2GBVA

C6a/c111a/c57a/c146a holo cuzn superoxide dismutase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGATSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLAAGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2gbvA00
1JK9A 3F7LA 1EJ8A 3GQFA 4MCMA 1F1DA 1N18A 3CE1A 2WYTA 1SPDA 2Z7UA 1XSOA 1HL4A 2C9UA 2WZ0A 1E9PA 3KBFA 3QQDB 1E9OA 1SDAB 3HFFA 2Z7YA 5KBMA 2AEOA 1CB4A 2C9SA 2WWNA 4A7TA 1QUPA 2E46A 1PZSA 2E47A 2GBTA 2AQSA 2VR8A 2APSA 2SODB 2GBVA 2Z7ZA 1SRDA 2AQRA 4A7GA 4A7UA 2AF2A 1Z9NA 3QQDA 1B4TA 2Q2LA 1PU0A 1HL5A 3CQPA 2AQPA 1YAZA 4BCZA 1RK7A 2GBUA 2NNXA 1SXSA 2JCWA 2JLPA 2WZ5A 1FUNA 1IBFA 1OAJA 1IB5A 2WKOF 3GZOA 3GZPA 1SXCA 3KH4A 1JCVA 1COBA 4L05A 1YSOA 3MNDA 3S0PA 1BA9A 4A7SA 1SXAA 3L9EA 1F1AA 2WWOA 2R27A 1OALA 2ZOWA 2ZKYA 1IBHA 2V0AA 1OEZW 1DSWA 1SDYA 1YAIA 2Z7WA 1B4LA 1SXZA 3ECWA 3GZQA 3HW7A 4A7VA 3ECUA 3SODB 2LU5A 1MFMA 1BZOA 3MKGA 1UXLA 1SXBA 4BCYA 4N3TA 4MCNA 1XTLA 1S4IA 1EQWA 3H2PA 4OH2A 3KH3A 4FF9A 2C9VA 2VR7A 1DO5A 3GTVA 1P1VA 3GTTA 3KM2A 1CBJA 1KMGA 1OZTG 1E9QB 3RE0A 4BD4A 1TO5A 2WYZA 2XJLA 1TO4A 4A7QA 2AQQA 2WKOA 3ECVA 1XTMA 4B3EA 1IBDA 3T5WA 3PU7A 3CQQA 1UXMA 2ZKXA 5CU9A 3F7KA 5KBKA 1Q0EA 2VR6A 4N3UA 1IBBA 3KBEA 1JK9B 5KBLA 2AQTA 3LTVA 1Z9PA 3KM1A 1AZVA 3L9YA 1E9QA 2K4WA 4U4IA 2AQNA 2XJKA 1OZUA 4OJAA 1SXNA 1E9PB 1SOSA 2WZ6A 3HOGA 1U3NA 3K91A 4A7GF 1E9OB 1L3NA 1N19A 2ZKWA 1F1GA 1F18A 3H2QA 1ESOA 1PTZA
chains in the Genus database with same CATH superfamily
4G1EB 1A6WH 1YDPB 2ZD0A 4PGBB 1EV2E 4RMWA 3UZQB 1E8XA 4XCNA 2MCG1 2WJ5A 2WLLB 1P7KB 3JWNE 1UVQA 4W9DC 1QEWB 2ZYIA 3NSXA 4G7YL 4PJFA 3UJTH 2YPVA 3MCKB 1U6AL 3DUSB 4X6BB 4PGEA 3O4LE 1LTXA 3AQYA 3NSCA 2X2YA 3CXDL 2BOLA 3K6IA 3QO1A 1XF4A 2H2SC 4P57A 3MUZ1 1G0DA 1RZGA 3DGDA 4G7YH 2VUYA 4S11A 4A04A 2KPWA 2O61B 4NRZA 1U6AH 4NJAL 3M1BB 2XSKA 3D69A 4MRBA 3AITA 3CXDH 2K6YA 4CSTA 1HEZB 3HN8A 2RFXB 3Q2LA 1S8DA 1UD4A 4ZSOE 2ROYA 5JW4Q 4JG5A 1HH6B 4MGXA 5HHQA 3DLQR 3OTTA 5HDQH 4NJAH 5A2CA 4FABL 5E8PA 3FHEA 4TNWK 3TBYB 2DJUA 4YHYB 6PAZA 4MMYA 2ZUTA 3HG3A 2Q3XA 5I30L 2O4EA 3D51A 1NGYB 3NH7L 4ZMOA 4MJ2A 3GM8A 2FQFA 2LAAA 1DSWA 2MKWA 3MRDB 4TNEA 3EDFA 2NY5C 3ATFA 2H3NB 3DWTA 3CSTA 3I9IA 1O6TA 4GKOA 3E38A 4OV5B 1JN6A 3U46A 5J56B 4HK0B 3NH7H 4R83A 3VFRB 3EZJB 5HJGA 1BXXA 3EFDL 3OKEA 4N2BA 1YPZE 1U30A 4PY7A 3DX8B 3S3BB 5I15L 5AOKA 2GEQA 4NQVA 5F9AC 4EIGB 2VQUA 1Y18A 1PF3A 2W07B 4N20A 2X1XR 3V9FA 1I7UB 1RZIB 1WC7A 2H2SD 3EFDH 4NI3A 5B7FA 4ELMF 4KBPA 4L1HA 2I7SA 5CU9A 4AGMA 1FNLA 4WTWA 1JZIA 1A4KA 5D6CB 3KGSA 1WISA 1ZSDA 4PRPE 2H1PH 1X4YA 1B2WL 1B6UA 2LTQB 4LGSB 4Z0XA 1HU8A 1KBKA 1BAWA 1OF2B 2UVEA 3LKPA 4MB5A 2X0WA 5J11B 3NCEB 1E27A 2J6EL 4ZFZA 3NCCB 5I1DA 4M93C 2Q5BA 3P77B 3VA2C 1Q1JL 2P4AB 5F1IA 2HLEB 3PQYA 3S5LB 1B2WH 4JEGB 3IBOA 3T8VA 2EDXA 4H40A 2Z65C 3QWOA 4H5SB 4GAGL 2J3SA 3DV4B 1I1FB 3QA3B 5CJOL 1L9OA 2IDQA 3FUDA 5F7EL 2J6EH 4WW2B 2GG1A 4FA7B 1IIIA 1NFDF 3CZFA 1Z9LA 1HSAB 2XPYA 5KAQG 4RMVA 3LNDA 3SKUD 4ELMA 5AVYB 4JKPL 2MQCA 3FB7A 4GAGH 4PRIA 1T7XA 4PRPD 5CJOH 1KPVA 3ULUD 2FHBA 4Y1AA 3LEVL 2OA9A 5T5NG 1K8IA 3GSXB 1M9WA 1O7VA 3H42L 3FONA 3EJQA 1TQBC 3LQZB 2H1XA 4QGTA 4FL4B 1MLBB 3QFJE 3D9AL 2XRAL 1MJUL 4PY8J 3Q8CA 1U8OA 1QHOA 3K4DA 3ZDYB 3H42H 5GSVB 3QI9B 3QQ4B 1E7VA 3O8XB 4OCRH 4PGJA 5IW1A 3OKNA 3SGJA 2DV6A 2XRAH 1MJUH 3RVTC 2CKBL 1BHGA 5ESVB 3WNOA 2BVYA 1NFDA 3ESVF 1JPTL 3I6KB 2XUWA 3KGUA 2X89D 2H0EA 3UCRA 1AH1A 2QGBA 2X0VA 4GXUN 4PS3A 2CUIA 5TTRA 3T4AA 3C6LC 3L17A 4R4FL 2CKBH 2ZXGA 1AOHA 4DO5A 4M29A 4M9OA 4MJHA 1JPTH 4CNIA 3SO3C 5EBMA 3QQXA 3M7FB 3CHRA 3SGKA 4S0SD 2NQ3A 2X09A 4HIXH 4R4FH 5I6LA 1OAKL 5F6IB 2DBLL 1IEAB 3L48A 4JFEB 4XPHL 1UXSB 1HHJB 4ZFOL 1OTSC 1SUHA 1XX9C 4QXTB 4YSPA 4WRLA 4KJYB 3QJRB 3R1GL 3BSHA 5L88L 3GLDA 1TCRB 1J8HA 3RDTD 5I17A 4XMXA 3NCFB 2EP6A 1OAKH 5T1DL 4F8TA 4Q9QH 4LEBA 3N91A 4JGJA 4XPHH 2D7PA 4PIRF 5L0QB 5GISL 2NXZB 2BJML 4QRQA 4YR6B 5I6NA 5L88H 3R1GH 3D09A 4OCLC 1WAAE 4KHXL 5DUBA 1IBBA 3NVQA 3MRLA 1HCVA 4PRAA 3WJJA 2BVQA 5T1DH 3T4YB 1FG2A 4OUUB 3UC0L 3RJOA 3B83A 2YWZA 2HN7B 1KJMB 4PJHA 5GISH 2TRHA 1G7JB 2DRUA 1U0QA 3AG1B 3H55A 3MJ7A 4KHXH 3D0LB 4RZCB 4KX7A 3RVTD 1WICA 3IDNB 3MNZB 4JMNA 2NSQA 4NNPL 3TF4A 5JHDE 3SGEH 3UC0H 3DOSB 1QO3B 2IGFL 1DVFB 4I3RH 1QFWI 1ZE3H 3C6LD 3MVSA 1HCZA 5CR8A 3APMA 1QWNA 5KANG 1WZ1L 3FCTA 3C60B 3QUXA 3BMWA 3B7UX 5ANMB 4CN1A 3IDUA 5AKTA 4NNPH 4FFTA 4DP1X 2WQXA 4XNBA 2XWJB 5IF0A 3ZDZF 4NQXB 2IGFH 3EGDB 2J6EA 3V0VA 1TT6A 3HFFA 4U6YB 3B37A 4K5NA 1WZ1H 1BZ7B 2Q8BL 2O30A 2KH2B 4HMDA 4IBVA 3TH3T 2VZUA 4YSEA 4IJ3B 4ZTOL 2F8IA 2WKLA 4P5TC 3CN1A 1TIUA 5E2WL 1CIDA 2WV3A 5JHDD 3QDME 1ZA6B 2Q8BH 1O6SA 4RGND 4ZTOH 1OB1A 2J2ZB 2KBGA 3D6GA 4XPFH 4I48A 3C5ZC 1EXHA 3RX9A 3S98A 5E2WH 4HKZA 3II2A 1T89A 5GIRA 1CR9L 3S0PA 5I1JL 1IZKA 4LP8A 3GFUA 1F6AA 4WLCA 2HPOA 3TS8A 4PJ9C 4PG2A 2DWEB 3MLUL 4KZEH 3NESA 2ZOWA 5D9SB 1XAUA 3QNFA 4PJIF 3SJVA 4Y2OA 1R3JA 1K5NA 1Y6KR 3IMVA 2DQFB 1CR9H 2BP3A 2VLRB 3HE6B 5I1JH 4HJEA 3NK4A 1BQSA 5JO5A 4WTZA 1UXLA 3MLUH 4FXKA 2CKBA 3QDMD 3BP6A 1AD9B 2W92A 3LEXB 5GGQL 