DHMA 4TS6A 4HU2A 1AO7B 4YLCA 3DUSB 1SOXA 3PHOB 3GHPA 1OP3K 3MRCB 3K72A 4JPKL 4PRPD 2WXKA 2C4FT 1JDAA 4FI7A 4A6YB 1PZ5B 3FTVA 4OGAD 4DZ8B 4CDGC 4DFIA 2IH8A 4RFNC 4ZMTA 2Y7MA 2C3VB 1E2ZA 2IMMA 4I8DA 4M7ZB 2BNQA 4WI9A 2EIKB 3GRBA 4Z7OE 2BP8B 3CIAA 4OLVL 3S3CB 5EZJB 3QWOA 4P07A 3SE9H 2XQ0A 3PL6B 3AQYA 3VXPB 5FO8B 5IBLD 1D5XB 1CCZA 2VL4A 1IKFL 5D1ZA 1ZDSA 4AQOA 1QASA 2BY2A 1HXMB 4U05A 2E7LA 1P69B 3OKLA 3JV4B 3ZL1A 1IGJB 3SE3A 3U4EA 3DIDA 1PY4A 4OAWA 4XPFL 3VFPB 5EF0A 4AT6A 5D1ZI 4GKSB 5HVFB 4JE0A 4IU3B 4O02H 1ZRUA 3NOIA 2VR5A 3KYKL 4RMWA 5DVKA 2GI0A 2YJQA 3S7GA 4P2CG 4TMPA 3ESMA 4B60A 1Z9PA 4RSVA 1YQVH 2BOLA 1TU2B 2EDWA 1FL5B 1TQCC 3AZUA 3H55A 3MUUA 3OR6A 1MW0A 1RVFL 4UNTA 4ZYKA 5H2BA 5AW0B 4OFKA 5JIMA 4UINL 3PWVA 2P45B 3KNBB 1FVCB 2WLHA 3T0EB 4EKJA 3HA0A 1U3YA 5B1KA 1RUPL 2ZWKA 3WN5A 3V0HA 5BVJA 4NGHL 5KAQG 4B9JA 4Z8FL 3O2WH 1AKPA 1IJNA 1KTKE 3QIWA 1O9ZA 4IOFD 5TFSH 3VGDA 2F54D 2CPCA 3D4GA 3EDFA 3ARGC 2YAHA 3OG4B 1YZZA 1HL5A 4Z76A 3DOSB 1OF2A 4B9KC 4D0DB 4V2BA 2C4FU 3WCYA 5A2FA 1TJMA 3AS3A 3V9EA 1EQWA 1OTSC 1ZTMA 2O6PA 5D1QE 4R7LA 1WBYB 5JW3H 1CD0A 3A67H 1W0YT 2NY1D 3DA0A 3FSWA 1SBSH 3FUMA 3FQ2A 3ZRCC 2BVOB 4YQXH 4R5TA 1XCTB 1RZIA 3SB3A 5IOKA 1ROWA 3WTWA 3ZT5A 3D4ZA 1DDHA 4DF9A 1A25A 2IAND 1KLGA 5EOCL 2AI0L 2NSQA 4N0RA 3BN9D 4U1KA 3ZZQA 4DEPC 4Z7WE 4UANA 1NDGB 5AVTB 2DJ4A 2Y07L 1UADC 4KXAA 2A1WH 4D9LL 2BS9A 1VGKB 2ZP9A 4FZEH 1KB9J 4XO8A 3LN4A 3S5YA 2WKOF 1KBPA 1ZA6B 3VD7A 3ZE0F 1AOZA 1XGUA 3QJRB 3GMMA 4H8PA 3ZZLA 5ID1B 4KKLD 3FFDA 4APQC 3CPLB 3DSNA 5I74B 5CP7A 2GTZB 3WTVA 1SMDA 3QPKA 5AVZB 3EDKA 3OM3B 3RKDC 2EE0A 3VWJB 3QQ9C 1FVDB 2VGLM 4AITA 1IGYA 3QUYC 5E4EC 3ECWA 3FOMA 4NQDA 5DVLA 1QNIA 1HHHA 2FZ3A 2CHWA 1J9RA 2VCOA 2WNWA 4PJIF 4J39A 2YC1B 2UWEB 2A9DA 2XPGA 2D7OA 2OM5A 3GKWH 4FG4A 4Y2OA 3S35X 2BSED 4BWTA 4GUCA 5AYUL 1HSAA 1F5WA 4EE2A 5IB3A 4FHKA 1YMMA 5D1XD 4AQ8C 1K2DA 2AXFB 5D5MA 1KPRA 5DHEA 5GISH 