2GBVA

C6a/c111a/c57a/c146a holo cuzn superoxide dismutase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGATSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLAAGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2gbvA00
1U3NA 2WYZA 2K4WA 1IBHA 1HL4A 3GQFA 3HOGA 1OZUA 4BCZA 1N19A 2Z7YA 3GZQA 3ECUA 3L9YA 2AQTA 2C9SA 2Q2LA 1SPDA 1OEZW 2SODB 2Z7UA 3ECWA 1E9QA 3KM1A 1EJ8A 1SRDA 2GBUA 1E9OA 2ZKYA 2GBTA 3CQQA 3F7LA 3GTVA 3CQPA 3GZOA 1YSOA 4L05A 1SXAA 1BZOA 3GTTA 4N3TA 1CBJA 1EQWA 3GZPA 2WKOA 3K91A 5KBKA 1PZSA 1E9PB 3T5WA 2AQRA 1SXSA 1FUNA 1SDAB 2APSA 2JLPA 2AQPA 1PTZA 1IBDA 5CU9A 3SODB 2WZ6A 1B4TA 1XTMA 3MNDA 1DSWA 4BCYA 2AF2A 2E46A 1KMGA 1COBA 1SOSA 1Z9PA 2WZ5A 2VR8A 2WYTA 2V0AA 1MFMA 1SDYA 2WZ0A 5KBLA 2NNXA 3S0PA 2WKOF 1HL5A 3ECVA 1Z9NA 3F7KA 1S4IA 2Z7ZA 1UXMA 1QUPA 1JK9A 2C9UA 2WWOA 4A7GA 1BA9A 3KH3A 2VR7A 3HFFA 3PU7A 2XJLA 2GBVA 1E9QB 2ZOWA 1F18A 1OAJA 1N18A 1E9OB 2ZKWA 1TO4A 2JCWA 1DO5A 1F1GA 5KBMA 3QQDA 3RE0A 1XSOA 1P1VA 4A7TA 4FF9A 1JK9B 3HW7A 1F1DA 1AZVA 3KBEA 4BD4A 1OALA 1IBFA 1TO5A 1SXZA 3KBFA 1L3NA 4A7SA 3CE1A 2C9VA 2AQSA 4N3UA 4U4IA 3KM2A 4A7VA 1JCVA 1RK7A 4A7UA 1UXLA 1Q0EA 2Z7WA 1YAZA 2WWNA 4B3EA 3H2QA 4MCNA 3KH4A 3H2PA 3MKGA 4OH2A 2LU5A 1B4LA 2VR6A 2XJKA 1SXNA 1YAIA 2AEOA 1E9PA 2AQQA 1XTLA 4A7QA 4MCMA 3LTVA 1CB4A 2AQNA 1IB5A 4OJAA 1PU0A 3L9EA 1OZTG 1SXBA 2E47A 3QQDB 2ZKXA 4A7GF 2R27A 1SXCA 1IBBA 1ESOA 1F1AA
chains in the Genus database with same CATH superfamily
5D1XC 3TJEH 2XNAA 3F84A 5SWZE 4AMXA 2WXQA 5EU7C 1W72B 4WWPA 4GFXA 2WTRB 1VFAB 3BQUA 1QBBA 5TD4A 4FOMA 2IFGA 1DJYA 3NMEA 1BF8A 1KB5A 1OSZB 5CEZD 2W94A 3HNVH 1XGTB 2VLKA 4NJ9H 3EJYD 5HHOA 3KPTA 3CN4A 3BPNC 3QQXA 3NVQA 4A1RA 2VDLH 4X6DE 5IIEB 1XDTT 4M6AA 5EBGA 2E5EA 5AYTA 3TBBA 2C4FT 1NWPA 4XC1H 4JHWL 4U7SA 4ANVA 3SOBL 1E8WA 2X3CA 2RR3A 2Y7SA 4N22A 3RIAF 3HZKB 5LBSA 5LB1A 3WSQL 3UMTA 3GBLA 5C0FA 3E6FB 2EE0A 2F18A 5CJOL 2VISB 3BKCH 3TBWA 3V0DA 2CBTA 1A6ZB 4LGPB 1LDPH 4YVUA 1GGIH 4Y8AA 4YDLB 4Y2OA 1WZAA 4IKIA 5GGUB 2YKLH 4Q56A 3KPQB 5AZUA 1CE6A 2XETA 4YO0B 3B3BA 2AQ2A 1NFDF 2I60L 3RVUC 5ANMB 4X98B 3SE8L 5JLZA 2F7PA 1HXKA 5E00A 3GUFA 2DOCA 3OKDA 2QQLH 2OMNA 5C7XL 1QI4A 4BZ1L 1JRHI 2HA1A 2V17H 2AVFA 3PNWB 1ZV2A 3BD5A 2JJWA 4FZ8L 4L5FE 4MAYA 4KVCH 2WJ7A 2R4SH 3AU1A 1UKQA 2NW3A 1BQ5A 2NY4B 1ZK9A 3QGVA 4HK3N 1A47A 3O4LD 4KTGA 5JHMA 3SDCA 3P9MA 1GYAA 4U0RC 2AMGA 4X7SH 4BK5C 4AL8H 3BWSA 3HW7A 3D30A 3O2DA 4B7LA 2YEZA 3D50A 4YQXL 3LOWA 4YHPB 5FLVA 3BH9A 2OI9B 1HNFA 2G4GA 3F58L 4ZMYA 5FECB 4H8WC 5IOPB 5HYSA 3V6FB 5AKTA 4P2QD 3G9AB 4Z3EA 2F8OA 3PV6B 4RESB 1V3LA 1QHQA 2ENYA 4ZMLA 5F9AC 2NSMA 1H9VA 2CIIB 4YHKH 3UAFA 5C70A 1TTAA 2H6UA 3MJGX 4PJAF 5FFOA 3DVFA 1NCCH 3C2AH 1KJVB 1I75A 3FU6A 3FFCE 3UAAA 4UQCA 1UB6A 4EDXB 1DTUA 5C07A 1EAJA 4Z77B 3Q0HA 4QLWA 5DJ0B 5GHWH 2AQQA 4PGZA 2D7PA 2A77H 5CO1A 1JZ8A 3WXWH 1C12A 2DEYX 4IHOB 4PJ8D 1N9PA 2P7TA 4FJZA 2APFA 1JVLA 5C9KA 4BGLA 5E8EB 4G11A 4HG4K 5KSAC 1IGFH 4JB9L 3PDDA 3NACH 4QRTA 4GRWE 4U1JB 2AV1B 4QHLA 2ETWA 1WA2X 1HHJB 3VXTB 2R8SH 3L5JA 4E9LA 2EIZB 4KMTL 2O93L 4O2EA 2J71A 3P9WB 3NCWA 3O2VL 3SJVB 1HSAB 3UJJL 1MF2L 5K9KB 2P9RA 1F3JB 2LW3A 3ARFD 4X42A 3VG0H 2R0WH 3DRTA 3ME0A 4X9IA 5SV3A 3HMWH 2P49B 3VXUE 2WK2A 3ZK0A 3SOTA 4FULA 5EZLB 3SE4C 5A16A 3WHE0 5DJ6B 1L3WA 1FGNL 4KO5A 2MNJB 4APQA 2OA9A 3I9GL 2GJPA 5FOJA 3U36A 5LGJA 2IALA 3UP1A 1XGUA 1XR9B 3LRSB 3QXAA 5HHMD 4DK3A 4K94H 5TE6L 5KVDE 5FGRA 1FNGA 2F7QA 4G8GB 1V10A 2MNWA 3M1CA 3GNML 4G6KL 2P5WA 1JYVA 4KZDL 5T1DL 1JE6A 2CM5A 3AWFA 1DVTA 3EOAB 3GI9H 3W0WA 2YUZA 4BFBD 4JO1H 3B2XA 4FQ1L 2D7TH 3LEXA 3K2IA 4XMLL 3N40P 4HH8A 1LILA 3ZMRA 2WNXA 1GOFA 1ET7A 5FYLE 1OTSD 3V6OA 2XJLA 2BRRH 5TDOA 4NI6A 1HHIB 1P4IL 1VDGA 4V2CB 5MP6L 2CWRA 3U6RA 4TTDC 1GPOH 5FHAH 2GIYA 1G1OA 1KZYA 3B6SB 4ENZA 1IFRA 4FG6D 3DHUA 1NMBL 2HRGA 2VDNH 2QPDB 1UYWL 1S7WB 4FJYA 3JWOC 3B5TA 1Z9LA 3RGVD 3ELQA 1A9BB 1BQRA 3MMEB 4ZSOA 4JFOA 2VXVH 4PRDA 5FAAA 3D09A 4Y5XC 4WNJA 1QRNE 1U3HD 1Y07A 3WTUA 3WJMB 1HXYA 1Z7JA 5F88B 1JN6A 1PZDA 2P8LA 2CR3A 3EGXA 4YC2B 4QRQB 5HHVL 4NZ8A 2Z1PA 2VDRL 4ZW6A 2CG9X 1MWAL 1KCRH 1T1YB 2CGRL 4ISVA 4R96B 2A74A 4NKOB 5FEBA 4I0PB 4E42A 5KWYC 5IHUL 3UJIL 3QEGL 3D4ZA 1TKWA 2C1OA 2YRLA 2PYFB 3V5HB 1P84K 4HPYH 4KBPA 3DUSA 1YYCA 3GBNL 4M1DH 4XI5D 1BJMA 1CF1A 2HT2D 1I8MA 1EAOA 1TJMA 3FSZA 3HCVB 3R06A 2KQNA 1HNGA 4DQOL 4KTDL 3LS5L 1DLHA 4ADIA 2RACA 2CGZA 5E5LA 2VLRB 1WFNA 3UBHA 4PG2C 4U6YB 1P5UA 4NPYB 2D2CC 2IFFL 2JKTM 5F3HB 1WS7A 2I5YH 5HVHC 4ZFFB 2VZ3A 4WI0B 3AS3A 2IWKA 3QZWA 5FYJD 4HFWB 7PCYA 1D5ZB 4OI7A 4OBRA 1JHLL 1AGBB 4U1NA 1G5GA 2H3KA 4I13B 4LAQH 1BVZA 5I1KL 3MRJB 4L8BB 2JB6A 1YEIH 2VAAA 5CLZA 3MV9E 4BK5A 1EO8H 1UM4H 1TLKA 4NIKB 4YOKA 3ZE1B 1X5FA 3VI4A 3SY6A 2MIZA 4JEGB 4WTXA 4GEIA 3KS0J 3DVNA 5EEUA 1AS6A 2UWEB 3T3PE 4WHYH 2CR0A 5D1QC 2UY7B 4R9HA 2J6EL 3IMSA 4XGZA 2GUOA 5L6YH 1A1NB 3GBML 5KVGH 5HYQA 4FKHA 3MFGB 3HHMA 1FAIL 3U2SB 1XTMA 1N64L 5JZ7C 3P3SA 4HSAC 4I48B 3ZXAC 4KI1A 3NIFE 3ALPA 2VGLM 4K3EL 3MO1A 2G2RB 4N90D 4NOFA 4PUBH 4DKFH 1RQ5A 3D7PA 4B0MM 