4EI5A 1VENA 4MXVF 4OLVL 3R8BB 1EDYA 4L0ZA 2C9VA 4JN2A 1DO5A 2KZBA 2LGNA 4HS8L 4NQCB 4FJ6A 3FU7B 2F19L 4L8CB 1N10A 1N4XL 1S9VB 3K1DA 3MA7A 2WXLA 3S4SA 5GGQH 1DP0A 1TQSA 1FPTL 3QWRD 4EI5C 4TUUA 5ID0A 3VMPA 4OF3A 4HS8H 1QD0A 1Y07A 3LKSA 3PF2A 1E6JL 4AEIL 3KPMA 1SYVA 2F19H 2V9TA 3LEYL 1R4XA 1N4XH 3S5YA 4XNMB 4PJIA 4DZ8A 2MOGA 3LTVA 4D2NA 1FPTH 3GXMA 4PCTA 4ZFOA 3QPQC 1NGZA 1XQ4A 1E6JH 8CGTA 4AEIH 3C5ZD 1JZEA 4I7ZC 4JAMA 1I3RB 3GMMB 3H54A 5D7LE 5KSVB 3JV0A 3QR2A 2IH3B 2R2EA 5DU7A 4FQLL 5JLZA 4ILDA 1PTZA 3LXAA 4UOJA 4PG9B 4RX4A 5DMYA 3CIAA 1CDGA 3SCMA 4DQOL 1N7ML 3ZE0B 1E5AA 4ANWA 3BEWA 2X4OB 3QIWA 1I7TB 2MOVA 3C2SA 4FQLH 4ZQKA 2K7PA 5KJ4A 1JWUA 4JJ5A 3B7YA 1ND0A 4DQOH 4KO9A 1BOYA 2KZWA 2EKSA 5EDXA 1X5IA 1ZVSB 4J3TA 1Y6NR 2WTRB 3BWSA 2EDFA 3HN5A 4M7LT 1EFXB 3BPLC 1BREA 1XGQB 4M8RA 2R2BB 4Y2DC 3SDAB 1MKFA 2XBZA 4NXSA 4X5XA 3K2MC 2AJVL 5E8EA 4O51A 1U58B 5D7LD 3GSRA 1JVLA 4C58B 2DEYX 4IGBB 1A6TB 3DHMA 3LPWA 4LT7A 1FORL 3T8MA 5KSAC 1CXHA 1W2KT 4XMUA 3GUTA 4GOSA 5FA4B 1IFRA 1V5JA 4Q0XL 2AJVH 1DJHA 2FNBA 3VXUB 3U4EA 2UXFA 1FUNA 1ZHBB 2B15A 4Z3TA 4Q56A 2YD9A 5FKAB 1KXQE 4PJXB 1FORH 5KYYB 2XU9A 1KULA 3PUUA 4Q0XH 1U42A 4JO1L 4UYQA 3ZHKA 3KS0J 4M8QA 5F89B 3VXMB 2MWCA 3TC9A 3CPLA 1B4LA 2G2PA 1QBAA 1QFUL 1N64H 2CJSA 4HIIA 3PXJA 5E8DL 1MWAH 1WUNT 3WLBA 4UCFA 4G8GB 2J88H 4JO1H 3RAJL 3N41B 4JY6A 5DD3L 3TV8A 5CJ8A 3PL6B 1QTYT 3HG4A 3GSQB 3CVCA 3C09C 3L6FB 4JG9A 3D3VB 4ODUA 4MB4A 1QFUH 4PLKD 2CLZA 5E8DH 5T5FL 3KW7A 4Z7WF 1CT8A 5ALCL 4YDZA 1HKFA 4K5LA 2CM6A 3ZGHA 2FWLB 5DD3H 4B0MB 4IRJC 5AAWA 3D4CA 4UANA 4PW9A 3HI6L 5E9DE 1AOZA 1R24A 1RY7B 3GB7B 4ORGB 5L7XL 1U92A 3DVNB 3BGAA 5TF0A 5ACZA 3HC0B 3TBVB 5I5MA 5JW3L 2EE2A 1W0WB 1YMHA 1P0SE 5T5FH 3V7MA 4ZUWA 4N3UA 3LB6C 7FABL 3HI6H 4I1PA 4J2XA 1XGTA 3TO4B 2OP4L 1CE1L 3FTYA 4UIMA 5TDNA 5KSAD 1WIOA 4ZUVA 1HESA 3FQNB 4UQ9A 3HBGA 5FYJE 4GW5A 1ZHKA 7FABH 3DOHA 4RFEA 2DBJA 5EEZA 1F18A 1QSFB 2C4FU 1VPOH 2PYEE 2OP4H 1CE1H 3NG5A 4GIPD 4P2RA 3VI3F 4GQZA 4Z7WA 4JPSA 3KWVA 5E9DD 5I8OL 1JXJA 4K07A 5CKAA 5FPIA 5JDSB 4MA3B 3UBXB 1CICD 3AWFA 1OLZA 2WNGA 3HFML 1C16A 3RKPA 1M56B 4PBWD 1HQRA 2G3MA 5ACMA 4WHCA 2C9SA 1J8SA 5GS3A 4JFDE 5AOJA 3UIYA 3CH1B 3TN0C 2E74C 1MFUA 3BVUA 3HFMH 4M5TA 1MUJB 5AW9B 5FYJD 3EO0B 4F7TB 4P9HL 1ZPLA 2BZDA 1XB3A 1LM8V 2PYED 1GW0A 4MBRA 3M1OA 1KBVA 4HXAL 1KYUA 4FKKA 1NGWA 5DO2C 1NC4D 3VI3A 2QSVA 1UUSA 2XXFA 5BZDA 2AFNA 4TNVK 1Z2KA 2NNXA 2MCMA 4LPTA 3ZN6A 3OKMA 5GRZA 2YJLA 2BK8A 3IWVA 1RZKL 1KGXA 3TH2T 5EOCJ 4HXAH 3LXCA 1LP9E 5KSBF 2ENJA 1H9VA 4WHTA 3GS7A 5JPNB 1IMHC 3BZEB 2AKRB 1E4XL 5I0VA 1OSZA 3S36L 3X1BA 2TSAA 3JTSA 4JFDD 4JDTL 4Y1TA 2IDCA 2VE6A 4GUPA 3NJGA 43CAB 5IWLC 4LPXA 1AKJD 5DYOB 5BS0A 2ZXEB 1S7SA 2O26U 4PHZA 1FH5L 1E4XH 4E9SA 3S36H 3N42F 4AIZA 2PYFB 4JDTH 4A68A 4FA8A 2BVTA 4NO0D 5ICZB 15C8L 3S4SG 4AQAA 1Q9OA 2A6KA 1WEJL 3PABA 1D9KC 1MWAA 3F2LA 3B3BA 4I2XB 5DUJA 4HQQL 4YHKL 4ACPA 3K72A 4X8GA 1A2YB 1WITA 3X1FA 2EDRA 1YG9A 3D25A 3DXAB 3WENA 4HS6B 5I66A 4R4BA 4Y4KC 5KSBA 3NIFF 1JHLH 1WEJH 2G2RB 3TN0D 1HFUA 4HQQH 2I07A 4J27A 2YD1A 4MKTA 1ILUA 1N67A 4YHKH 5DD1L 5EUOE 1NIDA 3MRKA 2PMZA 2YSTA 3SPVB 3ZUCA 5DO2D 2W0FB 5T5FA 4DNLA 1SOSA 1U8KA 1FO0B 2FECL 3LS4L 3QXVA 1AC0A 2WVSA 1S7QA 5DD1H 5EFIA 5HDOA 4A7GF 1Q9KB 1QW8A 2QL1A 3PHQB 3S48A 1A9EA 1JTPA 2N7SA 3RTQB 2WXMA 4OCYL 4YK4B 4LCCB 5CZVH 2H5UA 3VB8A 1TU2A 3GI9L 2EYTA 3C2AL 2GUYA 4S1RL 3TP4A 5MI0B 3R06B 3BKML 4HJ0C 3OKLB 2Z35A 4FP8L 2W38A 4UT9L 4KZDL 4F1SA 4OCYH 3NRPA 2YEQA 4KKZA 1CU4L 3GRWL 1PKOA 1P4LB 2G60L 4EZLA 3C2AH 2K8QA 2V8LA 4S1RH 1R3HA 4P8QA 3D2UA 4U7KA 2GC7C 3TL5A 4BWWA 2WAHA 4FP8H 3V5KB 2V8MA 1TF4A 2UWEB 3AZUA 3TT1L 2J5WA 1D9KD 1I1RA 4A7GA 1CU4H 2YC1A 3GRWH 1JXGA 3L5WB 1L9NA 2AGJL 1BF2A 2G60H 3RB5A 3RZWA 5HYEA 4KK5D 1QFWM 2AQPA 5K9JL 4RBPH 2VCOA 4CVXA 4Y4KD 5DJ8A 1RK7A 3FOLB 1TYRA 3TT1H 5I6KA 2WYIA 3VGHA 5D1ZI 3L4YA 3O6LL 1NCWL 4PJ8A 5FF6A 2VITB 4X4MA 5KVFH 1K4DA 4JVPA 5D71L 3U9PL 5IHBA 1H3UA 1QYGL 3D52A 4NC0B 4XB3A 3NJNA 4BK5A 4H44C 3KPRB 1FL5B 3UZEC 3NA9L 3CDGA 1NCWH 3O6LH 5E6ZA 1KEGL 5D71H 3U9PH 4MNHA 4MS8D 1UB5A 3ECUA 1J87A 2KQNA 3E8UL 2LU5A 5TJWK 2ADFL 2VISB 3MLYH 2HAZA 1JFHA 3T3PB 3AUVA 1I1YB 4DUVA 1URZA 3NA9H 4P9HC 3US0A 1KEGH 2CRIA 2NTSP 2BS9A 3UO8B 3DVFA 4OZ4B 3HG0A 1WBXB 4HJ0D 5HYJB 3ZDXB 4GXFA 3E8UH 2ADFH 2JMRA 2PP8A 2QGDA 4RAHA 3AQDA 5I8EB 3H2WA 1UFGA 3LKOB 3NYKA 4KUCD 4HBQA 4LAJH 1KIQA 2ZYRA 3UPRA 1FJ1A 1RZKC 1RVFL 4OGZA 4X7SL 2XWTB 5DHDA 4UQ3B 1RUPL 3R4RA 5B21A 1EO5A 1E5BA 1KLUA 3WBDA 2VC2B 4GSUA 5E6RB 5E08L 4Y19D 4CILA 5TK4A 4MAUL 4P5KA 3TYGL 3GS0A 3KGTA 3MXWL 5ETUB 1AR1B 1FYTE 3LH8A 4X7SH 3FXIC 1RUPH 5AEAA 5I16A 3IETB 2ADJA 2WLHA 5E08H 1H6EA 1N8ZB 4QD2E 4X6DB 4MAUH 2BIQA 2FX9L 1OQXA 2JFCA 2P49B 2X40A 1CS6A 3FULA 3QULA 4QI3A 1ID2A 2F74A 1EZVY 2OLDA 2X1WL 3C8HA 4Y7MA 4CDGC 4QDGA 2JJSA 4LCWA 3T0XA 1CYWA 2EABA 1NFIB 3OAUL 4MA8H 4U6HA 3BQVA 1XH3B 4ALAL 4GKSB 1UWXH 2H0FA 1RI8A 1V7NL 2ID5A 1XZ0A 2NUPB 2NY7L 3MI6A 4ACTA 4AT6A 1S7RA 2YBRA 4IRSD 3GSVA 4HKBA 4BHUI 4E41A 3VFMA 2XZQL 4QHPA 1XL4A 