4AG4H 4JRXA 2IAMC 4LK4A 2ERJB 4NNXB 2X4TB 1MUJB 5E56A 4L0YA 1TVBA 2YPLA 3MX0B 4F7TA 4L1SA 4N25A 2VXUL 5F88B 3RI5F 1EO8L 3AVEA 4PJ5E 1AACA 3X1FA 3TEUA 1JN6B 4RNRB 3T0WA 3J2PA 1XCWA 2PYED 2VDQH 5DUPL 5FGCE 4TUOA 1D5IL 3B9KB 2HLEB 3GRWA 1QYGL 2EC9T 2Q8BH 1L9TA 4AQ1C 3KPSB 4NXKA 2KLRA 1L9RA 1ZAGA 3IJEA 1WD9A 3CFCL 4EN3C 2ZD0A 2JCCB 3QDJE 4JRXE 4Y7OC 4AGMA 1NINA 1K6QH 4GRMA 3M6DA 2L7UA 2DBLL 1OCCB 2ICEB 2XETA 3M1CA 3NCBB 1MCCA 4H8QA 3TYFA 5IW6A 2VE6A 5E00A 5LGHL 1LE5A 3QR2A 1O7DC 1P7KA 3N3EA 4I18A 2YAPA 1SMAA 4JHBA 5C0DA 3P2TA 1ZLSH 5EUOA 3GRGA 4WWOA 5DUBB 2X7LB 4FFWC 4PB9H 4OJYA 1GCYA 1LP9F 1CUOA 1EMTH 1NAKH 2R59A 3C8DA 3H9ZA 4PRPA 3VXQB 3RJQB 4AL8H 4DIXA 5DYFA 1RHHA 4NKOB 4GFXA 2ZYRA 5MENE 4ZOBA 4YFLF 1C16B 2YQ2A 3U1QA 4PJFE 2CLZA 3IMWA 3WMQA 4BFGA 4RGOH 2B4CH 4PJIB 3TLRA 1UD3A 3ZW3A 2IPTH 2L7EA 2WBJA 1G0XA 4PJ8C 1MFVA 4EUPB 1YYLL 5KYNA 4YHLH 4JO8A 4WGWB 3GEWB 1BLIA 1IGCH 2APXA 2X6UA 3PQYB 4YHOH 5HD8C 3WEXB 5F9JB 1NKGA 3QXAA 3QUMA 4MA7L 3BFOA 3GBMH 4JGNA 1MCEA 1MN4A 3I50L 1QG3A 2A6JA 4LVHB 3KYNA 4OLWH 4TF4A 1FE8H 3T3PE 2V8MA 2EDQA 4YXKL 2FHFA 4NQUA 4L18A 3KVDD 2H6UA 3FUJA 3HLAB 1P0SE 4KKLC 4DOHB 5FO7A 5T5NF 2C1OA 1NLBL 4IOSA 4Y9BA 4Y4HC 3RUGA 4KK8D 3IFNH 1IMHC 3LOWA 5EBWA 2ZWSA 1QSEB 2SEBB 5K9OB 4XMXA 4Z95H 3C5JA 1CF1A 1W6LA 3HI1A 3UJJL 4I0KA 1MFBH 3EOAA 1I1AA 3RIAK 2Z0BA 3LS4H 1T7YA 1VEPA 2H26B 2DQUH 4JANA 4GW5B 3SCMB 3CFBB 3BEWA 3QEHA 4DQAA 4JL2A 1IEAB 5C09A 2F54A 2BWQA 3PQYD 4JQXA 2EEAA 1UA6L 1EGJA 1DANT 1S46A 4XCNA 5CD5C 3HEIB 5LBSH 4BFNA 4YHKL 2DWXA 3HPLA 3HG1A 3LRSA 3TN0B 3ZT7A 4LESA 5ENWB 3QIBA 3ULUC 3GB7A 4KK5D 5E94B 5DVNA 5BZWB 4UT9L 2C1PB 2OPCA 1TZAA 3EUUA 1HK6A 1CD1A 1P1ZA 4RISL 2AP2A 5H94A 3CIQA 4J4PA 1JSYA 1MJ8H 4UMGA 1D6EB 1IBDA 2VB5A 4BZYA 4RISH 3BQVA 3BPOB 1QP1A 1DVFC 4LP5A 5EU4A 4TKWA 5JIQA 3DUHA 4YDLB 3NJVA 3U0PB 4AJVA 1FNEA 3QEQA 4IDLA 4QRBA 4DKFL 4WI3A 4JO2H 2ZWYA 5PCYA 4LLAA 3GK8L 