2GC5A

G51s mutant of l. casei fpgs
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
425
structure length
407
Chain Sequence
MNYTETVAYIHSFPRLAKDHRRILTLLHALGNPQQQGRYIHVTGTNGKSSAANAIAHVLEASGLTVGLYTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLQQQQADFNVTEFEFITALGYWYFRQRQVDVAVIEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKHAGIIKRGIPVVTGNLVPDAAAVVAAKVATTGSQWLRFDRDFSVPKAKLHGWGQRFTYEDQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGIYAAMADRLTAAFSTVYLVPVPGTPRALPRLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation of Gly51 to serine in the P-loop of Lactobacillus casei folylpolyglutamate synthetase abolishes activity by altering the conformation of two adjacent loops.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Ligase
molecule keywords Folylpolyglutamate synthase
total genus 128
structure length 407
sequence length 425
ec nomenclature ec 6.3.2.17: Tetrahydrofolate synthase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02875 Mur_ligase_C Mur ligase family, glutamate ligase domain
A PF08245 Mur_ligase_M Mur ligase middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.10 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase Mur-like, catalytic domain 2gc5A01
3.90.190.20 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Mur ligase, C-terminal domain 2gc5A02
4ZIYA 1E0DA 2X5OA 3QCZA 2GC5A 1GG4A 1UAGA 2XPCA 3ZM6A 3ZM5A 4C12A 5A5EA 2JFFA 2GC6A 1EEHA 1J6UA 1GQQA 2UAGA 3MVNA 2WJPA 1GQYA 2WTZA 4BUBA 5A5FA 2UUPA 3EAGA 1W78A 2Y68A 4CVKA 2JFHA 2UUOA 4C13A 2F00A 2VOSA 2JFGA 2GCAA 1P3DA 4QF5A 2Y1OA 3PYZA 1W7KA 2GCBA 4UAGA 3N2AA 3UAGA 1FGSA 2VTEA 3LK7A 2Y66A 2VORA 2Y67A 3ZL8A 4HV4A 1JBVA 4CVMA 2XJAA 4QDIA 2VTDA 3NRSA 4CVLA 1P31A 1E8CA 1JBWA 3HN7A 1O5ZA 2AM1A 2AM2A 4BUCA
chains in the Genus database with same CATH superfamily
