2GBWB

Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
b'QIPVTPDVHYDIEAHYRAEVRMFQTGQYREWLQGMVAEDIHYWMPIYEQRLTRDRRPDPTPDDAAIYNDDFGELKQRVERLYSGQVWMEDPPSKIRYFVSNVEAFEAGNGELDVLSNILVYRNRRQTEVTVHTLGREDKLRRDGNGFKVFRRKLILDARVTQDKNLYFFC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biphenyl 2,3-Dioxygenase Alpha Subunit
publication title Structural investigations of the ferredoxin and terminal oxygenase components of the biphenyl 2,3-dioxygenase from Sphingobium yanoikuyae B1.
pubmed doi rcsb
source organism Sphingobium yanoikuyae
molecule tags Oxidoreductase
total genus 48
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gbwB00
1OGZA 3OWUA 1WQLB 1S5AA 3MG2A 1GY5A 3EBTA 5D83A 1OH0A 1GY7A 3I0YA 5AEWB 1C7HA 3T8UA 3STDA 3HK4A 2F99A 1JKGB 3ROBA 3DUKA 3MG3A 4HM3B 1W02A 1OF5B 3EN8A 2STDA 2W2CA 1O7PB 3NM2A 3ER7A 1QJGA 3JUMA 5IERA 3UNLA 6STDA 1UUWB 4IIAA 1OUNA 1E3RA 1IDPA 4HJLB 4U13A 3OWSA 3GZRA 4OUQA 3KKGA 2HMLB 5CF1A 1O7NB 4X2OA 1W00A 1OHPA 3A76A 3RGAA 3GZBA 4HM8B 1K41A 2IMJA 3F8HA 1A2KA 5CLKA 5JPUA 3OXAA 4WP5A 5AIGA 8CHOA 1OCVA 5D82A 3UJMA 1EA2A 1Q40B 2BMRB 3NHXA 3JUNA 5STDA 3G16A 4XDWA 2F86B 2YFJB 2HMKB 5DRVA 5AIFA 5AEUB 2R4IA 1U5OA 3ECFA 3NBRA 1AR0A 5IG5A 5TGNA 4XDVA 1ISKA 1O7MB 2BMOB 3FGYA 4ORLA 3GWRA 3D9RA 2BNGA 5FW5A 2F98A 2HMNB 2B1XB 2OWPA 2HMMB 1BUQA 4WYKA 4HM5B 4XBYA 2XSOB 2GXFA 2XR8B 1SJWA 3NV0B 1ASKA 3EHCA 5G2GA 3Q90A 3DXOA 4PEJA 1VZZA 1O7WB 3MKIA 2BMQB 3HZPA 3FKAA 1Q42A 4K1VA 1NDOB 4LEHA 3EC9A 1HKXA 1ZX2A 3K7CA 3EJVA 1QMAA 1Z1SA 3SOAA 5AIIA 3F40A 3DM8A 2HMOB 3EX9A 1JN5B 2CKFB 1JKGA 4FCMA 4L8PA 1OPYA 2Z7AA 2Z76A 2PZVA 2JQ5A 1GY6A 4HM7B 5JPPA 2I9WA 4KVHA 5IG3A 2UX0A 3F14A 3FF0A 3M8CA 3BB9A 3H51A 3EN1B 2GEYA 4OVMA 1NWWA 3OV4A 3G0KA 4HVNA 3DMCA 1CQSA 3CNMA 3FH1A 3B4PA 3MYTA 4R1KA 5CF2A 1JB4A 2XSHB 3LYGA 4L8OA 2YFLB 1ULJB 2RFRA 3GZXB 2QGUA 4FCJA 3WMDA 4GB5A 1Q40A 3H3HA 4J9AA 3F8XA 5IENA 1E3VA 5BXQA 4WWUC 3VSYA 1E97A 2INXA 4R9KA 5KP4A 2K54A 3GRDA 4XB5A 3CPOA 5AI1A 1OHOA 4HM2B 2GBWB 3VGNA 4XBXA 3SEDA 3T8NA 3F7SA 4WYKB 1TP6A 2RCDA 3K0ZA 5KP1A 3E99A 4HM1B 5IF6A 2RGQA 4LMIA 1OGXA 5IG4A 4N3VA 7STDA 2HMJB 3MSOA 3NV0A 3F7XA 5D81A 1JB5A 4H3UA 3EQQB 1OHSA 4HM0B 3CU3A 2GEXA 1OF5A 3EBYA 1W01A 3GZYB 2GBXB 4L7KA 2B24B 5HGRA 1JN5A 4HM4B 3B4OA 2YFIB 5KP3A 3KSPA 5BVBA 3FZWA 4Q53A 3FF2A 3NUVA 3JUPA 3JUOA 4HZBB 2CHCA 3LZAA 3NXJA 4XBTA 3KZTA 2QIYA 4RZMA 1STDA 3KE7A 4K1UA 3MG1A 1JB2A 4HKVB 3JUQA 4MJDA 4X2HA 5CK6A 3RGRA 1ZO2A 4R9LA 5CXOA 3FSDA 1W6YA 1NU3A 1GYBA 3HX8A 3S5CA 3MHEA 3FLJA 1UUVB 1DMMA 4HZ9B 4J8TA 3B8LA 3CNXA 3B7CA 3F9SA 3OX9A 5IG0A 5EVHA 5DREA 3SOYA 5IEPA 4HM6B 1TUHA 4CDLA 3BLZA 4XM4A 1DMNA 2Z77A 3G8ZA 4STDA 1EG9B 3OWYA 4I4KA 1O7GB 1DMQA 1ULIB 5IEOA 4LGQA 1GS3A 3EF8A 1O7HB 3IPTA 2A15A 3DZLA 5AIHA 2XRXB
chains in the Genus database with same CATH superfamily
1OGZA 3OWUA 1G96A 5A0OB 3CCE3 1DE3A 1WQLB 1YVSA 4FR9A 2XH9A 1BSEA 3FG1A 1S5AA 3MG2A 4DKIA 1GY5A 3EBTA 4KFEA 2IUJA 1KD14 1UI8A 5D83A 3ALAA 4KFDA 1OH0A 1BRKA 1AVKA 3Q2PA 1GY7A 2GSPA 2OQEA 3I0YA 3T0UA 5AEWB 1RRLA 1C7HA 3GAXA 2E2UA 1BNRA 4IPBA 3T8UA 4AEQA 1MWSA 4FMAA 3STDA 4BL2A 3HK4A 2F99A 2CWVA 1JKGB 3ROBA 3DUKA 3MG3A 1RCLA 3X3ZA 3N8BA 4HM3B 1W02A 1OF5B 1BAOA 1ROAA 3AMOA 3SLUA 3X42A 2OOVC 2CIUA 3EN8A 2STDA 2W2CA 2P38A 1O7PB 1WNHA 3NM2A 3BNBA 4NPBA 1IQ8A 1UI7A 3ER7A 1QJGA 3Q1CA 4LSOA 3J7Yd 3JUMA 1TFOA 1A90A 1EKMA 5IERA 1TJDA 5G1KA 1S723 4R80A 3UNLA 1K734 2WO0A 3DY5A 5BU4A 1RGKA 4EW5A 1BNJA 2K3DA 1YGEA 3I563 1TTOA 3CCM3 2XF3A 3CC43 6STDA 1UUWB 2Y74A 4IIAA 1N8QA 1A2VA 1OUNA 4RNYA 1E3RA 3WA2X 1RTUA 1IDPA 2BU4A 2CFLA 3AGNA 2H0GA 3LH4A 3L0RA 1RKYA 3WA3A 1TRPA 4HJLB 4U13A 3OWSA 3GZRA 2WGQA 3S28A 4OUQA 3LTDA 3V99A 3KKGA 2HMLB 5CF1A 3PYJA 1O7NB 4X2OA 1YVBI 1RGGA 2IA7A 2Y73A 5GSPA 1B20A 1UCKA 1FGOA 1BNSA 1W00A 4O3VA 1FGRA 1OHPA 1VQN3 3ZFZA 3N54B 1Q864 1K8A4 1IVVA 1LOYA 1MNLA 1RGAA 2UGIA 3A76A 3K63A 3RGAA 2FNQA 3RDEA 2W0QA 3CME3 3GZBA 2OTJ3 4HM8B 3KN4A 1FUWA 1K41A 1W6CA 3IMAB 1ZGXA 4GHOA 1T2HA 1MWRA 3CCQ3 1VQ83 2IMJA 1WTHA 2SBLA 3F8HA 1A2KA 1BNEA 5CLKA 5JPUA 1UUGB 3OXAA 3NBBA 4WP5A 1Q814 5AIGA 2W9QA 8CHOA 1OCVA 5D82A 1UCIA 3HIIA 2Q07A 1DVCA 2CX0A 1AV4A 1BSCA 4BU4A 3UJMA 2RSXA 1EA2A 1F8NA 2P0MA 1LQMB 3WODG 1Q40B 3CXC2 1I8VA 1FYSA 2BMRB 4MMXB 2ZHXB 3NBJA 3NHXA 1US1A 3JUNA 5STDA 1MOLA 3WOFB 