3REVA 1CXLA 3FDWA 3EZ8A 2V9TA 5ECJE 5LBSL 1KC5L 5DUBA 3ZYJA 3BUYA 4G43A 3LIUA 1CICB 4JFFA 4NC1E 4K94C 2YRPA 2QADC 4N8VA 3AS0A 2X40A 2JWYA 5GGSA 4I18B 1E5ZA 1NBYA 2C8NA 4Y4KA 1AANA 4ZZKA 4JG0L 5B38B 3E2HC 4BRVA 2XA8H 4LB8A 5F1SA 3O11A 5TDPB 2WLJA 5FFLA 1IC7L 1MIEL 1HZHL 4OVVA 4YSUA 4Z9KB 3LZFH 2KZ1B 1JWSA 3H9SB 5IB5B 4ELKB 3ULSA 5JMRA 1HFUA 3L1GA 5EHFA 3S8FB 1YEJH 4P46C 1KN4H 1OB0A 2Y7OA 2BCKA 3EJTA 4IK7A 3D7PA 3H2QA 3QHZL 3IJSA 5DVPA 4RRPM 3QCTL 3PXHA 4MAYC 3DV6B 3MJ9A 1NCGA 3BZ5A 2ZKXA 5CEXB 1VCAA 5CBAA 4OF0A 4Y89A 2O5XL 4FNLL 4UT9H 5FECA 1JPST 2YK1L 4MB5A 4EI0A 3NZSA 2HT4D 5B39A 4DEWA 4IBQA 3COOA 5F7YC 5TGBA 3VWKD 4PGBA 4FQHA 1KIUA 1Z5HA 3AGWA 1XBRA 3QG7H 3U46B 3BW9B 2JKRM 1RUQL 3IDJB 1QBML 2W9EH 3QIWB 3ZKMD 5CR8A 1UH3A 2E4FA 1GYUA 1VZGA 3O4LA 4N0CC 4WGKA 4KITB 5GGSB 4MCYA 4K9EL 1NC4D 1CLOH 1ICTA 4RH4A 1D5MA 3V4VL 1OT4A 5E8NA 1E4XI 1WUZA 1N0XL 3C2SA 1NICA 1KDJA 2UZXA 4NUPA 4ZYKB 3QG6B 5F44A 4X80L 1SOQA 1G7PA 2F68X 4GP4B 3AU0A 4LASH 4CU8A 3RL1A 5F9DC 2QJDA 1UEMA 3U9PH 4WU5A 1RULH 1MDAA 1XX9C 1BFOA 2JMRA 4NZUH 3X14A 4PJEF 5F7HA 2ORBL 4MCNA 2BSTA 1RIVH 2WINA 1G5GA 1WV7T 3BUTA 2EXSA 3MLZL 1HSBB 1A14H 5DEFB 2EIJB 1LJMA 2BOBA 4AYSA 12E8H 5KBMA 5BZWA 1FZKA 1U3HD 1DBJH 1GMIA 3FO9B 4MA1B 5HJGA 5JXAH 1A7BA 1NEZB 2YEQA 2EE2A 4ELMB 5HHMB 2VW7A 3V0WL 4M03A 5AW7B 4J28A 1PKQE 4K5MA 4UUJA 3TT3L 4N9GB 4BGLA 1A6VH 1NPNA 4D3CH 4F2EA 4GKNB 3BZ4B 4LQFH 1MCOL 4DPAX 3MUY1 3GJEB 1OSYA 3TWCL 4HD9A 2XZCH 1S6NA 3HAEB 3SPCA 1M9WA 5IREA 4LGPB 1VKXA 3DRTA 2BMKA 1ZHBB 2AEPL 5EFIB 2AK4A 3W0WD 1F4HA 3NCWA 3L2LA 2QQKL 4QHPA 5DUJA 5IHZB 3EFDL 1HJCA 2ED8A 3G9AB 3Q44A 1TJHL 4EIZC 3MRLA 3WDHA 5I2IA 4F8LA 1JHTA 2V33A 3N55A 1I9IL 2EEDA 3QULB 2HG5A 4QHNA 3D05A 1P6WA 2JKXA 3I9GH 3X3GL 1FIGH 1ZTXE 1N18A 3ZT6A 2F5BL 1JZDC 2VN6A 3WJMA 4HEPG 4L29A 2HRGA 1IGFL 3MRLB 3ISWA 5E8DL 1R5WB 1L5GB 3UZEC 1TZHB 4UYQA 2FJHA 3QP3A 3ZZ1A 1HC1A 5FCSH 3PJSA 