2BZLA 1GQTA 3NM3A 3HJ6A 1J4XA 4C5LA 4PVVA 5KA9A 2PKMA 5GTJA 5IBMA 5KA1A 1C83A 2J16A 4C5JA 3QKQA 2VEYA 3N0AA 1XM2A 2F6FA 2CNGA 2I4HA 3V0FA 1YTWA 2H4GA 4E3AA 4QDIA 3RTEA 3B1PA 3RU3A 5AWXA 1PTUA 1RKSA 2JGVA 3NL6A 2QCJA 2HQQA 2DDWA 4C5MA 2QHPA 5MMZB 3V0EA 3RPZA 5EHPA 3F99A 3RQQA 3H2XA 1ECVA 5BZZA 2AJRA 2WJPA 2I6MA 2DDMA 4EN4A 1W78A 4DC3A 4ZI4A 5B6AA 2I4EA 4H34A 3V0JA 4GRZA 4K8CA 5TRWA 1WYEA 3KD6A 1ZZWA 4JJPA 1QZ0A 4QF5A 1XBOA 3H49A 3NBWA 3O4TA 2ZMMA 2YXUA 2HNPA 2VEVA 2QCTA 3BLUA 2VTDA 3RGQA 3CQDA 3NL5A 2I4GA 3BF5A 4C12A 4DGXA 2BGEA 3B1RA 2QDCA 3MVNA 4JKSA 2AFBA 2WTZA 5C40A 1Q6TA 3RREA 3RRJA 2I5BA 4HJPA 2FJNA 1G4US 2HY3A 4GE5A 3UQ9A 2PBNA 5IBSA 1BX4A 1JXHA 2GCAA 4E8YA 3ZM3A 3ZM1A 2F6TA 2HC2A 4RI5A 3QCBA 2Y66A 2B07A 2A9YA 1ESJA 1Q6PA 2GWOA 1P31A 3VAQA 2RBCA 3ZV2A 3S3HA 4U7XA 3Q1YA 1V1AA 2AX3A 3NL3A 3MBJA 3UQDA 1OEVA 3ZMQA 1VHRA 2V78A 5KACA 1RFVA 1YGJA 4RI4A 3RTCA 1ONZA 1BZCA 2F02A 2R3BA 1C87A 1Q6NA 3NL2A 1OHEA 3RO1A 3GXGA 5BYDA 3ZMPA 2JFGA 4S0GA 1LHPA 2DCNA 5BX1A 3NM1A 3RQ6A 4E84A 4OHLA 3S3FA 2PI7A 2Y67A 2PKFA 4K9IA 1LQFA 4GE2A 1U25A 4S1HA 3B3LA 3RSQA 3W4SA 4KANA 2CJZA 2I3UA 3QCMA 3KZHA 3MBHA 3RTDA 3NC9A 2QCVA 3ZM5A 2F46A 4YL5A 2I42A 3V0IA 2AA0A 2GC6A 4HRFA 1GQYA 2F71A 1YHJA 2CM3A 5KA2A 2UUPA 3EAGA 3RT7A 3B1OA 3NCAA 4KBEA 1G4WR 2CNEA 2JFHA 2J16B 2NZ6A 3QCJA 4GRYA 2NT2A 4S1MA 1NZ7A 4GWFA 1P3DA 2CNHA 3OMHA 3A5KA 1OETA 2F6YA 4J51A 4E69A 2R3EA 4HV4A 3NC2A 4WOHA 2SHPA 1JBVA 2DDOA 1QXKA 4GE6A 2XJAA 5EYNA 3NBVA 1P15A 1O5ZA 4BUCA 4QBWA 2QBRA 1V3AA 3QCKA 2GC5A 1GG4A 1FPRA 2B3OA 1OEMX 3V0HA 3RQHA 2Q5RA 2OOQA 4LC4A 1WAXA 4YAAA 5BUGA 1LIJA 2GP0A 2CMBA 2UUOA 1YGUA 3MOZA 1Q6SA 2B49A 2P6XA 4RDDA 1ZC0A 2NTAA 3JULA 3UAGA 5F11A 1DGMA 5KA4A 2B4OA 3QCFA 1ONYA 3V0GA 4WTYA 2HW1A 3O5XA 4RKKA 1LIIA 4TVVA 1G1FA 1RKDA 1ZCLA 4O1LA 1MKPA 1PYNA 1LARA 2QEPA 4R0TA 4UBEA 2CMAA 3IQ0A 2I6BA 4ERCA 1I9TA 5KAAA 3F9AA 3V0DA 3B1NA 1C84A 2BGDA 2PQ5A 4WU3A 4ZN5A 3D1QA 2G59A 5J8RA 1EKKA 3I80A 1RPMA 2I6IA 3GO7A 2I6JA 2QBPA 3F81A 2VTEA 2H4VA 4RH9A 4O1GA 1NO6A 3RTAA 2E0TA 3SMEA 4B8SA 1YPTA 3U96A 1I9SA 2A9ZA 4ZIYA 