2XFSA 3G16A 1B2UA 3CD63 1I2FA 4XDWA 2V1LA 2F86B 2YFJB 4J5KA 3SYUA 2WGOA 1FZUA 2HMKB 5AIFA 5DRVA 3UL6A 5AEUB 1LXEA 3I553 2R4IA 4NHFA 4O8SA 1LNIA 1PYLA 1RLSA 1U5OA 2W03A 3EE1A 3JVCA 3ECFA 3NBRA 4GL6A 1W6GA 1AR0A 1IYYA 1AQZA 4MMYB 1FA3A 1Q7Y4 5IG5A 1I0XA 1LRAA 4EV5A 5TGNA 4NREA 1U8CB 5ELUA 2QEX3 4XDVA 4BTYA 1GOYA 2R41A 1SPUA 2ZA4A 3U1WA 1ISKA 1GD4A 1GMQA 1O7MB 1QAKA 2BMOB 3MWZA 1RGCA 3FGYA 5M1AA 1BRSA 1T5YA 2CC3A 1MWTA 5M18A 4ORLA 3GWRA 3D9RA 2BNGA 5FW5A 1SIIA 1VQK3 1N8R4 2F98A 2HMNB 4HOHA 1VQ93 2B1XB 1BNIA 2OWPA 1W2ZA 2HMMB 4EC6A 1BUQA 4WYKA 1CYVA 4HM5B 4XBYA 1PFPA 2PNCA 7GSPA 2XSOB 5AYRB 2GXFA 4H61A 4ILFA 1G0TA 3CCR3 1D6UA 2P0XA 2XR8B 1SJWA 3CMA3 1QVF2 3NV0B 1ASKA 3A5EA 3D3LA 2L4VA 3EHCA 4FCZA 3Q90A 2CH9A 3DXOA 4PEJA 5G2GA 1VZZA 3G713 1RCKA 4EYCA 4I5QA 2HOHA 5RNTA 1O7WB 4N6OB 3SX1A 1CYUA 3MKIA 3X41A 1JBRA 2OQEC 1BNFA 3EB8A 1D6ZA 2CFWA 1SARA 2BMQB 2KF6A 3HZPA 3LTBA 3FKAA 1Q42A 1RN7A 1I3FA 3FCSB 4K1VA 2CG1A 5G1LA 1NDOB 4LEHA 3QK9A 5EQLA 1L5GB 6GSPA 3V92A 3CCU3 2ZDJA 3EC9A 1HKXA 1CH0A 1PU4A 2M7OA 1Q9EA 1JRQA 1RGFA 1W5ZA 1ZX2A 3K7CA 5LC6A 3RNTA 3PS8A 1B2SA 3EJVA 1IV9A 1QMAA 4HBRA 3WDGB 3AHSA 1JBTA 1Z1SA 3WOEB 1QALA 3SOAA 5AIIA 3F40A 1BVIA 3DM8A 3QRDA 1RJOA 2O9UX 2F4YA 2O3OA 4CJNA 2HMOB 3EX9A 1I70A 1RNBA 1JN5B 1YIJ3 3ZG5A 2CKFB 1BU4A 1Y4KA 1JKGA 4N6NB 4FCMA 1BRNL 4L8PA 3CCJ3 4RBNA 5ELJA 1OPYA 1IVXA 2Z7AA 1VQM3 1YJ93 2ZL8A 2C11A 1WMOA 3NQYA 2Z76A 4LZIA 1QVG2 2PZVA 2JQ5A 4MEIA 4BTWA 1NB5I 1Q7HA 1GY6A 1LOXA 2CFKA 3IJEB 1KSIA 4HM7B 3D79A 3KSED 1DETA 1A2PA 4AKZA 5JPPA 4RNTA 2I9WA 4KVHA 3KCHA 5IG3A 2UX0A 3D5IA 3F14A 3HOHA 3FF0A 1UW1A 3BB9A 3M8CA 2D1WA 3H51A 4RNZA 3EN1B 4JF8A 2GEYA 4OVMA 2CFGA 1M1XB 2C10A 1NNVA 1NWWA 2ML5A 3OV4A 3SVAA 3G0KA 4HVNA 1TIJA 3DMCA 2KCDA 3AGOA 2JDIH 1CQSA 3CNMA 3FH1A 3B4PA 3MYTA 5FGOA 4R1KA 1BSBA 1RDSA 4IT7A 5CF2A 2YX9A 1JB4A 4K61A 4EV2A 2XSHB 3CCV3 5BIRA 4N6TA 2C4BA 2LQVA 3LYGA 4L8OA 5I97A 3X3YA 2YFLB 1RGLA 1ULJB 2RFRA 2CW9A 3DGOA 1BSAA 3NM7A 1PY3A 1IVWA 2F5MA 1FW7A 3G4S3 2KF5A 2K0MA 1LOWA 3BIRA 4GSPA 3GZXB 1W2B2 1RGEA 1GOVA 2QGUA 4FCJA 3KIIA 1N9EA 3WMDA 4KFFA 4GB5A 3LOYA 2ML6A 1Q40A 3CC23 1YJN3 2AAEA 2IYJA 3H3HA 1BUJA 2CFDA 1VQ43 4K90B 1UCLA 4J9AA 4CCVA 3F8XA 1MGRA 6RNTA 5IENA 1WMNA 4LYLB 3PXMA 2W56B 3BNCA 1FGTA 1D6YA 1FUTA 1DVDA 1E3VA 5BXQA 4R4KA 1YNVX 4N6MA 1NB3I 3BU4A 1RGHA 1IQYA 4WWUC 3V98A 3NX0A 3DGYA 4MMZB 1E97A 4OK0A 4FMDA 3O8YA 3VSYA 1B2XA 2INXA 3G6E3 4FMBA 4R9KA 5KP4A 1BNGA 2K54A 1B2MA 3GRDA 1RN4A 1V74A 3LT8A 2RNTA 4XB5A 1JJ22 3CPOA 1SQWA 1BIRA 1C54A 1I2EA 5AI1A 2BIRA 1N9JA 4N6UA 1OHOA 1JZDA 4HM2B 1NO3A 2GBWB 4JRFA 2F5WA 3VGNA 2J8XB 2RBIA 1B3SA 4XBXA 1WMPA 3SEDA 1VQP3 1M904 1W7CA 4J5GA 3T8NA 1UGHI 1VQO3 3TDGA 1RN1A 3F7SA 4TX4A 1LVNA 1TP6A 2RCDA 4WYKB 1BRGA 3K0ZA 1YI23 5KP1A 3E99A 4BL3A 2CWTA 4HM1B 2CWUA 9RNTA 1YGWA 1RMSA 3KFQC 3S29A 1MWUA 3CC73 1N5PA 3OW22 5IF6A 3Q3FA 1VQ53 2D42A 2E2TA 2RGQA 3GSPA 4LMIA 1A67A 4WHAA 1JNQA 1OGXA 3AHWA 3ZG0A 3U97A 3WHOA 5IG4A 4N3VA 7STDA 2HMJB 1EUIC 1HZ1A 3MSOA 3NV0A 1J2BA 2CG0A 3F7XA 1IU7A 4ZM8A 5D81A 1JB5A 2E2VA 1CEWI 3MPHA 4H3UA 3EQQB 1BRHA 2KRTA 3LTCA 1M9GA 1R4CA 3K9MC 1OHSA 2L1SA 3AMOB 4HM0B 1IQXA 1TFKA 4KZ1A 2AADA 2FXTA 3CU3A 3D5GA 1ZS7A 3FG4A 5M19A 2GEXA 1T3BA 1X1UA 3UB1A 1OF5A 3D4AA 3EBYA 3LTAA 2P05A 1W01A 2KAAA 3GZYB 2GBXB 7RNTA 1BRJA 1VQQA 2OOVA 1JZOA 4L7KA 1MGWA 3S27A 1RRHA 3UL5A 1W4NA 4QWTA 2B24B 3DGLA 4FMCA 5IW9A 3CCS3 5HGRA 1B21A 1JN5A 4HM4B 1BRIA 1K28A 3URPA 2IY2A 1YJW3 1RSNA 1IT7A 1QAFA 3B4OA 2W9PA 4N6LA 2KXGA 2YFIB 5KP3A 1YHQ3 3KSPA 2W04A 5BVBA 2CX1A 3FZWA 3K5TA 4Q53A 4O02B 1B27A 2GU1A 3LT9A 1ROVA 3SXXA 1KC84 3FF2A 3NUVA 4BIRA 1LQGC 2Z6BA 1K9M4 3JUPA 3JUOA 4HZBB 2CHCA 4O2HA 3LZAA 3NXJA 2F56A 1T2IA 4XBTA 1Q824 3KZTA 1RHLA 1BSDA 1STFI 2QIYA 4RZMA 4WFOA 1STDA 3KE7A 1IVUA 3BNDA 4K1UA 1G02A 1IT8A 2W6JH 8RNTA 2XFTA 3MG1A 1JB2A 3DGNA 4CPKA 1IV7A 4HKVB 3JUQA 4MJDA 1EEJA 4X2HA 1KWIA 5CK6A 1GOUA 3RGRA 3CCL3 2H0HA 1ZO2A 4R9LA 5CXOA 1I0VA 3FSDA 2XGNA 2WOFA 3PCRA 3S67A 3PCSA 1X1YA 3DH2A 3N9HA 4G1MB 1UCJA 1GMPA 1W6YA 2QA43 1JBSA 1NU3A 1B2ZA 1GYBA 1X1WA 3HX8A 1OACA 5AYSC 3S5CA 1KQS2 1FGQA 1UDII 3BNEA 3VF1A 3MHEA 1R4YA 3FLJA 1UUVB 1V58A 3CPW2 1NJI4 2OCTA 5HOHA 1DMMA 3LXUX 1M1K4 5EEOA 3HIGA 4HAAA 2XEPA 3PZWA 4HZ9B 2BT3A 1HU9A 1LNHA 4J8TA 2IUKA 1JV2B 3B8LA 1BOXA 1VQ63 3DGMA 2P09A 3CNXA 1I3IA 1I2GA 3B7CA 3F9SA 3OX9A 4AKYA 2KF3A 5LC7A 5IG0A 2FGTA 4HYZA 5EVHA 2BO9B 1SIHA 1DYUA 4N6V0 4EXRA 5DREA 1GSPA 3SOYA 2W56A 3NQZA 3WR2A 5IEPA 1V57A 2BHMA 1BGSA 1FGMA 1N5HA 1TUHA 4HM6B 1BANA 4CDLA 3BLZA 4XM4A 1DMNA 1AY7A 2Z77A 3G8ZA 1TRQA 4STDA 1EG9B 2H0IA 3OWYA 3FG3A 4KT3B 1GMRA 1VQ73 2SARA 2KF4A 2WOHA 4I4KA 1LOVA 2MF7A 3X40A 1O7GB 1DMQA 1ULIB 3HI7A 2LYXA 1EQKA 5IEOA 1HYFA 5JBSA 3PGBA 1GD3A 4LGQA 1GS3A 1UGIA 2CK3H 2GU3A 3LMLA 1IK3A 3EF8A 1O7HB 1FUSA 3IPTA 1VQL3 2XGLA 3X3XA 4EBGA 1RNTA 2A15A 1YIT3 2MC8A 2UUGC 1X1XA 1TU5A 2OTL3 3DZLA 4BTXA 1AVLA 5AIHA 2XRXB