1HJBC 2ED9A 4JMNA 4N6RA 5E03A 5FDWA 4XP6H 1IGMH 4K9JA 5E9DA 2EDJA 5IZ7A 1U92A 3PQYA 5B8CA 2AJYL 1A2YB 4QTIL 1OAZL 5F7UA 4WAFA 2J71A 3ZZSA 3PUCA 1RZJC 1BXUA 5M7QA 3LSOA 3QIBD 1BHGA 2DWSA 3GMRB 4FQJH 4HK0A 3NZ8B 1FFTB 2P47B 3KHQA 4MQ7B 3O3BB 3F6LA 1ZWIA 2YFOA 4L8SB 1RFDL 2HWZL 4X6FA 3QWNA 2FYVA 3FHEA 2H3NB 5IGXH 4FLOA 1I8UA 1AVAA 4Y4FB 2E9JA 4AY0A 4YJZL 1MWOA 3CSPA 4AZ8A 5JQIB 4LCWD 5BZZA 2Q1EA 3RY6C 1HEJC 1U8OA 5GRVK 4MWFB 3GSRA 1NFDB 5D72H 3QHTC 3VI3B 2N7SA 3MFFA 3DMMC 5F72S 2JCCF 3M45A 2BSTB 1QO3B 1WC7A 3MLRL 2F7RA 1EHAA 2JB5L 3H54A 3KL0A 4NNPL 4ODVL 2Q7YB 2NT0A 5K1JA 1KENL 4XBEH 3SOBL 4CJ1A 4OB5L 5LG6A 2FECI 1I7TB 3N40P 4CMHB 2I27N 3BIAX 5E8PB 2PUQT 5DZJA 4TUOB 3WO4B 3QJQB 3TCTA 1OPGL 1S3KL 1XZ0A 1SUHA 4J8QA 4YVNA 1E4XL 5E6IC 1X9UA 2IQAB 3KXFE 2MTPA 4BM7A 4XNMB 1A9BB 5CXPA 4Z5RA 1AGDA 2WZPA 4R0LB 1E4XH 4L0PB 4NNXA 4TL4A 4X8JB 1I8KA 1RLBA 5CINL 1MNUH 2Q8AL 2DEYX 1U95A 3MBEB 1EZVX 3EYSH 1AO7D 2CSPA 1YRKA 3WBDA 2PXYB 2Z92A 4GAFB 1T83A 2K1MA 4I3SH 1XGTA 3TBWA 2CGZA 3MLUH 5DJCB 5F7MC 4MQTB 2XXFA 1B2YA 4MS8C 4NJ9H 1DBBL 1H6TA 1EZVY 1QBLL 3MRGA 4JFEE 3RVXC 1F58H 5JR1L 5EN3A 3AREB 1KJMB 3KCPB 5MHSD 5CGYC 1KJ2L 4TTDC 1M1SA 1P9MC 3ARBC 3JWOH 3LDBB 4G8AC 4OLUL 4RMQA 4HCGA 4Z0XA 4OBSA 4P57A 1FNHA 3CN1A 5IBLC 2FATL 1NIDA 3LKQB 5FM5O 4DO4A 4PW4A 5GGRA 2OV0A 2ARWA 4V33A 5GGTL 5E0QA 1X7TA 3MU3A 1E50A 2VXSH 4XPHL 2H32H 5FKPB 3HS8A 3WFDL 1PZ3A 2RH0A 2EDRA 4TUUA 1BD2A 2E9IA 1ZA6A 1VFOA 2Y1AA 1B6UA 4YUEH 2WWOA 4ORZC 1OM3H 2R9HD 4G43B 1QLEB 5I0WA 1IAOA 3NEXA 1KIPB 5D7LE 1KCWA 1HEZA 5C0BA 2F15A 4LOUC 1M3IA 2A38A 3QIUD 3SPJA 1BQ5A 1XVSA 4WK4B 4ZMNA 5BMFH 3QEQB 4JS7A 5T1KB 5T1DL 3VO0A 3DGDA 3RKPA 2A77L 2F8IA 4ONFL 5HGBB 3BP5B 5HHOE 5IJKC 4JY6A 1XEDA 1I1RA 4GBXD 1A7RH 5CZXC 3VFRB 2CO7A 3RGHA 2BVQB 1TENA 2VMCA 5HJDA 3MV9D 2UZYA 4A63A 3GNML 4K7PL 1K72A 2R29H 1GVIA 1M7UA 2XTSA 3AW5A 4XC1H 5GS2H 4N5UA 3S88L 4XT1C 1FAIH 2Z91B 