2GBWB

Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
QIPVTPDVHYDIEAHYRAEVRMFQTGQYREWLQGMVAEDIHYWMPIYEQRLTRDRRPDPTPDDAAIYNDDFGELKQRVERLYSGQVWMEDPPSKIRYFVSNVEAFEAGNGELDVLSNILVYRNRRQTEVTVHTLGREDKLRRDGNGFKVFRRKLILDARVTQDKNLYFFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biphenyl 2,3-Dioxygenase Alpha Subunit
publication title Structural investigations of the ferredoxin and terminal oxygenase components of the biphenyl 2,3-dioxygenase from Sphingobium yanoikuyae B1.
pubmed doi rcsb
source organism Sphingobium yanoikuyae
molecule tags Oxidoreductase
total genus 48
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gbwB00
5CF2A 3LZAA 3CPOA 3OWYA 3T8NA 3ECFA 3B7CA 4HJLB 3EF8A 2BMOB 5IG4A 3DM8A 3GRDA 4K1VA 3JUPA 4HM3B 3OV4A 3STDA 5KP4A 4HM4B 1Q42A 6STDA 3HK4A 3NM2A 3MYTA 3RGAA 4K1UA 2F86B 3M8CA 3F7XA 1TUHA 5FW5A 5G2GA 1TP6A 1OPYA 2BNGA 2HMMB 2F99A 1NWWA 5D81A 2BMQB 2XRXB 5AIFA 3OWSA 4R1KA 1JKGB 4Q53A 1OCVA 1O7PB 2R4IA 5IG0A 3MG2A 3EBTA 4WP5A 1WQLB 1EG9B 5KP1A 4LMIA 3MKIA 3K0ZA 4OVMA 1DMQA 2GXFA 3NUVA 3NXJA 1O7HB 5AI1A 1QJGA 2CHCA 3T8UA 3ER7A 2OWPA 4RZMA 3H3HA 3KSPA 4LEHA 1OGZA 2HMJB 1ULIB 1GYBA 1OUNA 3KZTA 5AIIA 3JUNA 4L8OA 1O7MB 3B4PA 3DUKA 5AEWB 1IDPA 3SOYA 4FCJA 1K41A 4J8TA 4I4KA 5IERA 5CF1A 1GY6A 2INXA 1OF5B 4R9KA 5KP3A 3JUMA 8CHOA 2IMJA 1GY5A 4ORLA 4L7KA 1C7HA 2BMRB 4HM2B 4GB5A 3MSOA 3B4OA 4HM1B 2XR8B 2RCDA 2CKFB 2Z76A 4FCMA 3D9RA 2I9WA 1S5AA 3SOAA 2HMKB 1JKGA 2Z77A 1GY7A 5D83A 1STDA 3JUOA 4HM6B 1OGXA 2XSHB 3NV0A 2Z7AA 2STDA 3F7SA 3BB9A 2RFRA 4L8PA 4XDVA 3UNLA 3EJVA 1NU3A 5BXQA 3G0KA 4OUQA 3K7CA 4HZ9B 3F40A 2GBWB 1O7GB 5STDA 2HMLB 3F14A 3GZRA 5JPUA 1JB5A 1UUWB 4HM7B 3NHXA 1ZX2A 4N3VA 3NV0B 4MJDA 5EVHA 3DZLA 5IEPA 2GEXA 1OHOA 3HZPA 1JB2A 4HZBB 5IF6A 2W2CA 3CNMA 1OH0A 1ZO2A 1OF5A 1A2KA 1HKXA 5AIHA 5IEOA 1JN5A 3WMDA 4XBXA 3VSYA 3FF2A 1DMMA 3GZYB 1AR0A 4IIAA 4X2OA 2PZVA 4XB5A 3IPTA 2QGUA 3GWRA 5TGNA 5DRVA 3DMCA 3FLJA 1W02A 5IG5A 1ASKA 4H3UA 5CK6A 3MG3A 1EA2A 1JN5B 1DMNA 5AIGA 4R9LA 2XSOB 4CDLA 5IG3A 3I0YA 5CXOA 3G8ZA 3JUQA 3CNXA 2YFIB 4XBYA 3FH1A 3BLZA 1W01A 4WWUC 3FZWA 1QMAA 1ULJB 4HKVB 1Q40B 4LGQA 1O7NB 2YFJB 4X2HA 5AEUB 4XM4A 2B1XB 3MG1A 2YFLB 2HMOB 4WYKB 3VGNA 2UX0A 2RGQA 3HX8A 5IENA 5CLKA 2A15A 2F98A 3OX9A 1UUVB 1BUQA 1W00A 1E3VA 3MHEA 5DREA 3CU3A 3FF0A 3S5CA 1ISKA 3G16A 3B8LA 4J9AA 2JQ5A 3EQQB 1U5OA 2QIYA 3ROBA 3F8HA 3E99A 5HGRA 2GEYA 3DXOA 3FGYA 1E3RA 3NBRA 1CQSA 1E97A 3SEDA 4KVHA 3FKAA 1Z1SA 4XBTA 1GS3A 4HM5B 3EX9A 3GZBA 3KE7A 1W6YA 1VZZA 3FSDA 3EBYA 4XDWA 3OWUA 4HVNA 1OHPA 3OXAA 4HM0B 3A76A 3EN8A 2HMNB 3LYGA 1O7WB 5JPPA 1SJWA 3EN1B 3H51A 2B24B 1Q40A 3EC9A 5BVBA 1NDOB 1OHSA 3GZXB 4U13A 2K54A 3F8XA 3EHCA 1JB4A 2GBXB 4WYKA 3F9SA 7STDA 3RGRA 4STDA 4PEJA 4HM8B 5D82A 3KKGA 3Q90A 3UJMA
chains in the Genus database with same CATH superfamily
3NQZA 5CF2A 1STFI 3LZAA 3N54B 3WR2A 3CPOA 3OWYA 3T8NA 1AV4A 3ECFA 1IVXA 4GL6A 1B2MA 1ROAA 5EEOA 3B7CA 4HJLB 3EF8A 2BMOB 5IG4A 2QEX3 1VQ83 1JRQA 3DM8A 1J2BA 3GRDA 2W0QA 1N8QA 1RNTA 2KRTA 2R41A 3SVAA 1BSDA 1HYFA 2CWVA 1K9M4 1Q864 2H0GA 3JUPA 4HM3B 4K1VA 4BU4A 6RNTA 1VQ53 1UCLA 3OV4A 1LOVA 1M1K4 2P0MA 1QAFA 3STDA 5KP4A 4HM4B 1Q42A 1YJ93 1VQQA 3V92A 1RHLA 3CCE3 5FGOA 1X1XA 3WODG 6STDA 1VQ73 1A2PA 3HK4A 1RMSA 3PXMA 2Y73A 1K28A 2BU4A 3NM2A 4CPKA 3MYTA 3QK9A 4K90B 3RGAA 1I2EA 1L5GB 4K1UA 1BOXA 4N6LA 2F86B 3M8CA 4EC6A 1DVCA 3F7XA 3CCL3 1R4CA 2C10A 1TUHA 5FW5A 5G2GA 3AMOB 3I563 1TP6A 1OPYA 1G02A 2BNGA 2HMMB 1R4YA 2KF5A 3BNCA 4QWTA 5EQLA 2F99A 2F5MA 1K734 3NBJA 1WMNA 3Q3FA 3NM7A 1VQO3 1NWWA 1YGEA 1AVKA 2SARA 1MGRA 4RNZA 1FGQA 2BMQB 2XRXB 2KF6A 3LTAA 4HBRA 5AIFA 5D81A 1KQS2 2KXGA 2JDIH 1FA3A 3OWSA 4R1KA 2XGNA 1JKGB 4RNYA 2W56A 1D6UA 4Q53A 1WMPA 1OCVA 2ZL8A 1O7PB 2R4IA 3LT9A 1BSAA 5IG0A 1X1WA 1EEJA 2LYXA 3MG2A 1FZUA 1I2GA 3EBTA 2CK3H 1YI23 1BVIA 4WP5A 1WQLB 4JRFA 1EG9B 3X3XA 1FUTA 3CMA3 5KP1A 4LMIA 1MGWA 1FGOA 3MKIA 2XFSA 3K0ZA 4OVMA 3HOHA 2P38A 1DMQA 2GXFA 5AYRB 3S27A 4IT7A 3HIGA 2FGTA 2OQEA 1BRSA 3NUVA 1UGHI 1X1UA 1I2FA 1O7HB 3NXJA 4G1MB 5AI1A 3FG3A 2IY2A 4DKIA 1MWTA 1B20A 1QJGA 3HI7A 2CHCA 3URPA 3T8UA 3WOEB 5HOHA 3ER7A 3IMAB 2LQVA 2OWPA 4RZMA 3H3HA 3G713 3KSPA 1BSEA 1BRGA 2F5WA 1G0TA 1KWIA 2UUGC 3AHSA 4EXRA 1NB3I 1BRHA 1M9GA 1YVBI 4KZ1A 1ROVA 2W56B 3WA3A 1LQGC 2W04A 1OGZA 2CC3A 2HMJB 