chains in the Genus database with same CATH topology
1OGZA 3OWUA 1G96A 5A0OB 3CCE3 1WQLB 4FR9A 2XH9A 3FG1A 1S5AA 3MG2A 1KD14 1GY5A 3EBTA 4KFEA 2IUJA 1UI8A 5D83A 3ALAA 4KFDA 1OH0A 1AVKA 3Q2PA 1GY7A 2OQEA 3I0YA 3T0UA 5AEWB 1RRLA 1C7HA 3GAXA 2E2UA 4IPBA 3T8UA 4AEQA 4FMAA 3STDA 3HK4A 2F99A 2CWVA 1JKGB 3ROBA 3DUKA 3MG3A 3X3ZA 3N8BA 4HM3B 1W02A 1OF5B 3SLUA 1ROAA 3AMOA 3X42A 2OOVC 2CIUA 3EN8A 2STDA 2W2CA 2P38A 1O7PB 1WNHA 3NM2A 3BNBA 1IQ8A 1UI7A 3ER7A 1QJGA 3Q1CA 4LSOA 3J7Yd 3JUMA 1TFOA 1A90A 1EKMA 5IERA 1S723 4R80A 3UNLA 1K734 2WO0A 3DY5A 1YGEA 3I563 3CCM3 2XF3A 3CC43 6STDA 1UUWB 2Y74A 4IIAA 1N8QA 1A2VA 1OUNA 4RNYA 1E3RA 3WA2X 1IDPA 2CFLA 3LH4A 3L0RA 3WA3A 4HJLB 4U13A 3OWSA 3GZRA 2WGQA 3S28A 4OUQA 3LTDA 3V99A 3KKGA 2HMLB 5CF1A 3PYJA 1O7NB 4X2OA 1YVBI 2Y73A 2IA7A 1W00A 1FGOA 4O3VA 1VQN3 1FGRA 1OHPA 3N54B 1Q864 1K8A4 1IVVA 1MNLA 3K63A 3A76A 3RGAA 3RDEA 2FNQA 2OTJ3 2W0QA 3CME3 3GZBA 4HM8B 3KN4A 1FUWA 1K41A 1W6CA 3IMAB 3CCQ3 1VQ83 2IMJA 1WTHA 2SBLA 3F8HA 1A2KA 5CLKA 5JPUA 3OXAA 3NBBA 4WP5A 1Q814 5AIGA 2W9QA 8CHOA 1OCVA 5D82A 3HIIA 2Q07A 1DVCA 1AV4A 3UJMA 2RSXA 1EA2A 1F8NA 2P0MA 3WODG 1Q40B 3CXC2 2BMRB 4MMXB 3NBJA 3NHXA 1US1A 3JUNA 5STDA 1MOLA 3WOFB 2XFSA 3G16A 3CD63 4XDWA 2V1LA 2F86B 2YFJB 2WGOA 2HMKB 5DRVA 5AIFA 3UL6A 5AEUB 3I553 1LXEA 2R4IA 4NHFA 4O8SA 1U5OA 2W03A 3EE1A 3JVCA 3ECFA 3NBRA 4GL6A 1W6GA 1AR0A 4MMYB 1FA3A 1Q7Y4 5IG5A 4EV5A 5TGNA 4NREA 1U8CB 5ELUA 2QEX3 4XDVA 4BTYA 1SPUA 3U1WA 1ISKA 1GD4A 1O7MB 1QAKA 2BMOB 3MWZA 3FGYA 1T5YA 2CC3A 4ORLA 3GWRA 3D9RA 2BNGA 5FW5A 1SIIA 1VQK3 1N8R4 2F98A 2HMNB 1VQ93 2B1XB 2OWPA 1W2ZA 2HMMB 4EC6A 1BUQA 4WYKA 1CYVA 4HM5B 4XBYA 1PFPA 2PNCA 2XSOB 5AYRB 2GXFA 4H61A 3CCR3 1D6UA 2P0XA 2XR8B 1SJWA 3CMA3 1QVF2 3NV0B 1ASKA 4FCZA 3D3LA 2L4VA 3EHCA 5G2GA 3Q90A 2CH9A 3DXOA 4PEJA 1VZZA 3G713 4EYCA 1O7WB 4N6OB 3SX1A 1CYUA 3MKIA 3X41A 2OQEC 3EB8A 1D6ZA 2CFWA 2BMQB 3HZPA 3LTBA 3FKAA 1Q42A 1RN7A 4K1VA 3FCSB 2CG1A 1NDOB 4LEHA 3QK9A 5EQLA 1L5GB 3V92A 3CCU3 2ZDJA 3EC9A 1HKXA 1PU4A 1RKYA 2M7OA 5LC6A 1JRQA 1W5ZA 1ZX2A 3K7CA 3PS8A 3EJVA 1IV9A 1QMAA 4HBRA 3WDGB 1Z1SA 3WOEB 1QALA 3SOAA 5AIIA 3F40A 3DM8A 3QRDA 1RJOA 2O9UX 2O3OA 2HMOB 3EX9A 1JN5B 1YIJ3 2CKFB 1Y4KA 1JKGA 4N6NB 4FCMA 4L8PA 3CCJ3 4RBNA 5ELJA 1OPYA 1IVXA 2Z7AA 1VQM3 1YJ93 2ZL8A 2C11A 1WMOA 3NQYA 2Z76A 4LZIA 1QVG2 2PZVA 2JQ5A 4MEIA 4BTWA 1NB5I 1GY6A 1LOXA 2CFKA 3IJEB 1KSIA 4HM7B 3KSED 4AKZA 5JPPA 2I9WA 4KVHA 5IG3A 2UX0A 3F14A 3FF0A 1UW1A 3BB9A 3M8CA 2D1WA 3H51A 4RNZA 3EN1B 4JF8A 2GEYA 4OVMA 2CFGA 1M1XB 2C10A 2ML5A 1NWWA 3OV4A 3SVAA 3G0KA 4HVNA 1TIJA 3DMCA 2KCDA 2JDIH 1CQSA 3CNMA 3FH1A 3B4PA 3MYTA 5FGOA 4R1KA 4IT7A 5CF2A 2YX9A 1JB4A 4K61A 4EV2A 2XSHB 3CCV3 4N6TA 2LQVA 5I97A 3LYGA 4L8OA 3X3YA 2YFLB 1ULJB 2RFRA 2CW9A 3DGOA 3NM7A 1IVWA 3G4S3 2K0MA 3GZXB 1W2B2 2QGUA 4FCJA 3KIIA 1N9EA 3WMDA 4KFFA 4GB5A 3LOYA 2ML6A 1Q40A 3CC23 1YJN3 3H3HA 2CFDA 1VQ43 4K90B 4CCVA 4J9AA 3F8XA 5IENA 1WMNA 3PXMA 2W56B 3BNCA 1FGTA 1D6YA 1DVDA 1E3VA 5BXQA 4R4KA 4N6MA 1NB3I 4WWUC 3V98A 1IQYA 3VSYA 3NX0A 4MMZB 4OK0A 1E97A 4FMDA 3O8YA 2INXA 3G6E3 4FMBA 4R9KA 5KP4A 2K54A 3GRDA 1V74A 3LT8A 4XB5A 1JJ22 3CPOA 1SQWA 5AI1A 1N9JA 4N6UA 1OHOA 4HM2B 1NO3A 2GBWB 4JRFA 3VGNA 4XBXA 1WMPA 3SEDA 1VQP3 1M904 1W7CA 3T8NA 1VQO3 3TDGA 3F7SA 4TX4A 1LVNA 1TP6A 2RCDA 4WYKB 3K0ZA 1YI23 5KP1A 3E99A 2CWTA 4HM1B 2CWUA 3KFQC 3S29A 3CC73 1N5PA 3OW22 5IF6A 1VQ53 2D42A 2E2TA 2RGQA 4LMIA 1A67A 4WHAA 1JNQA 1OGXA 3U97A 5IG4A 4N3VA 7STDA 2HMJB 3MSOA 3NV0A 1J2BA 2CG0A 3F7XA 1IU7A 4ZM8A 5D81A 1JB5A 2E2VA 1CEWI 3MPHA 4H3UA 3EQQB 2KRTA 3LTCA 1M9GA 1R4CA 3K9MC 1OHSA 3AMOB 4HM0B 1IQXA 1TFKA 4KZ1A 2FXTA 3CU3A 3FG4A 2GEXA 3UB1A 1OF5A 3EBYA 3LTAA 2P05A 1W01A 