3GZOA 2EIDA 4H0HB 4QYOA 3WTXA 2QGDA 4LSSL 2VM3A 1QW8A 3L3HA 2P46B 5D71H 4F8OA 5IV2B 2IDFA 4MD0B 3KWXA 3QUXC 2CG9X 2BZ7A 3WYRA 2EINB 3VI4E 2MOGA 1U8HB 3X1EA 2FQFA 1SVZA 3PNRB 2QT6A 2VH5H 1MJ7H 3E6HB 2X3BA 2H0JA 4MCMA 4DO5A 2ZUVA 5IKCB 4UTBL 3ARGA 3FU6A 5CLXA 5FAAA 3GMLA 2TRYA 1QFHA 3T6WA 3HBPA 4DCQB 4WEMB 4DP4X 1UB5B 5B21A 2ZKYA 4KBPA 4ZTOH 4CVWA 1NDTA 1GMEA 4OCYL 1KLUB 3V10A 5I6XC 1E3FA 3BT0A 5MI0C 2VR8A 1TJIL 3RP1A 5EBWB 1E30A 3UEZA 4NOBA 4YFDB 1JNHA 2AC0A 5LCVA 3F5WB 1XF5A 2OMWB 3NEOA 4OAWB 3GT6A 1FGNL 1MLBA 4L3AA 2DS4A 2LTQC 2HFEA 5F93C 3CN2A 5KVEH 1XGYL 1I85C 5AKSA 4D7BA 1OAQH 1VPOL 5TH2A 4DGVL 1HXMA 3NFPA 2XN9D 5KYWA 4PVBA 4JFPB 4RAUB 1XIWD 5DD6B 2EH8H 3DX9B 4AVHA 3CTTA 4NZTL 3CQFA 4N0UB 2IPUK 5IROA 4F2MA 1R3IH 3SY6A 3IKCA 5DFVC 3D2TA 4ZFFA 4HIIB 4P2QE 1UCBL 4PTUB 5IMKA 4U1JB 3EHBB 3JV6A 1L9QA 4MNGE 1A0QH 2LAGB 2V0AA 3N1FC 4ZXBB 3I3EA 2WJ5A 4JCWA 4BHUA 4MMYA 3QISA 4PBVC 3UTTD 4A39A 5I23A 3TYGL 4JM4L 5I6LA 4XR8C 4NHUA 4GSQA 4ODUA 3VFVA 3MJ9L 4HXAH 4WTQA 1CTOA 3WAKA 4EN2A 5KS9F 2CGRL 5JOFB 3TYGH 4OZ4A 2XUWA 1LK3H 2NCEA 4NRXB 4OCSL 3WNIA 5ABZA 2EILB 5HYJA 2C9PA 5EZLB 4AIEA 1SQMA 4NO0A 2NQDA 1OL0A 3BQUD 2JK5B 3RVUC 2IDUA 2X5PA 2PO6C 3ZKXC 4AQZA 4DKEH 2VM9A 4NP4H 1F8TL 1MI5E 3B4NA 3JT2A 3CK0L 2JE8A 5IW6B 2AZUA 2K6WA 3L13A 1A5FH 3SYCA 3QWRD 3WFHB 5DEJA 1G1OA 1AS7A 5JXEC 3JWOC 5DK3A 4C56D 4YX2L 3HFMH 2A83B 1FGNH 3NJXA 4HFWA 2HN7A 4GG6E 4AQAA 1NMAH 3OAWA 3SZ6A 4Y16B 1OLLA 4HISA 3MV9B 5C08D 1NCDH 2WQVA 1TO4A 3BH9B 3F7YA 15C8L 1EVUA 2VDLB 1XB3A 3T2OA 1N8OE 4P5TC 4PPTA 4JFUA 1YDPA 5DFAA 2ITDA 5KSVA 2PO6D 1SBSL 2X4TA 1IC4L 2EIZB 3UTQA 4LAQL 3HAEH 1I7ZB 5JUEH 1VAHA 2WXHA 3LH2H 5D1QD 1TNNA 1U8MB 4ORGB 4OJEH 4PLNC 3UCQA 3BQUB 3JZ7A 2RJMA 2WK2A 3UMNA 4LAQH 5JUEL 2XQBL 3CFNA 4MSWA 2WBJC 4FDWA 4PJ8A 2F19H 1VSCA 5DC0A 1KDIA 4FG2A 2CLVB 2H2PC 3G7TA 5FGBC 2OZ4A 1GPOH 2VO5A 3M46A 1KXQE 1FN4A 4A2EA 1HHHB 1HOEA 1MF2H 