4LEHA 1ULIB 1GYBA 1TRQA 1OUNA 1V57A 3KZTA 4IPBA 5AIIA 1TFKA 1T5YA 2CFGA 2K0MA 3V99A 4EW5A 1RTUA 3JUNA 4N6V0 4WHAA 4L8OA 2L4VA 1O7MB 1I70A 2D42A 4N6NB 3CC43 2AAEA 1GOVA 2WGQA 1YJW3 2D1WA 3B4PA 3DUKA 2BIRA 4O02B 1EKMA 2CIUA 1I0VA 1IDPA 1US1A 3SOYA 4FCJA 2XEPA 5AEWB 1K41A 4J8TA 4I4KA 3J7Yd 3SLUA 4FCZA 3K9MC 2ML5A 4OK0A 5CF1A 5IERA 3RNTA 3FCSB 1GY6A 1GSPA 3D79A 1CH0A 1IQ8A 2INXA 1OF5B 5G1KA 3BIRA 4R9KA 3BU4A 5KP3A 5BIRA 1BGSA 1UGIA 4FMAA 3JUMA 4WFOA 1NB5I 2E2VA 4EYCA 1FUWA 4KFFA 4BL2A 5A0OB 8CHOA 2IMJA 1JV2B 1GY5A 1VQ93 1BRJA 1UCIA 1W7CA 4ORLA 4LSOA 3RDEA 4L7KA 1C7HA 2BMRB 4FR9A 5I97A 1AQZA 2H0IA 3PCRA 4HM2B 2QA43 4GB5A 1V58A 3MSOA 2XFTA 1BNEA 1MOLA 3B4OA 3DGMA 4HM1B 2XR8B 2RCDA 4NHFA 2CKFB 1RJOA 2Z76A 4FCMA 1BNIA 3D9RA 1I8VA 2CFLA 3UL5A 1A2VA 1I0XA 1SIHA 4O3VA 3DGOA 2I9WA 3CC73 1BNFA 1HU9A 1S5AA 3SOAA 1BNRA 2HMKB 1JKGA 2Y74A 2Z77A 1AY7A 5GSPA 5M19A 1GY7A 5D83A 1BRKA 1RRLA 3D4AA 1STDA 1YGWA 3JUOA 3V98A 2HOHA 2ZDJA 3QRDA 3LOYA 1FW7A 1GMRA 1TJDA 1UW1A 2CG0A 3NQYA 4HM6B 2BHMA 1OGXA 1LQMB 2XSHB 3NV0A 2XGLA 1TFOA 2Z7AA 2STDA 1DE3A 4N6TA 2OCTA 3X42A 3F7SA 1RGKA 1VQP3 3BB9A 2RFRA 3DGYA 2IUKA 1YHQ3 1NO3A 1X1YA 3DGNA 4BIRA 3IJEB 3LTCA 8RNTA 2CWTA 4H61A 3CME3 1A67A 3AHWA 4TX4A 1LVNA 3SYUA 3LMLA 4L8PA 4XDVA 3Q2PA 2CFDA 3UNLA 3SX1A 3EJVA 1FGTA 1NU3A 5BXQA 2ZHXB 3G0KA 1KSIA 3KFQC 4OUQA 1QVF2 2CX1A 3ALAA 3K7CA 3NX0A 1PFPA 4HZ9B 4BTXA 1VQ63 3F40A 1JZDA 2GBWB 1O7GB 2J8XB 3CCS3 5STDA 2C11A 1N5PA 2HMLB 2MF7A 3F14A 3GZRA 3KSED 1JB5A 4O8SA 5JPUA 3I553 1IVWA 3JVCA 1W6CA 1K8A4 1BRIA 1TU5A 2W9QA 1UUWB 4HM7B 4LZIA 1RDSA 3NHXA 1KD14 1ZX2A 3L0RA 4N3VA 1KC84 3NV0B 4MJDA 3LTBA 1Y4KA 5LC7A 4RBNA 1VQK3 5EVHA 1RGGA 3DZLA 4AEQA 4FMCA 5IEPA 2GEXA 1OHOA 1Q824 1UCKA 2AADA 7RNTA 3HZPA 1JB2A 6GSPA 4EV2A 1VQM3 3GAXA 4HZBB 1V74A 5IF6A 2W2CA 1IV9A 3KN4A 3WOFB 3LTDA 4CJNA 3G6E3 3CNMA 1OH0A 2XF3A 1BNSA 1BNJA 1JNQA 1ZO2A 3A5EA 3ZG5A 1OF5A 1BUJA 2V1LA 3PYJA 1A2KA 1SPUA 1BRNL 2YX9A 1Q7Y4 4BL3A 3CCQ3 1HKXA 5AIHA 5IEOA 1JN5A 2E2UA 3WMDA 1B2ZA 4XBXA 2CFKA 4HYZA 3ZG0A 5ELJA 1G96A 4HOHA 2OOVA 1CEWI 3U1WA 1LRAA 3U97A 3OW22 2KCDA 3DH2A 3VSYA 1GD3A 3FF2A 1DMMA 3BNBA 1UUGB 4J5GA 1JBRA 3GZYB 1AR0A 3Q1CA 4IIAA 1WNHA 4X2OA 1RCLA 2PZVA 3IPTA 2QGUA 4XB5A 4MMXB 3GWRA 1SQWA 5TGNA 5DRVA 4AKZA 4LYLB 1IT7A 1FGMA 3DMCA 5LC6A 4GSPA 3FLJA 2OQEC 1JBSA 3BNDA 1RGHA 2F56A 4MMZB 1GMQA 1W02A 3D5IA 1B2XA 1RCKA 1ASKA 5IG5A 3UL6A 4EBGA 1B2SA 4KT3B 1D6ZA 4H3UA 1RN7A 5CK6A 2IA7A 3MG3A 1EA2A 1JN5B 2CH9A 2CWUA 3KIIA 2GU1A 3CCJ3 1UI8A 1GMPA 2XH9A 4MEIA 4BTYA 1PU4A 1DMNA 1TRPA 5AIGA 2XSOB 4R9LA 1IQYA 3CCV3 3LXUX 1YIT3 3G4S3 1B3SA 1MWSA 2OOVC 1Q814 1LOXA 1BAOA 4CDLA 4BTWA 3CPW2 2ML6A 5IG3A 3T0UA 1N8R4 3I0YA 2UGIA 5CXOA 3G8ZA 3JUQA 1ZS7A 1M904 4N6OB 3CNXA 3EB8A 2YFIB 1BSBA 4XBYA 5AYSC 3FH1A 3BLZA 1W01A 1D6YA 1N9JA 3GSPA 4WWUC 3LH4A 3CC23 4FMDA 2GU3A 1LOYA 1N9EA 2KF3A 4R4KA 1SARA 1M1XB 1QMAA 3FZWA 3WDGB 5M1AA 1LOWA 3FG4A 1MWUA 3MWZA 1GOYA 1IV7A 1T3BA 1ULJB 1YNVX 2W6JH 2BO9B 4HKVB 4AKYA 4RNTA 2IYJA 1Q40B 1EUIC 4LGQA 1O7NB 2YFJB 3N9HA 4K61A 4X2HA 5AEUB 5G1LA 1B21A 1LNIA 1WMOA 2BT3A 3O8YA 1YVSA 4XM4A 1A90A 2B1XB 4ZM8A 2CW9A 2YFLB 3MG1A 1JBTA 2HMOB 7GSPA 2FXTA 4WYKB 1W2B2 2L1SA 2P09A 1UCJA 5BU4A 3CCU3 3VGNA 2O3OA 2CFWA 3KCHA 1B2UA 2UX0A 1T2IA 1MNLA 2RBIA 2RGQA 3DY5A 1BU4A 1SIIA 1BSCA 1RN4A 2WO0A 3K63A 3DGLA 1C54A 2RSXA 2SBLA 3HX8A 1AVLA 3BNEA 3MPHA 1OACA 2CG1A 1QALA 5IENA 1Q7HA 1CYVA 3SXXA 4GHOA 2KAAA 1YJN3 5CLKA 1RLSA 2A15A 2F98A 2O9UX 1FYSA 3OX9A 1UUVB 3NBBA 1PY3A 1BUQA 1W00A 4N6MA 1E3VA 2F4YA 1IVVA 3MHEA 1RGEA 5DREA 3CU3A 2WOHA 3X3ZA 3FF0A 2CX0A 3S5CA 1JJ22 3S29A 1ISKA 1IT8A 3G16A 1N5HA 1NJI4 2OTJ3 2PNCA 3B8LA 2JQ5A 4J9AA 4J5KA 1JZOA 3EQQB 3CXC2 1U5OA 3AGOA 2QIYA 2P05A 3ROBA 2OTL3 3S28A 1I3FA 3F8HA 1FGRA 3E99A 5HGRA 2GEYA 3DXOA 1WTHA 1UDII 9RNTA 1RGCA 1YIJ3 3FGYA 3WA2X 3PGBA 1IVUA 1E3RA 2FNQA 3NBRA 3N8BA 1CQSA 1VQ43 1RNBA 1W2ZA 1CYUA 1B27A 3PS8A 3UB1A 4N6UA 1E97A 5ELUA 5JBSA 1TIJA 1U8CB 3SEDA 2WGOA 1Q9EA 5RNTA 1EQKA 4KVHA 3FKAA 2MC8A 1QVG2 1Z1SA 1QAKA 2P0XA 3LT8A 4XBTA 2H0HA 1GS3A 4HM5B 4ILFA 3EX9A 1BIRA 2RNTA 1DYUA 2IUJA 3PCSA 3GZBA 4HAAA 2E2TA 3KE7A 1W6YA 1VZZA 1RSNA 3FSDA 3EBYA 1I3IA 3FG1A 4XDWA 1BANA 1W4NA 3CCM3 1GD4A 5M18A 3OWUA 4HVNA 1OHPA 2ZA4A 2GSPA 2Q07A 1PYLA 1UI7A 3OXAA 3PZWA 4HM0B 1DETA 5IW9A 3HIIA 3A76A 1DVDA 4CCVA 3EN8A 1NNVA 2HMNB 3X3YA 3LYGA 1O7WB 1RN1A 2K3DA 1IYYA 1VQL3 1LXEA 1IK3A 3VF1A 3S67A 5JPPA 1SJWA 3EN1B 3H51A 4FMBA 1VQN3 1RGLA 2W9PA 2B24B 1GOUA 1Q40A 3EC9A 1FUSA 1RGAA 2Z6BA 4KFEA 5BVBA 3CCR3 2M7OA 3AGNA 3X41A 1NDOB 1W6GA 3D3LA 1OHSA 4EV5A 3GZXB 4R80A 4U13A 3CD63 3D5GA 1RRHA 1HZ1A 2K54A 3F8XA 3ZFZA 1MWRA 3EHCA 1S723 1JB4A 2WOFA 1BNGA 2GBXB 4WYKA 1T2HA 1IQXA 3F9SA 4NREA 4NPBA 3X40A 1W5ZA 3K5TA 4KFDA 1RKYA 2KF4A 7STDA 3RGRA 1IU7A 3EE1A 4STDA 1ZGXA 4PEJA 4HM8B 4JF8A 1RGFA 1LNHA 4MMYB 4I5QA 3WHOA 1F8NA 3TDGA 3AMOA 1TTOA 4O2HA 2C4BA 5D82A 3KKGA 2W03A 3Q90A 3UJMA