3GZYB 2GBXB 2OOVA 4L7KA 3S27A 1RRHA 3UL5A 1W4NA 4QWTA 2B24B 3DGLA 4FMCA 5IW9A 3CCS3 5HGRA 1JN5A 4HM4B 1K28A 1YJW3 1IT7A 1QAFA 3B4OA 2W9PA 4N6LA 2KXGA 2YFIB 5KP3A 1YHQ3 3KSPA 2W04A 5BVBA 3FZWA 3K5TA 4Q53A 4O02B 2GU1A 3LT9A 1ROVA 3SXXA 1KC84 3FF2A 3NUVA 2Z6BA 1K9M4 3JUPA 3JUOA 4HZBB 2CHCA 4O2HA 3LZAA 3NXJA 4XBTA 1Q824 3KZTA 2QIYA 1STFI 4RZMA 4WFOA 1STDA 3KE7A 1IVUA 3BNDA 4K1UA 1IT8A 2W6JH 2XFTA 3MG1A 1JB2A 3DGNA 1IV7A 4HKVB 3JUQA 4MJDA 4X2HA 1KWIA 5CK6A 3RGRA 3CCL3 1ZO2A 4R9LA 5CXOA 3FSDA 3PCRA 2XGNA 2WOFA 3S67A 3PCSA 3N9HA 4G1MB 2QA43 1W6YA 1NU3A 1GYBA 3HX8A 5AYSC 1OACA 3S5CA 1KQS2 1FGQA 3BNEA 3VF1A 3MHEA 3FLJA 1UUVB 3CPW2 1NJI4 2OCTA 1DMMA 3LXUX 1M1K4 5EEOA 3HIGA 2XEPA 3PZWA 4HZ9B 2BT3A 1HU9A 1LNHA 4J8TA 2IUKA 1JV2B 3B8LA 1VQ63 3DGMA 2P09A 3CNXA 3B7CA 3F9SA 3OX9A 4AKYA 5LC7A 5IG0A 2FGTA 4HYZA 5EVHA 2BO9B 1SIHA 1DYUA 4N6V0 4EXRA 5DREA 3SOYA 2W56A 3NQZA 5IEPA 2BHMA 4HM6B 1FGMA 1TUHA 1N5HA 4CDLA 3BLZA 4XM4A 1DMNA 2Z77A 3G8ZA 4STDA 1EG9B 3OWYA 3FG3A 1VQ73 2WOHA 4I4KA 2MF7A 3X40A 1O7GB 1DMQA 1ULIB 3HI7A 2LYXA 1EQKA 5IEOA 5JBSA 3PGBA 1GD3A 4LGQA 1GS3A 2CK3H 2GU3A 3LMLA 1IK3A 3EF8A 1O7HB 1VQL3 3IPTA 2XGLA 3X3XA 4EBGA 2A15A 1YIT3 2MC8A 1TU5A 2OTL3 3DZLA 4BTXA 1AVLA 5AIHA 2XRXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGZ A;  3OWU A;  1WQL B;  1S5A A;  3MG2 A;  1GY5 A;  3EBT A;  5D83 A;  1OH0 A;  1GY7 A;  3I0Y A;  5AEW B;  1C7H A;  3T8U A;  3STD A;  3HK4 A;  2F99 A;  1JKG B;  3ROB A;  3DUK A;  3MG3 A;  4HM3 B;  1W02 A;  1OF5 B;  3EN8 A;  2STD A;  2W2C A;  1O7P B;  3NM2 A;  3ER7 A;  1QJG A;  3JUM A;  5IER A;  3UNL A;  6STD A;  1UUW B;  4IIA A;  1OUN A;  1E3R A;  1IDP A;  4HJL B;  4U13 A;  3OWS A;  3GZR A;  4OUQ A;  3KKG A;  2HML B;  5CF1 A;  1O7N B;  4X2O A;  1W00 A;  1OHP A;  3A76 A;  3RGA A;  3GZB A;  4HM8 B;  1K41 A;  2IMJ A;  3F8H A;  1A2K A;  5CLK A;  5JPU A;  3OXA A;  4WP5 A;  5AIG A;  8CHO A;  1OCV A;  5D82 A;  3UJM A;  1EA2 A;  1Q40 B;  2BMR B;  3NHX A;  3JUN A;  5STD A;  3G16 A;  4XDW A;  2F86 B;  2YFJ B;  2HMK B;  5DRV A;  5AIF A;  5AEU B;  2R4I A;  1U5O A;  3ECF A;  3NBR A;  1AR0 A;  5IG5 A;  5TGN A;  4XDV A;  1ISK A;  1O7M B;  2BMO B;  3FGY A;  4ORL A;  3GWR A;  3D9R A;  2BNG A;  5FW5 A;  2F98 A;  2HMN B;  2B1X B;  2OWP A;  2HMM B;  1BUQ A;  4WYK A;  4HM5 B;  4XBY A;  2XSO B;  2GXF A;  2XR8 B;  1SJW A;  3NV0 B;  1ASK A;  3EHC A;  5G2G A;  3Q90 A;  3DXO A;  4PEJ A;  1VZZ A;  1O7W B;  3MKI A;  2BMQ B;  3HZP A;  3FKA A;  1Q42 A;  4K1V A;  1NDO B;  4LEH A;  3EC9 A;  1HKX A;  1ZX2 A;  3K7C A;  3EJV A;  1QMA A;  1Z1S A;  3SOA A;  5AII A;  3F40 A;  3DM8 A;  2HMO B;  3EX9 A;  1JN5 B;  2CKF B;  1JKG A;  4FCM A;  4L8P A;  1OPY A;  2Z7A A;  2Z76 A;  2PZV A;  2JQ5 A;  1GY6 A;  4HM7 B;  5JPP A;  2I9W A;  4KVH A;  5IG3 A;  2UX0 A;  3F14 A;  3FF0 A;  3M8C A;  3BB9 A;  3H51 A;  3EN1 B;  2GEY A;  4OVM A;  1NWW A;  3OV4 A;  3G0K A;  4HVN A;  3DMC A;  1CQS A;  3CNM A;  3FH1 A;  3B4P A;  3MYT A;  4R1K A;  5CF2 A;  1JB4 A;  2XSH B;  3LYG A;  4L8O A;  2YFL B;  1ULJ B;  2RFR A;  3GZX B;  2QGU A;  4FCJ A;  3WMD A;  4GB5 A;  1Q40 A;  3H3H A;  4J9A A;  3F8X A;  5IEN A;  1E3V A;  5BXQ A;  4WWU C;  3VSY A;  1E97 A;  2INX A;  4R9K A;  5KP4 A;  2K54 A;  3GRD A;  4XB5 A;  3CPO A;  5AI1 A;  1OHO A;  4HM2 B;  2GBW B;  3VGN A;  4XBX A;  3SED A;  3T8N A;  3F7S A;  4WYK B;  1TP6 A;  2RCD A;  3K0Z A;  5KP1 A;  3E99 A;  4HM1 B;  5IF6 A;  2RGQ A;  4LMI A;  1OGX A;  5IG4 A;  4N3V A;  7STD A;  2HMJ B;  3MSO A;  3NV0 A;  3F7X A;  5D81 A;  1JB5 A;  4H3U A;  3EQQ B;  1OHS A;  4HM0 B;  3CU3 A;  2GEX A;  1OF5 A;  3EBY A;  1W01 A;  3GZY B;  2GBX B;  4L7K A;  2B24 B;  5HGR A;  1JN5 A;  4HM4 B;  3B4O A;  2YFI B;  5KP3 A;  3KSP A;  5BVB A;  3FZW A;  4Q53 A;  3FF2 A;  3NUV A;  3JUP A;  3JUO A;  4HZB B;  2CHC A;  3LZA A;  3NXJ A;  4XBT A;  3KZT A;  2QIY A;  4RZM A;  1STD A;  3KE7 A;  4K1U A;  3MG1 A;  1JB2 A;  4HKV B;  3JUQ A;  4MJD A;  4X2H A;  5CK6 A;  3RGR A;  1ZO2 A;  4R9L A;  5CXO A;  3FSD A;  1W6Y A;  1NU3 A;  1GYB A;  3HX8 A;  3S5C A;  3MHE A;  3FLJ A;  1UUV B;  1DMM A;  4HZ9 B;  4J8T A;  3B8L A;  3CNX A;  3B7C A;  3F9S A;  3OX9 A;  5IG0 A;  5EVH A;  5DRE A;  3SOY A;  5IEP A;  4HM6 B;  1TUH A;  4CDL A;  3BLZ A;  4XM4 A;  1DMN A;  2Z77 A;  3G8Z A;  4STD A;  1EG9 B;  3OWY A;  4I4K A;  1O7G B;  1DMQ A;  1ULI B;  5IEO A;  4LGQ A;  1GS3 A;  3EF8 A;  1O7H B;  3IPT A;  2A15 A;  3DZL A;  5AIH A;  2XRX B; 
