2GBTA

C6a/c111a cuzn superoxide dismutase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
152
Chain Sequence
b'TKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2gbtA00
5KBMA 4A7GA 2WYTA 2GBUA 1SXAA 2JLPA 2WKOF 1TO5A 1PU0A 3KH4A 2E47A 3QQDB 2AQTA 1QUPA 1E9QA 1P1VA 1UXMA 1E9OA 1MFMA 1E9QB 2E46A 2WZ6A 2AF2A 4A7VA 3MNDA 1IBDA 4BCYA 2WZ0A 1HL5A 1JCVA 1OEZW 2C9VA 2LU5A 1F1AA 3KBEA 3KBFA 3PU7A 4OH2A 2WWOA 2C9SA 3F7KA 2ZKYA 4A7QA 1SXSA 4N3TA 2WYZA 1U3NA 3GQFA 1E9PA 2Q2LA 2Z7WA 1RK7A 1DO5A 2AQQA 2ZKXA 3GZOA 1HL4A 1N18A 2AQPA 3ECWA 3QQDA 2ZOWA 4MCMA 1TO4A 1ESOA 1S4IA 1F1GA 1PTZA 1F18A 2GBVA 2GBTA 1OALA 2Z7YA 4U4IA 1YSOA 1COBA 2VR6A 1SPDA 1IB5A 3KH3A 1F1DA 1OAJA 1OZUA 1CBJA 1XTLA 2V0AA 3F7LA 2NNXA 1AZVA 2SODB 4BD4A 1EJ8A 3LTVA 4A7TA 3GTTA 3S0PA 4A7GF 2C9UA 1BZOA 1UXLA 1Z9PA 3HOGA 4L05A 1BA9A 4N3UA 4BCZA 4A7UA 2AQRA 1SDAB 1XTMA 3GZQA 3H2QA 4A7SA 3SODB 3ECVA 2XJLA 1PZSA 3H2PA 1IBBA 3L9EA 1IBFA 3CQPA 1SXBA 1YAIA 1Z9NA 3CE1A 1DSWA 1EQWA 1SDYA 2WZ5A 1YAZA 3MKGA 1CB4A 1KMGA 3ECUA 3K91A 4B3EA 2AEOA 2JCWA 2AQSA 1B4LA 2Z7UA 3T5WA 3CQQA 1SRDA 1JK9A 2WKOA 1N19A 1IBHA 1JK9B 2R27A 3L9YA 2VR7A 1E9OB 2AQNA 1SXCA 2K4WA 3HW7A 2ZKWA 3GTVA 2VR8A 3KM2A 3HFFA 4MCNA 5CU9A 1SXZA 5KBLA 3GZPA 2XJKA 5KBKA 4OJAA 1B4TA 2APSA 1XSOA 2Z7ZA 1Q0EA 1E9PB 1L3NA 1OZTG 3RE0A 1SOSA 1FUNA 2WWNA 3KM1A 1SXNA 4FF9A
chains in the Genus database with same CATH superfamily
3KPLB 4MNHA 1XQ4A 3HZYB 4QXTB 4OIIL 2O5ZH 3LKSA 3ZZLA 4F3FA 1A4KA 5J1TC 4MJ4A 2X70A 3QYCA 1UB6A 2PTVA 4B96A 1II4E 5KSAC 3DVGA 1FIGH 4P46D 2GSIA 5DO2C 4JDVA 5ABDE 2PO6C 3T09A 1YPZE 2R4RH 3GSWA 1T1WB 4TRPL 1ZPLA 4IW4C 2LU5A 2VLJA 2KZ1B 1QATA 4UV7H 5HDWA 1VJSA 3O8XB 5E6IA 2PCPB 4MZ2A 1RZJC 3FC8A 1AGFB 3NCXA 3WEOA 3LH2L 2A5UA 1FI8C 2QFRA 4UYQA 3VI4F 1UYWH 3NIFF 3ZE1E 3MRHB 3O3BA 4LFHG 2WLZA 4NN5C 1CMOA 3GINA 3IMTA 4XOCA 1HI6B 5C0RH 1G1KA 4R7LA 4J3BA 5T8IA 2LAAA 5EO9B 3OF6D 2ICWJ 3SDDC 4ZAKC 1E5AA 4FA8A 4KV5E 3KWUA 4WFFD 4GG6F 2HVJB 3D39E 1X5GA 3LZFL 1NMCC 5LNEA 4PJ7B 4N0CC 2UZIL 2EDXA 2EYTB 2G2PA 2HTKD 2F5BH 3O9WC 5EBWB 4Z76B 1P69B 4JRYB 5E7BA 2GJ6B 4KMTL 1X6NA 4NRZB 4GW1A 5D1QD 1QTYT 1PZSA 1EPFA 4AMKH 5A40E 2XYBA 2NTFB 5FM8A 1I4FA 4BH8B 5ETUB 2R2BB 5D7KE 3BDYH 2OMZB 3HB3D 1IEBA 3RTLA 1MHHA 4KVCL 1ZHNB 1JZFA 2VSDA 2X2UA 1SN5A 1R9FA 4Q9RL 2MEJB 5ANME 4E9LA 4DKDC 3FL7A 4TQEH 2NW3A 1UGKA 4GQZA 4XRCA 3BSZL 4F1ZA 3KLAB 4HAKA 5HGGS 2ZXGA 3FUFA 4LAQL 2J88H 3B9EA 1OP3H 1I8LC 4AYMC 3OLEA 5ICZA 2H6PB 2XG4B 1XF5B 2ZP9A 4J3OF 5K5YA 2QSQA 4UTCA 5CD3A 4FQLH 2Y2YA 5E5LA 1F11B 1AAJA 2ZNWA 3P4MA 4MDIA 1AKJA 3VDBA 1S8DB 3C9NA 4X5PA 4KY1L 2FT7A 2ZCKL 3QORD 5E2WL 1U3YA 4W9EC 4YIQA 4LEEA 4I0CC 4JFEA 1W0VA 4B95C 3BVNB 5FA4B 3SD2A 2IV9A 3TFBA 1A6PA 1VGKB 5BZDA 4U1HB 4DPRA 2UUDK 3QH3A 3BFWA 3T08A 4N8VA 5IGXH 5IJVA 1U58B 3FQXA 5E24E 4OZ4A 3QDMB 3V9FA 3SE3C 1G7MB 4N5ED 2GG1A 2IOMA 2J55A 4I48B 4EXKA 4ZNCD 1GAFL 1O6SB 5C6TH 1VIWA 1TG8A 4CU8A 3ZHDA 5AAPA 1G9NC 4KWUA 4KVPA 1X5AA 3FFOA 1G9MH 3KBEA 5D4IA 1N6QL 4L9LB 1JFQH 2EH7L 1MAMH 3VQLA 4ZS7L 1LEIB 1FZOB 1GOFA 4TPRL 2J7LA 5J6HA 4UQ9A 3RLSA 1ZXQA 2VH5L 2NY6B 3VNZA 2WUCH 1U8JB 1GH7A 1TJXA 3KWTA 4S0TD 1G9EA 4L4VE 1IFRA 2A9MH 3TO2B 3FTUA 3UG4A 5EZJA 4ZXBA 2FR4A 2EIKB 4PV8A 1U3JA 1BEYH 5D7HA 1K6QL 3U7WL 3WJJC 1L7TL 2ICWI 2FSDA 4ZJ9A 5ABAA 2FGWL 1TJGH 1I1RA 2E9IA 2FSEB 5GRUL 1AXTL 4PLJC 4HS3A 2DQ6A 2ADGB 3W39A 2ZSWA 1G0YR 3L4ZA 3FH8A 2R69H 3CDGA 4NRYA 1F1DA 5DJAA 2CKBB 4MJIE 5JHDD 2P52A 1JF5A 1PZ5B 4L3AA 2Y36H 3VWKC 5L7XH 1DQDH 3MA9H 2XFXA 4U1KB 5CEXA 2V7HB 4PJDE 3JV0A 4ABUA 3LEVL 4MB4A 5CCJA 4ZUVA 3ZKMC 3B9KB 3VI3F 2QKIA 1MCPL 5F8RC 2GY7B 4PGDA 2YMOA 1SHWA 3KNBB 4NAJA 1YC7A 3MTRA 1ADQH 5AB2A 4RWYH 4L0YA 3ZGIA 4PJGB 3IFNH 3MACH 4UTAA 4DVBA 1A6ZA 4QRPA 3QNZB 1YAZA 2CLVB 4YFEA 5EBGA 1IGFH 4FNQA 5D1ZC 1SZNA 1EXGA 2W1NA 2Y72A 3VFOB 1K5NB 3VMNA 3PWPB 4OD2A 4UQ2B 1D6VH 3IDYB 3OLIA 1R0AL 3O0LA 1T0NA 3BWAB 4Y8DC 5CP3H 1QABA 1WVZA 4WFED 4XP1H 5J1AA 4LSQH 2QQNL 1TZHB 3F8UB 3HN3A 1NCBL 2MTAA 1KJVA 4FNTA 1IM9B 5EUOA 4M5ZH 4M8VA 4MMYA 2AAVA 3V95A 1F3RB 5KANI 2YBRB 3KGUA 3CK0L 1UWGH 4ZUSB 5C70A 4DZ8A 2CA3A 4JFXB 3WKQA 3QXUA 3QJQB 2HH0H 4JZOA 2WQUA 1IGCH 3DX4A 5CJ5A 4CDHA 3FPYA 1FPTL 3NRPA 2AITA 2HX7A 4L1SA 3L9RA 2DLGA 3SE8L 5CIPA 4ZD3L 1KNOA 2YWZA 4BSWB 4NQDB 2ZXAA 3K0WA 4MVBD 3QFJE 1BJ1H 4LRIA 5AKRA 4R8WH 3E80A 4IKIA 4ZW6A 3PS6A 1JCVA 8FABB 2HG5A 4OZFH 4U1IB 3PU7A 3M07A 2LFEA 3MLZL 4HQQH 4UBDC 3CGTA 4WHTB 5HGDA 1P5VA 4DP9X 3RWCA 2AK4A 3GI8L 2EO7A 4RDQF 1EEYA 1U0QA 2XBZA 1G9MC 1M3JA 2CLZA 5D7LE 1KT2B 4ZFZA 3MR9A 5EU7E 2BZ7A 1IGTB 4X7EC 2AQ1A 4EZKA 4NQCB 5EN3A 3MV9D 3EBHA 4DUVA 1MCOL 4XXCA 3FHQA 2NLJA 4Y5YB 3MJ7A 1D2PA 3HC4H 3PDDA 4LPTA 3RAJH 1GHFL 4YPGA 4HH8A 4AIZB 4XP5H 2G3NA 1AJ7L 3O4LB 3GJFB 4XNQB 4G5ZH 3CQFA 1AZVA 1OCOB 5H35A 5E2TH 3U2SB 3OMZA 5BV7C 3JQOB 4Q52A 3OGOE 3SQRA 3DO4A 3PXHA 4ALAH 1DBKH 5E70A 3VRJA 5JR1H 3I3DA 4OZHA 1NL0H 1D5BA 3UTSA 3P11H 3WDIA 1OIOA 1V5JA 2IAAC 3B6SB 4QO1B 1UKSA 1PJ9A 5D1ZD 5F7AA 3E6FA 1G7QA 3CTTA 5DJ0B 4F24A 3PQYA 4OD3H 1EAOA 