2KLTA 3MCG1 2ZTBA 3O3DA 2XX0A 2JJSC 4ALAH 1FYTD 3B3IB 3GC3A 2VR8A 2HFGL 3A4EA 2JCCB 3FUKA 1V7NH 3L5HA 4U3SA 1HZKA 1D2PA 2YD6A 4M61B 1G7HA 1KN4H 1NM9A 2EEDA 2XZQH 2CCWA 5DA4A 2D7QA 1JZ3A 4I85A 3D5OF 3QQDA 1B4TA 4X8JB 5EN2B 3QAZB 3MRRA 4WFGE 2HFGH 2YXMA 3ILPB 2D31B 2YA1A 4R4NC 5LXVA 3CLWA 4UT9A 1ZK9A 1JGDA 5IVZB 3G9AB 1G5GA 2MCPL 5B39B 4OM1H 2I25N 3EG9B 4NN7C 3RGBA 5J57B 1PDKB 2B59A 2WKOF 1A6ZB 3GRWA 4MJ5A 4MTMA 4PIBA 1L9QA 3S35X 3BQUA 3SGDH 1IE4A 3HC4L 4OZHF 1AANA 4WEMB 4TPRL 4FFYL 3OLEA 3OQRA 1KFAL 2X4SA 1EA9C 1RZJL 3S3DB 3WFHB 3OPZH 4R90L 1S78C 4N9GA 3MV7D 5EEVA 2GPZA 3BFOA 2Y69B 4R6UA 4G6FD 3ROLB 3HC4H 2DKSA 3BKCL 4NPKA 1RK0B 4TPRH 1JYXA 3B2XA 3FUNA 1LE9B 1KFAH 5LXGH 1RZJH 5FM8A 3V6OA 5DJ0A 4R90H 3PWLB 3ILEA 3GTVA 4ZUSB 2IG2L 4ZW6A 4UQBA 3ZRCC 4NKOA 4HPOL 5LGYA 5JYMA 1UOVA 3P4OA 4HJUA 3F8UB 2FLMA 4JE4B 5F7MC 2ICEB 4TUOA 5C07A 3L8QA 1NBZB 2XG5A 2WKOA 4XC1L 3KZ8A 1KLGB 1G9ML 4HFWA 2IG2H 1DLHA 4OZHA 3TOPA 2PXYC 4HPOH 4HIHA 2C3HA 2PR4H 2ZOKB 4C57C 1MI5E 1O6VA 5K1JA 1N6UA 1UA7A 2HKFH 4NRYA 2OTUA 1AZVA 3DUUB 4XC1H 5IJBC 5CWSA 2FJGB 4LKXA 3BAIA 3UYPA 1G9MH 3KPOB 1TZOA 4G72B 4BZYA 2HRPL 1DANT 2R56L 5DS8B 2ZSVB 3FNKA 4R4ND 5DD0L 2HT2D 2WZAA 4NBYB 5I0XA 1DQTA 1P5UB 3VE0B 2WAQA 1ZVHA 3TBTB 1GW6A 1UACL 2ICWB 5GGRY 1KXTB 5IOPA 4YGVA 4L23A 5A2IH 4YPGA 1MCOL 5D7KE 4CVZB 2R56H 2XETA 5DD0H 1MVYA 1ZLWH 3BZ5A 4Y5YA 1A4AA 3LZFL 3OJVC 3WS3B 4ODHL 3MLTA 5GXBB 1UACH 1Z9SA 1G7QB 3TYFB 1D5BA 4NUGH 3WG7B 3L1OL 5AVUB 5HYIA 1OL0A 3LN4A 4PS7A 2A0LC 2SEBB 5AW5B 5TDOB 1MI5D 1A3RL 5E00B 3JBG7 4CRPA 1SEBB 2BSDA 2G4EA 4JFFB 4HXBH 4X42A 3LZFH 3MV9A 1PZSA 4ODHH 3DURA 3IRPX 3VGGA 5L8KB 2NZ9C 3TCXA 3L1OH 3QDJE 4OZGB 5SWQA 1JPSL 3AM8A 5CHNB 1A3RH 1AE6L 1G1OA 3DMMB 3UERA 1XIWB 1PY4A 1T1ZA 4Y16D 1NAKL 5D1ZC 1RLBA 4ANUA 1VFBA 5FDWA 1T04B 1U8NB 3DGGB 3EXLA 4LLMB 1IM3A 5D7KD 4AYBA 2FYYB 1PZCA 4HJTA 1JV2A 4P23A 2B5IB 1DUYA 4ZXBB 1MG3C 2PXYD 1K2DA 3BP7B 5FGCB 4I8DA 3HUJE 5ISZA 1OAJA 3L54A 3HA0A 5MEOA 3IXAA 3AT8A 1FN4A 1MFEL 3LS5H 3VJ6B 3VO0A 3T0BA 2OM5A 3TEUA 4OD1L 5F6HJ 4W1TA 1FFTB 1N5YL 3IKKA 2YRZA 3HZKB 3QIUA 2WIMA 4ZO7A 3QDJD 3V10A 4NX0A 4MD0A 4YNYB 3DRTA 4OD1H 5IVXE 1BLIA 1N5YH 4NYLB 3MRNA 4FYTA 5HJ3A 1HOCA 4GI6A 4K3DL 1YY8A 1CD1A 4GQPH 4XO5A 4HGWA 1AZZC 2UVFA 2ZCLL 3VXQB 3ARTA 4QRRD 1JGVL 5BZXA 2BP0B 3TVMA 1JPGA 2XIBA 4M5ZH 2P5PA 4KRNA 1ORSA 4FEMA 1I7ZA 4JZJA 1YRKA 2NQCA 4K3DH 3T5WA 3VFGL 4AOFA 4ODSL 2ZCLH 2DZEA 5HYFA 1JGVH 2VDMH 1Q0EA 3HBZA 3VQLA 3MKKA 2HVJA 2DLFH 1CMOA 5D4JA 3H56A 5EZJB 4GBXA 4OJFL 5HDLA 1QVOB 4B9PA 4F9LC 3BAJA 1XR9B 3NBNA 4N0YL 3VFGH 4C56A 1LO5A 3ZZLA 3W5NA 4ODSH 3ZHFA 2YUVA 2Y3AA 1E5CA 3VXSD 2X1PA 4U3XA 4Y9CA 1LO4L 4BHUA 5DD5L 5AD0B 1PZBA 3CHOA 4N0CC 3IAQA 5JXAL 1SJXA 3CMOL 1MCIA 3CH8A 2YD0A 3BD5A 4OJFH 2G3XA 2J8OA 1MN4A 5EH1A 3VD1A 1XCQB 4N0YH 2N4IA 2RB8A 1M2OA 2G3NA 4JJHA 1BZEA 3HG2A 4CGTA 3MRMB 4X5LA 1XD0A 2HX9A 2IQ9L 1GZQB 3X3GL 4F92B 3UJIL 5I8OH 5ITFA 2F68X 2EH8L 3UOAB 4OLWL 1E9PA 3N1GC 5E9AA 2Q76A 4GFXA 4CW1A 2GT9A 4UTAL 2BP8A 3GSWA 3B7TA 4YDVA 2IQ9H 2R0KL 1HCFX 3X3GH 2Y5TB 3UJIH 4N0UB 1OVZA 3WEAA 2EVIA 1DVYA 1C5BH 3LPGA 5IB4A 2EH8H 2CALA 4OLWH 5DK2A 2XIIA 5BUGA 5D1QA 4CVUA 4UTAH 2WO3B 4FI7A 3U36B 1OANA 3BHBA 4MDIA 4G11A 2NNAA 1FA4A 2R0KH 3C5JA 4OLUL 4FQJL 1TJXA 5DJXB 5DMGC 3V6FA 2BVPA 1UM4L 4X0NA 2R1WA 1RZPA 1PAMA 4TQIA 3RWGB 5C0EB 3GSNL 2C3WA 1B4JL 3MBXL 3NIDF 4TQPA 4UBDC 4UI2A 43C9A 2EDEA 4OLUH 3EGXA 5KUMA 4FQJH 3DO7A 1Q94B 2F6AA 3FN9A 4NNYA 5EN3A 1MW1A 2R9HC 2X70B 3GSNH 4ZBJA 1IM9A 4JKKA 2EUXA 3MRCA 3RQ3A 2BIOA 3RNKB 1ZK5A 1WFMA 4KZCA 3A22A 3MBXH 3PFUA 4APQD 2FATL 2WXJA 4WSGA 5IEKA 3AWEA 3GK8L 3UMNA 3CZGA 1MDAA 1GXEA 4YHIA 3VCLA 3PRZA 4H26B 1MQ8A 5DDHB 4DOHE 1FFRA 1T2QH 2L0DA 3EFOB 4PP2A 1QUNA 5MENE 3W39A 4Y5VB 5GRJL 2ZPKL 3FRUB 1J5OL 5HHPA 3QEGL 3AY2A 3ARBC 5T3ZL 1ZLVH 3P4MB 2VZ3A 3GI8L 4ZPVB 3IM1A 1FNEA 3AQZA 3VYOA 4TL4A 5MERA 4AVJA 3GJFB 2RTTA 5CUSL 2BHUA 2PW2A 4AL8C 2FWSA 4QPEA 5GRJH 4KAQL 4XNQB 3QEGH 1GKEA 3IT8D 2VDKH 3EBGA 3GIVA 3GI8H 5EZPA 2A6DB 3L3HB 4QTHA 5ICYA 4LASL 5EPMB 5CUSH 3GEWB 3M88A 3VD5A 2J5LB 3FT4A 4KAQH 5D7JA 4UOQA 5BV7B 4PUBH 5DMGD 1Q0YL 4R96B 3X12B 2CIIA 3SDCC 3UBHA 4LASH 4CC0A 4V1DB 2X2JA 5ALBL 4DP5X 1CGVA 4UBDD 5TE6L 1A3LL 2OTPA 3GJEA 2BP5M 4AIEA 2E6JA 1ROWA 1DLFL 1DCEA 3IDGA 4ZOEA 1Q0YH 4FNUA 2R9HD 3H7BA 2Y5EA 4WDIA 1JHTA 1Q4NX 5ALBH 1PAZA 4IMKA 5AW8B 3EHBD 1A3LH 4RSVA 4HCFA 3P69A 1UJ3A 3PS6A 3Q3GA 4B9ZA 2EDHA 1DLFH 5EO1A 3SPHA 4X8CA 1EANA 4K0OA 5C0GA 1AQ8A 4QOKA 3V6BR 1KB5B 1XWVA 3D1MC 2EVJA 4FOMA 4WEUD 3EUUA 1AO7A 1JNNH 3H9HB 1KCSL 2NMSA 3ARBD 3L16A 4Q2ZA 1F3DJ 5F3HB 5HDBF 5KG9A 2W8CA 1CDYA 4IIQA 4LVNC 4MDRA 2R7EB 5G4OA 1N6QL 3OAZK 3KCWA 4A7UA 2BH0A 3HHSA 3N06B 1SM3H 3S3SA 5CN2A 5JUEH 1RV6X 2I26N 1W72L 5E5MB 1Y0LA 4BK4A 5F96L 3UAAA 5CBEB 4MAYA 1KCSH 3V0DA 3MX0B 1ZT7A 1LWHA 4UTAA 4PJBB 1MZYA 5D4HA 3O9WB 3QUGA 1HYSC 3QNYA 2XWDA 4UQCA 5IQ9B 1W72H 4FTVE 5F96H 1J7VR 3DJ9A 4F37K 3CDZA 3B9VA 1F8TL 4R7NB 5CINL 1QTSA 5B1AB 5KW9L 4OIIL 4OJDH 3SDCD 1SLVA 1OGAE 1VJSA 3RGVA 5E6IB 2OSWA 