#chains in the Genus database with same CATH topology
 1OGZ A;  3OWU A;  1G96 A;  5A0O B;  3CCE 3;  1DE3 A;  1WQL B;  1YVS A;  4FR9 A;  2XH9 A;  1BSE A;  3FG1 A;  1S5A A;  3MG2 A;  4DKI A;  1GY5 A;  3EBT A;  4KFE A;  2IUJ A;  1KD1 4;  1UI8 A;  5D83 A;  3ALA A;  4KFD A;  1OH0 A;  1BRK A;  1AVK A;  3Q2P A;  1GY7 A;  2GSP A;  2OQE A;  3I0Y A;  3T0U A;  5AEW B;  1RRL A;  1C7H A;  3GAX A;  2E2U A;  1BNR A;  4IPB A;  3T8U A;  4AEQ A;  1MWS A;  4FMA A;  3STD A;  4BL2 A;  3HK4 A;  2F99 A;  2CWV A;  1JKG B;  3ROB A;  3DUK A;  3MG3 A;  1RCL A;  3X3Z A;  3N8B A;  4HM3 B;  1W02 A;  1OF5 B;  1BAO A;  1ROA A;  3AMO A;  3SLU A;  3X42 A;  2OOV C;  2CIU A;  3EN8 A;  2STD A;  2W2C A;  2P38 A;  1O7P B;  1WNH A;  3NM2 A;  3BNB A;  4NPB A;  1IQ8 A;  1UI7 A;  3ER7 A;  1QJG A;  3Q1C A;  4LSO A;  3J7Y d;  3JUM A;  1TFO A;  1A90 A;  1EKM A;  5IER A;  1TJD A;  5G1K A;  1S72 3;  4R80 A;  3UNL A;  1K73 4;  2WO0 A;  3DY5 A;  5BU4 A;  1RGK A;  4EW5 A;  1BNJ A;  2K3D A;  1YGE A;  3I56 3;  1TTO A;  3CCM 3;  2XF3 A;  3CC4 3;  6STD A;  1UUW B;  2Y74 A;  4IIA A;  1N8Q A;  1A2V A;  1OUN A;  4RNY A;  1E3R A;  3WA2 X;  1RTU A;  1IDP A;  2BU4 A;  2CFL A;  3AGN A;  2H0G A;  3LH4 A;  3L0R A;  1RKY A;  3WA3 A;  1TRP A;  4HJL B;  4U13 A;  3OWS A;  3GZR A;  2WGQ A;  3S28 A;  4OUQ A;  3LTD A;  3V99 A;  3KKG A;  2HML B;  5CF1 A;  3PYJ A;  1O7N B;  4X2O A;  1YVB I;  1RGG A;  2IA7 A;  2Y73 A;  5GSP A;  1B20 A;  1UCK A;  1FGO A;  1BNS A;  1W00 A;  4O3V A;  1FGR A;  1OHP A;  1VQN 3;  3ZFZ A;  3N54 B;  1Q86 4;  1K8A 4;  1IVV A;  1LOY A;  1MNL A;  1RGA A;  2UGI A;  3A76 A;  3K63 A;  3RGA A;  2FNQ A;  3RDE A;  2W0Q A;  3CME 3;  3GZB A;  2OTJ 3;  4HM8 B;  3KN4 A;  1FUW A;  1K41 A;  1W6C A;  3IMA B;  1ZGX A;  4GHO A;  1T2H A;  1MWR A;  3CCQ 3;  1VQ8 3;  2IMJ A;  1WTH A;  2SBL A;  3F8H A;  1A2K A;  1BNE A;  5CLK A;  5JPU A;  1UUG B;  3OXA A;  3NBB A;  4WP5 A;  1Q81 4;  5AIG A;  2W9Q A;  8CHO A;  1OCV A;  5D82 A;  1UCI A;  3HII A;  2Q07 A;  1DVC A;  2CX0 A;  1AV4 A;  1BSC A;  4BU4 A;  3UJM A;  2RSX A;  1EA2 A;  1F8N A;  2P0M A;  1LQM B;  3WOD G;  1Q40 B;  3CXC 2;  1I8V A;  1FYS A;  2BMR B;  4MMX B;  2ZHX B;  3NBJ A;  3NHX A;  1US1 A;  3JUN A;  5STD A;  1MOL A;  3WOF B;  2XFS A;  3G16 A;  1B2U A;  3CD6 3;  1I2F A;  4XDW A;  2V1L A;  2F86 B;  2YFJ B;  4J5K A;  3SYU A;  2WGO A;  1FZU A;  2HMK B;  5AIF A;  5DRV A;  3UL6 A;  5AEU B;  1LXE A;  3I55 3;  2R4I A;  4NHF A;  4O8S A;  1LNI A;  1PYL A;  1RLS A;  1U5O A;  2W03 A;  3EE1 A;  3JVC A;  3ECF A;  3NBR A;  4GL6 A;  1W6G A;  1AR0 A;  1IYY A;  1AQZ A;  4MMY B;  1FA3 A;  1Q7Y 4;  5IG5 A;  1I0X A;  1LRA A;  4EV5 A;  5TGN A;  4NRE A;  1U8C B;  5ELU A;  2QEX 3;  4XDV A;  4BTY A;  1GOY A;  2R41 A;  1SPU A;  2ZA4 A;  3U1W A;  1ISK A;  1GD4 A;  1GMQ A;  1O7M B;  1QAK A;  2BMO B;  3MWZ A;  1RGC A;  3FGY A;  5M1A A;  1BRS A;  1T5Y A;  2CC3 A;  1MWT A;  5M18 A;  4ORL A;  3GWR A;  3D9R A;  2BNG A;  5FW5 A;  1SII A;  1VQK 3;  1N8R 4;  2F98 A;  2HMN B;  4HOH A;  1VQ9 3;  2B1X B;  1BNI A;  2OWP A;  1W2Z A;  2HMM B;  4EC6 A;  1BUQ A;  4WYK A;  1CYV A;  4HM5 B;  4XBY A;  1PFP A;  2PNC A;  7GSP A;  2XSO B;  5AYR B;  2GXF A;  4H61 A;  4ILF A;  1G0T A;  3CCR 3;  1D6U A;  2P0X A;  2XR8 B;  1SJW A;  3CMA 3;  1QVF 2;  3NV0 B;  1ASK A;  3A5E A;  3D3L A;  2L4V A;  3EHC A;  4FCZ A;  3Q90 A;  2CH9 A;  3DXO A;  4PEJ A;  5G2G A;  1VZZ A;  3G71 3;  1RCK A;  4EYC A;  4I5Q A;  2HOH A;  5RNT A;  1O7W B;  4N6O B;  3SX1 A;  1CYU A;  3MKI A;  3X41 A;  1JBR A;  2OQE C;  1BNF A;  3EB8 A;  1D6Z A;  2CFW A;  1SAR A;  2BMQ B;  2KF6 A;  3HZP A;  3LTB A;  3FKA A;  1Q42 A;  1RN7 A;  1I3F A;  3FCS B;  4K1V A;  2CG1 A;  5G1L A;  1NDO B;  4LEH A;  3QK9 A;  5EQL A;  1L5G B;  6GSP A;  3V92 A;  3CCU 3;  2ZDJ A;  3EC9 A;  1HKX A;  1CH0 A;  1PU4 A;  2M7O A;  1Q9E A;  1JRQ A;  1RGF A;  1W5Z A;  1ZX2 A;  3K7C A;  5LC6 A;  3RNT A;  3PS8 A;  1B2S A;  3EJV A;  1IV9 A;  1QMA A;  4HBR A;  3WDG B;  3AHS A;  1JBT A;  1Z1S A;  3WOE B;  1QAL A;  3SOA A;  5AII A;  3F40 A;  1BVI A;  3DM8 A;  3QRD A;  1RJO A;  2O9U X;  2F4Y A;  2O3O A;  4CJN A;  2HMO B;  3EX9 