2R0KH 4WWKA 3TH3T 1NGWA 3G08B 2VQTA 5E95B 1OHQA 5D2LF 3K72A 2Z35B 2VM9A 4U49A 1HSAB 2VN5A 3QUGA 1RU9H 1EH9A 3T0VA 5IHBA 1AR2A 3UBXI 7TAAA 1CLOL 5GS1C 4YJZL 2OW6A 1MUJB 2ZZUT 3H56A 3KG5A 3C5ZB 3CN3A 3U0WH 5E6YA 4HPOL 3P30H 4EZJA 5LNDA 3QWRD 1B0GA 4KK5D 3RIAF 2BXYA 3QZWB 2CA4A 1DBJL 1AHWA 1A1OB 3QNYA 1SY6H 1KN2L 1QW9A 4MCZB 3AB0B 1IL1A 3ECBB 2ZKWA 1U3HB 5KZCD 1LP9A 4FMVA 4XODA 3WJLA 4Y8AA 3D6GA 3EOAB 2BX5A 4KK9D 1KXTA 1N5AB 4IOFD 3PNWA 1FV1A 2F54B 4P2QD 1XGRB 3FYIB 5J57B 1NEZG 1AQKL 4KFMA 2D7QA 4UBDD 4AV5A 4EI5D 1BFOA 1L6ZA 3DV6A 5EZIL 1RSFA 4N22A 2D2CC 2CMRL 5E08H 1AIFA 4PN6A 1MRFL 3FOMA 3FH5A 3KL0A 4LQFL 4PJBB 1P2CA 4HT1L 4U1SA 1NZRA 1TXKA 5DA0B 3QG6A 3FRUA 4ZUWA 3ERXA 4FQQA 1J8KA 5E8DL 4GW5B 1OSYA 2C9SA 5A2BA 4JZJC 4L5FE 2MCPH 3L2LA 3CN2A 1QSFE 4OFPA 2YUWA 4NZRH 2Q9OA 4GRMB 5FIEA 2F5AH 2GW5A 1BIIA 3BZEA 3AAZA 1NCCH 1CF8L 1XGQB 3SDAA 3SKJL 4UDTB 5D1QA 3QWOB 4YDNA 4CADB 2J56A 4XNDA 3TJHD 4F57L 4TVPH 1JE6A 5D55A 4EIBA 3UEZA 4AL8H 5BS0E 2VN3A 3ZYZA 4P59H 2Z9TA 3KHOA 2CNZA 1KCUL 4IBYA 3HMWH 2C7FA 2YQBA 2GI7A 3V0HA 2P7TB 1Q9LA 1Y0LB 3KXFB 3WNOA 1CLZL 3MUZ1 4Z3EA 5B3JF 2A77H 4LP8A 4IBWA 3FTZA 4H44C 3RWEA 5DLML 5DUBB 3CX5J 3DETC 1S5HB 5HHPA 1FHNA 4XMLH 1R46A 2DN7A 2OMVA 2Y6TE 4HIIA 5IF0B 3CN4A 1T3FA 4B6ZA 1H3PL 2YN5A 3A4DA 4PWJA 4BUHA 4E2OA 5KANG 3EF7A 4ALAC 4YDIH 5KVEH 3CQPA 1KTDA 3HMXL 3Q6GH 4IYKA 5E1AA 1RUAL 3NCFB 4PRHB 5C3IA 5IOPB 3BOVA 5J56B 2XIDA 3CZSA 3MJ9L 1Q9WA 5KSAA 1WSST 5KW9L 3TP4A 4XZUB 1BBJA 4FQCL 3WUWA 3NSXA 4FYQA 4XBEL 3CD4A 3N85L 3M86A 5C0GB 2LLGA 4PBVC 2J5LB 4S10A 5BO0D 2AJSH 4FZEH 4ONHB 2EXYD 3O6LH 2IALB 3GXFA 3C60D 4K2UH 1Y6MR 4NQUA 2PNDA 5L8JB 1YEWA 5HHXL 2YXMA 2AI0L 3P2TA 1UTDA 3O2WL 5HGBB 5C9JA 2AEQH 4AQ1C 1WAAA 2ZOOA 3MRRA 2N7SA 3KS0H 5CLYA 3ARPA 4QY8B 3RWDA 3BP4A 1LHZA 1NOAA 3P1VA 4ACPA 5C0CA 5I24A 2P9RA 4IHOB 4H25B 4XBPA 5DHYA 5DQ9B 3SDDA 3BVDB 4GXUM 1GOGA 4LPXA 4ZAKA 1SEBB 3O6ML 1S3KL 4ZTOL 3D39D 5JDSB 3FO1A 3S35X 2C4XA 3KH4A 4DT2A 3QUHA 4J7RA 3ZX1A 4UTBA 4IJTA 1HJBC 4RMRA 5EBLA 3RA7H 1ORQA 1QBLL 5DURB 5TQ0H 5ACLA 4N2LA 4HGWB 4NHCH 4WI9A 4ZFOB 1MH5A 2KKQA 4PRDA 3QUXB 4R97C 3HRZB 4D0CA 1KYFA 2CIKA 2KLSA 2N7AA 3GK8H 1EJOH 2OSYA 1PKQA 1S9WB 2NXYC 5GRJH 2J1XA 2BVPB 2HFEA 2WN2A 4WHCA 4OR1A 4W70A 3T4AA 3BVXA 5D7KD 3P0YL 1Q0YH 4ODVH 3L3JA 2NY4C 3DJSA 4BFOA 4A6YA 1HAWA 4M7LL 4JFDB 3UCQA 4B9FA 1JSYA 1VFBA 4HEME 1L9NA 1Z32X 3X12B 1D6EA 3VG0H 1E3XA 1NMAL 2E4TA 3WTSA 3LHPL 2YD4A 1XZ0A 1X5HA 5DDHA 1UUNA 3ALPA 5CSZA 1JZGA 2GTZB 3UBXG 3P4OB 4LCCB 4X0KB 5EEYA 5B1CA 5TDPB 2BSDA 5I8OH 4LHUD 3MROB 4M93B 4UU9A 4NUGL 4XAWL 5FYKU 5SWQA 3LN9A 1M53A 3KLQA 5I1AB 1E40A 2Y2WA 4PGZA 5JQIB 1SM3L 1J05B 3BJLA 4K71C 2VIRA 4FJ6A 1MIEH 4NIKB 3VXTA 2DQIL 3NN8B 4GAAA 5I2IA 2V6HA 4JFZL 1Q72H 3K6DA 2GSGA 2ROXA 3RU8L 2CCWA 1QRNE 4DGUA 4JL2A 4DGIH 2UY7B 4G6JH 4XCEA 4P2OC 4DP0X 2TRHA 3SE3A 2IH8A 3Q3GA 3OMIB 2FB4H 1AD0A 3WHXB 2FHBA 2VDKH 4X5WB 1F3JB 4MD5B 1FNEA 4J3OC 3T77A 4BH7A 2WUBL 1I9IL 2J3SA 5GGTL 3BUYA 2E7LC 4L8CA 4ONFL 1TTRA 4G6FD 5DD5L 3D7PA 4W6XB 4TNFA 4JFFA 5F7BA 4R2GB 1B4JL 2VYRE 4XMKH 4YR6A 4FNRA 3SDXA 2Z65C 3HS0B 3ECQA 3DV4B 3V5KA 2VDRB 3IGLA 3HZVA 4Z7WB 5HY9A 3ARDD 4OZIB 2F19L 1IC4H 2BP5M 1CGYA 3WY2A 2DY2A 3IFPB 1FGNL 3NJXA 2XHNA 4IIQC 4AIEA 4L4VD 2B2XH 3I85A 4X4KA 4X6EB 5LJYH 4RMBA 3AG2B 3ZY7A 3V4LA 5DS1A 4PJ7F 4WK4B 4GBXC 2B0SL 2CGRH 2UZYB 1E90A 1OZTG 3ZE2E 3ISWA 3B5GA 4HWBA 3WJJA 1KULA 3HKFA 5A6LA 1XCQA 4PJFB 5GISH 1BOGA 4O4YL 5KVDH 5CEZH 3WFCH 3M7FB 1X5KA 1FN4A 4MJID 1FVDA 3Q43A 2VR5A 3FN9A 3Q1EA 5FYJL 1UT1A 1B6DA 5J12C 1E5YA 1JHLL 3EDKA 4MYWB 3VACA 2H26A 1IBDA 2R7EB 5CKAA 4JB9H 2ZXEB 4YQXH 2APTA 4MA8H 4YBLC 4ELMB 1OSZB 2X87A 2JH2A 3KBFA 3B3IA 3BISA 3HHRB 2VXUH 2X4RB 3RDTC 3HS8A 3AGWA 3V0DA 3I6GA 3AGVA 4JDEA 1BDYA 5EDXA 2GHWB 2ZUVA 3T1FB 4OLXH 1PBYA 4Y1TA 2XZCL 1TITA 3MLYH 4X80H 3PHQA 2OMTB 3FQRB 4XPGH 3DHUA 1YYCA 1DE4B 4H8PA 3T2NH 5D1ZA 3FMGL 4P5RA 4WJG3 2NYYC 3DROA 4TNWF 1QWUA 2OCCB 5FUCE 4F7PB 5AW5B 2DQCH 3ZZ1A 1BFTA 2FJFB 3HFMH 5MEOB 3CCHB 4I2XB 1EVUA 4X6CE 1N59A 3QXVA 3BE1L 3HG1B 2P8PA 1MHPH 1XSIA 4CVXA 1SF3A 3BFOA 1DANU 1T89C 3TPUB 4A7TA 2DLFL 2X0WA 4Y4HB 3RJQB 2N0MA 2NY7H 2X4QB 3AABA 4HCIA 4L05A 1HU8A 2QL1A 4A7UA 4RX4A 3GSRB 3OKYA 2TSBA 2V2TA 5JIHA 1XTMA 5C8JA 3D8MA 5H37G 3ARBC 3RGBA 4UILH 2FD6H 2G0KA 3GS4A 3R1GH 3ZT6A 4EN3D 1MFBL 1QO3B 3QWNA 3MRFB 4C56B 2OI9B 2OMUB 3AMKA 4GRLD 3SO3C 2NUTA 3QFJD 4HCRA 4M9PA 3MKGA 3S3SA 4R0LC 5HI4D 1Q9KA 1KFGA 1WHOA 2IGLA 4KRNA 5D72H 4OCXH 5AG8A 4JO1H 1J10A 1PX3A 2I07A 1OB1B 4XMUA 5IFAL 1BZ7B 5B4MC 4M02A 1HIMH 3CFEB 4EI5A 1HKLL 2HJLA 2ZYHA 1T22B 4PR5A 3E8UH 3CBKB 5AUMB 5D7LD 3MX0B 4PJ8C 3J07A 1C5BL 5KJRL 2EDYA 1CU4H 1BM3H 2XKNA 4J3TA 3SIKA 5DK0A 4UAOB 2BOCB 5KBKA 1AG0A 5I82A 1AQDA 2VDQH 3HNVL 4NM8H 3FU9A 3EBGA 3WFHB 2ITDB 1CFQA 4QLRA 4PGJA 4N2BA 5DT1H 4F2MB 2G5UA 2Z92A 4IRZA 5ABZA 1SXAA 1QBMH 2K1MA 1FL3B 3BRFA 2O4EA 2FYYA 2W07B 1KYUA 3V5HB 5LXGL 4D8PB 3NEXA 5AG9A 5C7XH 2AANA 3MFFA 2D4DA 2J8UB 4X4XB 4QYOB 3B1TA 1B2WH 1D5MA 1A6UH 2IADA 3ARTA 3QEQD 