4P99A 3EGSA 4WUUA 1R5WA 2YWZA 4UUJB 1N0LA 1WV7T 3B9DA 3R8QA 2QVKA 4WU7B 2GVYA 4AE1A 2GJZB 3C75A 5F7YC 4PRIB 2P5EE 3QZOA 1FYTA 4X4XA 3BVXA 1E9OB 4W4NA 2J2ZB 4I88A 4JQXA 3BPOB 2NUTA 3L08A 4ZW7A 2V5MA 5ALCH 1A2YA 4A2FA 4K3JH 5I8CA 3CZKA 5DS2A 1P6FA 4IMKC 4MAZA 3CV5A 1TQCC 4N2HA 2CUHA 4A7VA 3WYRA 4TVUA 2MOQA 4EJ1C 4CVXB 1KCLA 1SFDA 4PJEE 4QCIB 5AW3B 2CA3A 4HJJH 2A83A 3WUWB 2FK9A 4BKSC 2X0VA 4FHKA 3EJSA 5IFJA 2GAZB 4YDIH 4MMZA 4ZUWA 1SVBA 5IB4B 1EZUA 4TUKL 3EJTA 3D52A 4BRVA 4FKEA 4XWOC 4G6AD 1K8IB 3L2MA 5F6IB 3VX0A 3EW3B 1RZQA 3WXVL 1E6OL 2QVIA 3ZDYB 4IJTA 3KGTA 5C0AD 6FABH 5EU3B 5KJ4A 5DD0H 5TH2A 3S5ZA 1J1OH 1FYHB 2XN9B 3X1NA 4AQAA 4XPFH 5AAWC 1KV3A 3UTTA 2JI3A 3C5ZB 3NGBB 2HKFH 3DPDA 3ULUL 1ORQB 1JZ2A 4CN4A 2ARWA 2NRDA 2EDKA 3GJFH 3P4OA 4HLEA 1USQA 1F13A 5AYUH 1WAAE 3CZNA 3FZUC 5CEXB 4FFVD 1NWOA 3QNYA 4JDEB 1E9QA 2FECL 4JN1H 2XTJC 3UBXG 3KPOB 4LF3B 5FUCC 3ELAT 5C3LD 3HC2A 1L5GA 3DV4A 1P1ZB 1VAHA 4XB8A 4NQEA 3CFDA 1KCSH 3HEIB 1HQRB 1TQVA 1XH2A 2X2IA 1FL6A 5I1CL 2WZAA 5DWPA 2X44D 1VA9A 4PY7A 4Q0XH 1OO2A 3O2WH 4DKTA 2XPYA 1M9WA 3CZLA 3K6DA 1PD0A 5ACZB 1XBDA 3MLYH 1D7BA 1A7OH 2OKMA 3E7JA 3ZRSA 3P54A 3GWJA 4E0RA 1Y18A 2NY2D 1UXSA 2AHIA 3MJ9L 1SYVB 5K9QG 3Q6FA 3FB5B 4HG4J 2XZCL 3TZVD 1RUQH 1ZGLM 1K4DA 1G1KA 3DECA 2ZP8A 2X40A 5JXAH 3C60C 2IMNA 1QUNB 4P5RA 2XPGB 4WO4C 4H2CA 3GLEA 4OF5A 4KMQA 1TT6A 1F2XK 3H7BB 4QOKD 4LSDA 2DWDB 4ZODA 4ATTA 5J13B 5T1KD 2ZIDA 4H8VA 2JB5H 4OT1L 5DJZB 2P42B 3Q8AA 4HZLA 3TEUA 4AUYA 5K69A 1MCOL 1UJ3A 1N18A 2V2XA 3RIFK 2BSBA 3D4CA 5IROA 1ID5I 4RFNB 3CLFH 1ZD6A 3EDKA 2V5YA 1N2RB 4O9HH 4WNQB 5E9DD 3BAJA 4KRNA 2OR9L 1KT2B 1JMXA 1JPGB 2G0KA 3DDGA 3J8F7 3UCQA 1R3JA 4G42B 5IUSA 4Y4HA 5CHNA 2C9VA 2WLZA 3MRBA 5KSVA 2OK0L 5FLUA 4XC3L 4B0MB 4BSWB 4K3DH 4PJIE 1KBBA 4GRLD 4RRPM 1NL0L 2QPFA 5GGTL 4MHHG 5CCGE 2Z7WA 3AACA 3ULVL 1IUZA 4R7LA 2JIXA 5L4IA 3FB6B 4I1RA 4F15C 1UWGL 3VFRB 4JMNA 1I53A 1UC6A 2O5YL 1ZLWK 1AI1L 2BLFA 3NZ8B 1EH9A 4M02A 1SLVA 4MD5B 1M71A 4NKMA 5IVOA 5CBEA 2ZXAA 2BS71 1KPVA 4A6YL 5GGRY 1YAIA 2YAQA 5ICXB 3V4VL 4JCWA 1AGFA 5I0VA 5I8KL 5AZ2L 4NZRL 2XQBL 4ZQKB 1AZUA 2X1WL 2LE9A 3N85L 2SEBB 3CVIH 1ZHBB 3KE0A 2ZAGA 4A7GF 2VYRE 1T3FB 3NFSH 3OG6B 1CBVL 1F1AA 2Q76B 1AGEB 1NKRA 3LQAL 4ZXBD 1TEGA 3PABA 3ARRA 3DX4A 4MB3A 5D1XD 1CFBA 1QLFB 5HHQB 4HP5A 2HP4A 4YGAB 2XBTA 3SO3C 4CW1A 3QJZA 2BW4A 5B1JC 2KZ1B 1JG9A 3H3KA 4NZUL 1CGSL 3FO0L 5T1LD 4QTIL 2ZJSH 4F37K 4GP4B 1YMME 3B5GA 4MNGA 2PYEA 2NT1A 3DX3A 2A73B 2VQ1A 3UBGA 4BA0A 2QQKL 3MCLL 3BOVA 2HFEA 3H55A 5LAXA 5B38A 1G0XA 3GS4A 5KYWA 1P84J 2X6BA 5FKAB 3P02A 1F42A 2X1OA 3Q5OA 3HBPA 2VXTH 4L3EA 1I1AA 1NGZB 1XCQB 2AQPA 1IZJA 5DEFB 3RWGA 1OAZL 5FDWA 2C34A 1I9RL 4HWUA 4ZFGL 1NBCA 3IXTB 5EV7A 1SBSH 3MLSL 5IEKA 2A6JB 4NENB 2GYSA 1K2DA 1MCNA 5C6TL 2C4FU 4K73A 5E94B 3PQYE 3U30B 3DKHA 4F5CA 3G08B 4N2DA 2YPKA 2MEJB 2F15A 3RVUD 1H5BC 1JGUH 5CGMA 3J07A 4YHMH 2ZONA 1NDMA 4U1IA 3SQOH 2HWZL 4DFIA 3VB9A 4N2LA 2VDPH 5IMKA 3OXRA 1T83A 1TXKA 1DBBL 3B56A 2XWEA 4Q89A 4S1SL 1F1DA 5AW5B 2KPNA 1OSYA 2ZCHL 2FO4B 2WC7A 4JUTA 3KXFD 1YNKH 4ODWB 2WXJA 1INEL 1ZGLB 1G7LA 4HMCA 3QNZB 3OSKA 4LVEA 2B4CC 2JKRM 3S34L 3I75B 4HW6A 3L3DB 3GB7A 2OSLA 1AO7E 1C5CL 1X7TA 5AALA 1QAWA 5G5DB 1BZ9A 4G5ZL 1IGML 3M1OA 3OG4B 4PGJA 1UZ8A 3TO4B 4MJIB 4XCCL 4HPHA 3NJJA 5DO2C 5BJTB 5GGVH 4WUKL 1R24A 1RJCA 2P24B 4K15A 4GKLA 1JRHL 4MYWB 2ICWJ 4AYFA 1CB4A 4R97C 4MA3A 3EDFA 2AK4D 4LSVH 1H3UA 5EOTA 3K6SB 4PJCB 5GRWA 4NHCH 3MGTB 2ZYIA 2X9WA 3EYQC 3G9VA 3BPCB 4PEEA 2BJML 3QULB 1IM9B 4NM4H 3DIFA 3P4NA 1CDYA 4XBPB 1BJ1J 2X28A 5KSAD 3EHBB 4JFPA 1G7MA 1B0WA 4Z7QF 3VJ6B 3QUMA 4N5EC 1HAWA 3IKCB 4AQ8A 4X6EB 4JREB 3UERA 2C9XA 2IH3A 4FMFA 2J8UE 4FTVB 5KOMC 2BOCB 5BOPA 2FYVA 1NC4D 2PKDA 4ZTPH 5C3TA 1AQHA 3MBEB 1I8IA 4UYQA 5I0ZA 4N3TA 3GIVB 1VFBA 4EI5A 2HVJB 2AJ3B 1P2CB 1V54B 2A1WH 1F97A 2NR6C 3F7VB 3GRWL 3OBAA 1UB5B 2YPVA 4MD4A 5D7IA 2ZX9A 2YGNA 5J1AA 3HPJB 4FYSA 3H53A 3QFGA 1UACH 3VWJB 3CU7A 1RZGB 5T1MA 1MFCL 5TE4H 1JZ4A 1XF1A 1ONQB 1YDPB 1GY2A 1LD9A 1ASQA 3FFOA 3KWTA 1X5AA 1C7SA 2WJ5A 3HG4A 5HVFB 1NPUA 4Y4KA 5KBLA 2GJ6E 3KJ6L 1KTLB 2CO2A 2PXYB 4F9PC 2E9GA 2WD0A 3LKRB 1F4AA 2NW2A 3B7YA 3KNBB 1DQQA 3T04D 3TV8A 3V0AC 5JIDA 2EINB 4P2YA 1I8KB 4XP5L 5DYFA 3VGHA 2HVKA 3HG3A 4EIBA 2OMZB 3IGAA 1SJEA 3C12A 4Y19D 1EUTA 2ZUQC 3I6KB 2RBLA 2VXQL 1ZV9A 1XSOA 3P40A 1KB5H 3NDYE 4TTDD 2F9BT 3HNVL 1HINH 2OMUA 1LK2B 4G80A 2XG4A 5EUOB 1BWMA 3FCSB 1HE8A 3MACH 3PJSB 2Y4SA 4WJG3 3MNWB 1M7DA 1OXYA 3IVKB 3Q05A 1U91A 1WH0A 1IMHC 4XC1L 3HJ0A 1NDTA 1L0PA 1LO2L 1ZRUA 3EJQA 2IANB 1WZLA 3QI9B 5LBSH 1M1XB 3KR3H 3ILPA 4KHXH 1EAQA 2HLFC 3UXFA 3SPVA 1JZ3A 5ANHA 1MJ7L 5B1CA 5BRZD 2R51A 1QBML 3UZQB 1C16A 1CLCA 4XN2A 4H0LC 3OL2A 1ZIAA 2IIJA 1GGIL 1IE5A 2DLEA 2LTQB 4TQEL 1EHLH 2QHRL 2XHNA 1NANI 4NDMA 1XR8A 3H42H 5FHBH 3ASWA 5IHWA 5I71C 4G7YH 2QV2A 2RQ8A 2YD8A 4JCMA 4KO9A 1MCJA 3N1GC 4B5EA 4APXA 5CP7B 5JHLA 1BQLH 3SE3C 3CTTA 4W9FC 2AEQH 4LQFH 4MTMA 5I1DB 1FE8H 3WEMA 1N6QL 5HY9A 4R83A 4UM9D 3CXDL 3VSUA 3ARTA 3FO2A 2R4SL 2CNYA 3L3HB 3VFNA 1CIUA 