A;  1I70 A;  1RNB A;  1JN5 B;  1YIJ 3;  3ZG5 A;  2CKF B;  1BU4 A;  1Y4K A;  1JKG A;  4N6N B;  4FCM A;  1BRN L;  4L8P A;  3CCJ 3;  4RBN A;  5ELJ A;  1OPY A;  1IVX A;  2Z7A A;  1VQM 3;  1YJ9 3;  2ZL8 A;  2C11 A;  1WMO A;  3NQY A;  2Z76 A;  4LZI A;  1QVG 2;  2PZV A;  2JQ5 A;  4MEI A;  4BTW A;  1NB5 I;  1Q7H A;  1GY6 A;  1LOX A;  2CFK A;  3IJE B;  1KSI A;  4HM7 B;  3D79 A;  3KSE D;  1DET A;  1A2P A;  4AKZ A;  5JPP A;  4RNT A;  2I9W A;  4KVH A;  3KCH A;  5IG3 A;  2UX0 A;  3D5I A;  3F14 A;  3HOH A;  3FF0 A;  1UW1 A;  3BB9 A;  3M8C A;  2D1W A;  3H51 A;  4RNZ A;  3EN1 B;  4JF8 A;  2GEY A;  4OVM A;  2CFG A;  1M1X B;  2C10 A;  1NNV A;  1NWW A;  2ML5 A;  3OV4 A;  3SVA A;  3G0K A;  4HVN A;  1TIJ A;  3DMC A;  2KCD A;  3AGO A;  2JDI H;  1CQS A;  3CNM A;  3FH1 A;  3B4P A;  3MYT A;  5FGO A;  4R1K A;  1BSB A;  1RDS A;  4IT7 A;  5CF2 A;  2YX9 A;  1JB4 A;  4K61 A;  4EV2 A;  2XSH B;  3CCV 3;  5BIR A;  4N6T A;  2C4B A;  2LQV A;  3LYG A;  4L8O A;  5I97 A;  3X3Y A;  2YFL B;  1RGL A;  1ULJ B;  2RFR A;  2CW9 A;  3DGO A;  1BSA A;  3NM7 A;  1PY3 A;  1IVW A;  2F5M A;  1FW7 A;  3G4S 3;  2KF5 A;  2K0M A;  1LOW A;  3BIR A;  4GSP A;  3GZX B;  1W2B 2;  1RGE A;  1GOV A;  2QGU A;  4FCJ A;  3KII A;  1N9E A;  3WMD A;  4KFF A;  4GB5 A;  3LOY A;  2ML6 A;  1Q40 A;  3CC2 3;  1YJN 3;  2AAE A;  2IYJ A;  3H3H A;  1BUJ A;  2CFD A;  1VQ4 3;  4K90 B;  1UCL A;  4J9A A;  4CCV A;  3F8X A;  1MGR A;  6RNT A;  5IEN A;  1WMN A;  4LYL B;  3PXM A;  2W56 B;  3BNC A;  1FGT A;  1D6Y A;  1FUT A;  1DVD A;  1E3V A;  5BXQ A;  4R4K A;  1YNV X;  4N6M A;  1NB3 I;  3BU4 A;  1RGH A;  1IQY A;  4WWU C;  3V98 A;  3NX0 A;  3DGY A;  4MMZ B;  1E97 A;  4OK0 A;  4FMD A;  3O8Y A;  3VSY A;  1B2X A;  2INX A;  3G6E 3;  4FMB A;  4R9K A;  5KP4 A;  1BNG A;  2K54 A;  1B2M A;  3GRD A;  1RN4 A;  1V74 A;  3LT8 A;  2RNT A;  4XB5 A;  1JJ2 2;  3CPO A;  1SQW A;  1BIR A;  1C54 A;  1I2E A;  5AI1 A;  2BIR A;  1N9J A;  4N6U A;  1OHO A;  1JZD A;  4HM2 B;  1NO3 A;  2GBW B;  4JRF A;  2F5W A;  3VGN A;  2J8X B;  2RBI A;  1B3S A;  4XBX A;  1WMP A;  3SED A;  1VQP 3;  1M90 4;  1W7C A;  4J5G A;  3T8N A;  1UGH I;  1VQO 3;  3TDG A;  1RN1 A;  3F7S A;  4TX4 A;  1LVN A;  1TP6 A;  2RCD A;  4WYK B;  1BRG A;  3K0Z A;  1YI2 3;  5KP1 A;  3E99 A;  4BL3 A;  2CWT A;  4HM1 B;  2CWU A;  9RNT A;  1YGW A;  1RMS A;  3KFQ C;  3S29 A;  1MWU A;  3CC7 3;  1N5P A;  3OW2 2;  5IF6 A;  3Q3F A;  1VQ5 3;  2D42 A;  2E2T A;  2RGQ A;  3GSP A;  4LMI A;  1A67 A;  4WHA A;  1JNQ A;  1OGX A;  3AHW A;  3ZG0 A;  3U97 A;  3WHO A;  5IG4 A;  4N3V A;  7STD A;  2HMJ B;  1EUI C;  1HZ1 A;  3MSO A;  3NV0 A;  1J2B A;  2CG0 A;  3F7X A;  1IU7 A;  4ZM8 A;  5D81 A;  1JB5 A;  2E2V A;  1CEW I;  3MPH A;  4H3U A;  3EQQ B;  1BRH A;  2KRT A;  3LTC A;  1M9G A;  1R4C A;  3K9M C;  1OHS A;  2L1S A;  3AMO B;  4HM0 B;  1IQX A;  1TFK A;  4KZ1 A;  2AAD A;  2FXT A;  3CU3 A;  3D5G A;  1ZS7 A;  3FG4 A;  5M19 A;  2GEX A;  1T3B A;  1X1U A;  3UB1 A;  1OF5 A;  3D4A A;  3EBY A;  3LTA A;  2P05 A;  1W01 A;  2KAA A;  3GZY B;  2GBX B;  7RNT A;  1BRJ A;  1VQQ A;  2OOV A;  1JZO A;  4L7K A;  1MGW A;  3S27 A;  1RRH A;  3UL5 A;  1W4N A;  4QWT A;  2B24 B;  3DGL A;  4FMC A;  5IW9 A;  3CCS 3;  5HGR A;  1B21 A;  1JN5 A;  4HM4 B;  1BRI A;  1K28 A;  3URP A;  2IY2 A;  1YJW 3;  1RSN A;  1IT7 A;  1QAF A;  3B4O A;  2W9P A;  4N6L A;  2KXG A;  2YFI B;  5KP3 A;  1YHQ 3;  3KSP A;  2W04 A;  5BVB A;  2CX1 A;  3FZW A;  3K5T A;  4Q53 A;  4O02 B;  1B27 A;  2GU1 A;  3LT9 A;  1ROV A;  3SXX A;  1KC8 4;  3FF2 A;  3NUV A;  4BIR A;  1LQG C;  2Z6B A;  1K9M 4;  3JUP A;  3JUO A;  4HZB B;  2CHC A;  4O2H A;  3LZA A;  3NXJ A;  2F56 A;  1T2I A;  4XBT A;  1Q82 4;  3KZT A;  1RHL A;  1BSD A;  1STF I;  2QIY A;  4RZM A;  4WFO A;  1STD A;  3KE7 A;  1IVU A;  3BND A;  4K1U A;  1G02 A;  1IT8 A;  2W6J H;  8RNT A;  2XFT A;  3MG1 A;  1JB2 A;  3DGN A;  4CPK A;  1IV7 A;  4HKV B;  3JUQ A;  4MJD A;  1EEJ A;  4X2H A;  1KWI A;  5CK6 A;  1GOU A;  3RGR A;  3CCL 3;  2H0H A;  1ZO2 A;  4R9L A;  5CXO A;  1I0V A;  3FSD A;  2XGN A;  2WOF A;  3PCR A;  3S67 A;  3PCS A;  1X1Y A;  3DH2 A;  3N9H A;  4G1M B;  1UCJ A;  1GMP A;  1W6Y A;  2QA4 3;  1JBS A;  1NU3 A;  1B2Z A;  1GYB A;  1X1W A;  3HX8 A;  1OAC A;  5AYS C;  3S5C A;  1KQS 2;  1FGQ A;  1UDI I;  3BNE A;  3VF1 A;  