4HSCX 4PJGF 3D50A 4NBYB 4WI6A 5INDA 3IAPA 2O61A 4RGNB 2VUKA 4XGZB 4Y16B 5ESQA 3SKMB 4ZFGL 3QDJD 2R29L 3DK0A 2CPCA 4G8EB 5C09A 4LPVA 1OB0A 4NP4H 1BVNP 3FUMA 4LGPB 4FYRA 1U6AH 5JHBA 4C54A 1NUNB 3Q48A 3NPSC 2YPKA 3SGDH 5KS9E 4L37A 5GGRY 1X5XA 3RIFF 3ME0A 5K9OB 5GS1A 4LGRB 3NGBB 3VXNA 5I17A 2K9FB 1N0LA 2YEZA 4HIQA 3VFWB 4CNIB 5CJBA 2VDOH 5DUMH 3P0VH 4TTGA 5SWZD 1VGEH 3O2DH 1WBYB 3MBWB 4HOXA 3VNYA 1MCCA 1NDGA 1RP9A 1MJJB 3PXJA 4M1GH 2ZCLH 3L3GB 2VITB 4ODBD 5AOMA 5I5MA 2XDHA 3AREB 5LCVA 4ZBJA 1RULH 4KX9A 4UCFA 1L6XA 3BHBB 2QSCH 2AGJH 4JKLA 3QYMA 1YEDB 1CLYH 1DJGA 1CBVH 3LXBA 1XR8B 3C60A 1XR9B 2DS4A 4P23D 4Z0BL 3NYKA 5T3XE 5KN5B 3S88H 3I9AA 3HS9A 5DGQA 5CJQL 2HRGA 2W65A 4LLAA 5JO5B 4UQ3B 3ABGA 3LIZH 1AGCA 4P5KA 3QQNA 3VWJC 2CCLA 2CWRA 2MPAH 4BFKA 4EUPG 2Z8WC 1DVTA 2VXSH 2YXVA 4I85A 1NGPL 1ZRUA 3T0EC 2ZONA 3VXPB 2GFBB 5LQBH 3GMMA 2ZUXA 4C83A 1X5YA 4JFOA 1BQLL 2NMSA 3CH1B 2FH8A 4PRAA 3T4YB 1WT5A 4CL7A 4KJQD 4JZJA 3TA3B 1MDAA 3D2UD 3Q8EA 1RJYB 4PB9L 1QSFD 3ARFD 4ZSOE 4ZQTA 5CKGA 5AENA 2K4WA 1J0ZA 3MV8E 2XXGA 2QSTA 2NY1B 32C2A 1ZEAL 3FRPB 2MWCA 3B3BA 5AVYB 5B1BB 4XMVA 5TDNA 4S1QL 3RL1A 2Z3FA 5EEVA 4HZLA 5BS0D 1ADWA 3EO1A 5MEQB 1AANA 1EMTH 3HBGA 4RAUB 4PJ5E 2Q86A 1MIML 1W0WA 2WCSA 4YLBA 5EA0L 1NAMA 4LVHC 4OCWL 3X3GH 1YECH 1QZ1A 3BAXA 3FB6A 4L8SC 4M3KB 1S7UB 2WXIA 1FO0B 1E9QA 1XGYL 5AW6B 3V0GA 4CJ0A 1WBXA 4LSVL 4TN9A 1INQB 4M56A 3WMPA 4F9PA 3LHAA 1EUTA 1MOEA 1JPTL 2XYCA 3SYOA 5JHMA 4JDZB 1XHHA 4PJAE 3C87A 5FYKE 1FZMA 3FQ2A 4FLOA 4OBRA 4PVNA 4R9HA 1NCTA 2FCBA 1HHHA 2QGEA 4LHUA 3QIUB 1T2JA 3H9HB 1AOHA 1MFNA 4JS7A 3HPJA 5AOLA 2YRPA 3JTTB 5D5ME 2OP4H 1IQDA 1I8MA 2P4AB 3CHSA 4N0UA 5DHMC 1CQYA 4U33A 4P57A 4UOJA 4ETYA 1AGEB 1W72A 1RJZB 3MJWA 2EVIA 4M29A 1LQSR 3H2WA 5GIRA 3GSNL 4LKXA 3U0TB 4DEUA 3FNKA 1INEL 1Z1WA 2WINB 1GGIL 1WFMA 5CSBA 3V6FB 5JHLH 4Z3GA 4GUPB 3PGCA 5IJDC 3LXCA 3MU3A 4LNRB 3DRTB 3ZE0E 4CMHC 4FHJA 3GT6A 4Y9FA 2KQNA 1IKOP 2CM5A 2NUPA 1JXGA 5GSVA 4GO9A 4WKXA 1FRGH 4AQ1A 4X9YA 5HHOE 5DWUL 1ACZA 1EGJH 1A64A 1SY6A 2KBGA 1VEMA 4K3JL 1JN6B 1WWBX 3GMLA 3K5SA 4AC4A 3CFBA 4YHOH 1PZBA 1PLBA 1GTFA 4KVNH 4HUNB 4OY9A 2W91A 4PJBF 5D4HA 3ULVE 3FU3A 1WZLA 4MAYB 3B56A 5D2NB 1YUHA 4OAWA 2VC2B 4MXVE 2O5XH 2MRYA 4L4VA 1EFQA 1J1PH 2GUYA 1YQ2A 3F05A 1E2VA 1FNSH 4Z3IA 4GFTB 3LKQB 4WW1A 3NA9H 3WY4A 5I8CB 2AKRB 3MUJA 3VD9A 4OIFA 2PTTB 3MYJA 2OXHB 3S9DB 3VI4A 1S9VA 3DBXB 4A63A 1P1ZB 2VXTL 3RX9A 4PVBA 4BFJA 5AVWB 2NY3B 2FX9L 1ZTXE 4JY6A 4F8OA 1EO7A 2WCGA 1MW0A 3A21A 3FUNA 3IPBA 4P4KC 1G6RB 1KB5L 1IBZA 3SKOA 2A83A 5E6ZA 3ZOAA 3CFKA 2AV1A 4PJDA 4A2FA 5C07E 3R0MA 2JTDA 2ZUQC 4Y5VC 5C2BH 1OE1A 4B9PA 2VZ3A 1KPVB 1I8IB 1MFDH 4X5XA 2ATPA 2ENQA 4FQIH 3GXTA 1XAKA 1J87A 1EDYA 5DC4B 4NQEB 5HHQA 3PFUA 1TZIA 2BSTA 5DVPA 1J8RA 3KS0J 2ZWSA 3FTSA 4RQQA 2XPYA 1WCBB 5CWSA 1DEEB 1ASOA 4OF5A 3FCSA 5I1LB 1KG0B 5AKSA 2R23A 3ES6B 2B4CL 1CCZA 3L3KB 4NFCA 4RGMC 2CHZA 3THMH 1A1MB 3UDWC 3VFMA 5EEXA 1RH8A 1BVOA 1FP5A 2O1AA 1CL7I 2ENJA 1QRND 3GMRB 4PUBH 3KBHE 1EBPA 3TVMB 5IMKB 3FZUD 1UZ6F 4EMZA 4V11A 5FB8B 4LKCA 3H55A 4P2OA 2A74C 1SJXA 2P48B 2H9GA 3IGUA 1R6VA 2FNWA 1IZKA 3KPRB 4F7CB 5CMAB 2P24A 1P4IL 3STBA 4POYA 2I7OA 2YPVH 4ZNEE 4EN3A 2ZF9A 1QR1B 3LNFA 1LEGB 2WWMC 1P9MC 4FG6C 4GRLA 4PJIE 3MLRH 1YUKB 3X1NA 1BBDH 1ZLSH 3GHBH 5GSRA 3GMQA 3W57A 3CU7A 4D7BA 1DUZB 1U9KA 2B1HL 2XWJB 3BYTA 3HAEB 3J27A 4L8BA 4N2KA 2AJVL 1SJMA 3UG5A 3CHQA 3ULUL 1NIBA 3ELQA 3E1F1 1TENA 1ZLVK 3O8XC 5T1LD 2C3HA 4HGMA 5FHBH 3QRGH 2BVUA 3OXRB 4K5OA 2HRPL 3HC2A 5I6KA 4ZMLA 2X4UA 4MD0A 5D7LA 3NJKA 3EDDA 1OSPL 2G9HB 1VESA 5FO9A 3U4EA 3AACA 1J18A 3LIUA 2X6MA 2COQA 4YHLH 4NX0A 3HZKB 1Q38A 2RBLA 5ICXB 4JRXB 2DJUA 2RB8A 4Z0XB 5GGRA 1ACYL 3EKCA 5EC2B 4QOKE 5DD0L 3KLLA 1LO4H 4GMSL 1KV7A 1XZWA 1E3FA 4Y9GA 4LVOB 2BHFA 3BAJA 2WBWB 5E8OB 4GQ9L 2DWYA 3UC2A 3U36A 2BHYA 1XCXA 4AV0A 2WTRB 4H0HB 4N0FA 3HKZA 3QEQA 1UZ8A 5F1IA 2VUYA 1ES0B 3QEGL 4MQ7A 4NWUL 5IIEA 3T9WA 1RZKH 4HWZA 4K7FA 3OXSB 1VZIA 4XWGL 1RHHA 2OTUB 1A7QL 4PSRA 5JQ6L 2BLFA 4OCRL 3QDJA 5AVTB 5MEOA 2YAMA 4WHYG 3NIGB 3ALXA 1UHVA 1KXVC 4N8CH 4WK0B 1NLDL 3BAEH 3EHBD 5BVJB 4DP2X 1WZ1L 3I50H 5F3BB 7PCYA 2P28B 3FS9A 1QUPA 1A14L 4HAFA 5JXEC 1P1VA 1RL1A 5DQJB 2ZXWB 3MV7E 5ESAB 3UABA 1QA9A 5B7FA 4G42B 5E2UL 5IK3B 5SWZA 1X7QA 1BD2E 4Z78A 1ORSB 3IGAB 2A1WH 3ARBA 1JTTA 4K94C 4AEHH 3S6CA 4BIKA 2H7WA 4R7XA 1SLUA 1E4WH 1IVTA 3SEPA 3SPJA 1EEUA 3VVVA 1WP6A 1QLEB 3ESVF 3H9SB 1KELH 4N1HB 1MWAA 1U92B 1ZHBB 4HG4J 1DBMH 1MFCH 1JNHB 4HC1A 4R0LA 4Z7WF 4OZIF 5I0VA 4HJ0C 2JKJA 3OKNB 4L3EE 3X17A 3GSUA 3HHSB 3F58L 3FJTA 3QHZH 2WXKA 1YSOA 5JUEH 5BZWB 2JK5B 4XN1A 2V37A 1MJ8H 1GIGH 2BNQE 1LGVA 4JPIB 4Z95L 3IMWA 2QVFB 3CAFA 5KYWB 1YEGL 4PJFF 4JCLA 1N0XL 3KPOB 3HN8A 4LOUD 4BKTC 4HUVA 3C5JB 4PJ8A 5JOPD 5KYUB 3P69A 3ZKND 1DR9A 4APXA 4L9LC 1S7TA 3VD5A 5B7EA 3UCRA 4WFHE 3EO0B 4PJ9B 1FFPA 4PWFA 3TBWB 2VL5B 3ARFA 5ERWA 1J88A 3X11B 1LK2B 1ZOXA 2NY6C 1E27A 5IB4A 3TYGH 4ELMF 5JORA 4NJAH 3C8KB 3RFZB 1CN4A 3V4VL 3ML8A 4LDEB 1EV2E 2O5YL 1LQBC 1I3RB 4UNUA 2EKSA 4A2HA 4ODWB 