4L4VE 4Y5VC 2LAAA 3VA6A 3IF1A 4XBMA 4JFZL 3LPPA 5E2WL 5BPPA 4ZFZA 3MCKA 2MEJB 3KR3L 5JW4R 3WXWH 1RUPH 3AXLA 1GJWA 2EIEA 5FYKL 4U1IA 3MRKA 1QFWH 2VLJE 3DARA 3E3QE 3HKZA 4CRPA 4UQCA 1JVOA 3T4YA 3DVNA 4GBXC 5CZXD 2IVFC 2PYEE 1MRDH 4ZNCD 1UHVA 1J5OH 5H37A 1USQA 1JGVH 1KJVB 1P4BH 4GW4B 3RBGA 1OO2A 1Y6MR 2DKUA 2Z8WC 5DJAB 4NQED 2AQ1A 4KJQD 2X42A 4ERSH 2DYRB 3QIUA 3CVDA 4LLWB 3BDXA 4CVUA 4TULL 2CM5A 1S7QA 5IVZB 4ENZA 2BC4B 4GAGH 3KPQA 4QOKE 2XKNA 5FM4A 5E4IA 4L0ZA 4JG5A 1AGFA 3OGCB 3OSVA 4Z95L 3VFWA 3MTRA 1KTJA 3FYIB 4LO9A 1TETL 4OT1L 4N8VG 1Y18B 2DI9A 5TQ2H 2X70B 2VDOB 1SYSB 5EUKB 1V10A 1EZLA 3BH8A 4LNRA 3EFOB 4PGDA 5DZLA 5GXBB 3F62A 1PEZA 4X4ME 4XAKE 4HF5L 5F6HJ 4F57L 5JDSB 4GQ9H 3VXRB 1N68A 4FD0A 3WNKA 1E5YA 4KK5C 2WOBA 4KTYA 5KVEE 3K71A 4KGJA 2GK0A 1GW0A 1JV2A 3PWLA 2B2XH 4NZDA 4IM8A 5JPMB 3K2UL 1WFTA 2AQ3A 3DJSA 5JNYA 1U2HA 5CJQH 2A4EA 1AOHA 5GSVA 2C3HA 3L7EB 5I9QB 2H8PA 4XN1A 2X70A 1FRGH 5EDXA 1K6QL 3QDMA 3U7YL 3SQOH 2CLVA 4X4ZA 4Z7WA 3ZTDC 4K8RH 5AL0A 1T20B 2BIIA 1DUYB 3U6XA 4FQ1H 1WF5A 3GF8A 3MNVB 1UASA 1VGEH 1E6OL 1MAKA 1AXSA 2X1XR 2E6JA 2PW1A 4UOW1 3KPOA 1ET5A 2G5BA 2VDNL 3CFMA 1D7DA 4FGMA 1OPGH 1X6LA 1JGLH 2IXQA 1V5JA 1S7SB 1FVEA 2CBPA 2I26N 2W0FB 1IAIM 3QDME 5F70A 2XWDA 5DT1H 2O5NA 3WFCL 1X5LA 1O75A 3RAJL 3EOYG 4POZC 1I4FA 2O6CA 2QSQA 1QSEE 3W39A 2BJMH 1M57B 4DP0X 5MEND 2QV2A 3B56A 3EZJB 3EH4B 5I1JH 4XPTH 2HN7B 2BSSA 2XIIA 1HOCB 2CK0L 3NCJH 4Y2DD 1QI5A 1MZZA 4AKPA 3SQOL 1QO3A 4UTAH 3I2CH 3IM1A 3VXPA 3IE4A 5FO8A 3APDA 2UUDK 2UYLA 5A2KH 2FH8A 2EUWA 5D4JA 1A7RL 2YSSA 4KDWA 4A7QA 1HN1A 3V6OA 4RMBA 1NM4A 2WLZA 2YD7A 1T2JA 3V6BR 1J9TA 2CBTA 1QW9A 1HQRB 1GC1C 1NGXA 5C07A 3U30C 2ZX8A 3GIVA 1OCZB 3KPMB 1FLRH 4P4KB 4JFOB 1QWUA 4UZUA 2B3IA 3SGKA 2VWEE 3KPLA 4JDVA 3QNYB 1NPUA 1REIA 3RIAF 4PLJC 2XZAL 5EBLA 1NDMB 2JJSA 4EIBA 2K7PA 3GBDA 4DETA 2AJZA 3IDNA 4PP2B 2MTAA 2XA3A 5FXCH 4OSUL 1F45A 1GGUA 4IRSB 3VTTA 