chains in the Genus database with same CATH topology
3NQZA 5CF2A 1STFI 3LZAA 3N54B 3CPOA 3OWYA 3T8NA 1AV4A 3ECFA 1IVXA 4GL6A 1ROAA 5EEOA 3B7CA 4HJLB 3EF8A 2BMOB 5IG4A 2QEX3 1VQ83 1JRQA 3DM8A 1J2BA 3GRDA 2W0QA 1N8QA 2KRTA 3SVAA 2CWVA 1K9M4 1Q864 4K1VA 3JUPA 4HM3B 1VQ53 3OV4A 1M1K4 2P0MA 1QAFA 3STDA 5KP4A 4HM4B 1Q42A 1YJ93 3V92A 3CCE3 5FGOA 6STDA 3WODG 1VQ73 3HK4A 3PXMA 2Y73A 1K28A 3NM2A 3MYTA 3QK9A 4K90B 3RGAA 1L5GB 4EC6A 4K1UA 4N6LA 2F86B 3M8CA 1DVCA 3F7XA 3CCL3 1R4CA 2C10A 1TUHA 5FW5A 5G2GA 3AMOB 3I563 1TP6A 1OPYA 2BNGA 2HMMB 3BNCA 4QWTA 5EQLA 2F99A 1K734 3NBJA 1WMNA 3NM7A 1VQO3 1NWWA 1YGEA 1AVKA 4RNZA 1FGQA 2BMQB 2XRXB 3LTAA 4HBRA 5D81A 5AIFA 1KQS2 2KXGA 2JDIH 1FA3A 3OWSA 4R1KA 2XGNA 1JKGB 4RNYA 2W56A 1D6UA 4Q53A 1WMPA 1OCVA 2ZL8A 1O7PB 2R4IA 3LT9A 5IG0A 2LYXA 3MG2A 3EBTA 2CK3H 1YI23 4WP5A 1WQLB 4JRFA 1EG9B 3X3XA 3CMA3 5KP1A 4LMIA 1FGOA 3MKIA 2XFSA 3K0ZA 4OVMA 2P38A 1DMQA 2GXFA 5AYRB 3S27A 4IT7A 3HIGA 2FGTA 2OQEA 3NUVA 3NXJA 4G1MB 1O7HB 5AI1A 3FG3A 3HI7A 1QJGA 2CHCA 3T8UA 3WOEB 3ER7A 3IMAB 2LQVA 2OWPA 4RZMA 3H3HA 3G713 3KSPA 1KWIA 4EXRA 1NB3I 1M9GA 1YVBI 4KZ1A 1ROVA 2W56B 3WA3A 2W04A 1OGZA 2CC3A 2HMJB 4LEHA 1ULIB 1GYBA 1OUNA 3KZTA 4IPBA 5AIIA 1TFKA 1T5YA 2CFGA 2K0MA 3V99A 3JUNA 4N6V0 4WHAA 4L8OA 2L4VA 1O7MB 4N6NB 2D42A 3CC43 2WGQA 1YJW3 2D1WA 3B4PA 3DUKA 4O02B 1EKMA 2CIUA 1IDPA 5AEWB 1US1A 3SOYA 4FCJA 2XEPA 1K41A 4J8TA 4I4KA 3J7Yd 3SLUA 4FCZA 3K9MC 2ML5A 4OK0A 5CF1A 5IERA 3FCSB 1GY6A 1IQ8A 2INXA 1OF5B 4R9KA 5KP3A 4FMAA 3JUMA 4WFOA 1NB5I 2E2VA 4EYCA 1FUWA 4KFFA 5A0OB 8CHOA 2IMJA 1JV2B 1GY5A 1VQ93 1W7CA 4ORLA 4LSOA 3RDEA 4L7KA 1C7HA 2BMRB 4FR9A 5I97A 3PCRA 4HM2B 2QA43 4GB5A 3MSOA 2XFTA 1MOLA 3B4OA 3DGMA 4HM1B 2XR8B 2RCDA 4NHFA 2CKFB 1RJOA 2Z76A 4FCMA 3D9RA 2CFLA 3UL5A 1A2VA 1SIHA 4O3VA 3DGOA 2I9WA 3CC73 1HU9A 1S5AA 3SOAA 2Z77A 1JKGA 2HMKB 2Y74A 1GY7A 5D83A 1RRLA 1STDA 3JUOA 3V98A 2ZDJA 3QRDA 3LOYA 3NQYA 1UW1A 2CG0A 4HM6B 2BHMA 1OGXA 2XSHB 3NV0A 2XGLA 1TFOA 2Z7AA 2STDA 4N6TA 2OCTA 3X42A 3F7SA 1VQP3 3BB9A 2RFRA 2IUKA 1YHQ3 1NO3A 3DGNA 3IJEB 3LTCA 2CWTA 4H61A 3CME3 1A67A 4TX4A 1LVNA 3LMLA 4L8PA 4XDVA 3Q2PA 2CFDA 3UNLA 3SX1A 3EJVA 1FGTA 1NU3A 5BXQA 3G0KA 1KSIA 3KFQC 4OUQA 1QVF2 3ALAA 3K7CA 3NX0A 1PFPA 4HZ9B 4BTXA 1VQ63 3F40A 2GBWB 1O7GB 3CCS3 5STDA 2C11A 1N5PA 2MF7A 2HMLB 3F14A 3GZRA 3KSED 1JB5A 4O8SA 5JPUA 3I553 1IVWA 3JVCA 1W6CA 1K8A4 1TU5A 2W9QA 1UUWB 4HM7B 4LZIA 1KD14 3NHXA 1ZX2A 3L0RA 4N3VA 1KC84 3NV0B 4MJDA 3LTBA 1Y4KA 5LC7A 4RBNA 1VQK3 5EVHA 4AEQA 3DZLA 1Q824 4FMCA 5IEPA 2GEXA 1OHOA 3HZPA 1JB2A 4EV2A 1VQM3 3GAXA 4HZBB 1V74A 5IF6A 2W2CA 1IV9A 3KN4A 3WOFB 3LTDA 3G6E3 3CNMA 1OH0A 2XF3A 1JNQA 1ZO2A 1OF5A 2V1LA 3PYJA 1A2KA 1SPUA 2YX9A 1Q7Y4 3CCQ3 1HKXA 5AIHA 5IEOA 1JN5A 2E2UA 3WMDA 4XBXA 2CFKA 4HYZA 5ELJA 1G96A 2OOVA 1CEWI 3U1WA 3U97A 3OW22 2KCDA 3VSYA 1GD3A 3FF2A 1DMMA 3BNBA 3GZYB 1AR0A 3Q1CA 4IIAA 1WNHA 4X2OA 2PZVA 4XB5A 3IPTA 2QGUA 4MMXB 3GWRA 1SQWA 5TGNA 5DRVA 4AKZA 1IT7A 1FGMA 3DMCA 5LC6A 3FLJA 2OQEC 3BNDA 4MMZB 1W02A 5IG5A 1ASKA 3UL6A 4EBGA 1D6ZA 4H3UA 1RN7A 5CK6A 2IA7A 3MG3A 1EA2A 1JN5B 2CH9A 2CWUA 3KIIA 2GU1A 3CCJ3 1UI8A 4BTYA 2XH9A 4MEIA 1PU4A 1DMNA 5AIGA 2XSOB 4R9LA 1IQYA 3CCV3 3LXUX 1YIT3 3G4S3 2OOVC 1Q814 1LOXA 4CDLA 4BTWA 3CPW2 2ML6A 5IG3A 3T0UA 1N8R4 3I0YA 5CXOA 3G8ZA 3JUQA 1M904 4N6OB 3CNXA 3EB8A 2YFIB 4XBYA 5AYSC 3FH1A 3BLZA 1W01A 1D6YA 1N9JA 4WWUC 3CC23 3LH4A 4FMDA 2GU3A 1N9EA 4R4KA 1M1XB 1QMAA 3FZWA 3WDGB 3FG4A 3MWZA 1IV7A 1ULJB 2W6JH 2BO9B 4HKVB 4AKYA 1Q40B 4LGQA 1O7NB 2YFJB 3N9HA 4K61A 4X2HA 5AEUB 1WMOA 2BT3A 3O8YA 4XM4A 1A90A 2B1XB 4ZM8A 2CW9A 2YFLB 3MG1A 2HMOB 2FXTA 4WYKB 1W2B2 2P09A 3CCU3 3VGNA 2O3OA 2CFWA 2UX0A 1MNLA 2RGQA 3DY5A 