5BQDA 4I3SL 4NPYA 5BS0A 1KC5L 3QPQD 1I8KA 2G30A 3S7GA 1JHKH 2CDGA 1JRHL 4HFWB 1ZMYA 3APCA 4P4RA 5F0PB 5CF3A 4JM2D 1AQ8A 2BK8A 1MCNA 1TETL 4IK6A 4M7JL 1WIPA 3SBPA 2I24N 1ZK5A 5DLLA 5TPWH 3WTXA 3CXFA 5D70L 3K4DA 1JDCA 1KCBA 3B9KC 5JOFA 4D94A 2R1XB 3AZUA 4LPCA 5L88H 1RPQA 1U95A 2DI8A 2DTML 5KTEL 5I6XB 3JUZA 2D7TH 3FCTB 1IX2A 3L1GA 5FEBA 3QEHB 5GRZA 2DZEA 4HK3N 3II3A 3VXSE 3PAVA 3U4BL 4WWPA 2RGSA 4LLMB 5D1XE 3NT0A 4M6OH 4YO0B 5IW3A 2Y7OA 4GW4A 3IDYC 3EFOA 4O2EB 3FU5A 3IS0X 3ZHFA 3TURA 1UOVA 2WMPA 1SXSA 4K4KA 4MDJA 4CJ1A 4XNAA 2B9AA 1MFAH 1UM5H 5T3XD 1HOCB 1YQVL 3AS3A 4N2GA 4OI8A 3X13B 4Q4EA 2MFNA 3BH9B 4Y4FD 4M1DH 2OR9L 2F7IA 4FFZA 4DIXA 2WO4A 1YNTB 1PCSA 2Q8AL 1XMWA 4Z6AT 4ONGH 2G3MA 2BMKA 3T0EA 1XD0A 3TNNA 2F8OA 1AI1H 3GLEA 3UP6A 4NO2B 5BQ7B 4G8FB 1CI3M 1UQSB 5ES4B 1I7TB 1HN1A 4LBAA 3U25A 1PDKA 5TE7H 3MSPA 2HUHA 2X7LA 4NLHA 2H2PD 3INUL 4YSSA 4GUCA 4RMWA 1RZ7L 3MV8D 2RMNA 5IG7A 2EC9T 4XHQA 4QRQB 1ANUA 3VH8B 1KJMB 3OZ9L 1SYVA 4JANB 4JJ5A 1YEEH 5HHNA 1S9XA 4PWEA 1I3VA 3NH7H 4OFYA 3V4PB 1X6LA 3V0VB 3OKKA 3EOYG 4A7SA 1H6UA 1JXKA 1QFUH 4TUOA 2R59A 4OCNC 4I8DA 5IBTL 4PJ5D 3LRMA 4J3SA 2XWTB 2VAAA 3TC9A 4BZ2L 4BE5A 1MNUL 5BJTB 1EXUA 1UVQA 2PCYA 1LNUB 1FVCA 4GKSA 3SBRA 2YWYA 3UZEC 1F4WL 3VFGL 4CRPA 4O2FB 3CPLA 6FABL 5IKCB 3UIZA 5FYKD 1MCEA 4UT9A 1OOAA 1SVCP 2NTSP 2BW4A 1ERNA 3F12A 4TULH 4XN2A 3TX4A 1KBBA 2Z8RA 5ECGA 2VM3A 1F90L 2BSRA 5AB1A 4Y2LA 1W6LA 1IAMA 1FZKA 2XX1A 1FAIL 2P5WA 5AYTA 3CFTA 4MKMA 3MTXA 3BFQG 1PMYA 3OJVC 4X6DB 3AU1B 2BP0B 4UQDA 1NAKL 4B0MB 1MHCA 1ZIBA 1VLXA 1SOSA 1XF4A 2MTPA 4O00A 3K2UH 1QRNA 1WBZB 1XGPA 4FF9A 4TQHA 1SBBA 4GXUN 3T8XB 3TO4B 4ES9A 5ALBH 4R90L 2VISA 2CR3A 2PETA 5JZ7D 1NFIB 1F4YL 2VJ0A 4MNGE 4GI9A 2OMBA 5K1JA 4ZMVA 4I1RA 3AWFA 3W2DH 3MCLH 2XRAL 4K0OA 3WFBH 5D71L 4MS8D 4F7EA 4OJFH 4LVEA 2YD9A 3IT8D 5HHOD 4N1EA 4KPHL 1L0XA 5AKVA 3WKML 4B5EA 3QQ3B 5F7LB 5TF0A 1K4CA 2AW2A 3GWJA 4PJHB 3U7YH 3POCA 3AB0C 3ULVD 1U3HC 1SJHB 2I69A 5TE4L 3BZFB 1JWUA 5E5RB 2DH3A 3DXAE 2P49B 5CEYB 2VLRE 3II1A 3UYRL 3GHEL 2OMXA 4QHUB 2Z93B 3GMNB 1NEZA 2E6JA 4JG0L 4V1DA 3DX2A 3MC0A 2HLFC 3TFKC 2X9YA 1ZDQA 3ZMNA 1G7HA 3GFUA 2ZWNA 5AW2B 3CFJA 4ANWA 5HXMA 4N25A 1QQDB 2ICWA 2E9BA 1DQLH 4HS6B 3L7EA 4U05A 2P3YA 4KJYB 4P4KA 3OQRA 5F9WB 4JY4B 1T0OA 4WIQA 1OANA 2ZXQA 1OGAE 3VFRB 4NO3B 3W9EB 2QHRH 3LKNB 1O7SA 1XXFC 5C07D 2HKFL 3OAZK 1FNHA 5IQNA 4PGBB 5EH1A 4Y5VA 3Q8AA 4W9CC 4LLWA 5AVQB 2F0CA 5GS3A 4DGYH 3HI6H 2XJLA 3FUDA 1TFPA 1LYQA 2PWDA 1IGMH 3U46B 1MELA 3OB8A 3F7YA 2WC7A 4XXWC 2RQEA 3C2AL 3ZGHA 2WQWA 3IXTB 3BH4A 1B88A 4JJHA 1CD9B 1JYVA 4CU7A 1FYTE 2FAUA 4N0YH 1A4JA 2HKHL 4U6HB 3QHFL 4KZEH 2ZOKB 5C9KA 4ELKA 3ASNB 3DARA 4JM4H 5FGBC 2E0PA 3IDJA 2YAEA 1HZHH 3TEYA 5IQ7H 3FOLB 2IMNA 4UUJA 2BNRB 4FGMA 3DLQR 3L4UA 3DVFA 3QXDA 4KTDH 4UWQB 2DMKA 4X6CA 4APQB 2UXVA 4OSUL 5IBLC 1YMMB 3D08A 3EGSA 3KPSB 4FULA 3LOWA 2Y1ZA 4LCVA 2A9NH 4B27A 4M5SA 3ZO0A 4LRNH 4XNXL 2Q8BH 4WI0A 4FFYA 2ZCHH 4JE4B 1IGJA 1OPGL 1CT8B 4BXSV 3CFDA 2X1OA 2A74A 1N64L 4OQTH 2XPGA 2DYSB 4TOYH 3G6DL 1CR9H 1UT9A 3LPPA 1TZAA 2V7NB 2OJ1A 3IJSA 3I6LE 4U6XB 2G2RB 1BQHG 3G5ZA 4P3DB 1U4EA 4B5ZA 3G6JB 1G0DA 1QP1A 2HFGH 3HZMA 1P9MA 3GIZH 4JN2A 2F53E 1AGBA 1FFNA 4QUOA 3ILQD 3ILPB 4PBXA 3T8VA 3L8QA 3HR5A 2YQ2A 2W38A 4LCWE 4DP1X 4HPHA 1JNLH 4IEFA 1BYPA 1NCIA 2PCPA 2X0VA 4L4TD 1AGFA 2CM6A 4IGBB 1QI4A 4EDWL 4TVPE 5CGYD 2XTSA 3IDUA 1NEPA 3MRHA 3H1ZA 4JG1H 2VQ1B 4AKPA 1HSBB 1G0XA 2QHLA 2DQDL 4KAQH 1UCBH 4Q2ZB 3QUML 3WFEL 2CIIB 4L2YA 4PV9A 4S11A 5FYLE 3WLBB 3EO9H 3ROLB 5LGJB 1TJHH 4JQIH 1AGDB 4QOKD 2BCMA 4JFHD 3NCEB 5HD8C 1T2QL 1M6UA 1TJMA 4NIYE 3T3MB 1UB5B 4QGYA 4GT7A 3VQ1C 1OZUA 2DQTL 1PD6A 4PJ7A 4ZW3A 5ILTH 3VUAA 5KVEE 3SQBB 4HV8A 3D85A 2NDGA 4M6NH 2C9UA 4AJVA 5EBWA 4ZMWA 3QUXC 3HRZC 1PZAA 4LLUB 3GEWB 1YEIH 4NRZA 2YPLB 4M61B 4O5LH 4KHXL 4U2ZA 5GGVY 2HLAB 3NFPA 1NC4B 4ICXA 1XIWB 2ICEB 4HIJA 4RBPK 2BZCA 3R18A 4HDIA 4NKMB 2LABA 1H5BB 1EO8L 1KXVA 1A7RL 1N12A 1N7MH 3BJ91 2OMZA 4WO4D 4WI4A 1ZHNA 1UXSB 2WZ5A 5H2BB 1R75A 3RVTC 3MV7D 4ZTPH 5PAZA 5C97A 3KLAA 1VRSA 3SZKC 4OI7A 3UBXA 1RLBA 2XG4A 4LCCC 1BAGA 4UT6A 5HPMB 3MZGB 4M93C 7PAZA 2R8SL 1ETZB 1YDPB 5KJ7E 4ODHL 4Y2DC 4GKLA 4TUKL 2XV0A 2E9JA 4JFYA 1NINA 2DL2A 4FQJH 4RRPM 1XF3A 5FA4A 4OF0A 1I3GL 3SGEI 4J6RH 3V8CA 2NXZB 2VZOA 4HWNA 4L3ED 3GXMA 4Z7UE 2D0FA 2QVIA 3N04A 5KBDA 3C5XA 2D31A 4DW2L 1GCFA 1U58A 4Q8BA 1NDMB 3BSHA 4M4RA 3N2JA 2B3RA 2BNQD 4Y4FA 3U82B 2C1OA 1XFPA 3MODH 3G04B 5A2CA 2QLVB 1O6SA 1R3KB 2BXZA 4MA7L 5DK3A 2DQFB 1YY9D 3I2CH 1KLUA 5CM1A 3H9ZA 3MRQB 2HX9A 2OZ4A 1JUFB 3EH1A 4R2GC 2HRLA 3C75A 3HS0C 5B8CB 1CJYA 2JJWA 4AMWA 4L9LA 1C5DA 3D0LB 4WRLA 3OKLA 4WFHD 5IESH 1FZOA 2GITB 1B4RA 2F74B 4AJ0A 5DZJA 4DPAX 2W81C 1U8JA 1TQSA 3MLXH 2IOOA 3RHWF 3UP1A 1QOKA 1BHGA 3CDYA 2XU9A 1DDHB 1Q90A 3EJYD 4GI6A 4O2CB 2B1AL 1RUKH 3GKWL 3P2BA 2JQZA 4I4WB 4ZYKB 4MLSA 3HG2A 4U1NB 1Q8MA 2ZNXA 4M1CC 1X7SA 2CKBA 3CSPA 4GB9A 3D69B 5FXCH 4AEIL 4G82A 3N9GH 2TSAA 3EYUL 1UWXH 3NIGF 4KKAC 4YAQB 3PAZA 2E9WA 2PXYB 1H0DB 3B9KA 3S5YA 5F6IC 3OG6B 