1Z32X 1J12A 4GKNB 1HKFA 2MQCA 4L4VB 3WFCH 2WO2B 1S7QA 5GGVY 3O2DH 4M6OL 1GAFH 1T5XA 2EDWA 3AREB 3NJGA 5D1ZA 4WEBL 3Q5TA 1RY7B 1ZJBA 5INDA 3F7PC 1DJGA 1RJZA 2Y3AA 4LFHD 1ZTXH 1QSFA 5F70A 3V8OA 4QRFA 2J72A 4ALAL 5HYJB 5M95B 1FSKC 3EFFB 4Q52A 5C09E 1FBIL 1PY4A 4LBAA 3NTCL 4NNPH 2C3GA 4FJ6A 3B9VA 1LO5B 4NC2B 4U6VL 1X5KA 3WNOA 4AGOA 3EH2A 2XWJB 3FSOA 2XXCB 1N59A 3NCJH 3IFNH 4Z95L 2OL3L 5D1QD 3X11A 2B14A 4LCUB 2NY5H 2AJYH 3WTVA 3A23A 5F9OH 5DJYB 1WWCA 5DTFB 3OAWA 1ZVNA 3PJNA 1ZLSH 2AK1H 4WWKB 5JZ7D 1M7UA 4C4KO 5EH1A 4BHUA 4DVRH 4RDQG 3B7TA 1C8QA 3QIBB 3WIAA 1XF5A 3FQWA 3QW9A 5I24A 1BW8A 4JKKA 1NGXB 3BT0A 2WVSA 1UD6A 5K93A 5D7IF 4JR9H 2WLHA 3QQ4A 1KXTA 4GKSB 4F93B 4YDZA 4XH2A 3BUIA 1BEYL 4RAVB 1QPXA 4FCAA 3HAEG 3DXAD 5CP3A 3ZYJA 5TDPB 2BZ7A 1T89C 3F7YB 5E4AA 3IWUA 3D69A 2IAMA 1S3KL 5H2BB 3WAJA 4NC1E 1KXQA 1OCCB 1BBJB 5C0NC 3QCVH 4XMWA 3TU6A 2XXMB 2GK2A 2OTUB 2XG5A 3A21A 4JZJA 4PCTA 4UAHA 1PF3A 3TT1H 3X14A 1DUZA 3T2OA 3VXMB 3EF7A 3F00A 4ZMAT 1F45A 4UM8A 2XIDA 2FJFA 2IEPA 3P0VL 4X99A 3TURA 3GSNB 2AZAA 2BHFA 4W9ZA 1WGOA 3MUUA 3OF6D 5F7AA 4JO3H 1KLUB 2NNAA 2NLJA 2AEOA 3F6IA 4RFOH 3GI9L 3HJEA 3OAYH 3OXSB 2IH8A 3IXAA 3PG2A 4LPXA 2VDRB 4JPSA 1TQUA 1MWAB 1YQVL 3QUZC 4FQXB 4LKXA 4NNXA 4XWOD 2QKSA 3DI3B 4JDVA 3PXLA 2XIBA 1U2HA 3X3GH 4ZO6A 2CPUA 1IGTB 1KJMB 3N06B 3QJRB 2QVMA 3RPKA 2KBGA 4TUUA 1YVLA 2OQJB 3B4NA 4R4BA 5FHAL 3TT3H 2AKRB 2DYPA 2WLKA 1X7QA 1EGJL 1OGAE 3MSPA 2B20A 2VDNL 3FZUD 1XIWB 3ZVVA 3PGDA 4WGVB 3RL1A 4X4YA 2XTJD 3PAVA 3DX2A 4RFEA 3T3ME 1LNUB 4KVNH 1EAPA 1MAJA 3DSNA 4QF1B 1RD6A 3THMH 3DROA 4R5TA 4ADJA 4CDHA 1T03H 4NRZB 4ELDA 4IRSB 4K9JA 1XCTB 1QVOA 2W0FA 5AKSA 4IQHA 3T5WA 5LNDA 4KI5C 5FYKE 1RIHH 1IC4L 1ETA1 2WO3B 3AXHA 3NZSA 4BKLA 2XZQL 2Z8WC 2CM6A 3WKNA 2CRMA 3DHJA 1PSKL 5IGXH 3KDPB 4OUUA 4Y1SA 4R2GC 1IAIH 4Y2DC 5IESH 2BHYA 3LZFH 1GSMA 3D0LA 5H4YA 2BIMA 5GIRA 3WFHB 1RIVH 1MFAH 3MXWH 3QJHB 4Z78A 3MODH 2VUOA 4X8CA 3C60D 1PX4A 2X4PB 3QZWG 4WO4D 1X5XA 2DLHA 2WVUA 1FFNA 4B9GA 5JMOC 1DJIA 1KGCD 1GOGA 3WFBL 5IJDC 4UU9A 1QO3B 3UTQB 4W4OA 1RFDH 3X1FA 3WKPA 3RY6C 4LCWB 1GC1C 1QW8A 4QTHB 3EYFB 5BZWB 3MV7D 2CKBB 1HOCA 2BSRB 3V0FA 3KEHA 2V5SA 3OB0H 2WLIB 4F24A 3HBQA 4LSUH 1ERNA 3ROOA 4JRXA 2NY3B 2DJMA 5HDWA 3BSZA 3TX4A 4F33A 5ETUA 2R29L 4M8RA 1OCOB 1QLEH 4HJUA 3TBCA 4ZFZA 1IV8A 3DX9B 4XPGH 1JHKL 5DFTA 3UAJA 4L18A 3BEVB 3MX0A 3HI6H 5TFSL 5EBMA 3HRZB 4O4YH 2Q3XA 3RX7A 4JFYB 2FX8L 1NCDL 3SDDA 2JCCF 1ASOA 3EBAA 2JJSC 4HYTB 2F19H 3PWNB 3Q06A 1LJMA 1PD6A 5L88H 5ANME 3QJXA 1MVYA 5IQ9A 2EYTB 2AITA 3GZKA 5F2FA 1F4YL 3HZYB 4QKXB 1IC0A 5DJ8B 3DGGA 4NNYB 3EH4B 3IDGA 2P80D 1F11A 2Y5EA 3NCFB 4KKAC 1IBHA 1Q1JH 3F7QA 3D08A 1A6UH 4QRPA 3CVHA 3IFOA 2ISDA 2VABA 1JGVH 2VZUA 4NQVB 5GS1C 3LNDA 2KMWA 1TYJA 1ZT7B 4TLTA 5J11C 5ALCL 2B0SH 1W0VB 3GMLB 2NSXA 2OJZL 3ZE2B 3FB7B 3CQQA 1GHFH 1CDBA 2BP8A 5H35A 3QRGL 4L4TA 2X2UA 4JVUA 2IV8A 3IFPA 2EILB 2V7HB 1JF6A 5MERB 2ICWA 4I5BA 1Q0YH 3KPNA 3HKZA 4IMLB 3AMKA 2G5BA 3BKYH 3NA4A 3FONB 3T4YB 4QHPA 5BS0D 3ARGA 4BKTC 1G9HA 1XSKA 2XKNA 2JJVA 4XCFL 3RWFA 3T0AA 2JKNA 4I3SH 5IEHA 4Y9EA 2WVVA 2DQCH 1F41A 3UADA 3NJHA 4TQPA 3GM0A 4JPVL 2YA1A 3CIQA 4NQQA 2VN3A 4RVBA 4TVPD 5TPWH 2BIHA 1J1OL 3OLGA 4C47A 1P4LB 5JORA 4FN0A 4PJDA 3OKEA 3FUMA 4DP2X 3HMXL 5HI4C 1OF2B 5BW7A 1CGVA 3BZFA 4KTEL 2F5AH 3P4MA 1DO5A 5DZAA 1A6AB 2O5XL 5AYUL 3MA7B 3WY4A 3SJVE 4FF9A 2ZAHA 3RWEB 5CGBA 2W07B 1Z0NA 2B5IC 3KBEA 5CEZL 1AIFA 1QEWB 1Z9OA 3IDYB 4K23H 3TEXA 2Y3NA 1L3NA 2H0EA 1JZFA 3ZKMC 4DGVL 2FSDA 1JWMB 4BRJA 2BVOB 3US0A 3S96B 1G4RA 3DPBA 5BZDB 3AB0C 3K0YA 3MRRA 1ZXKA 2WWNA 5LLIC 3ZHKA 3W2DL 3MLYL 4BFIB 4DCQB 1A7OL 3CZJA 4G8GE 3ZGIA 4L29A 2A2QT 2A99A 1BXVA 2MTAA 1A1OB 5CFAA 3BE1L 3I6LD 2FJSA 3K1KC 4RMRA 1YEFH 1DQLL 4U1KB 4OCMC 1KIUA 3PUUA 4PJ7F 3EOBA 1ASPA 5DO2D 3VFGH 5JXAL 4IOSD 4RSYA 1KLGA 4MNQD 4EI6B 3GINA 1EEUA 3DBXA 4WI5A 5F72S 3KJ4B 4A6YB 4OFYD 4WHTA 4ZUVA 1T6WA 5C0EA 3V4VB 3BW9B 4P2OC 5C08D 4LLWB 1JXFA 1JPTL 3EYQD 3FH5A 1HHGB 4HK0A 3VRLE 3OGCB 3QPQC 1F4XH 3UX9B 4PW4A 5E2WH 3S37H 1MI5B 2G9HB 3FHQA 3G5XA 4BFRA 1KY7A 4JZNA 5HPMB 1FNSH 4N5ED 3NQIA 5KVEH 3U46A 1U2YA 4WW1A 4AQZA 2BS9A 2NTFA 2B59A 2FCBA 5CEYA 2F6AA 3OLIA 3MKKA 3T77A 1A8ZA 4BDVB 4RWHA 4PJBE 5FA3A 2VH5L 4F2EA 4HKZB 2VRQA 2ROYA 4UQAA 3KPRD 1RCYA 2ZOKB 3HE6C 1EEYA 2KLRA 2D3JA 3S35X 4ZOBA 2YLHA 1ZKAA 2AV7A 3QWOB 4KKPA 5KYUB 2NR6D 3L5WB 4G8AC 3MLWL 4X5RA 2B77A 3BH4A 1MCFA 3IRCA 4TNVK 3KBPA 3QWRD 2AF2A 2E46A 1JNJA 2OMTA 2HX9A 2EDOA 1DBML 1BLNB 3BPLC 1Q9LA 1ZS8B 5CSBA 1CGWA 2EUZA 3VACA 2W0KA 4PJXB 2XY1A 1CPUA 1AJ7L 5T3XE 1O75A 4X5LA 2Y07H 2D03H 1CCZA 1P4BH 2R7EB 2R69A 1GYUA 1RHHA 4UV4H 2ATAA 5C0BA 5I17B 4NKIL 3K71B 2J1ZA 4Z7VA 5A40E 3N43B 2EKJA 3MPCA 5KYXB 3IBOA 5B38G 3PL6C 4PJFA 1JDCA 4IRJC 2J5LB 3HTLX 1OL0A 4YL4A 3MNZA 4XNZB 1YNTB 3ZKQD 3MRPA 1M6OA 4WV1A 1BZ8A 2YN3A 1BD2B 1G7IB 1UOLA 5IW6B 4IU3A 4XCNB 3NJMA 2VUYA 4U3SA 1OCWL 4X6BB 3L5IA 2WKGA 2UWEE 5LCVA 4PJDF 3R8BB 5DJCA 3T4AC 3TNMA 4F7TA 3BWUF 5AB1A 2CDGA 5E8OA 2YRZA 4ZS7H 2PPAA 5B3JF 1E30A 5DJXB 1HSBB 3L13A 4ZRGA 