1SIIA 2WO0A 3K63A 3DGLA 2SBLA 2RSXA 3HX8A 1AVLA 3BNEA 3MPHA 1OACA 2CG1A 1QALA 5IENA 1CYVA 3SXXA 1YJN3 5CLKA 2A15A 2F98A 2O9UX 3OX9A 1UUVB 3NBBA 1BUQA 1W00A 4N6MA 1E3VA 3MHEA 1IVVA 5DREA 3X3ZA 3CU3A 2WOHA 3FF0A 3S5CA 1JJ22 3S29A 1ISKA 1IT8A 3G16A 1N5HA 1NJI4 2OTJ3 2PNCA 3B8LA 2JQ5A 4J9AA 3CXC2 3EQQB 1U5OA 2QIYA 2P05A 3ROBA 2OTL3 3S28A 3F8HA 1FGRA 3E99A 5HGRA 2GEYA 3DXOA 1WTHA 1YIJ3 3FGYA 3WA2X 3PGBA 1IVUA 1E3RA 2FNQA 3NBRA 3N8BA 1CQSA 1VQ43 1W2ZA 1CYUA 3PS8A 3UB1A 4N6UA 1E97A 5ELUA 5JBSA 1TIJA 1U8CB 3SEDA 2WGOA 1EQKA 4KVHA 3FKAA 2MC8A 1QVG2 1Z1SA 1QAKA 2P0XA 3LT8A 4XBTA 1GS3A 4HM5B 3EX9A 2IUJA 1DYUA 3PCSA 3GZBA 2E2TA 3KE7A 1W6YA 1VZZA 3FSDA 3EBYA 3FG1A 4XDWA 1W4NA 3CCM3 1GD4A 3OWUA 4HVNA 1OHPA 2Q07A 1UI7A 3OXAA 3PZWA 4HM0B 5IW9A 3HIIA 3A76A 1DVDA 4CCVA 3EN8A 3X3YA 2HMNB 3LYGA 1O7WB 1VQL3 1LXEA 1IK3A 3VF1A 3S67A 5JPPA 1SJWA 3EN1B 3H51A 4FMBA 1VQN3 2W9PA 2B24B 1Q40A 3EC9A 4KFEA 5BVBA 2Z6BA 3CCR3 2M7OA 3X41A 1NDOB 1W6GA 3D3LA 1OHSA 4EV5A 3GZXB 4R80A 4U13A 3CD63 1RRHA 2K54A 3F8XA 3EHCA 1S723 1JB4A 2WOFA 2GBXB 4WYKA 1IQXA 3F9SA 4NREA 3X40A 1W5ZA 3K5TA 4KFDA 1RKYA 7STDA 3RGRA 1IU7A 3EE1A 4STDA 4PEJA 4HM8B 4JF8A 1LNHA 4MMYB 1F8NA 3TDGA 3AMOA 4O2HA 5D82A 3KKGA 2W03A 3Q90A 3UJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CF2 A;  3LZA A;  3CPO A;  3OWY A;  3T8N A;  3ECF A;  3B7C A;  4HJL B;  3EF8 A;  2BMO B;  5IG4 A;  3DM8 A;  3GRD A;  4K1V A;  3JUP A;  4HM3 B;  3OV4 A;  3STD A;  5KP4 A;  4HM4 B;  1Q42 A;  6STD A;  3HK4 A;  3NM2 A;  3MYT A;  3RGA A;  4K1U A;  2F86 B;  3M8C A;  3F7X A;  1TUH A;  5FW5 A;  5G2G A;  1TP6 A;  1OPY A;  2BNG A;  2HMM B;  2F99 A;  1NWW A;  5D81 A;  2BMQ B;  2XRX B;  5AIF A;  3OWS A;  4R1K A;  1JKG B;  4Q53 A;  1OCV A;  1O7P B;  2R4I A;  5IG0 A;  3MG2 A;  3EBT A;  4WP5 A;  1WQL B;  1EG9 B;  5KP1 A;  4LMI A;  3MKI A;  3K0Z A;  4OVM A;  1DMQ A;  2GXF A;  3NUV A;  3NXJ A;  1O7H B;  5AI1 A;  1QJG A;  2CHC A;  3T8U A;  3ER7 A;  2OWP A;  4RZM A;  3H3H A;  3KSP A;  4LEH A;  1OGZ A;  2HMJ B;  1ULI B;  1GYB A;  1OUN A;  3KZT A;  5AII A;  3JUN A;  4L8O A;  1O7M B;  3B4P A;  3DUK A;  5AEW B;  1IDP A;  3SOY A;  4FCJ A;  1K41 A;  4J8T A;  4I4K A;  5IER A;  5CF1 A;  1GY6 A;  2INX A;  1OF5 B;  4R9K A;  5KP3 A;  3JUM A;  8CHO A;  2IMJ A;  1GY5 A;  4ORL A;  4L7K A;  1C7H A;  2BMR B;  4HM2 B;  4GB5 A;  3MSO A;  3B4O A;  4HM1 B;  2XR8 B;  2RCD A;  2CKF B;  2Z76 A;  4FCM A;  3D9R A;  2I9W A;  1S5A A;  3SOA A;  2HMK B;  1JKG A;  2Z77 A;  1GY7 A;  5D83 A;  1STD A;  3JUO A;  4HM6 B;  1OGX A;  2XSH B;  3NV0 A;  2Z7A A;  2STD A;  3F7S A;  3BB9 A;  2RFR A;  4L8P A;  4XDV A;  3UNL A;  3EJV A;  1NU3 A;  5BXQ A;  3G0K A;  4OUQ A;  3K7C A;  4HZ9 B;  3F40 A;  2GBW B;  1O7G B;  5STD A;  2HML B;  3F14 A;  3GZR A;  5JPU A;  1JB5 A;  1UUW B;  4HM7 B;  3NHX A;  1ZX2 A;  4N3V A;  3NV0 B;  4MJD A;  5EVH A;  3DZL A;  5IEP A;  2GEX A;  1OHO A;  3HZP A;  1JB2 A;  4HZB B;  5IF6 A;  2W2C A;  3CNM A;  1OH0 A;  1ZO2 A;  1OF5 A;  1A2K A;  1HKX A;  5AIH A;  5IEO A;  1JN5 A;  3WMD A;  4XBX A;  3VSY A;  3FF2 A;  1DMM A;  3GZY B;  1AR0 A;  4IIA A;  4X2O A;  2PZV A;  4XB5 A;  3IPT A;  2QGU A;  3GWR A;  5TGN A;  5DRV A;  3DMC A;  3FLJ A;  1W02 A;  5IG5 A;  1ASK A;  4H3U A;  5CK6 A;  3MG3 A;  1EA2 A;  1JN5 B;  1DMN A;  5AIG A;  4R9L A;  2XSO B;  4CDL A;  5IG3 A;  3I0Y A;  5CXO A;  3G8Z A;  3JUQ A;  3CNX A;  2YFI B;  4XBY A;  3FH1 A;  3BLZ A;  1W01 A;  4WWU C;  3FZW A;  1QMA A;  1ULJ B;  4HKV B;  1Q40 B;  4LGQ A;  1O7N B;  2YFJ B;  4X2H A;  5AEU B;  4XM4 A;  2B1X B;  3MG1 A;  2YFL B;  2HMO B;  4WYK B;  3VGN A;  2UX0 A;  2RGQ A;  3HX8 A;  5IEN A;  5CLK A;  2A15 A;  2F98 A;  3OX9 A;  1UUV B;  1BUQ A;  1W00 A;  1E3V A;  3MHE A;  5DRE A;  3CU3 A;  3FF0 A;  3S5C A;  1ISK A;  3G16 A;  3B8L A;  4J9A A;  2JQ5 A;  3EQQ B;  1U5O A;  2QIY A;  3ROB A;  3F8H A;  3E99 A;  5HGR A;  2GEY A;  3DXO A;  3FGY A;  1E3R A;  3NBR A;  1CQS A;  1E97 A;  3SED A;  4KVH A;  3FKA A;  1Z1S A;  4XBT A;  1GS3 A;  4HM5 B;  3EX9 A;  3GZB A;  3KE7 A;  1W6Y A;  1VZZ A;  3FSD A;  3EBY A;  4XDW A;  3OWU A;  4HVN A;  1OHP A;  3OXA A;  4HM0 B;  3A76 A;  3EN8 A;  2HMN B;  3LYG A;  1O7W B;  5JPP A;  1SJW A;  3EN1 B;  3H51 A;  2B24 B;  1Q40 A;  3EC9 A;  5BVB A;  1NDO B;  1OHS A;  3GZX B;  4U13 A;  2K54 A;  3F8X A;  3EHC A;  1JB4 A;  2GBX B;  4WYK A;  3F9S A;  7STD A;  3RGR A;  4STD A;  4PEJ A;  4HM8 B;  5D82 A;  3KKG A;  3Q90 A;  3UJM A; 