3KDPB 1HXMB 3K6NA 1CDYA 3KNBA 3ORJA 3N06B 5KJ4A 1KBVA 1X5IA 1O75A 2IGFL 3SKUD 4WI2A 5J5EA 4EVNB 2CLVA 3VMOA 2CALA 3LPFA 2NW2B 4RISH 4Z5RB 5D1XD 5KG9A 3VFOA 3FT4B 4EKJA 1A7BA 2BSED 1H8LA 5G2NA 3MUGA 1EHLH 3LRSB 1OWWA 2FATH 3BWAA 4YFDB 5E23A 3D3VB 3WG7B 1TZHA 1MNNA 3ZL4L 2QSVA 1IM9A 1QUNB 5KEZA 1DFBL 2OJEB 2YBRA 4CW1A 4ZUSA 2QFPA 4NZTL 5CBEB 2XFGB 5KVDE 3LB6D 1RUQL 3ZHNA 5H37A 3EXJA 1UKTA 4KQ4H 1G9HA 4ZI8A 3HNTH 2I9TB 2GK0A 1YN7B 2WYHA 1LO2L 4L9DA 1BYOA 3WXWL 2D03L 3FU6A 3C5SB 4YHIB 4R26H 4NQDA 3I02A 2YS4A 1BZ9B 1JS4A 3GXPA 2WD0A 3F7QA 4P9HH 2BJMH 4NCC2 1C5CL 1SHMA 1SBSH 5G4NA 3BD5A 3QPXL 5TDOB 4WHTA 3VH8G 2M8XA 4GP4B 2DM4A 4DUWA 2NY0B 2OFQA 4N3TA 1NCAL 1EO5A 4RFOH 4X98A 1KJ3L 3I9GH 5EU4B 2QGCA 4NUJB 4F8TA 4R4ND 4UAOC 3OKEB 3S96B 3C12A 2VR3A 3IDGB 1ZCRA 1TO4A 5D2LE 3RUGB 1IC1A 2QKSA 2A6KB 3P73B 4FQPA 1FO0H 4KKAD 3UJJL 4OLYH 5CCHE 3UZEA 1UWEH 4KHTL 4BFIB 3D87B 3QI9B 4L1LA 2V9UA 2Y4SA 3GJFA 4XNQA 2YQ3A 3EH3B 2BRRH 3IMUA 3U2SA 4H0LC 2PP9A 5FKAA 1UH4A 2DQEL 1MEXL 1NIFA 2ED6A 4RGNC 3UBFA 3VMPA 4A1RA 2YMTA 1M7DB 4HFUH 1EWHA 1GZQB 1IE4A 4EIUA 5A3ID 3G5WA 1AY1H 3VXRB 3KZ8A 3FUIA 5HYSG 2VDLL 3CXDH 1A3RH 3GRGA 2V3DA 5I18L 5DZVA 4WV1A 1HSAA 4ELDA 5GJTL 2CDFA 3HLAB 3UEQA 3LPWA 3A5VA 1ND0A 3CUPB 3Q1SH 1MUJA 5CCKH 3NGBC 4P5MA 1MW2A 5F1NB 2EEXA 5CXPA 3H3PH 1TVDA 3KPPB 5BOPA 4MNHB 4EI0A 3LKSB 3CVHL 1A4KB 5F9AC 1YNTF 5JXAH 2O5NA 2X70B 1UB6B 2KI6A 4PJIA 5FM4A 3UTQA 3DVGB 2WKOA 4IBQA 3BN9D 3TIDB 2WO3B 4MCZA 4PGCB 3VXUB 1KCRH 1S7QA 1U3HA 2DD8H 2NX5E 2Y7QA 3QXAB 5DXWA 3GSWB 4JM0A 3AREC 2LW3A 2EABA 3KYKL 3O6KL 3DXAD 3HG5A 1KENH 4MXQC 4L18A 4Q14A 2FO4A 3BVVA 3ZIYA 4G8GA 2VLJB 2OBGA 3P3SA 4MJ6A 3T6QC 5E6IB 3BGMA 4IOSD 1XGRA 5ID0B 4HWEL 4L4TA 1JHTA 3BPNB 2O26U 4YBHA 3ZXAC 4TVSa 2WXMA 3RP1A 5E7FA 1FG2A 1HCYA 4HISA 4EUPA 2WBJD 4XZ4A 4E36A 1RAMA 3W38A 1U41A 3IAQA 1T4KA 1S5IH 4I77H 4ZUTB 1OGAD 1YC8A 1M7XA 3LEYL 4KTYA 2OXGA 5B3JE 5FO8A 4IDJL 4QOKA 3FU8A 1B6UA 4MNQB 5HDBE 1G6RH 1OEZW 2EZ0C 4GW5A 5CLXA 3VDCA 4D3CH 3TA3C 1FJ1A 3QB7C 5JYMA 3GEFA 5DZ9A 1A9VA 1V7ML 3ARGD 1HYSD 2FX7L 3SPGA 2GBAA 4LCUB 4GKNB 1GGYA 4GRMA 4XVTH 1TVBA 2J72A 4D8OA 4H13C 1INDH 2B16A 4MXWL 4BYHA 2JLLA 2AJ3B 5FOJA 3IKCA 4YDKL 1FYTD 4UOZA 2F8VA 3N1MC 4AQAA 3EOTH 4OJCA 3GNML 4GW1B 1NMBL 1S6NA 2UYLA 1ZVYA 3OR7A 3QG7L 1S78C 4AT6B 4L0PB 1OT2A 3ZKSD 4NSKA 4TKWA 1HINH 4X6DF 3T6ZA 4OF6A 3LKOB 2P7TA 2J4WL 3KXFA 4AGMA 1IEBB 4XNMB 1MHHB 1M9WA 1MCDA 4JHAL 3BKJH 2GAZA 1TNMA 2NW3B 4XRCB 1S5HA 2H41A 4RMVA 4NP9A 5A2FA 3WO4C 4M43L 3CIAA 2EXWC 5ICZB 3I6LD 5FA3A 5CD3B 1KN4L 3QIUC 3QJOA 1IU1A 4PM1A 4X7SL 3ARZA 1EK3A 3WEXB 3P4MB 5LUMA 3ETBJ 4S1DD 4PRHA 5IOPA 4L1DA 5F88A 3C9NB 3VG9B 4DNLA 4PJHF 1DL7L 5JW3H 4XZUA 4YIQB 2F53D 4JFEB 3WN5B 3RKPA 1W0VB 4DKAA 2ZOLB 1AD9B 4L5FL 1TZGL 5BZDB 2Y1AA 3L4TA 5CU5A 1CFVH 3QH3B 1MFEH 2R0ZH 2XN2A 4ONHA 3HAEH 3KEHA 4LMQE 5IJVB 4LCWD 1OOWA 1ZPUA 4XPFH 1V3MA 3UTPE 2BNQA 2VRQA 1TTCA 3V9CA 6CGTA 1DN2A 1IBHA 5J0BA 1J8HB 5I1KH 4EJ1C 4D0DA 3D09A 3OLGA 4TVPD 2QLYA 2DV6A 2EDDA 2Z8SA 3F00A 1MJUL 4LPYA 5HGBA 2R1WB 3BH8B 3GGWB 4QAMB 1ACXA 1IQWH 1L6PA 4FYTA 2AJUL 2EILB 3INOA 5FYLD 3HVNA 4IK7A 3RX5A 4HMEA 2SEBB 4MAYC 2K7PA 3JVFC 5D2NC 4N2OA 1TYRA 5DQ9A 3VD2A 3AWGA 4TVUA 4Z7OB 5J6HB 4F7KA 3KR3L 1MFUA 1Q4NX 2BHUA 5ISZE 3US0A 1ULVA 4R5VA 3WIHH 5A2LH 1DLFL 5KVGH 2BWIA 3V8OA 3LQAH 3ZN6A 1UZGA 3V52L 3RVWD 4NYLA 2QZQA 5EZJB 4ZXBB 3MOAH 2FR4B 1TR7A 1UXMA 4ONOA 1S46A 3DGGB 4PV8B 4G6MH 1AE6H 1CPUA 2HWZL 2BFVH 3S4SB 4ZFOA 3A47A 2G3XA 3LX9A 1BQ5A 1E67A 3VU2A 4HS3B 1N67A 3HRZA 3W39B 4KRPD 5F97E 2EVGA 1HQRB 5KSVA 4ODSL 3EFDH 3GRWA 3H42H 3IJEA 2NY3C 3CDGB 1EFXD 1FLTX 3APMA 3CVBA 1S78D 1KLGA 2BVPA 1I7ZB 1SN0A 1MZYA 3NQKA 5JLZA 4TSCH 2I5YH 1I31A 2XFXB 4Z7IA 5CEXB 2JJSC 1QHOA 1WDAA 1NGYB 4G9FE 4ZUVB 3MRLA 1T0MB 2QKIB 5EWIL 2G75B 2XN1A 4PGDB 3UAAA 3E3QC 1OAXL 4MA1B 3VDAA 2O6EA 1J5CA 3LVEA 4WUUE 1BV8A 1J5DA 5D7IE 4AEEA 4LCCA 3SKNB 2H0FA 1A6ZB 4QRPB 1MF2H 3H0TA 1NANI 4YXKH 2JB5L 2Y7SA 1NIDA 3G6JF 5I1HL 1KB5B 4QRTB 5F7DA 2HMIC 4Y2DA 1QFHA 4PCKA 3MBEB 1J05A 4QLWA 3GS7A 1IM3D 5EOCL 1T0NB 3EJZC 5DD1H 3VRLF 5J1AB 5LGHL 4LARL 4K7PH 1QLEH 3VTAA 2X9ZA 5HDQH 4YHZL 1E42A 3SDYH 2XQBH 1KJVB 3IU4L 5EUOB 3TVMC 4WJKB 1QNZH 5FYJU 3HE7C 3L9EA 3VCLA 2UY7A 2H1PL 5KOVC 4DZ8B 1KDIA 2QDWA 1MQKL 4JZOB 3WHXA 4TSBH 1DSFH 4MD5A 4KJPC 2GJ6E 5D6DC 1KIUB 4XH2B 4QHNA 5CD5C 3SY6A 2AABH 5CJXC 3T0XA 4OLVL 1CLVA 4FHBD 4F8QA 3RI5K 1KNOB 2XNAA 3HS0A 3DV4A 2X40A 4M7KH 5B38A 1C7SA 3ZTNH 2KL6A 4LK4A 4HF5H 4OZIA 2BVQB 5I30H 3S2CA 3IFPA 4GO8A 2OZNA 1V7NL 2LU4A 4E41E 4P07A 3ZQ9A 3E0GA 3IFLL 5BNXD 3AFLA 2L4OA 2HG5B 4X6EA 4GLRH 5CILL 3T3MF 1HHKA 3IYLW 2EP6A 3OJ2C 5HGDB 1P5VB 1ZHLA 3B7TA 4XPBH 4K3DL 2AK4B 2F7PA 2MQ0A 2UZYA 6PCYA 2ZUSA 2A9AA 4MMZA 5JIIA 4PJFA 1O6TA 3T3PB 2CLZB 4BZ1L 5E6SB 4ZFZB 3MR9B 5IVXB 5DJCA 5LBVA 3RKDD 4EE2A 1LE5B 1L7IL 3L54A 4PG2C 5FV1L 2W0FB 4HD9A 1OCZB 4DO4A 2E7MA 5INCB 5DJDB 5FGCE 4I88A 2NLJB 3MJ7B 3JT0A 3MNMA 1OSZA 4YFLI 4OUUA 5SX4H 2B1OA 1FORH 4YBQC 1G5GA 4LVOC 4X6FB 2X4RA 4YPGB 2ZKYA 