4MJ6A 4YWGH 2J1YA 1R17A 4ERSL 2F8IA 2TSAA 2HLFD 4AKPA 3Q3GA 4G9DA 3UZVB 3QYNA 1IGCH 3VXSE 3MRLB 4QJ3B 4E5XA 1WSST 4B50A 4HBCH 3K81A 2PTTA 1D5MB 1CE1L 1PGRB 4V1DA 3I2CL 4PU2A 4W68A 4ZPVA 3A22A 1R46A 3BDYH 2R0LH 1J8HE 1KG0B 3RTLA 4GSDL 2BNUB 3V0HA 4ANUA 5B4MC 5JNYB 3JWDL 1FHGA 4NUGH 4P9HH 4PRIE 4XNXH 1QFUH 2JWYA 5A6MA 1KDIA 3NFNA 2YQGA 5DVPA 1L9MA 3LXBA 2VZ1A 2DIBA 2WV3A 3R18A 1PVHA 1EHNA 5FGBC 4M3KB 4YX2H 5GS2H 5FUZH 4GKOA 1EJ8A 4WI4A 4F7KA 1GGYA 2KZBA 2WNKA 5E9AA 4Z6AT 4F92B 2V7NA 2MHAB 2BFVL 4XCEA 3BT2H 4KUZL 3RWIB 3QEQD 1MJJA 1U8NA 1OGAA 2FUQA 3LN4B 3QIWC 4WIQA 5IKCA 4C56B 4R26H 4ZDHA 2DLFL 5FCUL 4QHUB 4LPVA 1FZOA 4OD1L 4LEXL 3K6OA 4WI8A 2FIKB 3RURA 4JY5L 4RISH 1NQBA 2D7MA 1XGPB 1KB3A 2XIIA 3IDNB 2D9CA 1DDHA 2VRAA 4D9QE 3OKKB 2J43A 1E8ZA 1SYSA 1WBXB 2GJRA 2Z31C 4LSVL 2NY1C 3P2TA 1I7TA 5LBGA 4CU6A 3NK4A 5I74C 1DSYA 3MROA 1JK9A 4XNMB 3AABA 2PNDA 3MNVB 3OHXC 3KH3A 1CYXA 2XTLA 4M6NH 3RIFF 4PRPE 2Z91A 2BY1A 4FXTA 35C8L 4F1SA 1N4XH 3WHXA 3G04B 2H3NA 1BAFH 5KBDA 2Q8BH 1ZDQA 3U4EA 2R0KL 5FYJL 4KRMB 4MQSB 1NUGA 1YCSA 3HBGA 1W72A 4PTUB 1CFNB 1PLGL 1VFAA 2OS7A 2WTRA 5CUSH 3QC6X 1NAKH 3NSCA 4YHLH 4YVNA 3J2PA 1XGTA 4FFWC 3L4YA 1X4XA 3MA9L 4ODTH 3SDXA 5FGSA 3IJSB 5IIEA 3EDEA 1H6TA 1D5IL 3PGFH 5GRXG 3O8XC 5D93B 3KLSA 4PJFF 4OLWL 1A5FH 5TE4L 3SHSA 5MI0C 4EOWL 2Z8RA 4NJAH 3ZTCC 2WXIA 3E6FA 3VDBA 1DVQA 5IBUB 5ACLA 2A9NH 3WFEH 4YLCA 2AABL 2C9RA 3QUZD 3KPQA 2H1PH 1OP5H 4D0BB 4YO0A 3JZYA 4JG0L 1HL4A 3EO0B 4U05A 3FTXA 2BNQD 1G4MA 2CO4A 5AW7B 2P8PB 4TV3A 4O02L 5TQ2L 3KS0H 3BI9X 3R0MA 1PZ5A 3PNWA 1OSPL 1O6SB 2X4RB 1LQBC 1CFTB 1UH3A 3MACL 4M7ZC 5L2KB 2EE9A 5ECGA 4OD2B 4ZD3H 3W5MA 4JRYB 4L05A 1RUKH 3HLAA 2WUBH 3A4FA 4LP8A 2ESVD 4XO5A 4EVNA 3G6DH 4M1GL 3RQ3A 3T0EB 4YHPA 4KNQA 2IXQB 4A67A 2ICEA 5E5UB 5FECA 5DI8B 5IOPA 1F3RB 3OB8A 1K3ZA 3OMZA 3V6FA 5TF0A 4KI5D 1T1XB 1RIUH 1NA8A 5DWUH 3BCDA 4OLXH 2CIIA 1CXFA 1HCVA 5DC9B 4R2GD 4Y2DD 2EDMA 4PWEA 1Q72H 2OL3B 4I4WB 1LEKB 1WIOA 4HEPA 4LL1A 4Q6KA 3DURB 4LCCB 1OCRB 5DJ0A 4HS8H 3WIHA 4G9FB 2ZKWA 5KJRH 2GI0A 3UZEC 3QDGE 4DP4X 4JM4H 4G43B 4JFTA 4IHOA 4GMTH 1X9LA 1E4XI 3K2UH 1B9KA 3QFJB 1XH0A 5CIPB 1IKNC 1YPZF 2VAJA 4PW3A 1EZLA 5E8EA 4XPTH 1WCQA 3REWB 2DYSB 3NCEB 2LVCA 4P5MB 4HZAA 4OCRH 3VXNB 4U1JA 4I89A 2WZPD 2CBQA 2K78A 5AW1B 3VXTA 1TU2B 1TPXC 1SJHB 1UEMA 2EIZA 3D9AH 1CQYA 3QCUL 1HSAA 5K9KA 1F3JA 3ZTDC 2G2NA 3W38A 1SLXA 4LOEA 3KHOA 3BGFC 4OGZA 1QG3A 1DZBA 4P2RB 1WCBB 1K4CB 2BNRB 3NZHH 3FSAA 4PCKA 2AJYL 4LNRB 5EZLA 3QXTA 4W9KC 4TPRH 1I4FB 3RAJL 3UTPE 3F3HA 1XR9A 3LRSA 1F86A 3WS3B 4E41B 2F1BA 1HESA 5CLTA 2WB7A 3KPSD 1N7ML 25C8H 3JV6B 1RHFA 2NXYC 3EOAA 4GAFB 4KJQC 3NBNA 3SDXF 5IW1B 1D6VH 4JR9L 4QKTA 1MY5A 1LO4L 1UCTA 4AVIA 4KKAD 1KXHA 4RX4A 4ZW5A 3CZSA 4R7XA 2Z7UA 4KKQA 3MLUH 4B9JA 3DUHA 1HHIA 1KJ2H 2BFGA 4Z5RB 3DK2A 3NCYS 4PJ5D 5HDBF 2CUMA 2PTUA 4JN2B 1JUFB 3L3GA 1NGYB 2J7LA 1CVRA 1YECH 4P2CG 3B6SA 3KL3A 4G7RB 5D2LF 4KZCA 4UNIA 5TF1L 1AG6A 2VM3A 1NOAA 2VDNB 1S7WA 3QQNA 2M1KA 4M43H 5F1IB 3UDWA 4GUCA 4G82A 3VG9B 3MMEA 4NQDE 1SF3A 2YXFA 3ZN6A 5PCYA 2NY6C 1MIEL 2QTEA 4MJIE 1AQKL 1FZJB 2WZ6A 3L95B 4AY0A 5TDNB 4IU2B 3TBSB 3BKMH 1K5NB 2VB5A 4M93B 4MRBA 3WJMA 1QNZL 2DJUA 4KNSA 3QJQB 4LKCB 2Z93B 1T1YA 4R96A 3NIGE 4NKOA 4Y7MA 2WYTA 4I0PA 4YSSA 3VD9A 5DR5L 3CAFA 2ZOLB 3HFMH 4WFGD 4PCYA 2FHFA 2PYFA 2ZXDA 3HE7C 3JTSB 2FBJH 4DN3L 2ARJQ 3I6SA 3X3GL 1L7IH 4DERA 5I6NA 4XO4A 2ZOOA 3RVTC 5EF3A 3CDYA 4OZIE 5ERWB 5HI4D 2OJEB 4PB9L 4AWJC 3AXIA 2VLRA 4MSWB 4FTVE 1ZA6B 2L7JA 4H0HB 2J1XA 4U6YA 5E99H 1S5IH 5F3HA 4P8QA 4ZFFA 2FSEA 4NQCB 4WI0A 4O58L 1JI2A 4NPKA 4HFWA 4ZFQA 1D5ZA 3ZKMD 2Z4TA 1EK3A 1AGBA 3MLXL 3ABGA 3MZTA 4KVNL 1BIIB 4UT6L 3G3LA 1L9OA 2R2CA 3FH7A 2ADFH 4F7MB 1BQHB 3UGUA 2VQ4A 3GC3A 1B9ZA 2AJXH 3MRJA 4HALA 4L8BA 3CZEA 4JFED 4HEME 1E40A 1CI5A 2RFXB 1UWFA 5BO0D 1S7XB 2QSQA 4I18B 4YDMA 1NEPA 3FN0H 4X5XB 4AQ1A 5IGXL 4M9OA 1JERA 1IQDB 5KSBF 1CXEA 1O6TA 3E2HC 2UY7A 4ZMPA 5ICZB 2R9HC 1OPGH 3OSVA 5CMAB 5GS3A 1A1NA 3ASOB 3EFOB 3WNIA 5K5YA 4NUPA 1CFVL 3OHMB 1L9SA 3QDJD 4HUXB 3U2SA 1ES0B 1MDAA 2WBJB 4KGLA 4BINA 2V9TA 4I48A 1GIGL 3V5DB 4LMQI 3BH8B 2EZ0C 4HS6B 1M53A 1I1CA 2GQHA 2G2RA 4FZEL 3QARA 1WP6A 4GW5B 4P2OD 1X5IA 3MUY1 3GF8A 4UUJA 1N19A 4OV6F 5E08H 3L17A 4WU7A 43C9B 3QPQD 4AC4A 4Z8FL 1NMCB 3MRDB 3QG7L 2YPLD 3TA3C 2GJZA 5EUOE 2GSGB 1WWAX 5DUPH 1NCGA 1KWKA 1D7DA 1UKTA 1E9OA 2J2ZA 1JK8B 1Q94B 4K7FB 5CD5C 3BSZH 1QMUA 2I9TA 3V0WL 1PBYA 1QLEL 2Y1ZA 3GZPA 3QIUB 2XUWA 4PGEA 1LQSR 3S5LG 1JZHA 3C08L 2E7BA 5I1EH 1S9YB 2V2WA 4H8WL 1NGWB 3CSFA 2IWFA 3SKNB 5J7CC 2JJTC 3FBQA 3GXFA 5B1AB 3RKDC 4Z7UB 2XFXB 1AXTH 4YHOH 3WN5C 2PO6C 3DLQR 3HE6D 4YJZL 5LXGH 4CVXA 2EDTA 3PHAA 3U9PL 4QCIA 4QRRB 4QHNB 5LDUA 4JKPH 1BZEA 3L4XA 2DAVA 5C2UB 1MFMA 4AG4H 4OLYH 1EFXB 2GAZA 2YGPA 4P5TC 4U6XB 5JOPD 3FQ2A 2VERA 5E4EC 5JUEL 2DEWX 5IB4A 1XB8A 2EYRB 3PY9A 1QHPA 1TTCA 1K8IA 4FI8A 3RWDB 3CVHH 5F7WC 2R56L 4CADB 3F64A 1TO4A 3G5VA 2EH8L 1OGSA 1EHKB 4KY1H 4PMFA 5EU3A 5AUMB 1EV2E 1CG9B 2XN9A 2VM9A 4ZNEE 4GYBA 3QWQB 2JELL 2IOOA 3C5ZA 1S7VB 