#chains in the Genus database with same CATH topology
 3NQZ A;  5CF2 A;  1STF I;  3LZA A;  3N54 B;  3WR2 A;  3CPO A;  3OWY A;  3T8N A;  1AV4 A;  3ECF A;  1IVX A;  4GL6 A;  1B2M A;  1ROA A;  5EEO A;  3B7C A;  4HJL B;  3EF8 A;  2BMO B;  5IG4 A;  2QEX 3;  1VQ8 3;  1JRQ A;  3DM8 A;  1J2B A;  3GRD A;  2W0Q A;  1N8Q A;  1RNT A;  2KRT A;  2R41 A;  3SVA A;  1BSD A;  1HYF A;  2CWV A;  1K9M 4;  1Q86 4;  2H0G A;  3JUP A;  4HM3 B;  4K1V A;  4BU4 A;  6RNT A;  1VQ5 3;  1UCL A;  3OV4 A;  1LOV A;  1M1K 4;  2P0M A;  1QAF A;  3STD A;  5KP4 A;  4HM4 B;  1Q42 A;  1YJ9 3;  1VQQ A;  3V92 A;  1RHL A;  3CCE 3;  5FGO A;  1X1X A;  3WOD G;  6STD A;  1VQ7 3;  1A2P A;  3HK4 A;  1RMS A;  3PXM A;  2Y73 A;  1K28 A;  2BU4 A;  3NM2 A;  4CPK A;  3MYT A;  3QK9 A;  4K90 B;  3RGA A;  1I2E A;  1L5G B;  4K1U A;  1BOX A;  4N6L A;  2F86 B;  3M8C A;  4EC6 A;  1DVC A;  3F7X A;  3CCL 3;  1R4C A;  2C10 A;  1TUH A;  5FW5 A;  5G2G A;  3AMO B;  3I56 3;  1TP6 A;  1OPY A;  1G02 A;  2BNG A;  2HMM B;  1R4Y A;  2KF5 A;  3BNC A;  4QWT A;  5EQL A;  2F99 A;  2F5M A;  1K73 4;  3NBJ A;  1WMN A;  3Q3F A;  3NM7 A;  1VQO 3;  1NWW A;  1YGE A;  1AVK A;  2SAR A;  1MGR A;  4RNZ A;  1FGQ A;  2BMQ B;  2XRX B;  2KF6 A;  3LTA A;  4HBR A;  5AIF A;  5D81 A;  1KQS 2;  2KXG A;  2JDI H;  1FA3 A;  3OWS A;  4R1K A;  2XGN A;  1JKG B;  4RNY A;  2W56 A;  1D6U A;  4Q53 A;  1WMP A;  1OCV A;  2ZL8 A;  1O7P B;  2R4I A;  3LT9 A;  1BSA A;  5IG0 A;  1X1W A;  1EEJ A;  2LYX A;  3MG2 A;  1FZU A;  1I2G A;  3EBT A;  2CK3 H;  1YI2 3;  1BVI A;  4WP5 A;  1WQL B;  4JRF A;  1EG9 B;  3X3X A;  1FUT A;  3CMA 3;  5KP1 A;  4LMI A;  1MGW A;  1FGO A;  3MKI A;  2XFS A;  3K0Z A;  4OVM A;  3HOH A;  2P38 A;  1DMQ A;  2GXF A;  5AYR B;  3S27 A;  4IT7 A;  3HIG A;  2FGT A;  2OQE A;  1BRS A;  3NUV A;  1UGH I;  1X1U A;  1I2F A;  1O7H B;  3NXJ A;  4G1M B;  5AI1 A;  3FG3 A;  2IY2 A;  4DKI A;  1MWT A;  1B20 A;  1QJG A;  3HI7 A;  2CHC A;  3URP A;  3T8U A;  3WOE B;  5HOH A;  3ER7 A;  3IMA B;  2LQV A;  2OWP A;  4RZM A;  3H3H A;  3G71 3;  3KSP A;  1BSE A;  1BRG A;  2F5W A;  1G0T A;  1KWI A;  2UUG C;  3AHS A;  4EXR A;  1NB3 I;  1BRH A;  1M9G A;  1YVB I;  4KZ1 A;  1ROV A;  2W56 B;  3WA3 A;  1LQG C;  2W04 A;  1OGZ A;  2CC3 A;  2HMJ B;  4LEH A;  1ULI B;  1GYB A;  1TRQ A;  1OUN A;  1V57 A;  3KZT A;  4IPB A;  5AII A;  1TFK A;  1T5Y A;  2CFG A;  2K0M A;  3V99 A;  4EW5 A;  1RTU A;  3JUN A;  4N6V 0;  4WHA A;  4L8O A;  2L4V A;  1O7M B;  1I70 A;  2D42 A;  4N6N B;  3CC4 3;  2AAE A;  1GOV A;  2WGQ A;  1YJW 3;  2D1W A;  3B4P A;  3DUK A;  2BIR A;  4O02 B;  1EKM A;  2CIU A;  1I0V A;  1IDP A;  1US1 A;  3SOY A;  4FCJ A;  2XEP A;  5AEW B;  1K41 A;  4J8T A;  4I4K A;  3J7Y d;  3SLU A;  4FCZ A;  3K9M C;  2ML5 A;  4OK0 A;  5CF1 A;  5IER A;  3RNT A;  3FCS B;  1GY6 A;  1GSP A;  3D79 A;  1CH0 A;  1IQ8 A;  2INX A;  1OF5 B;  5G1K A;  3BIR A;  4R9K A;  3BU4 A;  5KP3 A;  5BIR A;  1BGS A;  1UGI A;  4FMA A;  3JUM A;  4WFO A;  1NB5 I;  2E2V A;  4EYC A;  1FUW A;  4KFF A;  4BL2 A;  5A0O B;  8CHO A;  2IMJ A;  1JV2 B;  1GY5 A;  1VQ9 3;  1BRJ A;  1UCI A;  1W7C A;  4ORL A;  4LSO A;  3RDE A;  4L7K A;  1C7H A;  2BMR B;  4FR9 A;  5I97 A;  1AQZ A;  2H0I A;  3PCR A;  4HM2 B;  2QA4 3;  4GB5 A;  1V58 A;  3MSO A;  2XFT A;  1BNE A;  1MOL A;  3B4O A;  3DGM A;  4HM1 B;  2XR8 B;  2RCD A;  4NHF A;  2CKF B;  1RJO A;  2Z76 A;  4FCM A;  1BNI A;  3D9R A;  1I8V A;  2CFL A;  3UL5 A;  1A2V A;  1I0X A;  1SIH A;  4O3V A;  3DGO A;  2I9W A;  3CC7 3;  1BNF A;  1HU9 A;  1S5A A;  3SOA A;  1BNR A;  2HMK B;  1JKG A;  2Y74 A;  2Z77 A;  1AY7 A;  5GSP A;  5M19 A;  1GY7 A;  5D83 A;  1BRK A;  1RRL A;  3D4A A;  1STD A;  1YGW A;  3JUO A;  3V98 A;  2HOH A;  2ZDJ A;  3QRD A;  3LOY A;  1FW7 A;  1GMR A;  1TJD A;  1UW1 A;  2CG0 A;  3NQY A;  4HM6 B;  2BHM A;  1OGX A;  1LQM B;  2XSH B;  3NV0 A;  2XGL A;  1TFO A;  2Z7A A;  2STD A;  1DE3 A;  4N6T A;  2OCT A;  3X42 A;  3F7S A;  1RGK A;  1VQP 3;  3BB9 A;  2RFR A;  3DGY A;  2IUK A;  1YHQ 3;  1NO3 A;  1X1Y A;  3DGN A;  4BIR A;  3IJE B;  3LTC A;  8RNT A;  2CWT A;  4H61 A;  3CME 3;  1A67 A;  3AHW A;  4TX4 A;  1LVN A;  3SYU A;  3LML A;  4L8P