3MHE A;  1R4Y A;  3FLJ A;  1UUV B;  1V58 A;  3CPW 2;  1NJI 4;  2OCT A;  5HOH A;  1DMM A;  3LXU X;  1M1K 4;  5EEO A;  3HIG A;  4HAA A;  2XEP A;  3PZW A;  4HZ9 B;  2BT3 A;  1HU9 A;  1LNH A;  4J8T A;  2IUK A;  1JV2 B;  3B8L A;  1BOX A;  1VQ6 3;  3DGM A;  2P09 A;  3CNX A;  1I3I A;  1I2G A;  3B7C A;  3F9S A;  3OX9 A;  4AKY A;  2KF3 A;  5LC7 A;  5IG0 A;  2FGT A;  4HYZ A;  5EVH A;  2BO9 B;  1SIH A;  1DYU A;  4N6V 0;  4EXR A;  5DRE A;  1GSP A;  3SOY A;  2W56 A;  3NQZ A;  3WR2 A;  5IEP A;  1V57 A;  2BHM A;  1BGS A;  1FGM A;  1N5H A;  1TUH A;  4HM6 B;  1BAN A;  4CDL A;  3BLZ A;  4XM4 A;  1DMN A;  1AY7 A;  2Z77 A;  3G8Z A;  1TRQ A;  4STD A;  1EG9 B;  2H0I A;  3OWY A;  3FG3 A;  4KT3 B;  1GMR A;  1VQ7 3;  2SAR A;  2KF4 A;  2WOH A;  4I4K A;  1LOV A;  2MF7 A;  3X40 A;  1O7G B;  1DMQ A;  1ULI B;  3HI7 A;  2LYX A;  1EQK A;  5IEO A;  1HYF A;  5JBS A;  3PGB A;  1GD3 A;  4LGQ A;  1GS3 A;  1UGI A;  2CK3 H;  2GU3 A;  3LML A;  1IK3 A;  3EF8 A;  1O7H B;  1FUS A;  3IPT A;  1VQL 3;  2XGL A;  3X3X A;  4EBG A;  1RNT A;  2A15 A;  1YIT 3;  2MC8 A;  2UUG C;  1X1X A;  1TU5 A;  2OTL 3;  3DZL A;  4BTX A;  1AVL A;  5AIH A;  2XRX B; 
#chains in the Genus database with same CATH homology
 1OGZ A;  3OWU A;  1G96 A;  5A0O B;  3CCE 3;  1WQL B;  4FR9 A;  2XH9 A;  3FG1 A;  1S5A A;  3MG2 A;  1KD1 4;  1GY5 A;  3EBT A;  4KFE A;  2IUJ A;  1UI8 A;  5D83 A;  3ALA A;  4KFD A;  1OH0 A;  1AVK A;  3Q2P A;  1GY7 A;  2OQE A;  3I0Y A;  3T0U A;  5AEW B;  1RRL A;  1C7H A;  3GAX A;  2E2U A;  4IPB A;  3T8U A;  4AEQ A;  4FMA A;  3STD A;  3HK4 A;  2F99 A;  2CWV A;  1JKG B;  3ROB A;  3DUK A;  3MG3 A;  3X3Z A;  3N8B A;  4HM3 B;  1W02 A;  1OF5 B;  3SLU A;  1ROA A;  3AMO A;  3X42 A;  2OOV C;  2CIU A;  3EN8 A;  2STD A;  2W2C A;  2P38 A;  1O7P B;  1WNH A;  3NM2 A;  3BNB A;  1IQ8 A;  1UI7 A;  3ER7 A;  1QJG A;  3Q1C A;  4LSO A;  3J7Y d;  3JUM A;  1TFO A;  1A90 A;  1EKM A;  5IER A;  1S72 3;  4R80 A;  3UNL A;  1K73 4;  2WO0 A;  3DY5 A;  1YGE A;  3I56 3;  3CCM 3;  2XF3 A;  3CC4 3;  6STD A;  1UUW B;  2Y74 A;  4IIA A;  1N8Q A;  1A2V A;  1OUN A;  4RNY A;  1E3R A;  3WA2 X;  1IDP A;  2CFL A;  3LH4 A;  3L0R A;  3WA3 A;  4HJL B;  4U13 A;  3OWS A;  3GZR A;  2WGQ A;  3S28 A;  4OUQ A;  3LTD A;  3V99 A;  3KKG A;  2HML B;  5CF1 A;  3PYJ A;  1O7N B;  4X2O A;  1YVB I;  2Y73 A;  2IA7 A;  1W00 A;  1FGO A;  4O3V A;  1VQN 3;  1FGR A;  1OHP A;  3N54 B;  1Q86 4;  1K8A 4;  1IVV A;  1MNL A;  3K63 A;  3A76 A;  3RGA A;  3RDE A;  2FNQ A;  2OTJ 3;  2W0Q A;  3CME 3;  3GZB A;  4HM8 B;  3KN4 A;  1FUW A;  1K41 A;  1W6C A;  3IMA B;  3CCQ 3;  1VQ8 3;  2IMJ A;  1WTH A;  2SBL A;  3F8H A;  1A2K A;  5CLK A;  5JPU A;  3OXA A;  3NBB A;  4WP5 A;  1Q81 4;  5AIG A;  2W9Q A;  8CHO A;  1OCV A;  5D82 A;  3HII A;  2Q07 A;  1DVC A;  1AV4 A;  3UJM A;  2RSX A;  1EA2 A;  1F8N A;  2P0M A;  3WOD G;  1Q40 B;  3CXC 2;  2BMR B;  4MMX B;  3NBJ A;  3NHX A;  1US1 A;  3JUN A;  5STD A;  1MOL A;  3WOF B;  2XFS A;  3G16 A;  3CD6 3;  4XDW A;  2V1L A;  2F86 B;  2YFJ B;  2WGO A;  2HMK B;  5DRV A;  5AIF A;  3UL6 A;  5AEU B;  3I55 3;  1LXE A;  2R4I A;  4NHF A;  4O8S A;  1U5O A;  2W03 A;  3EE1 A;  3JVC A;  3ECF A;  3NBR A;  4GL6 A;  1W6G A;  1AR0 A;  4MMY B;  1FA3 A;  1Q7Y 4;  5IG5 A;  4EV5 A;  5TGN A;  4NRE A;  1U8C B;  5ELU A;  2QEX 3;  4XDV A;  4BTY A;  1SPU A;  3U1W A;  1ISK A;  1GD4 A;  1O7M B;  1QAK A;  2BMO B;  3MWZ A;  3FGY A;  1T5Y A;  2CC3 A;  4ORL A;  3GWR A;  3D9R A;  2BNG A;  5FW5 A;  1SII A;  1VQK 3;  1N8R 4;  2F98 A;  2HMN B;  1VQ9 3;  2B1X B;  2OWP A;  1W2Z A;  2HMM B;  4EC6 A;  1BUQ A;  4WYK A;  1CYV A;  4HM5 B;  4XBY A;  1PFP A;  2PNC A;  2XSO B;  5AYR B;  2GXF A;  4H61 A;  3CCR 3;  1D6U A;  2P0X A;  2XR8 B;  1SJW A;  3CMA 3;  1QVF 2;  3NV0 B;  1ASK A;  4FCZ A;  3D3L A;  2L4V A;  3EHC A;  5G2G A;  3Q90 A;  2CH9 A;  3DXO A;  4PEJ A;  1VZZ A;  3G71 3;  4EYC A;  1O7W B;  4N6O B;  3SX1 A;  1CYU A;  3MKI A;  3X41 A;  2OQE C;  3EB8 A;  1D6Z A;  2CFW A;  2BMQ B;  3HZP A;  3LTB A;  3FKA A;  1Q42 A;  1RN7 A;  4K1V A;  3FCS B;  2CG1 A;  1NDO B;  4LEH A;  3QK9 A;  5EQL A;  1L5G B;  3V92 A;  3CCU 3;  2ZDJ A;  3EC9 A;  1HKX A;  1PU4 A;  1RKY A;  2M7O A;  5LC6 A;  1JRQ A;  1W5Z A;  1ZX2 A;  3K7C A;  3PS8 A;  3EJV A;  1IV9 A;  1QMA A;  4HBR A;  3WDG B;  