1LP9B 1ORQA 3D2UD 3PL6D 1DVZA 4PI0A 5CSZB 4IRJD 3AWEA 5KTEL 1KCUH 3FO1B 5I5MA 5K39B 4DF9A 5CEXA 4JDEA 4Y4FC 4LF3A 4ZTOL 1DVFB 3MV8A 2MCG1 4RIRA 4X2UA 2J4WH 2ODIA 4Y9BA 1UVQA 1T2QL 1JD9A 3BRGC 1HQRA 1XGQB 2IOIA 3LKNB 4F7CB 4W9JC 3NZUA 1MQKL 4BZ2A 2YXVA 4ZNCD 1X44A 4Y9CA 5C0RH 4HSQA 5FGCE 1J0IA 3ZSTA 5C0CE 4FQHB 3TJPA 3CSBA 1PMYA 5F7BA 4F2MB 3VGAC 1BJ1H 4ORGB 3LTVA 1IT9H 1RU9H 1KYFA 1REIA 1SYVA 3H8NA 3QJVB 3CSYB 5B4MD 3GS0A 1AY1L 3CK0H 3ET9F 1PG7X 3HNSL 3N2JA 4IBZA 4X9GA 4QI3A 2BIIA 3T8VA 1RULL 4RGMC 3NH7L 4DP5X 2XPGA 3ZE1F 2OMYB 2DM3A 1JV2B 3DVIA 3UEQA 3H7BA 4XN7A 2XDHA 2DWDA 3SQBB 3LNEA 4ZFOL 4JG1H 4IKNA 3VD7A 3ATFA 2VJ8A 5DJZA 3HHSB 1VADB 3BP5B 2MCAA 2Z1KA 2DI7A 5E70A 1QATA 1RK1A 4OJCA 3GYRA 2G3MA 1BVLB 1D9KC 1N2RA 3JWOL 4WNQA 3O4LB 1XH1A 4Z7OB 5JYLA 3OPUA 5T5NG 1YO4A 1JPGA 3BDBA 2CLVB 3LKQB 3C2SA 1NUFA 4HAGA 4JFXB 4G42A 1CDUA 3QIWD 3CVCA 1NC2B 4BWWA 2PWGA 4LHUG 3D18B 3OKLB 3ZDZE 3O6KL 2E7LA 4HCIA 3ZUNC 4J3VA 1ANUA 4P2QB 1I9JL 3KDMB 4H20L 4YSRA 5G55A 3UTSE 3FB6A 1G1CA 1UZ6E 3VFRA 3UYRH 1MH5A 2GB2A 4YSEA 3VFWB 4MD5A 2P44B 4PS4L 2G3ZA 1VHPA 2VR5A 2Z31D 3IU4H 2HZHA 2NY1D 5ICXA 4CC4C 3WL9A 1PKQB 2ENJA 4XP9L 3WNMA 4ZQKA 2MH4A 4NIYE 2EIJB 2X1QA 4KHTH 2SEBA 3JYCA 1F4XL 3X1EA 1Q38A 5MEPB 1PG7H 2DL9A 1D2PA 2Q76A 5I6OA 3AT9A 4QRSB 1L6XA 4PJ8B 5GRJH 4HWNA 5KVEL 2CCVA 4L3CB 3ARDA 5CZXC 1QLFA 1GC1H 3Q8CA 3I3EA 4HWBL 5EU5B 5HHQA 4JDZB 1C5BH 1RZ8B 3EFDH 4Z3HA 3UYPB 3OMNB 5B22A 4LVHB 3QZNA 2VLJD 5D96C 5GJSL 3FRPB 5D2NB 2IH9A 5E7BA 2FGWH 2WWKO 1QSEE 2HRPL 2Q20A 2A73A 3MV01 3LX9A 5EG6C 1ZANL 3LMJH 2OCFD 4FFWD 5AWNH 1BMGA 3ZDYF 4A2EA 1H3PL 3SEPA 3ARFB 2YD3A 1OIOA 4CBPA 1XMWA 4GBXB 1SY6L 1NCWH 3O8XD 3UBXI 3RY5A 3O81A 4A2DA 3A6OA 1WEJH 5A2AA 1NGZA 1XCQA 3AQZA 5DEFA 1RUPL 4L1SA 1GCFA 1RLBA 1RZIA 2PWDA 5EZOH 1W91A 3LQZA 4PJGA 3IXTA 3RFZB 5HHMB 4G6JH 2HAZA 2HH0L 2Y07L 1P4BL 2R69H 3PWPE 2VN4A 4I1NB 4JFFB 1C5DB 4NENA 4PY8I 5HI3C 5IHBA 2F68X 5E94A 3IAGC 3GLDA 4P4KC 4UV4L 3STLB 5ACMA 4D94A 5AKRA 2IMMA 1E6JL 4WTQA 3G08A 2LLLA 4GQ9H 4X7DC 1T04B 3QJFB 1ZLWH 4LDLB 2QPEB 5K9QI 2EEBA 1K6QH 2YK1H 5KBPA 1ZWIB 3SPIA 2LAAA 3QXDB 5IQ7H 1SJMA 1I8UA 4Y5VB 2AJSH 4AEEA 3V2AR 1IBYA 5LCVH 3BIBX 3FBKA 5HDRA 5I30L 5DVNA 3SKOB 4ODWA 1AKJA 2FO4A 2EQDA 1MFEH 4N2FA 2BX5A 3B7RL 4ZS7L 3LDBB 4G2AA 3M86A 3NFPB 4E5XG 1ZGLA 1FV1B 4YWGL 1NGQL 3QNZA 4EKXA 4E9VA 4LARH 3RGVB 5JPNC 2AQ3A 3L3DA 4JJ5B 5DMKB 2Y36L 1V05A 1F6FB 3WY1A 1T6VN 3FB8B 4NGHH 4L9LC 1U3HB 5G5DA 4HXAH 3AC0A 1SVCP 1MRDH 4TOYH 3WMPA 3TO4A 3E8UL 4AGMA 4MDIB 5E1QA 5BJTA 1S4IA 4DPRA 4MHHI 2P24A 3WJJA 4XNXL 5D7HA 2GBVA 1XSIA 4M03A 3SKJH 4J7RA 5D7LB 5E56A 5FM5M 2NY0C 3K6SA 4HIIB 4PJCA 1NAMH 1NCBL 1MCBA 1U8PB 3BKJL 2ED6A 3MGTA 3RU8L 4BK8A 1HJBC 4XNDA 3BPCA 1GSKA 4MYPA 3QULA 2R23B 1IM9A 4RRPA 1SLUA 1OT4A 5AAPA 3ULUE 1UEYA 1FIGH 2H2PC 4XBPA 3U6XS 3WN6A 4Z3FA 2W91A 2WSKA 2UZXB 4IGBC 3VJ6A 4PJAB 5IWLC 4X6EA 1MCHA 2EKSA 4FTVA 3VDAA 2AEPH 2BOCA 3FAXA 4R26L 1CLYH 3MBEA 1JV5B 2J55A 1UOVA 3WUZA 3QRLA 3ES6B 3E9UA 4BZYA 2HVJA 1BVKB 3NIDE 2AJ3A 5B39A 3I85A 5ITBL 4RISL 3F7VA 1H3GA 4GY4A 4NFDA 4ETQB 1UB5A 3IGUA 5CNHA 4I9WD 3SYOA 2WM0A 4QUOA 4E68A 4WRLA 3VWJA 2LABA 1DE4B 3JUZA 1JXJA 1OZTG 3CXFA 2DWYA 2WYHA 1E4XL 2VM4A 1ONQA 2F8VA 1YDPA 4NPJA 2EXWC 3W39A 5I76B 3NPZB 2NXYD 1I3GL 3L7FB 3NA9L 4KJQD 4AYBA 1NBVH 2ODHA 2CK0H 1KTLA 2PW1B 2FAUA 2PXYA 4MMXB 1BAFL 3TPUB 2A38A 3LKRA 3B2VH 1BXUA 1UJTA 1NGPH 1FHNA 4MCYB 1I8KA 2Y0SA 2XNAB 4LO9A 1W72H 4KXZH 4OKDA 3DX8B 3F62A 4X0KB 5SWZD 2RJMA 1MCDA 1RZ7H 2OMZA 4PJGF 1E4WL 1QFWI 3BIKB 3I6KA 3EG9A 4O02B 3I50H 4HJTA 4YHLL 4BZ1A 3MV8D 2JVUA 1LK2A 4XO3A 5EUOA 4ODXA 4DESA 4X4ME 4ODTL 3PJSA 5TJWK 3OTTA 3PAYA 4HT1H 4KRPC 3IVKA 2Y7LA 3WI9A 3BVWA 3AS1A 3ZT5A 4TNVF 1GA2A 4YZWA 4DFHA 3APFA 3ULVE 2NY6D 3IMUA 2IANA 3QI9A 3QUXC 1M1XA 3VU1A 2CMRL 4K9EH 2IV9A 1OF0A 5HD8C 3UZQA 4ZUUA 1ACXA 2W81C 5D70L 3WFEL 2YIHA 2ED8A 2BVPB 3DOSB 4IDJH 3OAZH 2X2JA 3ECVA 2Q0ZX 4HPOH 1RLWA 5A2LH 5IVNA 4DGUA 1CE6B 1R5IB 2APTA 3HE7D 3IU3B 4OF0A 4TSBL 2CCLA 3CH8A 2FO1A 1NLDH 4G7VL 1MI5E 4EBQH 3RVTD 3DIDA 1AE6L 5CP7A 3DDFA 2AGJH 5D6DA 5C0AB 4DN4L 3Q2VA 4NZTL 5I1DA 1F4WH 1PZ3A 3LZOA 5BUAA 1A0QL 1KC5L 4X9YA 5IMMB 4X6CE 4OF3A 5FOBB 2XN1A 2M8XA 4MAYB 3P0GB 4HKJB 1VPOH 5HGDB 2QELA 3L3HA 4NCC2 3MLVL 4HV8B 4ZD3L 3L1FA 4L4VA 4GKNA 1IAIM 4Q9RH 3SDCB 3P9MB 5I9QB 3EOTH 5GZOC 5JQHC 3AREA 4TVSa 5EU6E 5ECJE 4LPWA 1DQDL 4G8IB 4PJCF 5HYJA 5FR3A 3EFFA 3BZEB 1JMZA 2WQWA 1YY8A 1W80A 3FCGA 5KS9E 1LO5A 4HEPG 5K59F 4AYGA 5IQLA 2FJGA 1ZCRA 3VVWA 4KV5F 3SDAC 4ZMVA 2CJUH 4PJXE 2K70A 1Q72L 2R9HD 4FL4C 3FFCD 2X7LB 1R33A 2WIIB 1R3LB 5DJYA 5DTFA 3T6XA 5FYKU 1CU4H 3U9UB 4WWKA 4TVPL 3S36L 3F2LA 4M8VA 3ZBMA 3OKOB 4K55A 3TZVB 3WIHH 5ESVB 5IVZB 4WW2C 2EZ0D 1E8YA 2B2XH 1BMZA 4ZI8A 2WBXA 1AC0A 3DTXB 2NXZC 3QIBA 1PQZA 4GMTL 1ZSHA 5IK3B 3K2UL 3MRNB 1BP3B 2DKUA 1NGXA 3HIZA 1EXGA 3ZL1A 4H44C 4JJOA 4QOKB 4GKSA 3SGKC 4OCRL 3TA3D 3H0TB 3HS0B 4PM1A 5KG9B 1KTDB 4RAVA 5IMLB 3WNJA 3EOYG 4AVHA 3FULA 5CD5D 3D9AL 2RTTA 4XMKH 1WK0A 3F7YA 3CIAA 5H2BA 3NIFF 