A;  4XDV A;  3Q2P A;  2CFD A;  3UNL A;  3SX1 A;  3EJV A;  1FGT A;  1NU3 A;  5BXQ A;  2ZHX B;  3G0K A;  1KSI A;  3KFQ C;  4OUQ A;  1QVF 2;  2CX1 A;  3ALA A;  3K7C A;  3NX0 A;  1PFP A;  4HZ9 B;  4BTX A;  1VQ6 3;  3F40 A;  1JZD A;  2GBW B;  1O7G B;  2J8X B;  3CCS 3;  5STD A;  2C11 A;  1N5P A;  2HML B;  2MF7 A;  3F14 A;  3GZR A;  3KSE D;  1JB5 A;  4O8S A;  5JPU A;  3I55 3;  1IVW A;  3JVC A;  1W6C A;  1K8A 4;  1BRI A;  1TU5 A;  2W9Q A;  1UUW B;  4HM7 B;  4LZI A;  1RDS A;  3NHX A;  1KD1 4;  1ZX2 A;  3L0R A;  4N3V A;  1KC8 4;  3NV0 B;  4MJD A;  3LTB A;  1Y4K A;  5LC7 A;  4RBN A;  1VQK 3;  5EVH A;  1RGG A;  3DZL A;  4AEQ A;  4FMC A;  5IEP A;  2GEX A;  1OHO A;  1Q82 4;  1UCK A;  2AAD A;  7RNT A;  3HZP A;  1JB2 A;  6GSP A;  4EV2 A;  1VQM 3;  3GAX A;  4HZB B;  1V74 A;  5IF6 A;  2W2C A;  1IV9 A;  3KN4 A;  3WOF B;  3LTD A;  4CJN A;  3G6E 3;  3CNM A;  1OH0 A;  2XF3 A;  1BNS A;  1BNJ A;  1JNQ A;  1ZO2 A;  3A5E A;  3ZG5 A;  1OF5 A;  1BUJ A;  2V1L A;  3PYJ A;  1A2K A;  1SPU A;  1BRN L;  2YX9 A;  1Q7Y 4;  4BL3 A;  3CCQ 3;  1HKX A;  5AIH A;  5IEO A;  1JN5 A;  2E2U A;  3WMD A;  1B2Z A;  4XBX A;  2CFK A;  4HYZ A;  3ZG0 A;  5ELJ A;  1G96 A;  4HOH A;  2OOV A;  1CEW I;  3U1W A;  1LRA A;  3U97 A;  3OW2 2;  2KCD A;  3DH2 A;  3VSY A;  1GD3 A;  3FF2 A;  1DMM A;  3BNB A;  1UUG B;  4J5G A;  1JBR A;  3GZY B;  1AR0 A;  3Q1C A;  4IIA A;  1WNH A;  4X2O A;  1RCL A;  2PZV A;  3IPT A;  2QGU A;  4XB5 A;  4MMX B;  3GWR A;  1SQW A;  5TGN A;  5DRV A;  4AKZ A;  4LYL B;  1IT7 A;  1FGM A;  3DMC A;  5LC6 A;  4GSP A;  3FLJ A;  2OQE C;  1JBS A;  3BND A;  1RGH A;  2F56 A;  4MMZ B;  1GMQ A;  1W02 A;  3D5I A;  1B2X A;  1RCK A;  1ASK A;  5IG5 A;  3UL6 A;  4EBG A;  1B2S A;  4KT3 B;  1D6Z A;  4H3U A;  1RN7 A;  5CK6 A;  2IA7 A;  3MG3 A;  1EA2 A;  1JN5 B;  2CH9 A;  2CWU A;  3KII A;  2GU1 A;  3CCJ 3;  1UI8 A;  1GMP A;  2XH9 A;  4MEI A;  4BTY A;  1PU4 A;  1DMN A;  1TRP A;  5AIG A;  2XSO B;  4R9L A;  1IQY A;  3CCV 3;  3LXU X;  1YIT 3;  3G4S 3;  1B3S A;  1MWS A;  2OOV C;  1Q81 4;  1LOX A;  1BAO A;  4CDL A;  4BTW A;  3CPW 2;  2ML6 A;  5IG3 A;  3T0U A;  1N8R 4;  3I0Y A;  2UGI A;  5CXO A;  3G8Z A;  3JUQ A;  1ZS7 A;  1M90 4;  4N6O B;  3CNX A;  3EB8 A;  2YFI B;  1BSB A;  4XBY A;  5AYS C;  3FH1 A;  3BLZ A;  1W01 A;  1D6Y A;  1N9J A;  3GSP A;  4WWU C;  3LH4 A;  3CC2 3;  4FMD A;  2GU3 A;  1LOY A;  1N9E A;  2KF3 A;  4R4K A;  1SAR A;  1M1X B;  1QMA A;  3FZW A;  3WDG B;  5M1A A;  1LOW A;  3FG4 A;  1MWU A;  3MWZ A;  1GOY A;  1IV7 A;  1T3B A;  1ULJ B;  1YNV X;  2W6J H;  2BO9 B;  4HKV B;  4AKY A;  4RNT A;  2IYJ A;  1Q40 B;  1EUI C;  4LGQ A;  1O7N B;  2YFJ B;  3N9H A;  4K61 A;  4X2H A;  5AEU B;  5G1L A;  1B21 A;  1LNI A;  1WMO A;  2BT3 A;  3O8Y A;  1YVS A;  4XM4 A;  1A90 A;  2B1X B;  4ZM8 A;  2CW9 A;  2YFL B;  3MG1 A;  1JBT A;  2HMO B;  7GSP A;  2FXT A;  4WYK B;  1W2B 2;  2L1S A;  2P09 A;  1UCJ A;  5BU4 A;  3CCU 3;  3VGN A;  2O3O A;  2CFW A;  3KCH A;  1B2U A;  2UX0 A;  1T2I A;  1MNL A;  2RBI A;  2RGQ A;  3DY5 A;  1BU4 A;  1SII A;  1BSC A;  1RN4 A;  2WO0 A;  3K63 A;  3DGL A;  1C54 A;  2RSX A;  2SBL A;  3HX8 A;  1AVL A;  3BNE A;  3MPH A;  1OAC A;  2CG1 A;  1QAL A;  5IEN A;  1Q7H A;  1CYV A;  3SXX A;  4GHO A;  2KAA A;  1YJN 3;  5CLK A;  1RLS A;  2A15 A;  2F98 A;  2O9U X;  1FYS A;  3OX9 A;  1UUV B;  3NBB A;  1PY3 A;  1BUQ A;  1W00 A;  4N6M A;  1E3V A;  2F4Y A;  1IVV A;  3MHE A;  1RGE A;  5DRE A;  3CU3 A;  2WOH A;  3X3Z A;  3FF0 A;  2CX0 A;  3S5C A;  1JJ2 2;  3S29 A;  1ISK A;  1IT8 A;  3G16 A;  1N5H A;  1NJI 4;  2OTJ 3;  2PNC A;  3B8L A;  2JQ5 A;  4J9A A;  4J5K A;  1JZO A;  3EQQ B;  3CXC 2;  1U5O A;  3AGO A;  2QIY A;  2P05 A;  3ROB A;  2OTL 3;  3S28 A;  1I3F A;  3F8H A;  1FGR A;  3E99 A;  5HGR A;  2GEY A;  3DXO A;  1WTH A;  1UDI I;  9RNT A;  1RGC A;  1YIJ 3;  3FGY A;  3WA2 X;  3PGB A;  1IVU A;  1E3R A;  2FNQ A;  3NBR A;  3N8B A;  1CQS A;  1VQ4 3;  1RNB A;  1W2Z A;  1CYU A;  1B27 A;  3PS8 A;  3UB1 A;  4N6U A;  1E97 A;  5ELU A;  5JBS A;  1TIJ A;  1U8C B;  3SED A;  2WGO A;  1Q9E A;  5RNT A;  1EQK A;  4KVH A;  3FKA A;  2MC8 A;  1QVG 2;  1Z1S A;  1QAK A;  2P0X A;  3LT8 A;  4XBT A;  2H0H A;  1GS3 A;  4HM5 B;  4ILF A;  3EX9 A;  1BIR A;  2RNT A;  1DYU A;  2IUJ A;  3PCS A;  3GZB A;  4HAA A;  2E2T A;  3KE7 A;  