2RBLA 4QYAA 4BRVA 3KXFA 2YXWA 2WP3O 2DI9A 4MQTB 3BWUF 3GSNA 3CZJA 1WTLA 1F8TH 3GXDA 3OX8A 5CINH 4WHDA 2GJ6A 1IT9L 4B41A 5KW9H 1F58L 1FFPB 1OCWL 2IXQB 2YARA 5KVEE 2XBDA 3RY4A 4HWZB 1CLZL 1OSPL 4XR8C 5BCAA 1AZUA 4WNQB 1IT9H 1N26A 4A2MA 1C9SA 3BDXA 1JWSB 3LN5B 3ZZ1A 1JNHA 4FTVD 1F58H 2VABB 3AG4B 1OCWH 3IS1X 2BCKB 1HCYA 1HDMA 3QG6B 2HYMA 2DICA 1AXTH 1IU1A 3V8OA 2ICES 1CLZH 3RUGA 1OSPH 3PWVB 1OGAD 1WTGT 3TZVC 3BKYL 2QVTA 4JRYE 4G43A 2A73A 2OR7A 4N2LA 4AXWA 4YEFA 5LHDA 4ODWA 3FT3A 5J13C 1U4FA 1U3NA 1MWOA 4AYID 5I23A 2MNUA 3G6DL 2NUTA 1BLNB 3BKYH 3Q6FA 3VH8A 4HU2A 5A40E 5B1JA 3BE1L 4B5EA 3SBRA 1X9QA 1XT5A 4DW2H 4XX5A 5F88A 5BRZA 5K9QI 5SV4A 3LCYA 3AREA 1N0LB 3K6SA 1KTDA 2YAFA 2NOYA 3D50A 5D8JL 5GGUA 3QUZA 4G9FA 4MMXA 4N2IA 1TCMA 5IROA 1P5VB 3OWEA 2UZXA 3BE1H 3J7HA 4D0CA 4O5LL 4S2SA 5BW7A 4UDUA 4R0LA 4PJDB 1L0QA 5EO0B 1D6EA 4U1IA 4JRYD 2QJDA 4ZO9A 3D85D 5TDPA 4GUCA 3L4TA 3FL7A 5D8JH 2F53A 1MW2A 2YXFA 4IK6A 5HI3C 2OAAA 2BIPA 4O5LH 2VDLB 5BW7C 3CFJA 4X6EA 3SE3C 4Z7OF 1MH5B 2VLJE 3QJUB 1A9BB 1AI1H 3LHAA 5T3ZE 1TZIA 2EVGA 3HB3B 1IUZA 1EEZB 3QZWA 4FMFA 1NGXA 2C34A 1YAZA 3V95A 4XNYL 2EE3A 4JHWL 4NB7A 3W9DB 5IM7A 3OZKA 3U25A 3D18A 3OB0K 3TZVD 3GZPA 4AG4L 3WDIA 3IAPA 3R18A 2OMUA 3UAJA 4JFXA 4XNYH 1YNKH 4JHWH 3MN8A 3LXUX 4K55A 5FK9A 1F90L 3O0RH 3T0AA 4WTQA 4NQDA 1GGIH 3D2TA 1TTCA 3C9NA 3EOAA 3OWRA 4AG4H 3N2JA 2DQHL 2WXGA 4OCSL 3MC0A 1W72A 4RMUA 3STLA 3ZO9A 3T6QC 3QG7L 4UIKL 1I8KA 4XE0A 2VLJD 2J8UF 3UYRL 5DJYA 2L7UA 1XTLA 2W95A 3RIAK 1AG0A 5I76B 1WBYB 5ID1A 4KKNA 5KVDL 4H0IA 1S7TB 4QRPB 3WN5B 2DQHH 5FM5M 4OCSH 3OB8A 4HETA 4HHWA 4KK8C 3QG7H 1AGFB 4UIKH 1Q9WA 4HUMB 5EUKA 3RE0A 1BVLB 5BZZA 4BD4A 4OAWA 4FGMA 1CFSA 4YC2C 4HIQA 4F8LA 5KVDH 3IU4L 4AENA 4YHOL 4ETQB 3BPOB 4MNGB 4W4OA 2FWUA 1SJEA 1UYWL 2P8PB 3GT6A 3IXTA 5BUPA 4G6JH 1F13A 3PDOA 5D96B 2FHFA 1E6OL 1TJIL 2VAAB 5DHYA 1RJLB 2P44B 1SY6H 4KOCA 1EJ6A 3ECQA 3IU4H 4YHOH 2H0PA 2HFFA 4JRWA 4FNRA 3ARDC 4GAYB 2HFEB 4EZKA 2J8UA 1T03L 1UYWH 3QJOA 2NCEA 1E9OB 4FDWA 1E6OH 1TJIH 4PP1C 3Q8BA 2QHLA 3OGCA 5KN5A 4PGDA 2WUBH 1X7QB 2BNQA 3IEAA 4IEFA 1ZGLM 1TPXC 5DHVH 1OGSA 4EO5A 2Q6WB 3ZDWA 4QF1A 4GRLA 2AMUA 3QJTB 1AZCA 3TIEB 3CLFL 4RFNC 5C0FB 4TL5A 4UTCA 2YAQA 3SDDD 4CMMB 2HT4D 2DTSA 3IS0X 5ENWA 3QEQE 5C0IA 1KSRA 3ZE2F 3WNJA 4AGOA 2E27L 3MOQA 2J71A 4CADA 5E95B 2WANA 1PIGA 5D4IA 4GRLC 2Z31C 3P73B 4GSDL 5EO9A 4AUJA 3ZKMD 5IB2B 1OARH 4P07A 2EAEA 1M7DA 4KK8D 2EIBA 2XN1A 4OR1A 4XXDA 5I5JA 4F33B 1WLHA 2E27H 3O2DL 4XGZA 4Z0BL 3MRGB 4GSDH 4ZAKB 3PIQA 5DZLA 1HNGA 1DBAH 4L4VB 1FGVL 2QDWA 3I6GB 2JCWA 3V0IA 5INDA 3N44B 3DIFB 2IWEA 1XL6A 2YPLB 3O2DH 4HIJB 3WE6A 4Z0BH 5FFOA 5ACLA 1HWGB 3BWAA 3QEQD 1Q72L 6TAAA 4LLQA 5CSBA 1FGVH 4R2GD 3PAZA 1C5CH 4UM9D 4FCHA 1IAKB 4TRPL 1D5MA 4AEEA 1J88A 5IMLB 1MCNA 2PTTA 2CPCA 3F7VA 3FQXA 3MCYA 3BC9A 3NCYS 4PP1D 5AVRB 4KY1L 5IBTL 4UWQB 1EGJL 2Z9TA 3QHZL 4A39A 1Q72H 5IW3A 4BQ6A 5J7CC 1NOLA 4H8WL 2BNRE 4RETB 4TRPH 2DQGH 2YIHA 4U1SA 4LLVA 5IBTH 5J0BA 4K7FA 5E03A 4TVPL 1OZTG 3GSUA 2W0KA 1I1AA 4H8WH 1MFAH 4ONGL 1IFHL 1NL0H 4ANXA 1XH2A 4NPJA 2M1KA 3LSOA 1JDAA 2Z31D 3G6AB 3K46A 4TVPH 1ODAA 3H6AA 1K6QL 2X9YA 1JSYA 2X44D 4IHOB 1J0HA 2P47B 2X4PA 4ONGH 4MJJA 1NFKA 1IFHH 3FQTB 1ZKAA 1U2YA 4FQIL 4OFIA 4Y4HA 3GMLB 4PJCE 5B3NA 1NGPL 3VH8G 5IHLB 3GDCA 2BNRD 1K6QH 3DHUA 3VRIA 1E2ZA 3SPJA 4HH9A 4EEEA 1EWHA 3TIDB 4TNWF 3NCJL 5C0BA 3AS3A 1CL7I 1NGPH 3BFQG 5ESAA 2X4UB 4LHUA 3HHMA 2CLRA 4KMTL 2ZOTA 1DQKA 3DX9A 4Z77A 4P4KB 5DEZA 4QTFA 2VDNB 3BJLA 3E1F1 3NCJH 4Z78B 3SDXE 1DVTA 1A1OB 4KX9A 1J1PL 4JR9L 4YZFF 3MGTB 4XNUH 4R7DA 3DETC 4ZDHA 1SDAB 5EBWA 5DHVA 2EUWA 2ZYSA 3VD2A 1LMIA 4E9RA 4L4TA 5HHVH 2X6CA 3HVNA 4OSUL 2A2QT 2P5EB 4NKIL 4ONOA 4RIRB 1KCLA 3KHOA 1MCJA 3REWB 1J1PH 4JR9H 4U6XA 4PREA 4XMVA 3QZWG 5DMKA 2EYSA 1I31A 3L3DA 4OSUH 5J6GA 1CQYA 5IMMA 5M95B 2XQYK 4NKIH 3ARFB 3UTTA 5FO8A 1JJUA 3TX4A 4NPYB 1G7LB 1J9TA 1ZIAA 3K0WA 4QO1B 3TNMA 4GQ9L 3BW9B 2D0HA 1LEIA 3B2PA 2WO2B 2WLKA 1HEJC 4CC4A 2HUEA 4XMKL 5F3FA 5C2UB 5F9OL 2Q86B 2O6CA 3PHOB 2EECA 1KIUB 1W0VA 3VXNB 2K9UA 1P84J 1W80A 4I5BB 1ONQB 1X6NA 4GQ9H 2A4ZA 1DVXA 4XAKE 4WI0A 5FO9A 5GGSA 5F0PB 3O2DA 2IQAB 4XMKH 4YDJA 2UYLA 4RESB 4WWKA 4JFPA 1PFCA 2K3TA 4K7PL 3DVIA 5F9OH 5I1AB 2GITB 3GXPA 4H8UA 5L2KA 3WI9A 3H4FA 2Q20A 3UTSB 2BHYA 4XO3A 3W9EB 3V0WL 2CD0A 4OLXL 5EF0A 3FCSA 2QSQA 1UZ8A 1H5BA 3V0WH 4M7LL 3UTQB 1AVAA 2F18A 3G5ZA 4UB0L 3VG9B 4FFVC 1MSPA 1UT9A 1EXUA 1CJYA 1OP3K 1RCYA 4GKNB 2ZUSA 1AGCB 1S3KL 4PJHE 4F8PA 5LQBH 4XAKD 3BGFB 3BP4B 4ZYKA 4L9LB 4HD5A 5LAXA 2WP3T 1Z9PA 2VW7A 4UB0H 2UXTA 4KKCC 4F8OA 4X5RA 4U1NB 1Z3GL 1M1XB 1CFNA 2APXA 5CO1A 5TQ0L 1XMEB 1S3KH 3MPCA 4W9ZA 4X5QA 5I1LB 3JT2A 1B4RA 5SWSB 4YHYC 2VZOA 3DC0A 3D0AA 1ZHLB 5EIIB 1DQQA 1K4CB 1Z3GH 3VI4B 1RUKL 2XZZA 4XNAA 2W94A 5TQ0H 5CEXA 4J1UA 2D8KA 1MHCB 3B9AA 4YFDB 3OKKB 1KXVA 4J3OC 1I4FA 2M83A 3KL5A 4RMSA 4PH8A 2Y3NA 4JBSA 4H4NA 3VTAA 1QHQA 4QTIL 1USQA 1PEWA 3MHZA 3OR7A 4MSWA 4LLDA 5F0MB 1GZHA 1A22B 4NN5C 3MRQA 1OCZB 4KV5F 4LSVL 4MNQA 4PV8B 1WWAX 3MUY1 4EIUA 2BSTB 3WIFA 