1Z1S A;  3WOE B;  1QAL A;  3SOA A;  5AII A;  3F40 A;  3DM8 A;  3QRD A;  1RJO A;  2O9U X;  2O3O A;  2HMO B;  3EX9 A;  1JN5 B;  1YIJ 3;  2CKF B;  1Y4K A;  1JKG A;  4N6N B;  4FCM A;  4L8P A;  3CCJ 3;  4RBN A;  5ELJ A;  1OPY A;  1IVX A;  2Z7A A;  1VQM 3;  1YJ9 3;  2ZL8 A;  2C11 A;  1WMO A;  3NQY A;  2Z76 A;  4LZI A;  1QVG 2;  2PZV A;  2JQ5 A;  4MEI A;  4BTW A;  1NB5 I;  1GY6 A;  1LOX A;  2CFK A;  3IJE B;  1KSI A;  4HM7 B;  3KSE D;  4AKZ A;  5JPP A;  2I9W A;  4KVH A;  5IG3 A;  2UX0 A;  3F14 A;  3FF0 A;  1UW1 A;  3BB9 A;  3M8C A;  2D1W A;  3H51 A;  4RNZ A;  3EN1 B;  4JF8 A;  2GEY A;  4OVM A;  2CFG A;  1M1X B;  2C10 A;  2ML5 A;  1NWW A;  3OV4 A;  3SVA A;  3G0K A;  4HVN A;  1TIJ A;  3DMC A;  2KCD A;  2JDI H;  1CQS A;  3CNM A;  3FH1 A;  3B4P A;  3MYT A;  5FGO A;  4R1K A;  4IT7 A;  5CF2 A;  2YX9 A;  1JB4 A;  4K61 A;  4EV2 A;  2XSH B;  3CCV 3;  4N6T A;  2LQV A;  5I97 A;  3LYG A;  4L8O A;  3X3Y A;  2YFL B;  1ULJ B;  2RFR A;  2CW9 A;  3DGO A;  3NM7 A;  1IVW A;  3G4S 3;  2K0M A;  3GZX B;  1W2B 2;  2QGU A;  4FCJ A;  3KII A;  1N9E A;  3WMD A;  4KFF A;  4GB5 A;  3LOY A;  2ML6 A;  1Q40 A;  3CC2 3;  1YJN 3;  3H3H A;  2CFD A;  1VQ4 3;  4K90 B;  4CCV A;  4J9A A;  3F8X A;  5IEN A;  1WMN A;  3PXM A;  2W56 B;  3BNC A;  1FGT A;  1D6Y A;  1DVD A;  1E3V A;  5BXQ A;  4R4K A;  4N6M A;  1NB3 I;  4WWU C;  3V98 A;  1IQY A;  3VSY A;  3NX0 A;  4MMZ B;  4OK0 A;  1E97 A;  4FMD A;  3O8Y A;  2INX A;  3G6E 3;  4FMB A;  4R9K A;  5KP4 A;  2K54 A;  3GRD A;  1V74 A;  3LT8 A;  4XB5 A;  1JJ2 2;  3CPO A;  1SQW A;  5AI1 A;  1N9J A;  4N6U A;  1OHO A;  4HM2 B;  1NO3 A;  2GBW B;  4JRF A;  3VGN A;  4XBX A;  1WMP A;  3SED A;  1VQP 3;  1M90 4;  1W7C A;  3T8N A;  1VQO 3;  3TDG A;  3F7S A;  4TX4 A;  1LVN A;  1TP6 A;  2RCD A;  4WYK B;  3K0Z A;  1YI2 3;  5KP1 A;  3E99 A;  2CWT A;  4HM1 B;  2CWU A;  3KFQ C;  3S29 A;  3CC7 3;  1N5P A;  3OW2 2;  5IF6 A;  1VQ5 3;  2D42 A;  2E2T A;  2RGQ A;  4LMI A;  1A67 A;  4WHA A;  1JNQ A;  1OGX A;  3U97 A;  5IG4 A;  4N3V A;  7STD A;  2HMJ B;  3MSO A;  3NV0 A;  1J2B A;  2CG0 A;  3F7X A;  1IU7 A;  4ZM8 A;  5D81 A;  1JB5 A;  2E2V A;  1CEW I;  3MPH A;  4H3U A;  3EQQ B;  2KRT A;  3LTC A;  1M9G A;  1R4C A;  3K9M C;  1OHS A;  3AMO B;  4HM0 B;  1IQX A;  1TFK A;  4KZ1 A;  2FXT A;  3CU3 A;  3FG4 A;  2GEX A;  3UB1 A;  1OF5 A;  3EBY A;  3LTA A;  2P05 A;  1W01 A;  3GZY B;  2GBX B;  2OOV A;  4L7K A;  3S27 A;  1RRH A;  3UL5 A;  1W4N A;  4QWT A;  2B24 B;  3DGL A;  4FMC A;  5IW9 A;  3CCS 3;  5HGR A;  1JN5 A;  4HM4 B;  1K28 A;  1YJW 3;  1IT7 A;  1QAF A;  3B4O A;  2W9P A;  4N6L A;  2KXG A;  2YFI B;  5KP3 A;  1YHQ 3;  3KSP A;  2W04 A;  5BVB A;  3FZW A;  3K5T A;  4Q53 A;  4O02 B;  2GU1 A;  3LT9 A;  1ROV A;  3SXX A;  1KC8 4;  3FF2 A;  3NUV A;  2Z6B A;  1K9M 4;  3JUP A;  3JUO A;  4HZB B;  2CHC A;  4O2H A;  3LZA A;  3NXJ A;  4XBT A;  1Q82 4;  3KZT A;  2QIY A;  1STF I;  4RZM A;  4WFO A;  1STD A;  3KE7 A;  1IVU A;  3BND A;  4K1U A;  1IT8 A;  2W6J H;  2XFT A;  3MG1 A;  1JB2 A;  3DGN A;  1IV7 A;  4HKV B;  3JUQ A;  4MJD A;  4X2H A;  1KWI A;  5CK6 A;  3RGR A;  3CCL 3;  1ZO2 A;  4R9L A;  5CXO A;  3FSD A;  3PCR A;  2XGN A;  2WOF A;  3S67 A;  3PCS A;  3N9H A;  4G1M B;  2QA4 3;  1W6Y A;  1NU3 A;  1GYB A;  3HX8 A;  5AYS C;  1OAC A;  3S5C A;  1KQS 2;  1FGQ A;  3BNE A;  3VF1 A;  3MHE A;  3FLJ A;  1UUV B;  3CPW 2;  1NJI 4;  2OCT A;  1DMM A;  3LXU X;  1M1K 4;  5EEO A;  3HIG A;  2XEP A;  3PZW A;  4HZ9 B;  2BT3 A;  1HU9 A;  1LNH A;  4J8T A;  2IUK A;  1JV2 B;  3B8L A;  1VQ6 3;  3DGM A;  2P09 A;  3CNX A;  3B7C A;  3F9S A;  3OX9 A;  4AKY A;  5LC7 A;  5IG0 A;  2FGT A;  4HYZ A;  5EVH A;  2BO9 B;  1SIH A;  1DYU A;  4N6V 0;  4EXR A;  5DRE A;  3SOY A;  2W56 A;  3NQZ A;  5IEP A;  2BHM A;  4HM6 B;  1FGM A;  1TUH A;  1N5H A;  4CDL A;  3BLZ A;  4XM4 A;  1DMN A;  2Z77 A;  3G8Z A;  4STD A;  1EG9 B;  3OWY A;  3FG3 A;  1VQ7 3;  2WOH A;  4I4K A;  2MF7 A;  3X40 A;  1O7G B;  1DMQ A;  1ULI B;  3HI7 A;  2LYX A;  1EQK A;  5IEO A;  5JBS A;  3PGB A;  1GD3 A;  4LGQ A;  1GS3 A;  2CK3 H;  2GU3 A;  3LML A;  1IK3 A;  3EF8 A;  1O7H B;  1VQL 3;  3IPT A;  2XGL A;  3X3X A;  4EBG A;  2A15 A;  1YIT 3;  2MC8 A;  1TU5 A;  2OTL 3;  3DZL A;  4BTX A;  1AVL A;  5AIH A;  2XRX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...