2KLSA 5SX4H 5DQJB 5BZXA 1IC5H 5E9DB 2B4CL 3WMSA 5L4JA 4UNVA 4PGBA 3DX6B 3L6FB 2H5UA 3VM7A 1ZEAL 3FYIB 2OTUA 3UJTH 3VXUD 1KN2H 4JBSA 5FM8A 3RKDD 4PH8A 3VXMA 4J3BA 6PCYA 5JDSA 1PAZA 2PO6D 2JFCA 1CFQB 3G6JE 1EBPA 1M2OA 1YUKB 2ZKHH 3QP3A 4GRLB 1LXMA 4N8VG 4OZGE 4APQB 3GLAA 3U36B 1HI6B 1BECA 2IALB 4JFDA 1XGUB 4QHKI 2EC8A 2WZ0A 4HLZH 4JKWA 1KLUA 4E9TA 3IPEA 3ZE0E 4F57H 3KYMA 4GP8B 5ISZD 3VW3H 4P5TD 2WN3A 3OXSA 4TSCH 1S9WB 4DGYH 1WFJA 1KEML 1N5AA 1MWAA 2A9CA 2CK2A 3BFQG 4FQXA 2X9XA 4QYOB 4JHVA 3WD5L 5FW8A 1PL3A 2YFOA 3MFFB 3U4BL 1FL3B 4M5SA 4FLQA 1XL6A 5B8CC 5E2VH 2R0ZL 3K4DA 4OQTL 1YZZA 1AGCA 1H6UA 4OIIH 3UABA 3WS6C 4EDWL 4DP7X 4UQIM 1KELH 1OW0A 3ECBB 1KJ2L 1U8LA 1IGTA 1KJMA 4P4RB 4TUJB 2CO6B 2OQJA 1AS8A 5D1XB 5ABDE 2AKRA 3W5NA 1OTUC 1JCVA 2LV4A 1KSRA 2HFGH 2WKLA 4OCSH 2VIRB 1XIWA 5EZIL 3KLHC 2XBDA 4NQXB 5T1LB 5IHHA 1IC7H 4DJMA 4Y4FD 1S78C 1G7HB 3UGEA 1CGUA 5TQ0L 3RDTA 4J6RH 1G7JA 3MLPA 4PRDB 4FP8L 4QF1A 1W8NA 1EEZA 3CD4A 2PF6A 4OM0H 5F3BB 1QRND 3BKML 3BPNB 3K6FA 4HJ1A 4NRZA 2N7BA 4RMWA 4IRSA 4KXDA 1TCRB 1D3CA 4JY6B 4UIKH 4F27A 3QA3B 3IAQA 1EWHA 2RMNA 1VEPA 2YEQA 2HKHH 2V37A 4HQQH 2CUIA 4EUPB 1WAAF 1IL1B 3KWVA 1MXDA 1AH1A 3HC3H 2J6EA 5CM1A 1OE2A 1TF4A 5JA8B 3QJHA 3KLLA 5FWRA 2Z92B 3GGWB 2X4PA 4JM0A 5HJBA 4YEEA 5DQDL 3ZMEA 3MOAH 4AW7A 2YD4A 3MN8A 4EI0A 1QO3A 1FFOB 1HH9B 3CQFA 1FVDB 3UTQA 4JCLA 2RCSL 4PS3A 4JFQA 4LCWA 4QTHA 3EYFA 5BZWA 4PPTA 1TZGH 4U1NB 2BSRA 2WLIA 2ADFL 1D9KD 4IBYA 4JUSA 3A6BL 1MCLA 2JB6B 4U0RB 4WKZB 3ALXA 3MV9D 1WZKA 4Z9KB 1GMEA 4AV5A 1U42A 1A6WL 4G6MH 1CZ8H 3NEXA 5DHXB 5I0WA 1HHHB 4Y16C 1QLEB 2DWXA 3DVNB 4YHZH 2EXYC 3DX9A 2ENPA 3FUNA 3BEVA 2DIJA 4N8PA 4B96A 4D7BA 3FTSA 4JFYA 1EMTL 3WLWC 2VTFA 4RSVA 3NSDA 1JFQH 2C9UA 3PWNA 2PP7A 4MNHA 5DD6B 4D7PA 3QR0A 2BOLA 5DMYA 2EYTA 1CICC 3HZYA 1GMIA 3QDME 2Y1YA 4NNYA 4N2OA 2LLGA 2AK4B 4PJIF 1U8KA 5I15H 3VWKC 1QSZA 3MUGA 2YSTA 2P5ED 1FYTB 1O7DE 3QO0B 2VDML 1II4E 3EUUA 3GRBA 4NQVA 1ET5A 4YFLF 5CZXD 1F4HA 5JDJA 5KSAB 1ZT7A 3T0EE 1W0VA 2UV3A 1OP9A 1P6WA 3FB7A 4GG8A 3ZJAA 3WUWG 3TYGH 3O3AB 2OYPA 4AVJA 3PCYA 4YDKL 5JIPA 1QBLL 3ARBC 4N2CA 4CGTA 5SX5K 4JPIB 4LOFA 3AW5A 2EDJA 2V7HA 5MERA 2RAMA 3NUKA 3P11H 1PZUB 4EXKA 2NX5E 1GZQB 4UQ3B 4IMLA 4BCXA 1HQ4B 4YXKH 2V2TB 3ZYOA 1PU0A 1A7NL 3FONA 4HC1H 4FXGC 1DBAH 3EGDB 4J4PC 5ABAA 4FI6A 2BSSB 4MS6A 4EXPX 4NT6B 4WK0B 5GRVL 3IBEA 2OMVB 1HOEA 1T7YA 1QWHA 3MUJA 1JPSL 4YHYC 4G9FE 5FWQA 1GY1A 1L9QA 5HI3D 1CWVA 5E6UB 4HOXA 3ILDA 1CJYA 1CTOA 4N2KA 3MJ9A 4P4KD 3ZY7A 1P4LA 1CD9B 1ECYA 3CC5B 3CG8A 5F1NB 1U8CB 4AQAB 5CCJA 1OF2A 3INOA 3UTZB 3UTTB 4K5OA 3MOBL 1J88A 3D5OF 5B8CA 2FIRT 3GSRA 2ZUXA 1A6AA 1H8NA 2GSIB 2QZQA 3QJSB 1KGWA 4MJJA 3MA7A 2OAAA 4Q6IC 4ZFOB 4XMTA 5KW9L 3ABLB 2WKOA 1MFBH 4Y19B 2DMKA 3P3TA 3Q44A 4QGTA 5KOVC 1QEWA 3TVMC 4WGKA 2COVD 2J4WL 2LHAA 3DV4B 1L5GB 4NQEB 1KIQB 3E6HA 3P4LA 1JD7A 1IBDA 1JWMA 2BNRE 3APNA 4BZ2H 4HGWB 4P3CL 4Y5YC 2BVOA 1MIMH 3U4AA 3S96A 5BZDA 4LPTA 3IK2A 1UD4A 5BOZG 5EORL 3ZTEA 4D2NA 4O2CB 5GRUL 1DJWA 4S1RL 4BFIA 1NCIA 4RGNC 1IT9L 2OZ4L 4Y5XB 5TE7H 1O6VA 5EU4B 4PG9B 1A1OA 3DSFH 5GGTA 4U1KA 3Q6FB 1CO1A 3DX7B 3PU7A 4TRPH 1PFCA 4HKBB 2DI9A 4EI6A 2BVYA 4A6YA 1G9MH 2FB4H 2NY0D 2ZT9C 3SE9L 5F7DB 1G5AA 3V4VA 3BW9A 4LLWA 1QKZL 5CR1A 2CH8A 2DMGA 1HHGA 1PKOA 1CLOH 3RVWC 3RVXC 2H2PD 2XVBA 4JM2C 4JQVC 4XVSL 3VE0B 4UM9B 2G9HA 1KCBA 4F8LA 4IGBD 1J05A 3EJRA 1WBZB 3O3DA 4QLRA 5HVHB 4Q4IA 2DS4A 2K6ZA 1OPOA 4XXWC 2UXTA 2VXSH 1CDJA 1AVAA 2IGTA 5CHNB 5F0PB 3GIZH 1NIFA 1UH2A 1SEBA 4BDVA 2WXLA 2XA8H 5KSVB 5IVXB 3FU3A 3N9GL 4EF3A 3HRPA 5CJQL 2OCJA 4XE0A 3ULAB 2ZOKA 4P46C 2X4QB 4GUPB 3AUVA 3MRQB 3QWOA 2K3HA 4Q58C 5KYUA 2XBZA 4WENB 3L5WA 4GXVH 4XMPH 2X88A 3AJ7A 3QUYC 2WLNA 2HPTA 5D1QB 3ZE2F 5CBEB 3NSXA 3H9SD 4ODSH 1KPVB 5EZPA 3APMA 4KKRA 3EBHA 4FQJH 4BWUA 5KYYB 3MGOB 4N0UB 4B3VA 1AG0A 1BLNA 3GXTA 2J8UF 4QWWC 4TLKA 2OP4H 5EEXA 1ZS8A 2IBZX 4OM1H 5HPOA 4KKLC 2EXWD 2NNRA 4AOFA 1LE9B 1BWWA 5SWQA 3D25B 5EFIA 2R7EA 1P5VA 5D5MF 2DQTH 5GRJL 3FK3A 3B8SA 4ONHB 3MJ8B 5I17A 3MCYA 3ZZ1A 5F96H 2DQDH 3QISA 3K71A 4NN6C 5KYXA 4G3YL 1T22B 3E1F1 5AOIA 3MJ7B 3F65A 1YNTA 3A47A 4WKXA 3DXAB 3SSGA 2N1TE 1BD2A 1G7IA 1YMMD 1KACB 1YNLH 5IW6A 4NWUH 4XCNA 1CUOA 1A6TB 1DCLA 2CRIA 4KRPD 1NPJA 1OAYH 2CR6A 3SB3A 4RGOL 2WQ8A 3A67H 3VI3A 1T6BX 4WAFA 1HSBA 1TQCB 5DJXA 3U1QA 4JO4L 3SCMC 1KBGL 3QUXD 3OR7B 4K3HA 1UCBL 5KVGE 3MRMB 4FE9A 5E1IA 2QLYA 5HD8D 3AU0A 4IK6A 3FTWA 3UZVA 1LGVA 2WKOF 3EF4A 3MRLA 3IKKA 5E2UH 3IM1A 3TFKC 2IWEA 2QJDA 4YE0A 4P3WA 1D5MA 3ETTA 2X6UA 3PQYD 4HHGA 4ENEC 2Q5BA 5JNYA 5KVFH 2NZIA 2BNUA 5B1KA 1EIBA 1NSNH 1QFWL 4C4BA 4N2AA 4LDOB 4PB0L 3T0WA 4Y1AE 1FP5A 4U1IB 4LHJB 5IQOA 3JWNH 1U30A 2H6PA 4MA7H 3PIQB 1PX3A 3ZDXE 1J5DA 2F74B 3Q2NA 5J6HB 1IAKB 3QK0A 4MXVE 1YYLL 3T65B 3VDCA 3CVBA 4A66A 5GZOD 4A37A 3DYOA 5E6IC 4K8RC 5AW6B 4H4NA 1LWJA 4EPSA 3EADA 5D7KE 4UTBL 1UH4A 2XTJB 2JI1A 2ZCKL 5IG7A 2AI0H 4CUCA 3RWIA 3LN4A 3GHEH 2D0GA 1OGPA 4C56A 1AO7D 5JXEA 2VL5B 3RLSA 4FG2A 1B6DA 1V7NH 3Q1EA 4HXAL 2VO5A 1LHZA 1BZ9B 4PRNB 4CSPA 4OFKA 5C8JB 