4ZX5A 5GZOA 2VRKA 5KSUB 1XF2A 1N5AA 1O0VA 2J20A 1QASA 1NLDL 1XGPA 4M5SA 1BGXL 3QUXD 4TSAL 2MCAA 2QMKA 4B96A 2C1PB 3CFNA 3HC3L 5JTWA 3V55A 1C7SA 4QRTA 4LSVH 2DQUL 2ED8A 4FFVD 2D3VA 4IOIA 4XMLL 3IFOA 1NUGA 4XWOC 3N43B 4BGDA 3T3MB 4B9YA 4RQQB 2WQSA 4QNPE 5J3HD 1NLDH 3SY0A 4FZ8L 1BGXH 2LTQC 4TSAH 4WI8A 3HC3H 3JWOH 4KKCD 3LN9A 1U8PB 3IDJB 2DQUH 5J11C 4FX5A 4XMLH 1G87A 3NFPB 3ZHNA 4FJYA 2XYCA 5IFJA 5LAPA 4FZ8H 3QUYA 1ZT1A 3U0TA 1CFBA 4MD4A 1OOAA 4M00A 3EO1B 3CCHB 2GSGB 4RLDA 3PWNB 1JRHI 1DVQA 1MVFA 5K1VA 4WW2C 3UFIA 1RHHB 3Q1SL 1NEUA 1RK1A 2MPAL 3HMXL 2E7MA 4P3DB 4XBPB 2RGSA 1F97A 3OMNB 1CPUA 4J3OD 2V2TB 4JRXB 4MX7B 2BMKA 2QR0A 2FO1A 4DGUA 2Y72A 1LNUB 1IGIH 1UB6A 4J3BA 2MPAH 3WTVA 2F8VA 3HMXH 4G8FB 4DKFL 4KPHL 3ABZA 1EJFA 4FL4C 4UUJA 3G5XB 3ABKB 3HJEA 3BLPX 4GSXA 1I8MB 5T1KA 5EC1A 4AGQA 1SOKA 2CBQA 4FG0A 4PFEA 3THML 1F41A 3KYOB 5DFTA 3FQRB 5GGSY 2CA3A 3MBWB 4U4IA 3QI9C 4N8VB 3O8XC 4KPHH 3ZIYA 2LLNA 4U1LA 2WLMA 4LIQL 2DM7A 4QKXB 2E7CA 5AAMA 1PZ5A 3MGAA 2Q7AA 4XWOD 2R4SH 3THMH 4LHUG 4XMTA 2VRQA 2V7NB 3FQYA 4PYHA 1L7TL 2APFA 3DX2A 3BUPA 3IYLW 3UDWC 5E94A 4PGZA 3W0WA 4MLIA 4LIQH 3X11A 1VCBC 2MMXA 4JPKH 4EUPH 4MB3A 2G75A 4XT1C 2RACA 3E7JA 2IDUA 4AI7A 1L7TH 4OTXL 4XVSH 3QSKB 1CXEA 1JRHL 4H2AA 2XQ0A 3ZDYE 2PCYA 2EKJA 3MCLH 2XWCA 4HLEA 2XYBA 3ESUF 3IGLA 3G04B 5FGBC 2V4LA 2XOTA 4GS7B 3QFDA 2AV7A 1WP6A 5SX4H 2FD6L 4OTXH 4E5XA 1NOFA 3TNNA 4DZBA 1JRHH 1ETA1 1KIRA 2UZIL 2Y1ZA 4N2AA 1JGEB 2ZP0T 3VA6A 5IESL 3ESOA 3QIWD 4HS3B 5D2LB 2FD6H 4DN4L 3KL0A 5L0QC 3AMKA 5AOIA 2NXZC 4XHQA 1NKOA 3ZYZA 2FJHB 2PCFB 3V52L 1EAPA 2XKNB 1PG7L 5JIMA 2HTLC 2WD0A 1MOEA 3MUJA 3WAKA 1M71B 2IDTA 4HMEA 1PQZA 3QFGA 3B2DC 3FSZA 3ES6B 4NNXA 1HQ4B 3QRGL 5KS9B 3KS0H 1A1MB 1HHKA 3MFFB 3OSKA 4DN4H 4PJEB 4FXGB 3QI9D 4JFEE 2DQMA 1PJ9A 3FQWA 3IPBA 4FI6A 1NPNA 2BY2A 5CJXA 5HTSA 5IQMA 3FFDB 3MLPA 5TGBB 3V52H 1LWRA 1MEXH 1PG7H 3KEDA 1K8DB 4L5FE 5AG9A 2CLVB 3QRGH 1R3KB 1Z6JT 1D5XB 4LBAA 4PW4A 1OT1A 4XN2A 3SZ6A 3A47A 3SQBA 3NA4A 1DVFC 3T0EA 4MBOA 1RU9L 4BH7A 3VWJA 3ZO0A 3C60C 4DCQB 1K85A 3V5DA 5ES4B 2OV0A 3Q2VA 3IFPA 4W9FC 1AAJA 1RU9H 3FC8A 3T0EC 2QLYA 4JREB 5E4EB 4K15A 5JR1L 5D55A 2R2HB 1FL3A 2J2ZA 2BNUA 4GLRI 4IJ3C 4G7QB 3EAKA 2IADA 1NINA 3LH2L 4E9YA 2WJ7A 3CFDB 2XIDA 4A38A 1QSEA 1BFTA 5FM4A 2DYRB 1KIPA 1A4BA 2ZXAA 3MR9A 3FYEB 3HMXA 2OULB 1INEL 3Q2NA 1JVOA 5FUCC 3LH2H 1OKEA 5ANME 2NXZD 3FYIB 3PWJB 4PRHB 5D1XA 5CMAB 5CFAA 5A3IC 1XEUA 4X9IA 2F8XC 1KELL 1AZNA 2ZG3A 4PGCB 2DQFA 5SX5K 2ARWA 1Z1WA 4N0FA 2A99A 1G4RA 4F93B 3MUGB 1INEH 2J57A 5B1CA 5DRZA 4Y4FB 3VQ1C 5ERWB 1RP9A 2EDYA 5CGTA 3JWDC 3QARA 5DO8A 2FT6A 2VLLB 3Q2WA 3UEQA 5A16A 3UACA 4UDTB 5DGQA 4W6XB 3HE6C 3ARGA 3FFOA 3I75B 4N4YB 1MY5A 4OBRA 4RRPM 1CVRA 2VJXA 3F65A 3NFSL 4YEEA 4A6YL 4K7PY 1XGRA 4EUPA 1TJHL 5FUCE 2H8PA 1YEGL 4IKJA 4L0PB 3M17A 2GBTA 3GF8A 4R97B 5E8NB 4DWHA 4P2RD 4S1QL 2AV1B 1H6TA 5E8OA 3L4WA 3MTXA 1QA9A 3UC2A 2J8HA 3RY5A 4A6YH 4C8XA 5EEXA 3RDTB 32C2B 4BA8A 1FFOB 1YEGH 2IPUG 5GHWL 3ZYIA 4FQ2L 4S1QH 2FEDC 2B39A 2GK0B 4HW6A 5G2NA 1ANUA 4H25A 2GBUA 2VLRE 2XWZA 5EOCH 2ESVA 3E6FB 3RYMA 3GSOB 4NJ9L 2IANB 2RCSL 1S9YA 3A67L 1MW3A 3HKFA 1JZHA 3Q2CA 1QABA 4HIEB 1NDMA 1SVZA 1TKWB 4G6AC 5GHWH 4GLRH 3WJMB 3MXVL 3KLKA 3EJJX 2H32H 3FW6A 3HI1A 4X9GA 4FQ2H 2DQJL 1BF8A 5IW6B 1I3GL 1OALA 1SGKA 3WIIL 2XWRA 4NQCE 2RCSH 1WS7A 2QSTA 5FYLE 5J9PA 2CMRL 4UT6L 3SE8L 1M42A 3MXVH 1T66C 3V4UL 3OMIB 1PNDA 2VXVH 3FMGH 5E99H 3HRZB 1I3GH 2A38A 2FDBP 4UILL 5INCB 5JXEA 3WIIH 1KTLA 3VNZA 5AKRA 3MRBA 3KH3A 2HXAA 1UCTA 5LNGA 2CMRH 4UT6H 1MNNA 3WL9A 3FO0L 5CSZA 2VLRD 1R5WB 3HE6D 3V4UH 2ZAHA 4Z5RB 3N41F 3CX2A 4JFOB 3FO2A 1IL1A 1RL1A 1HYRC 1Q9LB 1ZLUH 2X05A 2YQGA 4F7MB 2ZUXA 4AQOA 4CN6A 2P5WB 4PJ5A 1M2VB 3KLAA 4H88H 5BS0D 3FO0H 3P9WB 3SDAC 1KLFB 4NQCD 1FVDB 1V3LA 2QKSA 2EQDA 4X50A 5FYLD 2PCPB 5ADOL 2Z92B 3DV6B 1OSYA 3OR6A 1X5LA 1LEKA 4OF7A 4IGBC 2YMXL 4HP5A 1M9SA 3ZE0E 3FFCA 4RGNB 4Y7OC 3DSNA 3BIKA 2CXGA 4TNVF 4AYEC 4AZ8B 5ADOH 1U8HA 1JG9A 2WWMC 4H1LB 2YMXH 4B53A 4NP4L 5HVWA 2R51A 1YY9C 5EOQL 2WSDA 1ROCA 3L1GA 4U2YA 2ITDA 3DIDA 3CU1A 1J05A 4ISVA 4Q6YA 1MCFA 1X9LA 4KO6A 3SPCA 4PWJA 3LZPA 4NP4H 3L3OB 2AJXL 4E5XG 1GGCL 3EYVB 3U4AA 2FVNA 2O6FA 5C08A 3PL6C 2WTPA 3MBEA 2RQ8A 3OXSA 3TCLB 2CDGB 2EZ0D 4U7MA 5A2LH 5C70A 1PYWB 2AJXH 3JV4B 4G80B 1GGCH 4PJXE 3HG5A 3QUKB 4OY9A 2GSMB 4WFHE 1FZOB 4MQ7A 3QORA 4TQEL 4WHYH 3VXME 4N2EA 4N6RA 5HY9A 1EFXD 5C0JB 3SDAD 4K5PA 3P3UA 3GBNL 4A6YA 2QGEA 2NXYB 1EHAA 3VWKA 3TEYA 1SYSA 4G8GE 1JGLL 3TO4C 4TQEH 1IX2A 3QORC 4FNSA 4AKPA 3L9RB 1T5WB 3QNXA 3HS0B 3PJNA 4L1LA 1D5IL 1QQDA 3D3VE 3GBNH 1MFCH 1YJDL 1S7VA 3HG1A 3X2QB 4AQ1A 3W82A 3VSQA 4PSPA 4YWGL 4XH2A 4ZOAA 5FCUL 3VWKC 3GMRA 1JGLH 2WWMD 3OZ9L 2H32A 4XN9A 3A4FA 3ARYA 4WZ9A 1YY9D 1D5IH 2NX5B 2JB6B 1YJDH 2JI1A 4PJ8D 2D2CC 3U9WA 4Z3EA 2WMPA 1VKXA 3A6CL 4AQ1C 2HKAA 2D9CA 3AACA 4YWGH 5FCUH 3VM5A 4JZOA 3VXMD 4AE1A 1YEDA 3GMNA 4AQEA 3OZ9H 1JNJA 2Z4QB 1IGTB 3WEXB 3VFOB 1SHXA 1OK0A 3CFKB 4G8GD 3GHEL 4Q52A 4D0DB 3A6CH 1ZA3B 3PP3K 2ODHA 5EU3A 3PL6D 3KLHC 4M4RA 