4LL9A 4R5TA 3BPCA 2Y07L 4AY0A 4CC1A 2WYZA 3ZYOA 1RMFL 4HOWA 1J7VR 3OKDB 5H35B 4NWTL 5DHXB 3MXWL 5C86A 3MRKB 1OP3K 4MRBA 1XO8A 4OKDA 3S34L 3T1FA 2GT9B 1O7DC 1QBAA 3FQRA 1MY7A 5JW4Q 1FA4A 4OZHB 4KKQA 5CBAB 4U0QB 1WGVA 2BRQA 1OAKL 1BJMA 2NQDA 5BOZG 3DUSA 1KYAA 4AG4L 2IXQA 4JDTH 1YNKH 1NGWB 3CFUA 3N55A 3K7UA 2EH8H 4OGYL 1XMEB 2FHCA 3DX6B 3HG1A 4GSDL 1CE1H 5TK4A 3FAWA 3TPUA 4OVVA 1XBDA 5IHUH 2X4QA 1IJ9A 1T6WA 3ESMA 3LRLA 1B0GB 1MI5E 2WLJA 3BGAA 3GSRA 4R7VA 5E00B 1AHWB 2FWSA 4NHUA 4JREC 3LRKA 3UGXA 1ETA1 4P46B 4ZMAT 5CD5D 4DQOH 4RMTA 1H3XA 1QO3A 1D3CA 3GUFA 2APWA 3OM3B 4P3CH 3MRFA 1LP9B 4KRLB 2AVFA 4JVPA 3BVTA 3AY4C 1BQUA 4GG8B 4NKOA 3F2LA 3ABLB 3SHSA 4HXAL 3AITA 3A0OA 1KXTB 2NRDA 3PNWB 1QI5A 1FV1B 4IOSA 2CLRB 3BKCL 3WFZA 5ADPH 3CV5A 3ETTA 3TCTA 1BZ7A 2NNAA 2YD8A 3CK0H 3TIEA 5AALA 3L6FA 3BI9X 1OAZH 1T22A 5I1IH 4YHMH 1Z9MA 3DV6B 3GTNA 5AUMA 1RUPH 1RP8A 5F6HJ 3V4PH 4FABL 3FOMB 4J4PC 4BK8A 1OGAA 4BXVA 3UROR 3QG6B 1CYGA 3L5WB 3OX8A 1RUMH 1T83A 1YJDL 3MZTA 2F15A 2QQQA 4PJ9C 1KIQA 3GMPA 1EX0A 3ARGA 3M88A 3MLUH 4H88H 4F7MB 2RFXA 2G9KA 4O58H 1CZ8L 1AQHA 1CURA 1OGTB 3RFZC 1XCWA 3HUJB 1BIIB 1G7IA 3BZEB 4D8PA 3IDIA 4X4XA 2J8UA 4O02L 3C08L 2R1YB 4QYOA 2E6PA 5DJZA 2OYPA 4AGNA 5D1QB 3MGTB 2JKRM 3UO1L 1LE9A 2BOBA 1PSKH 3OHXC 3WSQL 5LBSH 3FAXA 2Y06H 4F15C 5KYXA 3WU1A 2ALWA 1C08A 2XV6B 4XGZA 3SKMA 2K7QA 3HB3B 1Q9LB 5GJSL 3FTWA 4X7DC 1XEUA 5C0AE 5EORL 1MCOH 4WDIA 1HXYA 3APDA 3RWEB 3MLWH 4F5CA 3DMMD 4AIOA 1NH6A 1T80A 3ET9F 4HIIB 3GDCA 3IN2A 1T3FB 4CSZA 4GXVL 4M3JA 5D7SL 2YHGA 2L04A 1U91B 4CNIA 4C4BA 1KTDB 1G7PA 3QCVH 5CN1A 2K45A 3MBWA 5DS8A 2D0HA 4FNPA 4JVUA 4B3VA 5KSAB 1X4ZA 1MJJA 4JO3L 4RMSA 3EBIA 1JVKA 2BS71 2NX5D 3L3GA 3WUWB 4NQCE 3HEIB 3B2VL 4LSSH 3K71A 1NGQH 3AREA 4A7GF 3FQUA 1MCJA 1EJFA 2W9LA 1YEDA 4I9XA 4LCWA 4AGPA 5IFHL 2JWYA 1JVLA 1XR9A 2CK0L 5KN5A 1IJNA 5CJ8A 4KTEL 4B9JA 2YAFA 4FDWA 4KROC 4YGVA 2Z6FA 2HLEB 1JYWA 3QZNA 1QPXA 4UQ3A 4Z7NB 5EZOL 3MRRB 1PF3A 3T2LA 4Z8FH 4NN5B 3VAEA 4P05A 3RWDB 3BP4B 1T20A 1CDBA 2GFBA 4GSRA 4G2AA 4XBPB 4J4PD 3LYRA 1AQMA 4GRWE 1TF4A 3MJ8A 1E4JA 3B2DC 4C4KT 5DUPH 2JXMA 3RUGF 3FO1B 1ITBB 1GJWA 1GYVA 4GS7B 4PLNC 2XG5A 3ZO9A 4YHNB 1CK0H 4NZDA 2XZAH 5EBLB 4I1PA 5D7EA 1H9VA 2XUWA 2JE8A 4PPTA 3KL3A 4TNEA 2E6QA 2FBJL 2BO0A 4TLSA 5CZKA 4P9ML 5E51A 1EFXA 4JKNA 3D05A 2IAMD 5HVWA 5MEQA 3CMGA 1RJLA 3DOSA 4RAUA 5JHDB 3W0WE 2N3JA 1DQQA 1TQCB 3IBOA 3T4AB 5BXFA 3ZSTA 4Y7OC 4NC1E 1AXIB 4M8RA 4A6YB 1S7UA 3LZNA 5DRWA 1INQA 1VFBB 2IPTH 3P9LA 1D6EB 2F54E 4LSTL 5T3XL 4F58H 5KVFH 1R33A 1RZFH 3LKPB 4JDZA 5DDHB 1Z66A 1GPOH 4NO5B 1LO0L 4TUJA 1A6VL 2CU9A 4Q6IB 3TCLA 1E4XL 4W9IC 3RX7A 1JNNH 2YN3A 1WA2X 3QIUA 3JZYA 3K3QA 5KSUA 4F57H 2H2SC 3LZOA 1ZGLB 1JV5A 3F83A 5AL0A 3M1OA 2AQPA 1IM3A 1E4HA 4WI5A 2VIRB 3CC1A 1DVSA 4A2MA 4HH9A 1RJZA 4BGDA 4PJXA 2UX6A 5F3FA 4Z7UA 3JV6B 4Q6KA 3WCYA 3TO4C 3WBDA 3U0TA 1BYNA 1EHAA 3UTPD 3V6FA 4XCEB 4GUPA 4Y88A 5AD0A 1VACA 4LNRA 1ZWIA 2DI9A 3DRTA 1CGSL 3NCMA 3Q3GB 1AD0B 1TSHA 4BH7B 3NZHH 4HJSA 1FNEB 4KROD 4NB7A 5BUPA 2MOQA 3BUYB 4U1GC 4L8CB 2W59A 3K2KA 4JFFB 1V8HA 4K8RH 4I3RH 4YR6B 4G7SB 5DEGA 1H15A 3V5KB 2EVHA 1A1NA 2N59A 1QEXA 1AHMA 5I1GL 4AQOA 3G5XA 3TT1L 3SODB 3HZVB 4MAYA 4FX5A 3NIDE 1CGTA 4WEBL 5GS0H 1IBBA 4MYPA 4LEXL 5ISZD 4KXZH 4CUCA 4G6AC 5HHVH 1SMOA 4YSAA 3ILDA 4GPVA 4YFLF 4Y19E 5FYKL 3LKQA 3O2VL 5I8CA 2AKRA 5GS2H 1KMGA 2C5DC 4QTIL 1XCQB 2OXHA 3DBXA 3O2WH 3S4SG 2L7JA 1W6WA 1P1ZA 2DKSA 4BK5C 3JVGC 1I9JH 1FN4B 2W8CA 5L6YL 2YKLL 4QXWA 4WVRA 5MP6H 1WUNT 1RIUL 2NR6D 3BC9A 3MV9B 5F9WC 3CH8A 1SDDA 5C3TA 1R5WA 2H26B 3K6IA 1VFAB 4NGHH 4O9HH 2VN7A 2MOVA 2ESVD 2JJSA 4G9FD 2W9EL 4HHGA 3UJTL 1IGIL 1OCWL 5AW3B 5L8KB 3OWRA 2IQ9H 1F4XH 1KPVA 3BWSA 1FCCA 1I8IA 3MKKA 5HYJE 1DJHA 1OXYA 1HS6A 4JDEB 3MXVL 4MRCA 1FE8H 5GXBB 3IDXH 2AJXL 2IPKB 2K78A 4WUUD 1JYXA 4LIQL 4KX7A 1KBGH 4PS4H 2OK0L 5JIKA 1CUOA 1NFAA 2J6EA 3PHQB 5C6PB 1PZ3A 4LASL 1XB3A 2VW7A 2WZPD 5D1ZB 1KGIA 3OL2A 2B20A 4NKDA 1WCBA 3DROB 2DWXA 1ZHKA 1HL5A 2VXQL 1K8IA 3BKYH 5DSCA 5I1LA 5IV2A 1F1AA 2PW1B 4APQC 3F7KA 1BZEA 1TQBB 2WJ7A 1A1MA 2P8PB 3IXAB 1FGVH 1G1CA 3TVMA 5GGQL 1MKFA 2VDML 3HE7A 5DR5L 5FB8A 3Q2WA 3ZZSA 4X4ZA 3TASA 4ZUUB 1E7UA 1N18A 1JRHI 1BQHA 2GJ6D 2V2TB 5C8JB 4XP4H 1J1OL 1EEZB 5D6DA 3ZYJA 4UIKL 1ZTXL 1J86A 3RVVC 4G1EB 5CJXA 3EJSA 3NCJH 4NI6A 2VAJA 4HJJH 4WUKH 2NUTB 1AR1D 1GC1L 4HJ1A 4JFDE 5H4YA 3WYRA 1MREH 1ETJA 1XTLA 1Q9KB 1DUZA 3NCWA 3BUQA 4DERA 2XWJA 4Z7OF 4JFZH 4P2QB 4E41D 3RU8H 2FX8L 2ZKHL 4PJCB 2F68X 4A2LA 4B9IA 1EXHA 2I07B 2JI2A 2OPCA 4UOW0 5CN3A 3RTQC 3ALWA 2ILLA 1IT9L 3N42F 4EI5B 2HJLB 2BY1A 4PR5B 1YEJH 4UQIM 4IGBC 4R3SA 2BY2A 5GGTH 4OTXL 4OZGE 5EEZA 3VD1A 3P2DA 4GIPD 1HQ4B 1K8DA 1XCTA 2Y3AA 1A2YA 2IBZX 4KUCD 3PFQA 1IFHL 5DHVB 4PG2A 1NCOA 5DK0B 2D9CA 3ZLQC 4DOHE 4LCIH 4EIZC 1T1XB 1KY7A 3QJTB 3I9PA 4JRXA 4Z0XA 1NSNH 1CFQB 4W9JC 5GZND 1F58H 3ZT5A 1PLGH 5IJCC 1FNLA 3D5OF 4FNUA 4XI5C 1DDTA 3DECA 4NNPH 4XCFH 3OSKA 3MFFB 2B0SH 4DKEH 3RJDA 1N8ZA 5DVNA 5JHAA 4XPAH 3V0AC 5BMFH 3TF7C 4K73A 1NIEA 4M48L 5TF1H 4AOFA 3B5HA 