1W6Y A;  1VZZ A;  1RSN A;  3FSD A;  3EBY A;  1I3I A;  3FG1 A;  4XDW A;  1BAN A;  1W4N A;  3CCM 3;  1GD4 A;  5M18 A;  3OWU A;  4HVN A;  1OHP A;  2ZA4 A;  2GSP A;  2Q07 A;  1PYL A;  1UI7 A;  3OXA A;  3PZW A;  4HM0 B;  1DET A;  5IW9 A;  3HII A;  3A76 A;  1DVD A;  4CCV A;  3EN8 A;  1NNV A;  2HMN B;  3X3Y A;  3LYG A;  1O7W B;  1RN1 A;  2K3D A;  1IYY A;  1VQL 3;  1LXE A;  1IK3 A;  3VF1 A;  3S67 A;  5JPP A;  1SJW A;  3EN1 B;  3H51 A;  4FMB A;  1VQN 3;  1RGL A;  2W9P A;  2B24 B;  1GOU A;  1Q40 A;  3EC9 A;  1FUS A;  1RGA A;  2Z6B A;  4KFE A;  5BVB A;  3CCR 3;  2M7O A;  3AGN A;  3X41 A;  1NDO B;  1W6G A;  3D3L A;  1OHS A;  4EV5 A;  3GZX B;  4R80 A;  4U13 A;  3CD6 3;  3D5G A;  1RRH A;  1HZ1 A;  2K54 A;  3F8X A;  3ZFZ A;  1MWR A;  3EHC A;  1S72 3;  1JB4 A;  2WOF A;  1BNG A;  2GBX B;  4WYK A;  1T2H A;  1IQX A;  3F9S A;  4NRE A;  4NPB A;  3X40 A;  1W5Z A;  3K5T A;  4KFD A;  1RKY A;  2KF4 A;  7STD A;  3RGR A;  1IU7 A;  3EE1 A;  4STD A;  1ZGX A;  4PEJ A;  4HM8 B;  4JF8 A;  1RGF A;  1LNH A;  4MMY B;  4I5Q A;  3WHO A;  1F8N A;  3TDG A;  3AMO A;  1TTO A;  4O2H A;  2C4B A;  5D82 A;  3KKG A;  2W03 A;  3Q90 A;  3UJM A; 
#chains in the Genus database with same CATH homology
 3NQZ A;  5CF2 A;  1STF I;  3LZA A;  3N54 B;  3CPO A;  3OWY A;  3T8N A;  1AV4 A;  3ECF A;  1IVX A;  4GL6 A;  1ROA A;  5EEO A;  3B7C A;  4HJL B;  3EF8 A;  2BMO B;  5IG4 A;  2QEX 3;  1VQ8 3;  1JRQ A;  3DM8 A;  1J2B A;  3GRD A;  2W0Q A;  1N8Q A;  2KRT A;  3SVA A;  2CWV A;  1K9M 4;  1Q86 4;  4K1V A;  3JUP A;  4HM3 B;  1VQ5 3;  3OV4 A;  1M1K 4;  2P0M A;  1QAF A;  3STD A;  5KP4 A;  4HM4 B;  1Q42 A;  1YJ9 3;  3V92 A;  3CCE 3;  5FGO A;  6STD A;  3WOD G;  1VQ7 3;  3HK4 A;  3PXM A;  2Y73 A;  1K28 A;  3NM2 A;  3MYT A;  3QK9 A;  4K90 B;  3RGA A;  1L5G B;  4EC6 A;  4K1U A;  4N6L A;  2F86 B;  3M8C A;  1DVC A;  3F7X A;  3CCL 3;  1R4C A;  2C10 A;  1TUH A;  5FW5 A;  5G2G A;  3AMO B;  3I56 3;  1TP6 A;  1OPY A;  2BNG A;  2HMM B;  3BNC A;  4QWT A;  5EQL A;  2F99 A;  1K73 4;  3NBJ A;  1WMN A;  3NM7 A;  1VQO 3;  1NWW A;  1YGE A;  1AVK A;  4RNZ A;  1FGQ A;  2BMQ B;  2XRX B;  3LTA A;  4HBR A;  5D81 A;  5AIF A;  1KQS 2;  2KXG A;  2JDI H;  1FA3 A;  3OWS A;  4R1K A;  2XGN A;  1JKG B;  4RNY A;  2W56 A;  1D6U A;  4Q53 A;  1WMP A;  1OCV A;  2ZL8 A;  1O7P B;  2R4I A;  3LT9 A;  5IG0 A;  2LYX A;  3MG2 A;  3EBT A;  2CK3 H;  1YI2 3;  4WP5 A;  1WQL B;  4JRF A;  1EG9 B;  3X3X A;  3CMA 3;  5KP1 A;  4LMI A;  1FGO A;  3MKI A;  2XFS A;  3K0Z A;  4OVM A;  2P38 A;  1DMQ A;  2GXF A;  5AYR B;  3S27 A;  4IT7 A;  3HIG A;  2FGT A;  2OQE A;  3NUV A;  3NXJ A;  4G1M B;  1O7H B;  5AI1 A;  3FG3 A;  3HI7 A;  1QJG A;  2CHC A;  3T8U A;  3WOE B;  3ER7 A;  3IMA B;  2LQV A;  2OWP A;  4RZM A;  3H3H A;  3G71 3;  3KSP A;  1KWI A;  4EXR A;  1NB3 I;  1M9G A;  1YVB I;  4KZ1 A;  1ROV A;  2W56 B;  3WA3 A;  2W04 A;  1OGZ A;  2CC3 A;  2HMJ B;  4LEH A;  1ULI B;  1GYB A;  1OUN A;  3KZT A;  4IPB A;  5AII A;  1TFK A;  1T5Y A;  2CFG A;  2K0M A;  3V99 A;  3JUN A;  4N6V 0;  4WHA A;  4L8O A;  2L4V A;  1O7M B;  4N6N B;  2D42 A;  3CC4 3;  2WGQ A;  1YJW 3;  2D1W A;  3B4P A;  3DUK A;  4O02 B;  1EKM A;  2CIU A;  1IDP A;  5AEW B;  1US1 A;  3SOY A;  4FCJ A;  2XEP A;  1K41 A;  4J8T A;  4I4K A;  3J7Y d;  3SLU A;  4FCZ A;  3K9M C;  2ML5 A;  4OK0 A;  5CF1 A;  5IER A;  3FCS B;  1GY6 A;  1IQ8 A;  2INX A;  1OF5 B;  4R9K A;  5KP3 A;  4FMA A;  3JUM A;  4WFO A;  1NB5 I;  2E2V A;  4EYC A;  1FUW A;  4KFF A;  5A0O B;  8CHO A;  2IMJ A;  1JV2 B;  1GY5 A;  1VQ9 3;  1W7C A;  4ORL A;  4LSO A;  3RDE A;  4L7K A;  1C7H A;  2BMR B;  4FR9 A;  5I97 A;  3PCR A;  4HM2 B;  2QA4 3;  4GB5 A;  3MSO A;  2XFT A;  1MOL A;  3B4O A;  3DGM A;  4HM1 B;  2XR8 B;  2RCD A;  4NHF A;  2CKF B;  1RJO A;  2Z76 A;  4FCM A;  3D9R A;  2CFL A;  3UL5 A;  1A2V A;  1SIH A;  4O3V A;  3DGO A;  2I9W A;  3CC7 3;  1HU9 A;  1S5A A;  3SOA A;  2Z77 A;  1JKG A;  2HMK B;  2Y74 A;  1GY7 A;  5D83 A;  1RRL A;  1STD A;  3JUO A;  3V98 A;  2ZDJ A;  3QRD A;  3LOY A;  3NQY A;  1UW1 A;  2CG0 A;  4HM6 B;  2BHM A;  1OGX A;  2XSH B;  3NV0 A;  2XGL A;  1TFO A;  2Z7A A;  2STD A;  4N6T A;  2OCT A;  3X42 A;  3F7S A;  1VQP 3;  3BB9 A;  2RFR A;  2IUK A;  1YHQ 3;  1NO3 A;  3DGN A;  3IJE B;  3LTC A;  2CWT A;  4H61 A;  3CME 3;  1A67 A;  