5FFGA 4UT6A 4H1LH 1T20B 1CGTA 2OSXA 2UZYB 1FZKB 3D3VD 5F7LB 1QSFE 4GO6B 1P69B 1EXGA 1N0XH 1GS7A 3KNBB 3BAXA 2OMZB 3FU6A 1G7IA 5CILL 3O11B 4Q6IA 4IW4C 3JVGA 3CC5A 2P52A 3LKRA 2IMNA 4YUEL 1A3QA 3NCXA 3DKHA 4UV4H 3V6ZB 3ISYA 2DDQH 2DJMA 1G1CA 3O2VL 2ZKWA 4D9LL 5J8OA 4FLQA 3R7QA 3WTUA 1NFAA 2CJUL 2NZIA 4I3GA 5CILH 1GOHA 4NKDA 4DQAA 3TO4D 3W2DL 3SE9H 5JPNC 5DHXB 4YUEH 5M7QA 4ZW3A 4UF7C 1VFAB 2IF7A 1SEQL 3TFKD 3IJEA 3PNWA 3O2VH 5BJTA 2CRMA 1H8OA 4WSKA 5LBVA 4D9LH 1W8EA 2LE9A 5AW1B 2Z93B 4EUPG 1RIHL 4XBGA 3B2MA 1QSFD 2K45A 2CWRA 2WNXA 4LGPB 3W2DH 2MOQA 4FG2A 3O6FB 3CN4A 3HBQA 1EAQA 2X6UA 1SEQH 1J9CT 1IGFL 1TR7A 4RAVA 3KPQB 1RIHH 2I60L 4WJ5A 3J8F7 3D07A 2G2RA 2W0LA 1T1XB 4O2FA 5KVMC 2RD0A 2WLYA 3SZKC 1FZMA 4W9LC 4LCWD 5B3JE 1GOGA 1UASA 1QRNB 1IGFH 4TS6A 1G7MB 1BSIA 3CZKA 2AI0L 2I60H 4CSPA 2OJZH 2XLLA 2WXPA 3FU9A 2WZ5A 4NENA 3EH3B 3F05A 4F3FB 4ATWA 1F4AA 3ZTDC 2OK0L 1BXVA 1YEWA 2VR4A 3H8NA 4AK1A 2AI0H 3PV6B 2GTWA 3A23A 5MHSE 12E8H 2VL5B 2IBZX 1RJZA 3M86A 4FG6D 4XX1E 2OK0H 3QS2A 4I2XE 1G1YA 4KHTH 1E4HA 5ESQB 4OI9A 3RTQC 1XGYL 4KJWC 1IAII 3QYNA 1BZOA 3DXAE 4AIXA 3RWIA 4YK4C 1T3FB 4WUUA 1EHXA 3QPKA 3C6SB 2Y7QB 4WU5A 2AK1L 1KBBA 2ICWI 2CK2A 4HEPA 5MI0C 2MEJB 3FQ2A 1BBJB 4JHVA 3LKNB 1OK8A 1XGYH 3EBAA 4B0MM 5BO1L 3U6XA 2BSRB 3MRHB 4UQ2A 1AYRA 1RJYB 5D2NB 3OM3B 3TO2B 4J4PC 5MHSD 2VR6A 3EOTL 4HJSA 4J39A 5BO1H 3KBEA 4DK6A 3KDMA 2XICA 3RY6C 4PAZA 2PYEB 3RIFF 3QPXL 3DXAD 2N01B 1GRWA 2ATPA 3RWCB 2VB5A 3EOTH 4Z7VB 3S97C 3US9A 1CLCA 1U93B 1MREH 1UQSB 4KDTA 5C07D 1CK0L 3I6LE 1CD8A 2OMTB 4NWUL 4YXKL 2B16A 3PDDA 1JK9A 3QPXH 4Z7AA 2E4FA 3WHXA 3FKUS 2MPVA 4KX8A 3P9LA 1CFQB 3QXWA 1CK0H 4JDEA 1X5AA 1WA0X 4NHUB 2UWEE 3RA7L 4OM0L 1TQCB 1ECYA 4MJIA 1IAIL 2VDQL 4UNTA 1BX2A 2JKXA 5B7EA 3RG1C 4AJYV 4D8PA 5HGBB 1IGYB 3QO0A 3RTQD 5TE7L 1ACYL 3BVNA 4MCZB 4HVBA 2A9DA 4GRWH 3MGOA 2VDRB 2ZWKA 2R23A 3CFTA 3RWHB 5BQ7B 2KDYA 3PAVA 3B6SA 3FU5A 3RA7H 4OM0H 2J44A 3HS9A 1MHEB 2R8SH 2VDQH 1SN0A 1BWMA 3FO1A 2QV4A 2KZ1B 3KAAA 4LRIA 4L2LA 5DRWA 3TBSB 3FUFA 3K6NA 3I6LD 1WT5A 1SRDA 3NT0A 5TE7H 5G5DA 2HJLB 5EWIH 4F57L 4Z1PA 3HHRB 3VGEA 1IGJA 3RL1B 2GSIB 4N5EC 4HYTB 3WUWA 5JORA 4L4JA 5KYWA 3KPRE 3HPJB 3RJQB 4K3GA 1O5PA 2C9PA 4J4PD 2XPGB 4NQQA 3L7EA 4PS4H 1PKQB 2VMJA 3TFBA 1U8QA 4AEHL 4PCSA 5EU4A 1TYEB 2LT9A 1YN7B 4IM8A 5IHUH 4F57H 2OL3B 4I0PA 2P24A 4KVPA 4PJAB 2V7HA 3T3PE 5BRPA 3PWPA 4XP1L 1AR1C 2GBAA 3QS3A 1JF6A 2ZUYA 5IB5A 1R46A 4OFPA 1BM3L 5HYJE 1NBQA 1UXWB 3ZDXE 1MCPH 4U1HA 4Y89A 5IIEB 4QY8B 3SODB 1YLBB 2UXVA 4X4YA 1EHKB 5GS2H 4XCEA 5E7FA 4XP1H 4JANB 3MMEA 4JCLA 3EYSL 2FO4A 3W5MA 4P5RA 2CHZA 1IVLA 3K8LA 1E3ZA 3MO1B 5FR3A 4YDLB 4YSUA 5T1LA 3EOBB 2EVFA 5IR1B 4XZUB 1AY1L 3GMQA 4JL2A 3CFEB 3EYSH 3ABMB 5HGHB 3PU7A 3AXHA 1QLRA 1LXMA 3QXUA 2C3VB 3RZCB 4OD2A 2DQIH 4OCXL 4X6DE 2JXMB 5HYJD 3FTGA 3WFEL 4F2FA 3NJJA 5K59E 4L3EB 4ZNEE 3C6EA 1FVCA 3QAZC 5TD4A 5B8CA 1QR1B 4XXCA 3HMWL 4QYOA 3EYOB 4OCXH 5L6YL 2X28A 3TWCL 3FT9A 3K91A 3ZW3A 4EN3A 3WFEH 5KYUB 4G42A 4OVUA 2IMMA 2DYPA 4GRWF 1BQRA 1EO8L 2A74B 4PWFA 2VH5L 2ZWYA 4LHQB 2J43A 2VO8A 4R7VA 1YNTA 2VW4A 1BJ1H 5B8CC 3HMWH 4BWUA 5L6YH 1AR1D 3TWCH 4YS4A 3MRJA 5E1AA 4GBXD 5DTFB 1ES0A 2JCCE 1AIFB 3ALXA 4IOSA 4YBQC 4WFED 2XNAA 4KKPA 3TASA 3FUIA 3RNQB 2VH5H 3PNRB 3F83A 2F7RA 4QCIB 1X5ZA 1H3WM 3E2HB 4RAUB 4JNXA 3AWGA 2I9TB 1G9NC 1CZ8H 1FNSL 1WFJA 2PABA 1PLGH 3EUDA 1YEKL 2OJEA 3MNVA 1CFVL 4KXCA 5F9JB 5I8CA 1AGDA 1SN5A 1VF5C 3LV3A 3ILDA 4ZO6A 4AGLA 1NZRA 2G30A 1FNSH 2ICEC 1FNFA 1XSKA 2UY6A 5F9WB 1CFVH 2PWHA 2VKXA 1HT6A 3ETBF 3SBQA 4M03A 3T77B 4BJLA 5I1IH 4KVCL 4PJGF 3UG5A 1ZS8A 1NEZB 1P6WA 4WHYG 4WWPA 1VERA 4XTRD 4GP5B 2OQJA 4KKRA 4IU2A 1R5IB 1T5XA 3D06A 4ODVL 4Y19B 2UX7A 4U31A 1K5WA 4OU3A 5D1QD 4KVCH 4PI0A 5DZNA 3GXUB 2IH1A 2X6AA 1P5UC 4ELKA 1F0LA 3GHPA 1J0JA 1H8NA 5AAPA 1B0RA 4HX1A 1TMCB 2JWYA 5EF3A 2DQTL 1M4KA 1HI6A 2ROXA 2DKMA 3DPBB 3K6DA 1GJIA 2EO7A 4KJPC 2ADIB 1KXHA 3QYCA 2VSKB 2C1OB 2V3FA 1UZ6F 2BZCA 2DQTH 4JDZB 4PBXA 4PJGA 4X7TB 2OMXB 5IMOA 5K9KB 2X4RA 1J9RA 2NY0B 4LBEA 4IRSB 4FFWC 4B3EA 1PW3A 3WY4A 3B9KB 3VXTB 2ZKXA 5SWZA 1FFNB 2WVVB 4I18B 1MRDL 3IDIA 3VFNA 2VM3A 3QIBA 3VMOA 3BP7A 3V5HB 5C0AA 3DMMC 4H1LG 1GMEA 2FLBT 5FWQA 1XIWC 3ZKXC 5FO9B 1EVUA 4PTTA 4O58L 3BH9B 3RPBA 1V05A 3ESPA 2AAVA 1MRDH 3G5YA 4ZXBC 1VSCA 2B5IC 4DAGL 4JFQB 5CZKA 3Q05A 3TJPA 4OBSA 2IAMA 4OFVA 4OKVA 4KTGA 3C8DA 5CIPB 1BOGA 3C8KA 3H3PL 3IMWA 3LYRA 2NYZA 4JFFE 4BFJA 4FADA 4N8UA 5KBDA 1QFOA 3LPPA 3H9SA 4DAGH 2MNJB 1NIAA 2FBJL 4NT6A 4GW1B 4OZGE 3OAZH 3VFVB 4WV1A 1CFTA 3KBFA 1HHIA 2W81C 5C0DA 3MV7B 2FB4L 4FHKA 3H3PH 2FR4B 4DEWA 3PWUB 5C86A 4X6CF 2NLJA 2YPKA 3FO9A 3G08A 1GPOH 1AKPA 2FBJH 5FC9A 2IDSA 1IJNA 1YMMA 3AXLA 4QLWA 3FCUB 4ODTL 1AQMA 5FGCE 1RZ8A 1IGCL 2FB4H 5GRUL 1DN2A 2Y2WA 4CBPA 3L3GB 2YUZA 3WUWG 4P9ML 5CEZH 1F02I 2AK4A 1TVBA 2GUOA 4O9HL 4W81A 3GZKA 4MWFB 3HNTH 4FFWD 1M7XA 4JFFD 1FE8H 2M8XA 5I1CL 4NQEE 4ODTH 2DIEA 2Z4TA 2ZXQA 4H8HA 4JY5L 4BCZA 1IGCH 4L29A 4P9MH 5HXMA 5CCJA 2NR6C 5I1KL 3DMMD 5AW4B 2E8YA 4PB9L 5CCKL 4AC2A 1XH1A 5I1CH 