4AVKA 4MCZB 3HR6A 3WEAA 3SD5A 5BVPH 5BRPA 1F97A 1UXWB 2AITA 4N6RB 3ATFA 4F2MB 4AIXA 1QUPA 2KLSA 1Y0LB 3FB5B 1GHFH 4WO4A 4K4KA 3VG0H 2A9MH 1G4MA 1ORSB 2H4EA 2FR4A 4XCEA 5DD6A 4BA8A 4IDJL 2FLRT 1R3HB 5DSCA 4MVBC 4S1SH 5IK3A 3FT9A 4NUQA 1G87A 3CSFA 3RWFB 3ULVL 1UZ8A 5DRWB 2P43B 1MXDA 3W81A 2YS4A 1L7TL 5LHDA 3H9YA 5KOMC 2W0PA 1IEBB 4J3UA 2NPLX 3Q5TA 4IRSA 3QEQE 5DZNA 2XWTB 2EDOA 4Q2ZA 2OL3A 5EMYA 2J2ZB 4JFVA 4KDVA 4YBLB 1A22B 2DEWX 2HX9A 3SOTA 4Z18A 4I4WA 4TNFA 2XX0A 1NOLA 1KGIA 1G0DA 4C83A 3L3OA 3MN8A 3HAEA 3IJYA 3LPGA 3ZO0A 2OL3L 4NO3B 4BKLB 3SE4C 4EOWL 2J6EH 1X5JA 1MIMH 2B9BA 3RILA 3HZ3A 4PRIB 1MFAL 3IJHB 2X4PB 1SXAA 4G8FA 4JG9A 1FBIH 3SGDH 2V3DA 4X7FC 3WY3A 1JJUA 3GKZA 3W11C 1CXHA 1O7SA 4H26A 1KV3A 1CGYA 5BS0B 4FZ8L 2X4QB 4KXBA 4BHUI 2HFGL 5HI5C 2BSSB 2Y7QA 1NGQL 2YMXL 1QR1A 5L4MA 1ZHKA 3GSOA 5FYLL 1MLBB 3RB7A 1GHFL 3JV0A 3NH7L 5KVMC 3N04A 1QHPA 2BW4A 2GQHA 5AKVA 1MCQA 3RWHB 4HC1A 3Q2NA 4EQ2A 3MRNA 2F74A 4ANKA 1WBXB 3QJOA 4AJWA 4D0BA 2CNYA 5LCVL 1SXNA 2ITEA 4YE4H 3N5AA 3WFEH 5DJZA 3BD4A 1CWVA 1ZVYA 4TXVB 1JZ4A 4HX1B 3UIYA 5C09D 5GZNC 1R3IL 3ZE1E 4WU7A 1TR7A 1WFIA 1TCMA 5IBUB 5AAMA 4BQBA 3ASNB 5LNEA 3HE6D 1E42A 2BY3A 3V0FA 5TTRA 1P5VB 3C6EA 1YPZB 1SVBA 4MVBD 4JM2B 2IALB 3F6JA 4GS7C 1RL1A 2IPKA 2ZYHA 4H25B 1MRFL 2VDRB 4WV1A 1FNGB 4G6FB 4ABQA 1JZ8A 1ZVSA 3QQ9D 2WUCL 3GMNA 1X7QB 4N8PA 3VCLB 2A74A 5DHDA 3QFGA 5D2NE 3BKJH 3V6ZB 1GW6A 1U3HB 5CEZD 2FE0A 2FX7H 3BPLC 1S7UA 3L4YA 1M2VA 1MW2A 3RNKB 4HWZB 4N2KA 4MJ6A 2EDFA 3BVDB 1PSKL 3DYMA 3L8QA 3PWNA 3R19A 4FJZA 1DSFH 2YPKA 3QC6X 1J86A 5F7DB 4BEIA 1YUHA 1OP9A 4UV4L 3TT1L 5KW9H 2QKIB 3NH7H 3OKMA 3SDCC 5FWQA 43C9A 4ZFGL 1XGTB 2FHBA 1BMWA 1AR1D 2FWUA 1B4RA 4P5RA 3KPQB 5AB1A 4Q4IA 1D5RA 1S9VA 1SEQH 2YAQA 2PETA 4G8GB 2BPBA 4Y4KB 2W60B 4GXVH 3QZWB 4QOKB 5CGMA 5DQJB 3QEGL 5IMLA 1E7VA 1G9NC 3RL2A 3GSNH 3D0VB 2WXOA 1TQUA 3EBHA 4N90D 4LNVA 2RACA 1XZ0B 3NQKA 2UXVA 4JQVC 