4TX4 A;  1LVN A;  3LML A;  4L8P A;  4XDV A;  3Q2P A;  2CFD A;  3UNL A;  3SX1 A;  3EJV A;  1FGT A;  1NU3 A;  5BXQ A;  3G0K A;  1KSI A;  3KFQ C;  4OUQ A;  1QVF 2;  3ALA A;  3K7C A;  3NX0 A;  1PFP A;  4HZ9 B;  4BTX A;  1VQ6 3;  3F40 A;  2GBW B;  1O7G B;  3CCS 3;  5STD A;  2C11 A;  1N5P A;  2MF7 A;  2HML B;  3F14 A;  3GZR A;  3KSE D;  1JB5 A;  4O8S A;  5JPU A;  3I55 3;  1IVW A;  3JVC A;  1W6C A;  1K8A 4;  1TU5 A;  2W9Q A;  1UUW B;  4HM7 B;  4LZI A;  1KD1 4;  3NHX A;  1ZX2 A;  3L0R A;  4N3V A;  1KC8 4;  3NV0 B;  4MJD A;  3LTB A;  1Y4K A;  5LC7 A;  4RBN A;  1VQK 3;  5EVH A;  4AEQ A;  3DZL A;  1Q82 4;  4FMC A;  5IEP A;  2GEX A;  1OHO A;  3HZP A;  1JB2 A;  4EV2 A;  1VQM 3;  3GAX A;  4HZB B;  1V74 A;  5IF6 A;  2W2C A;  1IV9 A;  3KN4 A;  3WOF B;  3LTD A;  3G6E 3;  3CNM A;  1OH0 A;  2XF3 A;  1JNQ A;  1ZO2 A;  1OF5 A;  2V1L A;  3PYJ A;  1A2K A;  1SPU A;  2YX9 A;  1Q7Y 4;  3CCQ 3;  1HKX A;  5AIH A;  5IEO A;  1JN5 A;  2E2U A;  3WMD A;  4XBX A;  2CFK A;  4HYZ A;  5ELJ A;  1G96 A;  2OOV A;  1CEW I;  3U1W A;  3U97 A;  3OW2 2;  2KCD A;  3VSY A;  1GD3 A;  3FF2 A;  1DMM A;  3BNB A;  3GZY B;  1AR0 A;  3Q1C A;  4IIA A;  1WNH A;  4X2O A;  2PZV A;  4XB5 A;  3IPT A;  2QGU A;  4MMX B;  3GWR A;  1SQW A;  5TGN A;  5DRV A;  4AKZ A;  1IT7 A;  1FGM A;  3DMC A;  5LC6 A;  3FLJ A;  2OQE C;  3BND A;  4MMZ B;  1W02 A;  5IG5 A;  1ASK A;  3UL6 A;  4EBG A;  1D6Z A;  4H3U A;  1RN7 A;  5CK6 A;  2IA7 A;  3MG3 A;  1EA2 A;  1JN5 B;  2CH9 A;  2CWU A;  3KII A;  2GU1 A;  3CCJ 3;  1UI8 A;  4BTY A;  2XH9 A;  4MEI A;  1PU4 A;  1DMN A;  5AIG A;  2XSO B;  4R9L A;  1IQY A;  3CCV 3;  3LXU X;  1YIT 3;  3G4S 3;  2OOV C;  1Q81 4;  1LOX A;  4CDL A;  4BTW A;  3CPW 2;  2ML6 A;  5IG3 A;  3T0U A;  1N8R 4;  3I0Y A;  5CXO A;  3G8Z A;  3JUQ A;  1M90 4;  4N6O B;  3CNX A;  3EB8 A;  2YFI B;  4XBY A;  5AYS C;  3FH1 A;  3BLZ A;  1W01 A;  1D6Y A;  1N9J A;  4WWU C;  3CC2 3;  3LH4 A;  4FMD A;  2GU3 A;  1N9E A;  4R4K A;  1M1X B;  1QMA A;  3FZW A;  3WDG B;  3FG4 A;  3MWZ A;  1IV7 A;  1ULJ B;  2W6J H;  2BO9 B;  4HKV B;  4AKY A;  1Q40 B;  4LGQ A;  1O7N B;  2YFJ B;  3N9H A;  4K61 A;  4X2H A;  5AEU B;  1WMO A;  2BT3 A;  3O8Y A;  4XM4 A;  1A90 A;  2B1X B;  4ZM8 A;  2CW9 A;  2YFL B;  3MG1 A;  2HMO B;  2FXT A;  4WYK B;  1W2B 2;  2P09 A;  3CCU 3;  3VGN A;  2O3O A;  2CFW A;  2UX0 A;  1MNL A;  2RGQ A;  3DY5 A;  1SII A;  2WO0 A;  3K63 A;  3DGL A;  2SBL A;  2RSX A;  3HX8 A;  1AVL A;  3BNE A;  3MPH A;  1OAC A;  2CG1 A;  1QAL A;  5IEN A;  1CYV A;  3SXX A;  1YJN 3;  5CLK A;  2A15 A;  2F98 A;  2O9U X;  3OX9 A;  1UUV B;  3NBB A;  1BUQ A;  1W00 A;  4N6M A;  1E3V A;  3MHE A;  1IVV A;  5DRE A;  3X3Z A;  3CU3 A;  2WOH A;  3FF0 A;  3S5C A;  1JJ2 2;  3S29 A;  1ISK A;  1IT8 A;  3G16 A;  1N5H A;  1NJI 4;  2OTJ 3;  2PNC A;  3B8L A;  2JQ5 A;  4J9A A;  3CXC 2;  3EQQ B;  1U5O A;  2QIY A;  2P05 A;  3ROB A;  2OTL 3;  3S28 A;  3F8H A;  1FGR A;  3E99 A;  5HGR A;  2GEY A;  3DXO A;  1WTH A;  1YIJ 3;  3FGY A;  3WA2 X;  3PGB A;  1IVU A;  1E3R A;  2FNQ A;  3NBR A;  3N8B A;  1CQS A;  1VQ4 3;  1W2Z A;  1CYU A;  3PS8 A;  3UB1 A;  4N6U A;  1E97 A;  5ELU A;  5JBS A;  1TIJ A;  1U8C B;  3SED A;  2WGO A;  1EQK A;  4KVH A;  3FKA A;  2MC8 A;  1QVG 2;  1Z1S A;  1QAK A;  2P0X A;  3LT8 A;  4XBT A;  1GS3 A;  4HM5 B;  3EX9 A;  2IUJ A;  1DYU A;  3PCS A;  3GZB A;  2E2T A;  3KE7 A;  1W6Y A;  1VZZ A;  3FSD A;  3EBY A;  3FG1 A;  4XDW A;  1W4N A;  3CCM 3;  1GD4 A;  3OWU A;  4HVN A;  1OHP A;  2Q07 A;  1UI7 A;  3OXA A;  3PZW A;  4HM0 B;  5IW9 A;  3HII A;  3A76 A;  1DVD A;  4CCV A;  3EN8 A;  3X3Y A;  2HMN B;  3LYG A;  1O7W B;  1VQL 3;  1LXE A;  1IK3 A;  3VF1 A;  3S67 A;  5JPP A;  1SJW A;  3EN1 B;  3H51 A;  4FMB A;  1VQN 3;  2W9P A;  2B24 B;  1Q40 A;  3EC9 A;  4KFE A;  5BVB A;  2Z6B A;  3CCR 3;  2M7O A;  3X41 A;  1NDO B;  1W6G A;  3D3L A;  1OHS A;  4EV5 A;  3GZX B;  4R80 A;  4U13 A;  3CD6 3;  1RRH A;  2K54 A;  3F8X A;  3EHC A;  1S72 3;  1JB4 A;  2WOF A;  2GBX B;  4WYK A;  1IQX A;  3F9S A;  4NRE A;  3X40 A;  1W5Z A;  3K5T A;  4KFD A;  1RKY A;  7STD A;  3RGR A;  1IU7 A;  3EE1 A;  4STD A;  4PEJ A;  4HM8 B;  4JF8 A;  1LNH A;  4MMY B;  1F8N A;  3TDG A;  3AMO A;  4O2H A;  5D82 A;  3KKG A;  2W03 A;  3Q90 A;  3UJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...