4JQIL 4TOYL 2K9FB 4PRAA 3SDAD 2FIKA 1CR9H 4JKMA 4M62H 5EIIG 4L0YA 2I07B 1FDLH 1SXCA 1XGPA 1WFUA 3GRWA 3IDNA 4RRPG 3MLRL 5B3SB 1E5YA 2DQHH 3OKKA 3TH4T 1WBXA 4AYFB 5BMFL 1TR7A 4LASL 1NAML 4P07A 1MVUB 2XVLA 4FQLL 3RUGF 9PCYA 4XNMA 5DDHB 3MNVA 2Y22A 2NQDA 2SODB 2NXZD 4GAGH 4R0LC 4WO4B 5L8KB 4JNXA 5LNGA 5I1GL 4P59H 1IKFL 3F7LA 3G04A 3FT9A 3FU5A 1AHMA 3RRQA 3ZKXC 3LHPL 2FATH 1BFVL 1EQWA 4OZ4A 3QZPA 3HVNA 4PTUA 2AMUA 1CFNA 3MV7B 4F20A 2GEEA 3VXPB 4WFFE 2J6WA 1OWWA 2KHAA 4OJEH 4CNIB 1HKLL 1MQ8A 1ZPLA 5C86A 3NP3A 4AYEC 2VXQA 4GI6A 5JIIA 3LNFA 5HDQL 3ZKSD 4ZBJA 3W1ZA 3IJSA 3LJ3A 4B95C 3N43F 5D7IB 1AFVL 4NSKB 2F08A 4QAWA 4Y88A 5C3IA 3SOBH 1YNTF 1EDYA 1JDDA 4F15B 5I6XC 1FRGL 4W9LC 3WSQH 4WNSA 2VW6A 5CJOH 2IG2H 3LPFA 1LD9B 4B41A 1X4YA 5DURD 2XX0A 1H8LA 4DQAA 2GJ6D 4MJ5B 1BVOA 4K7PL 3VI3F 4D0BA 1HNYA 4W70A 1DQQB 2XWCA 4XAKE 2I60H 3EO0A 3H9ZA 5E8DL 3VFPB 1G7QB 3SE8H 2A9AA 1UUSA 4TKWA 2P8PA 5EBWB 5C7XH 4AYDC 4MVBC 5CJXC 4BZ1H 4C4KT 4Z76B 2GT9A 2XRAH 5CR8A 1O6SA 1OTUD 2X4RA 3BCFA 5LWYH 3SO3B 1CFTA 4Z3TA 5L2KA 1JI1A 4IRZL 4OD2A 3KLHD 2B39A 4JRYA 5JIHA 1AHKA 5G4MA 1M7DB 1CDGA 3N41F 1J9TA 4ZO8A 5HGHB 1S78D 1OTTC 2J8HA 3LYRA 3T0EA 3KPLB 1JZJA 2ARJB 4YQXH 2IXQA 3TEYA 5DI8A 3F58H 5IJKC 3Q8FA 4LHUD 2PW2B 2FATL 2G3NA 4U1GB 1T0NB 5GZNA 2YWYA 3RZCA 1C16B 3SCMA 5AZEL 2VDOL 4RQQB 4FXKC 3VAEA 5I26A 2WO4A 5FPIA 4ODHL 4RWYL 4NDMB 2OL3A 4GAJL 4I4WA 1XR8B 1LEKA 3T2NL 4ODBD 4FKKA 3DURA 3E8VA 4HXBL 1BG9A 3VH8B 4IIQC 3O6LL 5DC2A 3SYAA 3ZYIA 1EFQA 1WZMA 2FX9H 2HXAA 2DQIH 1F4WL 2EEDA 2E8YA 3BGMA 3RYMA 1A25A 2ERJC 3HC4L 1UHVA 3BPOC 1QWNA 4G9FA 4XMUA 3MRHB 2FZ3B 4G43A 1XO8A 3QFJA 5EB9A 3B2PA 5CIPA 5D2NE 1U4EA 1CBJA 3DOHA 3QXVA 3CZUB 4W81A 3L16A 5T3ZE 2ITFA 3REWA 2FVNA 5K1VA 4JB9H 4P5MA 4J3OF 3VXNA 4U3HA 5D1ZB 2CO1A 4G8EA 2AAAA 4KMTH 2ZWSA 5C09D 3O11B 2KZKA 1YN7B 1MF2H 3K5RA 1RPUA 3JV4B 5JA9A 1WT5C 1HZKA 1T4KA 4Y16D 3JYBA 3H9YA 2EXYD 1X9QA 4P2RA 4YSPA 1TETL 1UADC 1WCBA 1CXKA 2CJUL 3PGCB 1K4CA 4N0RA 1ZLUH 4N26A 4LNRA 1TG8A 4Z3GA 4D9RE 3CZFB 2N56A 5GPRA 1I4FA 3EJZC 4JFFE 1FF5A 1YHPA 2I85A 3FKUS 1DYZA 4JM2F 3WLWD 3ZL4L 4LRNL 3I9GH 2QV4A 2GK0A 2PR4L 1KEGL 4A55A 3CFBB 5JW5B 5TE6H 2Q6WB 3WS3A 4E41A 5B7MA 5I1HL 3GNMH 4KZDH 1MHHB 2RB8A 3D3VE 1WFIA 3NGBC 1CICD 2DM4A 1JPEA 4KZ0A 1W0YT 5IW1A 4R97B 3HA0A 4CA4A 4FQ1H 1TQSA 2HLEB 3FU8A 2TRYA 2P52A 5C08B 3VWKD 3QUKA 2ZX7A 1BYPA 2DQUL 3C6SB 1P69B 3L3JB 2CJTA 5EUKA 3BIAX 2QBWA 1DDTA 1DHKA 2JCCB 2XC8A 4Z5RA 3HN5A 1P4IH 2IAMB 1KJ2B 3ZSSA 1NFDE 1IC5L 4JN2A 1JUFA 5MP6H 1NGYA 4G72B 1G6VK 1WO2A 2F5BL 1SJXA 2YMOA 4ZZFA 1R1CA 3UJTL 3KVDD 1EGJA 1U8MB 1QFHA 1NMBH 3VRJA 5F1IA 1UYWH 3ARBD 3P2DA 3BP4B 3NJIA 1E90A 4J1UA 1WIUA 4UM8B 4MCMA 3KPRB 4X99B 1S7RA 2BWDA 1WA0X 3L95A 4MAUH 5TDNA 4U1MB 1AD9B 4IU2A 3TBSA 1K5NA 4WFEE 3MDJA 2DEXX 5CKGA 1MFNA 4J4PD 2NNAB 5D7LE 3VXOB 3D85D 3KWXA 5HHVH 2VDRH 2BH0A 3IXAB 2F53D 4ODUB 2CGRH 5HYIA 3HOGA 5J13C 1BM7A 1LM8V 4NNXB 5IHUH 3ARVA 3UJIH 2ZOLA 3QEGH 3ECQA 4XBEL 4DGIH 3JTSA 5FB8B 5E2VL 4ELMA 1IEHA 2WP3O 1CGTA 2JI2A 5A1AA 4RFNC 5LN4A 4ORZC 4TLSA 2ZKYA 3CDFA 1HILB 4PJAE 2EEFA 3QXUA 4DQOH 2FT7A 3LS5H 4KK5C 4KTDH 1BFSA 4PJHB 4QXUL 4MSWA 1BZOA 4XMVA 2HFGL 2DYPB 3ZTJG 1WFTA 1ZA6A 2BZDA 3BAKA 3N04A 4NQCA 2ZUQB 3OAUL 3SPCA 4L1LA 3TVMD 1NOLA 1BIIA 1JHLH 3N50A 4FMVA 4MD0B 1CF8L 3LV3B 1ZSDA 4GG6B 3BLBA 4F7MA 1BQHA 1GKEA 2YLKA 3DROB 5I1KH 3MCKB 1G94A 1FLTX 1BGXL 2J25A 2RFXA 3KBHE 4K07A 1S7XA 4KWUA 4TXVB 5FYKD 4BKLB 4G70B 3EO9H 3FCTB 4UQ9A 4L2YA 4ESKA 4X5XA 2HJFB 3BVUA 5EEWA 4RGND 1IQDA 3HLKA 3QZMA 3DMMC 4OUUB 1YEKL 1RJLA 5ICZA 2J6EH 1GKOA 4X7FC 3M8OL 3GBMH 1LK3L 4NKQB 3BWAB 3WE6B 4OAWB 4DNLA 1ES0A 4FFTA 2WBJA 5IF0A 3HUJB 1N64H 1OARL 2FE0A 4R5VA 3V5DA 2XN0A 1XF2B 3BH8A 1XHHA 2OTWB 2R2HA 4HS6A 1M1SA 1RAMA 4B5ZA 3ERXA 2OPCA 4K3EH 5I71B 4GO9A 4GW5A 4WEEA 4LSRH 1MJUL 2J88L 5I66B 3RVWD 3RVXD 3MRDA 1L7TL 2IQ9L 4JM2D 2VLKE 5DLLA 5HHOE 4ES8A 2GSGA 2J12B 1JK8A 4K7FA 3ROOB 4JRXB 4MS8C 4PJ7B 1F5WA 2O6EA 4G6ML 3BXNB 1CZ8L 3QIUA 3TGXA 1UURA 4U0QB 4WWOA 3P73A 1HS6A 3QH3B 1S9YA 1NGWA 1JNNL 3RTQC 1MCWM 4H0IA 3QEQB 2VO8A 3SKNA 4FEIA 3V0VB 1FSKB 4Z7UA 1A22B 3VRLF 2XFXA 5BV7C 2VDKL 1OK0A 4LVOC 4P46D 4MZ2A 5F8QC 2C9AA 3DO7B 4AKOA 2H2SC 5DGQA 4Z23A 3RX8A 1XD0A 2AJZA 3QUYD 4OZHB 3JVGA 4QRRA 2DICA 1SMDA 4QRUA 1EFXA 3BMWA 3H54A 3FJTA 4QWWD 3US1A 4U6XA 2J8OA 3WE1A 2Q2LA 2A3TA 3FC8A 4KKLD 4TULL 4UBDC 1MFVA 2EYRA 1R3IL 5DD5L 3RWDA 1KNOA 1PNCA 5FUOL 3WXVH 3SN6N 1E6OH 4QXTB 4CADA 4KZEL 4FCHA 1CD8A 3M1BB 5DVOA 5AUMA 2W65B 3VTTA 3X12A 1CG9A 2MCPL 2BPBA 3VQMA 2F54A 4AV4A 1S7VA 3HMXA 1LP9A 1DFBL 2ZQKA 1JGIA 2HFTA 3NPSC 5CSZA 3ZX1A 4HU2A 4E9YA 3FO1A 1NEZB 1PJ9A 1ZTXE 3QZLA 1RL1A 5K39A 2IPTL 4KK6C 2R1WB 3G5YB 2O26U 4ELMF 2P43B 3IS0X 3DGDA 5ALBL 4QXVA 3FQRB 3OV6A 1PY0A 5EO0A 5MHSD 4I77H 5HHXL 4DO5A 1QNIA 2PP8A 2BCMA 1XGQA 2ICWB 4YSAA 3LKNA 4F7CA 4HC1L 3SCMD 5C07E 2ZX6A 4G7SB 4FQHA 2PN5A 3MHZA 4Z7WB 1CS6A 3S3DB 2QFRA 5DK2A 3QHTC 4F2MA 4ORGA 4ZOAA 2X4NB 3TFKD 4EN3C 1UM5L 3CPLB 1GJIA 3FSVA 4OQ1A 3MJ9H 4YNYB 3CSYA 4NLHA 4GQPH 3UPAA 