1WFIA 5E1IA 2AQ3A 3VXRA 2AQ1A 2ZICA 4JY5H 1BVOA 4X6CA 1UOKA 3K0YA 5DHEA 1F6LL 2YEZB 4UM8B 4ZXBD 1UFUA 5I1KH 2E7LC 1C1EL 3QZLA 5CCKH 4KOBA 3ROOB 1T83A 5IB3B 1I53A 4MAYD 4LVHB 2DKUA 3FT0A 5C09B 3RWJB 4NQED 5ITBL 1GJUA 1VZGA 4LDCA 3PGDB 5CM1A 3WFBH 5E9NA 2HZHA 3DROA 4GXVL 2EDMA 4P46B 2JKRM 4WVRA 1MI5B 2JVUA 3L2NA 4F2MB 3DVGA 4Z7QB 3QZOA 3IJHB 1FZJB 3CG8A 3GBML 5ITBH 5LBSL 3VSTA 1RXLA 3RLSA 1AYOA 5C7ZA 4X99B 2AJSH 2N3JA 3S2CA 1NKGA 3F6JA 5DXWA 3EGSB 2K6WA 1AZBA 1DZBA 1B6DA 4YHLL 4G71B 5ECJE 3GBMH 2HG0A 1DFXA 5LBSH 3H53A 5K9OB 4HAFA 2BWDA 1SXNA 1BMZA 3D39A 3TA3A 4XC3L 5AL8A 4XXWC 2GTZA 2GW5A 3RX7A 3UROR 2NR6D 4JJOA 1CG9B 4TKWA 3B43A 1UWYA 1XCTB 2DPKA 1SNRA 1WBZB 2UX6A 2YQ3A 1MCQA 3C5XA 4YHLH 5E2VL 5HGDA 3ZK0A 4E36A 5DD6B 1U33A 2FWOB 4N0UE 3HR6A 4WKZB 4MXQC 1MHPH 4N0RA 4F37F 2QV2A 2OXHA 2R1XB 4P3WA 3JTTB 3IB4A 5E23A 4MZIA 3IJSB 3WIAA 1M7IA 2VLKA 1U8CA 2FEEI 2NY3D 1BEYL 2B4CL 2VQ1B 2IH8A 3WUZA 4PBVC 4OFYA 2OSYA 4Y5VC 3AY4A 2G4GA 1AIZA 3K6OA 3QXAA 4OZFB 4QHMB 4NUJB 2EXSA 4LQ1A 2WHVA 5D7EA 4ZPTB 1BFVL 5DVPA 1BEYH 4QRRB 4FQXA 4G8EB 3O4OB 2EH7H 4G9DA 4IDJL 3ARED 3HUJB 2DLIA 1Z9NA 2DM4A 3C5SB 1D7BA 4Q14A 2W65A 4PJ7B 2E4TA 4JM2D 3FF7A 4YAQA 4YSAA 4IDJH 2GJJA 4YHPB 1AZRA 3AAZA 1ORQB 4L05A 2OMWB 1B3JA 1TTBA 4G8IB 1PPIA 1S5HA 3CSYB 3SO5A 5BV7C 3QEHA 1FC1A 5I0YA 2QPUA 4HHAA 1FCGA 3HLKA 4DP0X 5CNHA 3VXSB 5CAYB 2DH2A 1GR7A 4E42B 1MHHB 1XR8A 3VG0H 1Z5LA 2YD5A 1JF1A 4HJGA 1IAOA 3IE9A 4XI5D 2G5BA 2XG4B 3UJJH 5HYQA 2J21A 2VMCA 1C5DB 5F97E 2FEEL 3VQMA 3KM2A 4S1SL 3S35L 4B50A 3TWYA 1E9QB 3EDJA 1TO5A 4X9HA 3WS6C 4PHXA 4YIQA 3UO1H 3EIFA 4IKKA 2ZUWA 2AQQA 3IDYB 4OF8A 5IJVB 4BFIA 1JD7A 4F2EA 1KJVB 3OHXA 2AITA 2AJ3A 4V1DE 3S35H 4S1SH 1GTNA 3PAUA 1KF9B 3QDGA 4NN6C 1PY9A 2CNZA 3F64A 5FKPB 3QXDB 3BLKA 4DP8X 5FECB 1U8MA 2OXGA 2JLLA 3K71A 4JFZL 5E24E 4FLRA 4PV9A 1GOFA 3BZFB 4M3JA 4NSKB 5IG7A 3EDKA 4NXKA 1RHFA 2JK5A 4MFHA 4MCYB 5E0FA 3MV8B 4WSJA 2QKIB 3O9WC 5IB1A 5CLYA 3WDHA 4JFZH 1M6OB 2Q87A 1FNHA 3QW9A 4C83B 4X0KA 1BMGA 4CU7A 1NBYB 5LBSA 1T7YA 3UTZA 1KCKA 4XBMA 4KITB 3G6JB 2XN9A 2G9KA 3DBXB 2Y07L 3HE7A 4MJ6A 1FNAA 3MA9L 4Z7UB 4M62L 5E6IC 4J7RA 4DEPB 4APQB 2WQVA 5GS1B 2I9LA 3MYJB 4P4RA 2NW2B 2X4NA 4WI4A 1WPCA 4K3HA 1A6VH 1GVIA 2V2WB 5AOLA 2Z91B 4F8QA 2Y07H 4Y5XB 1HL8A 4EVNA 3RWFA 4M62H 5E51A 1DBKL 2HVBA 4PJBE 1UM5L 5CN1A 2ITCB 3V4PB 4E0RB 2L7EA 4HU8A 3HS8A 1TITA 1MPAL 2KLSA 4Q7DA 2FIRT 3WJLA 1J12A 1UM5H 3PPEA 1BBDL 4YFEA 2O6PA 5F3BA 2E9WA 2CDEB 4ZX3A 3VDAA 3WU1A 1MXGA 1F3JA 1NIBA 3EJPA 5FW6A 1MPAH 2HMIC 3V9CA 4X7CC 1U3HA 1ZWIA 1EEYA 1BBDH 1KJ2L 2NY1D 1JE6A 3ESNA 5EU7C 1NAML 1A25A 2EDOA 4G1MB 2AVFA 3O9WD 2B4CC 4HC1L 3VFPA 1QLFA 1YC8A 3G3LA 4GI9A 1KJ2H 2RH0A 2P45B 3APFA 3KPTA 1NAMH 4HZLB 1QBLH 2PPDA 3WKNA 5JNYA 2WLNA 4RWYL 2VMEA 1M05B 4HC1H 3RFZB 3EHBB 4P04A 3CHQA 3P9MA 4L8BB 5HHOA 3IGAB 5EZLA 2J6WA 1L0PA 2AEIT 5DYFA 1KTJA 2EICA 2R1YA 1P4BL 1ICTA 5EU7E 4O2EB 4ZTPL 4HJJH 4PWGA 3CD4A 4ABUA 1WIUA 1T4KB 1ZMYA 4RWYH 3BAEL 5IFHL 2XY1A 2V2XB 2O5YL 1BVNT 2DQ6A 3IDMB 5J12B 5MEQB 1I82A 4FC3E 3ZMNA 3PJSA 1OXYA 4R26L 2AS5M 3QCTH 1TOXA 3KHQA 5D7IF 3U7YL 2E9GA 1RZQA 1P4BH 4GAJL 1U36A 2YN3A 3A0OA 4YVUA 3HB3C 2EO1A 1TFPA 2BVUA 3IKCB 5IFHH 2YQBA 3DNKA 5H35A 1QSZA 4BFKA 4AVKA 4EI6B 4F5CA 1Z9MA 2J25A 3L1FA 1I1AD 3BYYA 4GAJH 4PJDE 1FDLL 3WNIA 5IMKB 5EV7A 3V0JA 2Z0BA 1X5HA 4LL4A 4BKLB 4AH2A 4Q9RH 1EK3A 5CJQH 1OW0C 3HR5B 1JZ5A 2CBOA 2PO6A 3L5JA 1ZDQA 4Z76A 1XSOA 1S7WB 2LVEA 1DJZA 3AADB 2D3NA 1FDLH 4L4TE 1T1YB 3O3EB 1KB3A 1T6WA 2VN6A 4Y4HD 3RPIA 5HPMB 4LL1A 4I9WE 3M07A 1S2EA 4MMZB 1V54B 1WHOA 1BIHA 5DJCB 4L8DB 4N26A 2NDGA 5D7IA 4QJ4B 1MVUA 3PE9A 1N2RA 1Q38A 5J6HA 1NEZG 2EUZA 3WN5C 1MCHA 3BP5B 2L7QA 2J4WL 3VACA 5CD5C 3U2SB 3QQ3A 1KWGA 2W60B 2CA4A 1SUJA 4TUKL 5AW0B 3KCPB 3UH8A 3KJ4B 2X41A 3GLAA 5LGJB 4WI2A 3BPOC 3L13A 3ZE1F 1YECH 5CS7A 2EIZB 4WW1B 4X98B 1TVDA 3BEVA 3ENEA 3HRPA 4L4TD 4ONHB 4TUKH 5D96C 5H37H 5CR1A 4UNUA 1P7QA 1ZIBA 3BIAX 3MTRA 5CBAA 3HB3D 4YBLB 2PPFA 3HZVA 5EA0L 1H8SA 1DYZA 1UT2A 3KPPA 2UY7B 2WQ8A 3KLQA 4QRPE 3UBFA 4ZX4A 5I75B 2ARJB 1E30A 1I9RH 4LDEB 1KPUA 3FUEA 3KPLB 4LF3B 1UTDA 3OKOA 3UTTD 3ATEA 1OP3H 2OSLB 5CLZA 4NZTH 4YPJA 4Z3HA 4MNGE 4ZMYA 4AYFB 2WXFA 4QWWD 2LOEA 3PXLA 2AXGA 3KWUA 4ES9A 3N1PC 3TBCA 4CKVX 3BXNA 3MDJA 5CGMA 3VFWB 1KJ2A 1FBIL 2QZQA 4ENED 5BVJA 1E90A 4TXVB 4ODXA 1TO4A 1NAMA 4JRYB 3O45B 4WO4A 3U6RB 4GT0A 3N85L 1UZGA 4HC1A 3S5ZA 1ZGLB 2IDFA 2HKHL 4WWKD 4QRPD 3REVB 5GS0L 1NJ9A 4EN2A 4HKXB 1FBIH 5CD5D 4JPIB 1FL6B 3SDYL 1D5ZA 3NSYA 5CCGE 5IK3B 4KFMA 2CGZA 1HHGB 3BUYB 3FB8B 3H3BC 4D3CL 4PPTA 3O3BB 1UJTA 3N85H 4ZAKC 5GS0H 2HKHH 3VFSB 1JNLH 5L2JA 3FJTA 5LUMA 2BOBA 1U95B 3SDYH 1Z3RA 4KI5F 1ETJA 4JO3L 4D3CH 1R6VA 3DJRA 3ESMA 3IJYB 1FNGB 2K1MA 3KPSA 3HCVA 1JZJA 1GSKA 3E8VA 1ITCA 3Q8FA 2I24N 5GJTL 1A7RL 3MROB 4ZD3L 3LKQB 3SKNA 2CDFB 4HWBL 4HZAA 5I2IB 4JO3H 2ZKMX 2ZONA 2X3CA 1I8UA 1KPRA 2ZAIA 4FRWA 3RU8L 2ZSWB 4ZFGL 1CXFA 3P2DA 5GJTH 1A7RH 4ZD3H 4L8SA 2FUTA 4HWBH 1CE6A 1FSKB 3FT2A 1KN2H 3HZYA 4GPVA 4L4VE 1KT2A 1K3IA 3NCMA 3FDWA 2OI9B 