3RSSA 1U26A 2CMCA 2F7KA 2X5OA 2A3KA 1YTSA 4PYHA 1ESQA 1G1HA 3SR9A 4XF7A 4B04A 1VM7A 2FJMA 2F6WA 2VEUA 3EB1A 4KAHA 1GWZA 5KABA 3RTGA 4E8WA 5C3YA 1VK4A 3BLTA 1L8GA 2CFVA 2OUDA 2H02A 1EKQA 4I8NA 3LJSA 2PKNA 4NWFA 1FPZA 3DZVA 3B7OA 1UA4A 2ESBA 4C5NA 3FHXA 3S3KA 2H04A 2JG5A 3QCGA 3RZ2A 4S1IB 1T4JA 2NLKA 2F6VA 2AHSA 2I6OA 5BYCA 3AWGA 1C86A 4JNBA 5K9VA 5K24A 4K8PA 5CM5A 2B4PA 3ZM2A 4BUBA 1C3QA 3BM8A 5LXQB 1AAXA 1R6HA 2QDMA 2VOSA 1NNYA 3UMPA 2BV5A 2JJDA 4N09A 4S1IA 3KTNA 3RM5A 4UAGA 3N2AA 1M3GA 3QCNA 1X24A 1V1SA 4DU5A 1PA9A 3UBOA 1YN9A 3O4UA 2C7SA 4LBGA 3HICA 2VEXA 3RU2A 4AZ1A 5K23A 3D42A 3EZZA 3IKHA 4C5KA 4QAHA 1PA1A 3RO4A 3BGKA 3S3EA 4K8KA 1YTNA 4QAPA 2ZN7A 4PVGA 3AWEA 4D3QA 3D44A 2F00A 1OEUA 2JG1A 3D1OA 4Y2EA 3GBUA 3UQ6A 3PL2A 3DRWA 4JMJA 3ZL8A 1PXHA 5KA0A 3PZSA 3I36A 3A5JA 3KEUA 2CNFA 2F6ZA 4CVLA 1WCHA 2I5XA 1NWEA 1PTTA 4LBXA 4K9CA 3MMJA 2CM7A 2AM2A 2AWDA 4YR8B 1L8KA 4NWGA 1YGRA 2NT7A 2XTBA 3HYOA 2Y2FA 1TYYA 3AWFA 5M43A 3N1CA 1G7GA 3CWEA 2VEWA 2C46A 4QUMA 1KAKA 4BJOA 2Y68A 4CVKA 5K9WA 2DXPA 2FV7A 2Q05A 1RFTA 4RHGA 1LIOA 5EHRA 3PYZA 3F9BA 1JLNA 3FHYA 1T49A 3QCCA 3B1QA 4N08A 1V1BA 2I3RA 4X8FA 2BIJA 3RSGA 1XXVA 3RT9A 1I57A 4JKUA 1GC5A 3H74A 4DGPA 2HB1A 4KALA 4EUMA 3ZM6A 4GM6A 2PA5A 2C49A 1FQ1A 2JFFA 4E8ZA 4H1OA 4JMKA 1TD2A 1U24A 3IH0A 3F41A 4K93A 2I6AA 3UQEA 1KYHA 3OTXA 5F0ZA 2R0BA 3RS8A 1RK2A 4OHDA 3CM3A 3LKIA 4RH5A 4Z6BA 4XF6A 2CM8A 2Y96A 3RSFA 1TZ3A 2ABQA 2P4DA 3OLRA 2B4SA 3S4EA 4XCKA 1YFOA 2RF6A 2AJPA 1XXPA 2C4EA 4WU2A 3GO6A 2M3VA 2QBSA 5CGAA 3UMOA 3PS5A 1E0DA 5COJA 3ZS7A 2XPCA 3IN1A 4KI9A 3RY7A 3RQXA 2HCMA 1V19A 5C3ZA 2I6PA 4KYRA 2AB8A 5KA7A 3O3LA 1LYVA 4WJMA 3ZM0A 2HNQA 4EOHA 2I1YA 2FH7A 3I3YA 2HC1A 1Q1MA 1G1GA 4NX8A 3Q92A 3LK7A 3RQ2A 5K25A 4JBCA 4CVMA 5K22A 3GXHA 2HXPA 1E8CA 1ZCKA 4Y14A 1PTVA 2GJTA 4D3RA 5HDEA 3NMEA 2IMGA 1XRIA 1EEHA 4OHEA 2VARA 5EY7A 4QUNA 3QCLA 5TQIA 1BZHA 1PH0A 1YGKA 3QAIA 3S4OA 3D9CA 2WGPA 2Y1OA 1EEOA 2NV5A 2GCBA 1C88A 2J17A 1WRMA 1FGSA 4B8RA 