2YEQA 4IBZA 1HESA 5INDB 1T4WA 1A25A 3NACL 3OXSA 4FYSA 4M5YH 2J1WA 2O61B 4LSRH 5B1AB 1CTNA 4WTWA 2OTUA 3GIVA 1QFWL 1XIWC 2ICEC 4RDBA 4KKNA 2GABA 2WB7A 1JHLH 1H5BC 5BVJA 4WTXA 3DMMA 5IB5B 3UZQA 1JMZA 4DAGH 2YPKB 3LNHA 3QUYD 4RAHA 4GUQA 1WITA 4L37B 5T1KD 1OGPA 3BPLB 2IWEA 3ME0B 4Q0XH 5EUOF 1QTPA 5T5FL 3QUZD 5TQ2L 1CFSB 5I17B 5KVMC 3OJDA 4FOMA 1MI5D 2R0WL 3U1SH 2IOIA 1VF5C 2NY5L 2XWEA 3OB0H 1YA5A 2EJ1A 1E9PA 4YOKA 2NX5A 3WOVA 1YPZB 3EFFA 3OD3A 3FO0H 4XCYB 5J11B 2MCG1 4GP8B 2AJYL 3AY4A 4LLVB 3H9SA 4HK3J 3VJ6A 1ZHBA 1C12B 1KPRB 4PS8A 1EAJA 5EU5A 1XH2A 5IMLA 4W6YB 3C60B 5HJ3A 3OKNA 3BSZA 3WI9A 1AZBA 3VE0B 3CFMA 2FNBA 1KJ2H 3DTXB 4MD4A 3RTQD 2UWEE 2W65B 5BZWA 2UV3A 2O5ZL 3ZE1B 3HIZA 1LTXA 3VGBA 1VFUA 3FPXA 1AGCB 1SHXA 4JPIA 2VERA 5EU3B 1FIGL 3T3PF 1GYCA 1J12A 2HTLD 3C5JA 3FTYA 5IVXF 5KYUA 2R4RL 3VGAB 1RZPA 3GMMB 4J4PA 4BQ9A 2VKXA 4C83B 1DVZA 1A5FL 5B8CC 4DKTA 4LDOB 4N2MA 4UF7C 2Y24A 4NQSA 3D39B 4UV7L 1JK8B 43CAA 4PJ9A 1HE7A 3TBWA 2VL5A 2JELH 4ZX4A 4XVJH 1LK2A 4AGLA 1IBFA 4Z7VA 4XI5D 4Y4KD 5IFAH 3C8KA 3RFZA 1UYWL 1T1ZB 3IETA 4PIBA 5TDNB 1JZ3A 3RL1B 3UJIH 2YAQA 2X6AA 3R8BB 4ODWA 5C0RL 3P4NA 2BVOA 4EN2A 4XMTA 2M83A 1MCBA 3OHXA 5DS2A 2P43B 3EO1B 1CFTA 1C5BH 4WHDA 5LKNA 3DUHA 4JZNA 3OR6A 1W0WB 3IWUA 4OZHF 4C56E 1NAMB 3LNEA 2IDFA 1JK9B 1LJMA 5C0AD 3MQIA 2OL3H 5ANMB 1WBXB 2C8NA 4ISVA 1CO1A 2FK9A 3C6LD 2GVYA 4XN5A 3BVWA 2PXYC 2M26A 2F5BL 5AL8A 2R1XA 5DJYB 4FL4B 3EJCA 5IJBC 4JKMA 3PY9A 5ITFB 4LHUB 1KWGA 1A8ZA 3FCTA 1BECA 3HPJB 1NPUA 1C7TA 1BQSA 2GBUA 4PU2A 3RIAK 2MQ3A 5D8JH 1IQDB 1BW8A 2BY0A 4MMXC 3BDYL 3FW6A 4X7TA 3KVQA 1QSZA 4LLMA 4NQCD 3PYCA 2ZICA 4P57B 2Y6SC 4YO0A 1SFDA 1W72B 4X42A 5GRWA 2YLHA 3TBYA 1LP9F 4QXGH 4YSPA 4TQEL 5BRZE 3ZRFC 1LK3H 4G80B 5GIRB 4HLZH 3MCG1 2CBMA 2Y5EA 2J88L 1MCRA 1ONQB 1XH1A 1FNFA 1HOCA 4FQLL 2OTPA 4QWWC 2DYPD 2UZPA 2NUPB 4Y2NA 4G6FB 1JL8A 5GSVB 1VA9A 4AQ1B 5KBNC 1YNTA 2VLLA 2WNWA 5F71A 4BSJA 3EDFA 1IGYB 2ALAA 3BUDA 5F93C 1ROWA 5BQ7A 4ZMTA 3ARDB 4G8FA 4OAWB 1I7TA 5DFAA 3SZ6A 2ZAGA 5ISZA 1JWMA 1HXKA 5IGXL 1E28A 4L4VB 3U30B 4S1SH 3WD5H 4FP8H 3W9DB 2EACA 4AZ8A 2OYMA 3X14A 2Z0BA 4G43A 2X4OA 4WW1B 4QRQA 3AY2A 2Q76B 3VH8A 5C6TL 1KJMA 5IMOA 3MYJB 3HUJF 4MHHI 1RQ5A 4FS0A 4WFGE 1S9VB 4H7VA 2NY0C 3WKPA 5B1JA 4KNSA 5CR1A 1HL8A 3V0VA 3BAKA 3SSGA 3DPBB 5DMKB 2NXYB 4HBCH 4DP6X 1MAML 2NR6A 1LL1A 3MREA 5CCGE 2CZNA 2NZ9C 3W0WD 3H2PA 2HP4A 4A2DA 1SFHA 1NBYB 3WMSA 1G84A 3DSFH 4C4UA 4KZCA 1RIVH 2WUCL 3JV5A 1R5VA 2AV1B 2X0UA 4FJZA 2ESVA 3LZRA 4PJDB 4G9FA 5BJTA 2A9ML 2PWFA 1LNUA 2J12B 1KEMH 3ULUE 1BEYL 4D0BB 1PGRB 4O2FA 4U6VH 4IBVA 4X5XB 5IKCA 1ZVNA 5I6LA 1TJGL 4WUUA 5D7IA 4K3HA 1HHGB 1TZIB 2R69L 1HDMB 4IRSD 2WZPA 2APVA 3FXIC 3PGDA 4JPSA 4RQQB 1KCLA 2Y36L 4ZTEA 5L7XL 1DQDL 1WFTA 3GBMH 3BXNB 5CWSB 4X6DA 3MA9L 5DRZB 3AU1A 3FCSB 5FYJD 3AQDA 3ZE2B 2ADYA 5D6CA 5ICYB 3EYQC 2Y6SD 5HYSA 4CU6A 1C1EH 3VFMB 4C57C 1D5IH 1SHSA 2FUQA 4MJ2A 5FDWA 2F8XC 2OA9A 1ADQL 3ZKQD 4ZS6D 3ZTEA 3A6CH 4LKCB 1N70A 4RWYL 3RVXC 3IFNL 1NOLA 1JI2A 5GRYA 4Q6YA 4CVWA 2H9GB 3I3BA 1IGFL 2LR4A 2R2CA 3CLEH 4YUEH 4W9HC 2C9PA 4Z7NF 2P24B 1NWPA 1WAAF 1PLAA 4KOBA 4YSOA 1D6VL 4EN3B 4OH2A 1A0QH 3DOIA 4GRLB 4PJHA 3VXMD 2VNCA 4XP1L 2EDWA 4AUYA 3QFJB 1IAIH 4LSQL 4PSPA 4EI6B 1VCBC 1KBKA 2OQJA 5GSRB 3GMQB 2EINB 2VDLB 4M5ZL 3BZFA 4L8BB 2Z7WA 4GAYA 3STZA 1UWGL 4LLYB 5AKTA 3GZOA 3ZDWA 5EUKA 2WXLA 1KTKE 4QHUA 4YL9A 2HH0L 4Y19D 3F7VA 2Z93A 3N1FC 3S5LA 4QRSA 1IGCL 4K9EH 2FLRT 3BPNC 4MD0B 5D7LB 1CTOA 4OLWH 2BC4B 3HRPA 3U4EB 5FO9B 1UEYA 4BK5A 1QQDA 4HS6A 1M42A 4K3JH 1CD8A 1VKXB 4YE4H 1OTTC 4KJYA 1KEGL 4R8WL 3VFRA 1ZK9A 1Q94A 3LKNA 1PKOA 2BCKA 3QJVB 3H85A 1M7UA 4GQQA 4IBUA 4HQQL 4JHZA 4AWJC 2WHVA 4YVNA 1NCGA 4AM0B 3HBQA 2EDQA 1RLWA 5HYJD 3LMJH 4WSJA 3U36B 3U46A 1R19A 3QEQB 1UZ8B 1MVYA 5KSBE 1P7HL 4MQ7B 2E8ZA 4LSUH 3DYMA 1BWWA 3QO1A 4K7FB 3V7AE 5FDYA 2V5TA 3DIVA 4KJWD 4N9GB 4UTAH 5I23A 1RHHB 4AVHA 5FLVA 2YBGA 4U1MB 3QDJB 4F8NA 2APXA 3FOLA 3FSWA 1GS6X 4BQCA 4N4YB 3HC4L 4JGMA 3RAJL 4APQA 2X9XA 3EYQD 3M7OA 4XP5L 2WSDA 3KPSA 3KHQA 1OF0A 4FQXD 1BPVA 1CGVA 2YQGA 4G5ZL 5CO1A 4YE0A 1QA9B 2MPVA 5E2TL 3VW3H 1OLLA 1MI5A 3FQTA 1LWHA 3GYRA 1TMQA 5SWZB 4ALAL 1DBKL 5JPMB 5JR1L 1SYSB 1WTGT 1NL0L 1SOXA 3P11L 2G2RA 3FONB 3ARBB 2V8MA 5CZXC 1XGZA 3DBSA 3KW7A 1UOLA 4OD3L 2R0KL 2IC2A 3VG9C 4FTVE 5E4AA 1NBZB 5CIPH 4NS0A 2V3FA 3WN5C 5IB3B 4JFDD 1MWAB 4ZT1A 1RU9L 4JUTA 4R0LB 2ZTBA 1E9OA 1PG7W 2GHZA 3W37A 1A7OH 1CS6A 3MYZA 3U0WL 1WG3A 4AUJA 3P30L 3RTQA 1EZSA 2GJZB 1TIUA 4XB7A 3K46A 4LOEA 5T5NG 3KCPA 3HMXA 4X9GA 3LN4A 2VMEA 2W9DH 1FC1A 3SD5A 4MHHG 4Y1AE 3MJ9A 4YZFE 3AXLB 4APXB 1UT2A 3T1WA 1KB3A 4Q2ZA 4FC3E 1MN4A 5GQBA 3WLBA 2AQ2A 4I18B 4IIZA 3Q5YA 5LGJA 3D2UB 1FFPB 1QSFB 3ARFB 1R5IA 5CHNA 3TWCH 5IQLA 1PL3A 3RX8A 1DP0A 2J1KA 4YSTA 4IMLA 2A3TA 1EUUA 5ADOH 5K9JH 1E8ZA 4WGVB 4K9EC 5D96B 2PPEA 4N5UA 4ZXBC 3V0FA 1JFHA 1OAJA 4YSEA 4J39A 3SQBA 1TCMA 2EKSB 5E08L 4NPYB 3CSYA 1EIBA 5BS0B 4CN6A 3MLSH 2YAPA 1E8WA 3OC8A 1DN0A 3BUPA 1BAFH 4JGUA 4LLUA 3TBTB 4M61A 4JQXC 3I6SA 1KLFA 4N86A 4P4RB 