4HG4K 3LNFA 2GSIB 2BM3A 3TH4T 4AV0A 4UTBH 2JI2A 3T0EC 1TG8A 3MRQA 4M6ML 4IW4C 4P3DA 4PM1A 2NY0B 2AV1A 4Q8BA 2YAMA 5CHNA 2D3NA 4JJ5A 2VLJB 1WC7B 1W91A 2XTJB 4Y5XB 3VFGL 1KFAH 2HVBA 3DUUA 3VXNA 5JHLL 1RY7B 1U2CA 1GH7A 2IQ9L 3EYQC 2ARJB 3A47A 1NFDA 1FN4B 2D03L 3ZKQD 1LHZA 1LYQA 4OCNC 1QKZH 1BQUA 1CZ8L 1AIZA 4NRYB 4U2ZA 4UNUA 5FA3A 2OMXB 2TRHA 4PS3A 3VH8G 3T2NH 3NSCA 3GSVB 4MTMA 1LO4H 5CUSH 3WFEL 5F96H 1LTXA 3S4SA 4OLZH 1HINH 1JFHA 2P44B 3BQUA 4EN3A 1TO5A 2FT6A 2WXGA 3ZGIA 1HL9A 3PABB 4CW1A 2IF7A 2KDGA 4KHTH 2DRUA 2J4WL 4OBRA 4R2GB 4NQEB 1KXVA 3HZYA 5B4MD 1I9JH 1HXYA 3VXUA 4FXKB 1BOGA 3S5LB 5FYJE 4X6CB 1NFDE 3GS7A 3UTSA 1JPTH 4ZPTA 4A67A 1CN4A 4MS8D 3CCHA 4HXBH 1KYOJ 4ODSL 2LVEA 1DQDH 1JAEA 1YEDA 2QR0B 1S9YA 3LQZB 4YX2H 2GEEA 4LKXB 3FB8B 1Q0EA 4QIRA 4X5XA 3QJTB 4X98A 2V37A 1H5BA 4U4BA 1AHWC 3OSKA 1FFPB 4QRTA 1FPTL 3HHSB 3DWTA 1HCFX 1F6AA 1DQLL 4Z3FA 4K7FA 4GKZA 5F7BA 4JKWA 4Y4HD 2I5YH 3QUXB 1ZOXA 2D3JA 1IO4C 3AY2A 4JFZH 3BZEB 2RQ8A 2MIZA 1PDKA 3SGJA 2HG5B 4DGYL 1V27A 2HTLC 4AE0A 1QFUH 1EEYB 1FYTD 4HSAC 4PJ7A 5AVWB 2YXFA 4B3EA 4LCCB 2WXIA 3P3SA 4TQHA 4JM4H 4CSZA 2ZONA 2N59A 2AQRA 2B4CL 3QZOA 4B6ZA 3LXAA 3KM2A 1JYNA 3D39A 1ID2A 3ZJAA 1AAJA 4NPYA 4UBDC 4IBUA 1ZA3B 4JM0A 4WZ9A 5KSAB 2JFCA 3PFQA 1HIMH 3RVTC 1C16A 4UZSA 4CADB 4L2YA 4BCZA 3PJSB 4X42A 3W9EB 3GK8H 4P2QB 4XPAL 3FT2B 3VFOA 3W1ZA 3WNPA 4NUJA 4KNUA 3ZQWA 4DN3L 2WANA 4U3SB 2VIRB 2X4RA 1MCDA 3F7RA 3U0WL 3V0JA 2ENSA 2NY6D 2Z0UA 4XVSH 3IFOB 1AP2B 4Q9BA 1TJIH 3K3QA 2ICEA 4ZXBC 3CHXA 1ED3A 3GSWA 4M3JA 4XNUH 1NMBL 2J8HA 2W38A 1MVYA 1RUML 1PPIA 3QI9B 4Z7NE 1KJ2A 3V4PH 4DKEL 3IDGB 4KMTL 4RQQA 3FOLA 3H9SE 5AAWA 1EFXD 4GAYA 1BXXA 1D7CA 1FC1A 3OMNB 4S0SD 1UOKA 2OXHA 1CQKA 1DJHA 5LN4A 5IKCA 1EZUA 2Y36H 3AQXA 5F88A 4G9FB 4PP1C 4I77L 3SQRA 4EF3A 2AJVH 5F7KC 2R1WB 6FABL 3GI9L 1UM4L 4N9GA 4LKCA 4WW2C 4CBPA 2A73B 4XBPB 5D7LA 5IHBA 1DVFA 4MB1A 2WAQA 3OBAA 1I7RA 2CKN