2PKKA 1OEOX 3EAXA 3I7ZA 4D3PA 1A5YA 2Q47A 5I6VA 3HPDA 2PSZA 1JXIA 4R30A 4YWRA 2ABSA 1PTYA 2AZRA 2QBQA 3HN7A 2F70A 2AM1A 5BYEA 5CGEA 1L2LA 3K5WA 1KAVA 3M4UA 4QBEA 3IBQA 1RKAA 1Q6MA 2QDPA 5A5EA 1OESA 1J6UA 1GQQA 3RPHA 1NL9A 1VI9A 2CM2A 3O4SA 2H4KA 4KYQA 1YWFA 3RTBA 3VASA 1UB0A 3RRBA 3LOOA 4ICZA 4MBBA 5C41A 5KADA 3LJ8A 1D5RA 4K8TA 4EBUA 1W7KA 2HVLA 2PT0A 2YDUA 1JF7A 5BYFA 1U2XA 4IKCA 4OHIA 3RS9A 1Q6JA 1GFYA 1OHDA 1RXDA 2HLZA 4ZRTA 1G7FA 1JBWA 2YXTA 3K9EA 2G6ZA 4GS0A 5BZXA 1LIKA 1BZJA 1TZ6A 3QCZA 1UAGA 4GFUA 3QKPA 1T48A 4R0SA 2I75A 1NWLA 3QCIA 5KA3A 2UAGA 2A8BA 1OHCA 3D1HA 3EWMA 3EU0A 3EMUA 2CNIA 2NWHA 3RRFA 3RQ5A 4C13A 3MOWA 2MBCA 1RFUA 3BRHA 1YZ4A 3QCEA 3RQ8A 4OHHA 1SUGA 3LHXA 1C85A 4NYHA 3QCHA 2OZ5A 1EENA 2H03A 5KA8A 1LHRA 4BPCA 2VORA 4XDAA 4KADA 3QCDA 4LCAA 3RGOA 3NRSA 4NNDA 2OC3A 3QA2A 2B4UA 4GFVA 4HJQA 5A5FA 3IE7A
chains in the Genus database with same CATH topology
4ZIYA 1E0DA 2X5OA 3QCZA 2GC5A 1GG4A 1UAGA 2XPCA 3ZM6A 3ZM5A 4C12A 5A5EA 2JFFA 2GC6A 1EEHA 1J6UA 1GQQA 2UAGA 3MVNA 2WJPA 1GQYA 2WTZA 4BUBA 5A5FA 2UUPA 3EAGA 1W78A 2Y68A 4CVKA 2JFHA 2UUOA 4C13A 2F00A 2VOSA 2JFGA 2GCAA 1P3DA 4QF5A 2Y1OA 3PYZA 1W7KA 2GCBA 4UAGA 3N2AA 3UAGA 1FGSA 2VTEA 3LK7A 2Y66A 2VORA 2Y67A 3ZL8A 4HV4A 1JBVA 4CVMA 2XJAA 4QDIA 2VTDA 3NRSA 4CVLA 1P31A 1E8CA 1JBWA 3HN7A 1O5ZA 2AM1A 2AM2A 4BUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZIY A;  1E0D A;  2X5O A;  3QCZ A;  2GC5 A;  1GG4 A;  1UAG A;  2XPC A;  3ZM6 A;  3ZM5 A;  4C12 A;  5A5E A;  2JFF A;  2GC6 A;  1EEH A;  1J6U A;  1GQQ A;  2UAG A;  3MVN A;  2WJP A;  1GQY A;  2WTZ A;  4BUB A;  5A5F A;  2UUP A;  3EAG A;  1W78 A;  2Y68 A;  4CVK A;  2JFH A;  2UUO A;  4C13 A;  2F00 A;  2VOS A;  2JFG A;  2GCA A;  1P3D A;  4QF5 A;  2Y1O A;  3PYZ A;  1W7K A;  2GCB A;  4UAG A;  3N2A A;  3UAG A;  1FGS A;  2VTE A;  3LK7 A;  2Y66 A;  2VOR A;  2Y67 A;  3ZL8 A;  4HV4 A;  1JBV A;  4CVM A;  2XJA A;  4QDI A;  2VTD A;  3NRS A;  4CVL A;  1P31 A;  1E8C A;  1JBW A;  3HN7 A;  1O5Z A;  2AM1 A;  2AM2 A;  4BUC A; 