3RB7A 3L4XA 3RU8H 2YPLE 1IAMA 4ZFGH 4LP4A 1WGVA 5F7NC 4AM0A 1LDPL 1ZSHA 2F15A 2HLAA 4BH8A 2PKDA 5FA3B 1B9ZA 5KYXA 4WU7B 5EEYA 4TNFA 3PAYA 5DJ2B 2FLRT 2GJZB 3EJYC 1OM9A 1KB9K 3FQ1A 1A4JB 1LDPH 2IGTA 4W93A 1P1ZA 2FZ3A 1NCOA 1MAKA 3DYPA 2EE0A 2XN0A 4J6RH 2QADB 4MNQD 1XBDA 3PREA 2VAJA 4ZK8A 1L6PA 4WNSA 4JFWA 3ML9A 1RERA 9CGTA 5H37A 1G84A 3OPUA 4JK0D 2BM3A 3KPNB 5D5MF 2BDNH 2YPLD 1U8LA 1JPFA 3S3CB 5EU6A 5TH2A 1CI5A 1H15A 3CFBB 2Y1VA 4N3TA 3U9UB 2KZKA 2AABL 4AW4A 4P4KC 4LNRA 2AEWA 1NC2B 1WYJA 4LDOB 2IALA 1B0GA 4LLYB 1QX1A 4YE4L 3CVIL 1F2QA 4NO3B 3OKDA 2XI9A 4IU3A 2AABH 3Q5TA 3CZLA 1CIUA 2Y06L 3E6HB 2WBJB 3ZKXB 2R2CA 4UZGA 3PCYA 3QUYD 4Z8FH 1UXMA 3T2NL 3S34L 4JO8A 4YE4H 4N8CL 3CVIH 5DMJB 3IDXH 5AVVB 3U0PA 2O5ZL 3MRIA 4XCNB 3KWTA 2E75C 3BZ4A 1M3JA 2Y06H 5D5MA 1UVQB 4CSZA 5IHZA 4HMCA 1M57B 3VRLF 2K9FB 4PJFB 3N50A 4OW6A 4WWNA 4PGEB 5IJKA 1F5WA 4N8CH 3POHA 4P2OA 3BGMA 5HD8C 1UATA 1FHGA 2O5ZH 3EJYD 1F1GA 2D0FA 4LARL 5F7WC 3HLAA 2MIZA 1XF4B 2BSSA 2Y7LA 3QO1B 4N2KA 4Z3GA 5DI8A 4P57B 3SD2A 1RZGB 3W81A 4I9XA 4YHZL 1OO2A 4NRZB 4PRDA 4FQQA 5E2JA 5T1KD 4IMLA 2P5EE 5JOPE 4DHLA 1CFMA 4JM4L 3D69B 4R2GB 4LARH 3LNIA 5IBLD 4LU5L 1S8DB 3DA0A 1VADA 1GIGL 1XF3A 2QBWA 1HINL 1TYJA 4YHZH 5HHQB 1BQKA 4NWTL 1C12A 1VACA 5DZOA 3UTQA 5E8PB 2H4EA 4FQHA 4JM4H 3K4AA 4JFSA 2AQSA 4P49A 2DMCA 2OMYA 2IVFC 4MMYB 1GIGH 3W0WD 2OW7A 1HINH 1MJ7L 4NWTH 1LDSA 3JWNH 4LKCA 3ZT6A 2OTWA 4LOVA 4TV3A 3VXOA 1WCBA 4HWBA 1F2XK 4NDMA 2C7UA 1RIVL 3VG9C 2DL9A 1BD2A 3ZMEA 2KMWA 3BO8A 7PAZA 2JLPA 4Z7NF 5SV3A 3BGFC 1QTPA 1JN6B 4L9LC 3U46B 1HXKA 1MCWW 3DI2B 4TQ8A 3QCUL 3UTSE 3OKEB 4F7CA 4PRBA 1PL3A 3PGCA 4PY7B 3ZQXA 1UC6A 3ARFD 3FPYA 2OYKA 3QWNA 4NQVB 1BFOA 5HD8D 1Y18B 3NZ8A 3QCUH 2BFVL 3KWWA 1WC7B 4JG0H 2N0KA 1TZAA 3WKPA 4AY0A 4WI5A 4ICWA 1Y6MR 1LYQA 3PG2A 1A4KB 2YSSA 1ZSDB 3MLZL 2OCCB 4JGMA 1QNIA 3JV6A 5E4AA 1HNFA 2DI7A 2FL5A 4ZMQA 3RHWK 5T3XE 1PD0A 3LKPB 4EDXA 3GYRA 3RL2A 1L6ZA 3ARSA 3KVPA 1E27B 4ZFZB 5I1DB 3MLZH 3UTSD 5F1IB 2V6HA 5LN4A 5DVMA 4K3JL 3PQYB 1AGEA 2IAAC 1QW9A 2OMVA 3QWOB 4HT1L 1AS8A 5SWSE 2O72A 3QQ9C 4GMTL 4JO5A 4LPWA 1J5IA 1G5AA 2VDOL 5C0CA 3VI4E 3VWJD 1A4CA 3KM1A 4OZIF 3MACL 3CZFB 4OGXL 5DWUH 2Y22A 4OGAC 5DEGA 1XEDA 2NY5L 4HT1H 2XXGA 5DJZA 2GQHA 3FB7B 1CI3M 4GMTH 4IBSA 4PRIB 1UKTA 4G7RB 5LCVH 1JZ6A 1KPVB 2ADGA 2VDOH 2H2PD 4Y1AB 5T3XD 2XKSA 3MACH 1RD6A 1K8IB 4DO6A 3EADA 4OGXH 3FONB 2NY5H 4KH9A 1ZRUA 5EU5A 1X5KA 4AGPA 1RHHA 4E9TA 3FCGA 2WLIA 4BQCA 3P4NA 3NZHL 3RVXD 1U8OB 4O00A 5B4MC 1H3GA 5SWSD 5C8JA 2ENYA 1JBJA 2WTOA 2BINA 2VJ8A 4QJ5B 5IW1B 3CUPA 3P3TA 2ZX6A 3AMLA 3OKNB 1YN6A 1PSKL 1SQ2N 4HCRH 1FAIL 2B20A 2BX5A 2O5NA 4F24A 4OZIA 1NFDB 3NZHH 1KCWA 3NK3A 1BAGA 3T3ME 5LJYH 1B90A 2D7NA 2KT6A 4YHNA 1GGYA 3WNKA 4Y9EA 4FJZA 3T4AB 1PSKH 4ERSL 1E28A 1FAIH 3ULVC 4LSPH 3EO9H 2DQEL 3T6VA 2YO3A 4CNIB 4DGYL 4GG8A 3ARGD 5EBMB 3ZHLA 1WH0A 2WZPD 2VO5A 2B1AH 2HG5A 1ZPUA 3QQ9D 3DTXA 5DMIH 4JE0A 4ERSH 5IP4A 2PCXA 1M7UA 3BKJL 4HV8A 1ZV9A 4F7EA 2DQEH 1JL8A 2WVTA 3X13A 5D72L 4OGAD 3QRLA 3ECBA 1OQOA 3OC5A 5H37G 4DGYH 3O4LA 1J5DA 1J8HB 1FRGL 3ZY7A 5I17B 2CBTA 4JRXE 2IPKA 2P8MA 4AVHA 3BKJH 1AHWA 4AC4A 5B38A 3STZA 3DRQA 4HPYL 3TU6A 3ULVE 5D72H 3AROA 1A5FL 4PJEF 1QMUA 1NCCL 4EIZC 1CDUA 3AC0A 4QRQB 3KYAA 5DUBB 1FRGH 3V9EA 4PRAB 3MRLB 4LMQE 1E50A 1YPZF 4ZSOA 5I26A 1P2CA 2BVQB 3JYCA 2R39A 1FG2B 2EDWA 1A5FH 2FIKA 3CTTA 4HUKB 2DTMH 1LO3L 4PJHB 5L9DL 4KK9D 3OBAA 3MJ7B 2NYYD 3T2QA 3HAEH 4KJQC 1X3DA 4NQTA 4GS7C 1FHNA 3UABA 4YSSA 2Y6SC 2WINA 4FXLA 1HN1A 1LO3H 1SMDA 4HCIA 5L9DH 1K72A 4JRXD 1J1XL 1BJ8A 3VGFA 4J8RA 4Y1SA 1VIWA 3ULVD 3FCBA 3FCTB 3QUXB 2E8ZA 4TULL 4BZ2L 5DEFA 3UX9B 5JQ6L 4HSQA 1DJSA 1ZVYA 2OZNA 5IF0B 3ZU8A 2F8OA 1J1XH 2CG9X 4NCC1 4NKMA 1A7NL 4KGLA 3MLXL 4NRXA 4XPTL 1S7XA 3V0VB 4L1DA 1S9WA 1YPZA 3MJ6A 4QLRA 3VFTA 1NBCA 3P4LA 2E9JA 4LLUA 1ODUA 4YGAB 5GRWA 4TULH 4FXGC 4BZ2H 5JQ6H 2CGRL 3T8XA 1KC5L 2NNFA 4LDLB 2FEJA 3VX1A 5C1MB 5PAZA 4LCIL 2WKGA 3OXRA 3MLXH 4XPTH 3D87B 5CP7A 1S7UA 3HTLX 1O6SB 3A6BL 1OB1B 4PRPA 1KC5H 3EBIA 5JHBA 4I48B 5D2LE 1HXYA 2ZX9A 4HKZB 1DBBL 3AW5A 4KTYA 4FABH 1WGOA 1PD6A 1NCAL 2DYSB 5GIRB 3LPOA 1JPEA 2WUCL 3A6BH 2V33A 2YD4A 1F6AB 5KS9E 4KI1A 2K7QA 3ZDZB 2FH6A 4HCRA 4PJEE 1JD9A 2E7DA 4L37A 3ULUC 3HPLA 3SJVB 1DBBH 4KJQD 4YSCA 3FRPA 1R3JB 4JREC 4Y2OB 5E4EC 1K5NB 5I30H 4QHUA 3T1FA 2KL6A 2LFEA 1NCAH 2D7TL 4LHJB 3ZHDA 1A3ZA 2WUCH 3TBBA 2Y6SD 1H19A 1T0NA 5E4OA 4LVOC 5CMAA 4DN3L 1BZDA 5JO5B 5IUSA 4QHNA 5FOJA 4FXKB 2CKBB 2NTFA 2WPGA 3BP6B 4EI5B 2D7TH 3L3KA 4JN2B 3BSZL 1T21A 4X4KA 4ZMZA 4FCAA 2ZKYA 3II1A 3CVDA 4DN3H 3DK0A 5I15H 1F11A 2JJVA 2VR9A 3MA7B 3S4SB 5I6OA 2R0WL 2QPDB 3HZMA 3PP3H 3QFJA 4Q89A 5ID0B 1D3CA 1XH0A 3ULUE 2YD3A 2Q2EB 3BSZH 4APXA 3LKSB 4K94C 1E42A 4ICXA 3KPMB 1SYVB 1DQJA 5DJDA 1EQWA 4MQXD 4PJIB 4DZ8B 5DGRA 4L1SA 1UA3A 5FYKE 2XWXA 3JUYA 4ZFOB 3AT9A 1JK8A 1NGZB 3GS4A 3CU7A 4JAMB 4QGYA 4PRHE 4ELDA 4ZW5A 1Q1JH 1L9SA 2F7QA 4R97C 1TVHA 4U49A 2R2EB 5JLZB 4X5WA 1WAAF 4I87A 3QNZA 3N55A 3HAEA 3RDTC 1L5GB 3SCMB 3ARPA 5F7EH 4BRJA 3BEWB 3LRHA 3IRZA