4XBMA 2VLKE 5E2VH 1S7VA 1XIWA 2XN9A 2MCPL 5DWPA 1WZAA 5C0AA 1YNLH 1H5BA 4NZRL 4TNWK 3V6OC 1KTBA 1BPLB 1ACYH 4PFEA 1NJ9A 1W16A 4PQXA 2F5AL 4GMSH 4XTRC 5EC1B 3BD3A 1N3NA 1UXSA 2IBZY 3M45A 5H2BA 1EQWA 2QKIC 3MCKB 5JOFB 1NCCL 4B9KC 4EAEA 3PL6D 1JV2A 2PP7A 4LBEA 4MA1C 2IG2H 4TVPL 3W82A 3ZMEA 3WENA 4I13B 4AL8L 4P59L 2YIHA 3FBKA 5LLIC 4JRFA 5SX5H 1ZLUH 2F1AA 1WA0X 5FOBB 3HMWL 2KH2B 5A6IA 1JD9A 5AAWC 4DN4H 2A77L 5FYLL 5C0IA 4S1RH 5FAAA 4GW4B 1AO7E 4NRXB 3MBEC 2QQLH 5KVGE 2G5BB 4TNVF 4XMLL 5F44A 1RY7B 3WLWD 1F6AA 4YEEA 2N1KA 5B3NA 5CSGA 3VQMA 3W11D 1WH0A 3BWUC 3TCXA 1JDDA 1L9PA 2EEDA 2WQSA 5ACMA 4QRUB 1TJIH 4YDIL 2LAGB 5KVEL 2CNYA 2Y2TA 3Q6GL 2QPEB 2JKIS 1FCGA 4NM4L 4S0SD 1R3KA 2BP8A 1C9SA 5A16B 1UD6A 5CN2A 3MRQA 2BMKB 1UWYA 2E46A 1JUFA 1QEWB 1H6FA 3MA7A 2Q5BA 2B4CC 1JVOA 1PDKB 1ZS8A 2AJSL 4FZEL 4HOMA 3O6LL 4V2CB 3DYOA 3AWEA 3VM7A 1UFGA 2GITA 1AC0A 3CLFH 5F89B 2F74A 4LRIC 4K2UL 4MDRA 4W4OC 1LEKA 1YO4A 4HHWA 5TTRA 3VFUB 2APBA 1Y07A 3DUUA 5IG7B 3QISA 4ANXA 5F0LB 2ZWLT 4XCCH 1IIKA 4FERA 1SYVB 1TZOA 5I28A 3ASOB 4HX1B 5J6GB 2AEQL 4GIOA 3R19A 4BKSC 5FUOH 5GGTA 5J06A 2OAAA 4O2CA 3IPFA 2VE6B 5AZUA 4UV4H 1KUMA 5A7BA 2ARJQ 2F58H 4I4WA 1KIPB 5JIQA 2FJHA 4JFVA 4U1NA 1BVNT 4H8WH 1IC5H 4M6MH 2QVTA 1EXUB 2XY2A 4KXDA 4ZMYA 1FVCB 4YAQA 3RA7L 2ZQKA 5TQ0L 2D8KA 4NHCL 5EZLA 3CPLB 2XVGA 4W6WB 6PAZA 3DX0A 1DUYA 3B7SA 3QO0A 3GK8L 3DK2A 5F72S 1EJOL 1QSEE 4BQ8A 4A2EA 3O3AA 5GRJL 2BSRB 4NQVB 4IRSA 4B9YA 4I3SH 5FWRA 5FECA 3KPMB 4V2BA 4LHUG 2HT4D 1WEJH 4EVNA 3GLDA 4ODUA 4J8RA 3CE1A 4MMXA 4ODVL 1GS8A 2YOAA 4KDWA 2YGOA 4HSQA 3L1OH 1YPZF 3FT4A 5ELIA 4E9VA 1XF4B 2V9TA 4KNTA 5I16B 5BRZD 1QRNB 4H20H 3VG0L 4HU8A 1B4LA 1NPNA 1G43A 2VISB 1XGTA 3JWDH 5TD4A 2XWZA 4GI8A 1JZ4A 1LDSA 3U9UB 1QUNA 2CHNA 5I8OL 4KGJA 2OJEA 5CBEA 1RZJH 4F7EB 3KM2A 3ZE1F 5DQDH 4WJ5B 5AWNH 3MLVH 1AHWC 3VM5A 3VXMA 4Y16D 3PJSA 4P46C 1K4CB 5HBBA 2QVMA 1YN7A 4BKLB 2VB5A 4N2EA 3S37H 1MIEL 1PD0A 4DGVH 4KV5F 2IBBA 3ESNA 1E6JH 1Q72L 1MFVA 3C5SA 4ZMPA 4A7GA 3WJLC 3EYOA 4DGIL 4G6JL 5LWYH 4WW2A 4XPHL 5H94B 1BZ9A 5EU6E 5EEUA 3AU0A 5EOCJ 3VXQB 4HKZA 5T1LB 2FB4L 4XN7A 1Y18B 3BLBA 2VDKL 4FLQA 3SCMD 4UTBH 3EJUA 2D0GA 1YVLA 5TDOA 1N5YH 4WFGD 3IDMB 4XMKL 5EO0A 4FKEA 2H45A 3B7RL 5TFSH 4JO5A 1A3LH 2ICWB 4M5TA 1FBIH 3L7EB 3MRMB 3GRBA 3PJNA 4QTHA 3SYPA 5K69A 1MLBB 1IC4L 1WIOA 3S96A 2B2XL 1U30A 4IKKA 1NCJA 1PNCA 2HUEA 1ILSA 2W94A 3A3YB 3L48A 4JFQA 4A6YH 3ULUD 2A6KA 4LLWB 3EG9B 1MG2C 2CGRL 5HYJA 1L9OA 2RD0A 5EF1A 2J73A 2KLRA 4BFIA 3WTUA 5DK2A 3F7YB 5GISL 1ZD6A 5HGHB 2HTKC 1WJ3A 4W68A 5KVDL 4PWGA 3WUZA 5CEZL 1JI1A 4HXBH 3WFCL 1B0IA 4L48A 1RHFA 2YK1H 5D1QC 1NFDE 2X2YA 3JWNH 8PAZA 2I32A 1I82A 3QJFB 4Z18A 1Z9PA 2A6DA 4MA8L 4UUJB 4YXLH 4YQXL 3EHBB 1GJIA 1GZQA 3QXDB 2L7EA 2VXUL 4X6CB 3D34A 4MS6A 1EZVX 1ML0A 3EGSB 3FKUS 1E30A 4FQXA 3B9DA 2NDFA 1XT5A 2NY1D 3VFGH 4BK4A 4PCYA 3BUTA 2PKDA 4OLXL 2VT0A 2WSPA 3CFDB 2A74B 1EHNA 2A99A 3HE6C 3MLYL 4X80L 4XPGL 2M2DA 3L95B 4IJ3B 2A6IB 4HUUA 5AVRB 3IJSB 3T2NL 3KPPA 3BT0A 4A2GA 4P99A 1GCYA 3ZTJG 2X41A 5EV7A 5IMMB 4HP5A 3MAWA 1G9NH 2DQCL 2G60H 3QORC 4ERSL 3TIDA 3HZMB 3HFML 2R29A 4OGQC 5E4EC 4JN2B 4PGCA 3VXUA 4EDXB 5IB2B 1AGBB 1MRDH 4M9OA 3KBPA 3QXAA 1MHPL 1FFNB 3JWDC 4J2XA 5FKPB 2NY7L 2EDLA 3HR5B 4LSPH 1JPSH 4IEFB 4TTDC 4N5EC 4DEWA 5ID0A 4ZDHA 2WLLB 1JPST 1LVEA 2IPUK 3W3BA 4OZGA 4ZPTA 4F92B 2XICA 3FK3A 5E8PB 1K85A 1BQKA 4UILL 5E5MB 4HWBH 3U4AA 2FD6L 3R1GL 2A4CA 4Q9CA 4L2LA 4M3HA 4WCYH 4PV9B 3CZNA 2DQJH 4ZUTA 2YGVA 1OAUH 4OCXL 1UA3A 5D72L 4JO1L 3Q05A 3ZHLA 2X6VA 1J5OH 4MNQA 5C0EB 4PJDF 3D48R 3L3DB 2LT9A 4RIRA 4WO0A 4WWOA 4KI1A 2DQGH 2MNJB 4GS7C 1AMYA 1HIML 2VMFA 3GHEH 4BWUA 4P2RE 5K9KA 4BBWA 3E8VA 1ZV5A 3GQFA 3E8UL 4LCUA 4GKNA 3TGXA 5FF6A 1D5ZA 1QSVA 1XF1A 4HV8B 3D85B 3BSGA 3LXUX 2AJ3A 3MOQA 5HVHC 1IKNC 3MRDA 1CU4L 2ADIB 1BM3L 2NQCA 1PZCA 2WQRA 4F8PA 2VDQL 3RGVD 4AT6A 2KHAA 3NFPB 3Q6FA 4JM2B 4NM8L 5C92A 5K9QI 4HIJB 1X5JA 4HDIB 1JPGB 1TQCC 4UZGA 3T4AC 1OLZA 3ZE2F 1ACCA 3LKOA 4JX0A 5DT1L 3T2OA 4XNMA 2CJUH 1QBML 1QYGH 2QR0B 2GIYA 4U7KA 2BHZA 5C7XL 3PP4H 3TEWA 1A4CA 2HA1A 1B2WL 2MH4A 3BD4A 1A6UL 3SYCA 4G8IA 1SJEA 2Z4QB 3UBXB 3ATEA 4GXFA 1I1FA 3WE6A 3HE6D 5IT2H 1XF2A 4ODXA 4YN3A 4C58B 3JWNC 4MAUH 4Q6IC 1GSKA 3A4FA 2FO8A 2FLMA 1A4AA 3ZDXE 1BF8A 3WEXA 2YSSA 4FTVD 4NP4L 4XNBA 4OUOA 5FWQA 1BMZA 5JMOC 2EUXA 1U6AL 4JFYB 4AQEB 4HCFA 2H4EA 4TQPA 1ZV2A 3WN5A 1DSWA 3S8FB 2ZOLA 1XF3B 1AD9A 3P9MA 3TNMA 2DIEA 3C6SB 4HCRH 5DI8B 1PG7H 5ESVB 2W0PA 2C9AA 1JGVH 2D31B 4JKKA 3BQUD 4WI7A 5DUML 2VDOL 4M4RB 3P0VL 3KLKA 4Y4FB 1VGEL 1JTPA 1SVZA 2C1OB 2ADFH 1J8HA 3O2DL 4TTDD 5GRVK 5I1DA 2JFCA 3ESPA 2CK2A 4Z23A 1OARH 3QR2A 3EYSH 4M1GL 1KLUB 4DFIA 2R1WA 4Y1AD 2DOCA 3BH8A 3GGWA 3RDJA 5J3HD 1WUZA 2VJXA 4NQQA 4TLTA 1RULL 5M95B 2QSCL 1C5DB 2AGJL 2LOEA 3OKLB 5E9DE 4MVBC 1CBVL 2CJSA 3GBNH 2SEBA 1QNIA 1YMME 4ZSOB 1R3IH 3QSKB 5ITBH 3S88L 5B39B 5KVFE 3GSNA 3N43B 2PR4H 4DN3H 3P0GB 1E0OB 1FG9C 2WLYA 2YARA 4DHLA 3EUUA 3LIZL 2BIPA 4IRZH 2MPAL 3DGGA 3DJZA 3GUTA 4KZDH 2VXSL 3S4SA 4ZMXA 5AZ2H 5L4MA