4ENED 2XZCH 3WIFB 1YLBB 3QUZB 3KHQA 3SYPA 2O61B 5D6CB 4BV1A 2OMYA 3BZFB 4ZG1A 1JV2A 2YQ2A 1AZCA 3QHZL 3FO9B 1DVSA 4OLZL 2YHGA 2BNQB 2Z64C 3SJVD 1EERB 1HAUA 3HHSA 4LRIC 1VADA 1TTRA 4OT1H 1WUNT 2QQQA 2A7BA 3BP5A 4J23A 1MCOH 1R47A 1OB0A 2WY3B 1X5LA 1WAPA 4AEFA 1AIFB 4HUUA 3WTTA 2ZPKL 5E9NA 5E6ID 4K8RD 4HF5L 3O4LA 5DZLA 1JPFB 1A7BA 3UAEA 4WI9A 3WEBA 1HIML 2CLVA 2GI7A 2ESVB 2OR9H 3LKQA 4JFXA 4U6TA 4AEHL 2OK0H 3HG0A 3WJLC 3V0JA 4XC3H 3D18A 3OKLA 4G8GD 1UGNA 1UWXK 2P5WE 5GGTH 1NL0H 4P2QA 2JQZA 3KDMA 3ORJA 5DVMA 1F8TL 1KIUB 2F7OA 1UWGH 2I9LB 5CINL 5AEAA 1SQ2N 3VFWA 3W82A 2J21A 4BFGA 1OGTA 1KLGB 2O5YH 1VLXA 1AI1H 1D2OA 3P30L 4R2GB 1Z5HA 2DTSA 1V5JA 5GS0C 4A6YH 3DBXB 2FB4L 3C6LC 2CHDA 4W93A 3V6OE 4WHTB 1PKQA 4JHAL 4PN6A 3ZYZA 3CVDA 3W9EB 5C0EB 5I8KH 5AZ2H 5IJVA 2PETA 3FUJA 4NZRH 2XQBH 1YEGH 3BYTA 3IT8D 1SRDA 4JLRA 4Z7UF 3LB6C 2GBUA 4OKVB 5EC2B 5LKNA 2IH1B 3LNGA 3N85H 3GZOA 5MEPA 5D7JC 4L5FL 2DQFB 1N8ZB 2YMXL 3Q8EA 4GLRH 4JRLA 4R8WL 4QRSA 4BXSV 4F7PB 3PP4L 4F80A 4PJ8A 4YSQA 3N3EA 1G84A 3LQAH 3D33A 4PP2B 4L3CA 1E3FA 5EU5A 2G3XA 4WW1B 3FUFA 4ZSOE 4JDZA 5E2JA 2WLMA 1WZ1L 1RUML 1RZ8A 1VENA 3B8YA 4V11A 3RIKA 1PTZA 1WF5A 4OFQA 3T77B 4LU5L 2WCSA 1BZ7B 4NZUH 1CGSH 3FO0H 3FRPA 2MQ3A 4NXKA 4YAQB 2CJSA 5D2NA 4QTIH 3L45A 4FA7B 5IB1B 3P3UA 1U3YA 1ZGLP 1P9MA 2EDRA 1NJ9A 2QQKH 3ARFA 3MCLH 5H37G 4AITA 3LPGA 2JF1A 4X5QA 3F6LA 4UMGA 3ZZQA 1AYOA 4K5LA 4P05A 1LP9F 4LLQB 4ODSL 5E51A 4L1DA 1E65A 4KQ4L 5KYNA 1OOAA 1Q9LB 1ZLVK 1OAZH 1I9RH 1THAA 3NCMA 2N01B 4ZFGH 43CAA 9CGTA 3RFZA 1KFGA 1BOYA 1MSPA 1I7ZB 5LUMA 4MA8L 3MLSH 2QMKA 3D1MC 5CJBA 5T3XD 1R0AL 1C5DA 3KPSB 1PZAA 4GSXA 4LGRB 5C6TH 4IBVA 4PI2A 3STLA 4PJ9C 4YHNB 5C0BB 3R4RA 5F96L 1A7RL 1T04A 3QJFA 4NX0A 2Q7YB 5KEZA 2YD7A 2BMKA 4OFPA 1YMHB 4NHUB 4PRHD 2MPAL 1ZMYA 1DQML 2H32B 5L7XL 3JV0A 2C9QA 3MNZB 4MVBD 1M6OB 3RG1C 5GS1B 4Y5VA 2E6PA 5J11B 3MQIA 3AM8A 3VI4E 4PJ5B 3S48A 1UG9A 4S1SH 4GIPD 3SKOA 5FF6B 3ARWA 5DJCB 4QJ4B 2VITB 3SGDI 2ZCHH 1OTTD 2CDGB 3LNHA 2E27L 3NFPA 4FNLL 3C09C 1INEH 1FV1A 2AXWA 1ACZA 3FXIC 4H40A 3S35L 4N2NA 2EH7L 2CNZA 2E7CA 4MJ6B 1RZKC 2C4XA 2ZYRA 1S9KC 1OP4A 3RGVA 3S34H 4JJ5A 5DMKA 4XE5B 3UC0L 4M7KL 5E2UL 2A6KB 4JVWA 5KVDL 1C5CH 1E4KC 1WGVA 3FB8A 3VXSD 4ADGA 1DVUA 1U3HA 1OAUL 3KYAA 4N8CL 1PS3A 1A21A 4G5ZH 1IGMH 4WUUE 4BWTA 4K71C 1O0VA 2I25N 1J8HD 1HWGB 1LO3L 3NJXA 4MDIA 1F58L 4XCCH 4Z7OF 4K2UH 3TBTA 4KDWA 1JNLL 2WXNA 4WUKH 3KEDA 2FD6H 3ULSA 2IPUK 5I8OL 4PRID 1JRHH 1FYTE 2FEEI 1DZ0A 2QTVA 2QSTA 4HIIA 4GI8A 1OE1A 3B9KC 1NAMB 1F2QA 3CQPA 4NP4L 5SWSD 4JG5A 1WJ3A 2R23A 4JO5A 2BJMH 4IM8A 5LG1A 5IFAL 2XZAL 1U8IB 1V27A 4H8UA 4YGVB 2M2DA 1TVBB 1ZVSB 2YZ1A 5AL8A 4CKVX 3UACA 2UZXA 5CAYB 4RAHA 3EYVB 5EWIL 4HX1B 4BQ9A 2AI0L 4D0DB 3GHEL 3WFDL 1R5VB 3LZQA 3U2IA 2W38A 3L4TA 2Y1AA 3LVEA 5GGQL 3ES6A 1KBKA 2CJ3A 4JFEB 3AB0B 3DI2B 1G9NC 1FLRL 3FQUB 4P5KB 3WKQA 5MEOA 2Y23A 2YQBA 1P4UA 3AT0A 1B0IA 2BSED 4GINA 3E0GA 4E9WA 1YPZB 4ETQA 2E7DA 3HFFA 3EJZD 4J3OH 4D9QD 1DE4A 4UOQA 1IM3A 1OHQA 2XI9A 4X6FB 5FK9B 1MFCH 1NLBL 3QDJB 1XD1A 5K9JL 1JK9B 3UTTE 4F8QA 1FO0L 2EO7A 5I76A 2AC0A 1OT1A 2OLDA 3L7FA 1TJHL 5JQIB 1SN0A 4MDJB 4PRPD 4H0GA 4J8RB 2PW1A 1NICA 4N3UA 3TPUA 2GFBB 3KJ6H 2ZXBA 2FQDA 3OJVC 4P2OB 3IMBA 4TNFA 3WEXB 4Y19E 1I8LA 4MCYA 2HT3C 2YGOA 3AQYA 4XP5H 3DX8A 4X0KA 2YPLB 5KSUB 4NQEE 4IKLA 3QC5X 1H3WM 3BIKA 1NKOA 1IEAB 4O02A 2VXQH 3UYOD 4P23C 2V33A 4OU3A 1CD0A 2NCMA 1G7PA 1YEEH 4H7VA 1Y6MR 4UOW1 3SDXB 4ABVA 2Q86A 1U8HA 1VCAA 1FG9C 1BF2A 3GMQA 2FGZA 1TJIH 5H94B 1LO2H 4GT0A 3LIZL 5HHNB 5I6MA 1OLZA 3MYZA 5D8JL 4ZW3A 2ZWNA 1ZE3C 2IG2L 2FT6A 1MJ7H 2Z65C 4NQTA 1QBMH 2BVPA 3DOSA 5HDBB 2YGVA 1JSYA 2VDOB 5J5EA 5D2LB 3BPLB 5DRZB 4TQEH 2QHRH 5F1OB 1R5IA 2VJ0A 3LEYL 3IU3A 4QNPF 1P7BA 5EOCL 5DHYB 3KCPB 5DEGB 5C0AA 3P2BA 4YPJA 3B2UC 2DJSA 2ZX5A 4KK5D 2NY3C 1PZ5B 5IMMA 2XRAL 3QS3A 2L0DA 1N6QH 5LWYL 5FOBA 4Q2ZB 1PCSA 3CXDH 5HGDA 4HKJA 4I3GA 4HV8A 4TQIA 3D2UB 3PL6B 4IRJB 3SO5A 4M5YL 3HLAB 2VERN 1PYWB 4M6OH 3HRZC 4EVNB 3AADB 1PW3A 1WVZA 3FHEA 4G8IA 2BHZA 4WEBH 3CFJB 2L7EA 2VT0A 2ICEB 5LBVA 4N1EA 4ALAH 3BRFA 3BZEA 3T4AB 4Z7QE 4OZIF 5D1QE 4XVTL 1FBIH 2ZCZA 3NTCH 3S0PA 5J4MA 5C71A 2Y5TA 2VN6A 4PGDB 4U6VH 4UQ2B 1IEBB 3MRGB 3GSXB 2BP5M 3DMMD 4URTB 1J1PL 5E24E 4Z95H 2OL3H 3H3PL 4XHJC 2X7LA 3K80A 2WIIA 1R3LA 5KBMA 3FU9A 2B08A 3CFTA 3U9UA 4ZTEA 4ABQA 4WF7A 2DQIL 2FX9L 3OKOA 5DRXB 1NUNB 5ESVA 5IVZA 3IJHB 1FFQA 3TZVA 3BVTA 1TUPA 1KGUA 4BFEA 3Q1SL 5LGYA 5SV4A 3DTXA 5F7EL 2R4RL 3QDGD 2V3DA 5IK3A 3MRNA 5CIPH 1RK7A 4LIQH 5AB2A 2XKSA 4QOKA 2QKIA 2WMPB 2PYEE 4MNGE 5T1KA 5KSBB 3A4EA 3FFDB 3H0TA 3HS0A 3WTWA 3DJZA 5KG9A 1KTDA 1EPFA 5AAMA 5IMLA 1BEYH 3GPEA 4PVBA 3X2QB 3OR6A 3EYSH 1BFTA 3VGBA 4G6FB 4AZUA 4MS8D 1UA6L 3HAEB 5E5MB 4DOHB 2HFFB 5ADPL 1MW3A 5JW4R 2APXA 1S3KH 3QR1A 5DQJA 2DIEA 1XWVA 2KDYA 3AG4B 3NRPA 4L3EE 5E9DA 1L9RA 2DLIA 4PGCB 4HWEH 3DX6A 3L6FA 3RTQD 3QIWB 1IFHL 3AY4A 3L9EA 5JQ6L 1WBYA 5E0QA 2QADC 4QXGL 1CFQA 3BD3A 1JZDC 4GRLA 4PD4K 3GXDA 5DUBB 2H2SD 3QRBA 3UTPD 1HI6A 3TS8A 3P0VH 4WK2B 4F5CE 4QHMB 3K6NA