#chains in the Genus database with same CATH topology
 2BZL A;  1GQT A;  3NM3 A;  3HJ6 A;  1J4X A;  4C5L A;  4PVV A;  5KA9 A;  2PKM A;  5GTJ A;  5IBM A;  5KA1 A;  1C83 A;  2J16 A;  4C5J A;  3QKQ A;  2VEY A;  3N0A A;  1XM2 A;  2F6F A;  2CNG A;  2I4H A;  3V0F A;  1YTW A;  2H4G A;  4E3A A;  4QDI A;  3RTE A;  3B1P A;  3RU3 A;  5AWX A;  1PTU A;  1RKS A;  2JGV A;  3NL6 A;  2QCJ A;  2HQQ A;  2DDW A;  4C5M A;  2QHP A;  5MMZ B;  3V0E A;  3RPZ A;  5EHP A;  3F99 A;  3RQQ A;  3H2X A;  1ECV A;  5BZZ A;  2AJR A;  2WJP A;  2I6M A;  2DDM A;  4EN4 A;  1W78 A;  4DC3 A;  4ZI4 A;  5B6A A;  2I4E A;  4H34 A;  3V0J A;  4GRZ A;  4K8C A;  5TRW A;  1WYE A;  3KD6 A;  1ZZW A;  4JJP A;  1QZ0 A;  4QF5 A;  1XBO A;  3H49 A;  3NBW A;  3O4T A;  2ZMM A;  2YXU A;  2HNP A;  2VEV A;  2QCT A;  3BLU A;  2VTD A;  3RGQ A;  3CQD A;  3NL5 A;  2I4G A;  3BF5 A;  4C12 A;  4DGX A;  2BGE A;  3B1R A;  2QDC A;  3MVN A;  4JKS A;  2AFB A;  2WTZ A;  5C40 A;  1Q6T A;  3RRE A;  3RRJ A;  2I5B A;  4HJP A;  2FJN A;  1G4U S;  2HY3 A;  4GE5 A;  3UQ9 A;  2PBN A;  5IBS A;  1BX4 A;  1JXH A;  2GCA A;  4E8Y A;  3ZM3 A;  3ZM1 A;  2F6T A;  2HC2 A;  4RI5 A;  3QCB A;  2Y66 A;  2B07 A;  2A9Y A;  1ESJ A;  1Q6P A;  2GWO A;  1P31 A;  3VAQ A;  2RBC A;  3ZV2 A;  3S3H A;  4U7X A;  3Q1Y A;  1V1A A;  2AX3 A;  3NL3 A;  3MBJ A;  3UQD A;  1OEV A;  3ZMQ A;  1VHR A;  2V78 A;  5KAC A;  1RFV A;  1YGJ A;  4RI4 A;  3RTC A;  1ONZ A;  1BZC A;  2F02 A;  2R3B A;  1C87 A;  1Q6N A;  3NL2 A;  1OHE A;  3RO1 A;  3GXG A;  5BYD A;  3ZMP A;  2JFG A;  4S0G A;  1LHP A;  2DCN A;  5BX1 A;  3NM1 A;  3RQ6 A;  4E84 A;  4OHL A;  3S3F A;  2PI7 A;  2Y67 A;  2PKF A;  4K9I A;  1LQF A;  4GE2 A;  1U25 A;  4S1H A;  3B3L A;  3RSQ A;  3W4S A;  4KAN A;  2CJZ A;  2I3U A;  3QCM A;  3KZH A;  3MBH A;  3RTD A;  3NC9 A;  2QCV A;  3ZM5 A;  2F46 A;  4YL5 A;  2I42 A;  3V0I A;  2AA0 A;  2GC6 A;  4HRF A;  1GQY A;  2F71 A;  1YHJ A;  2CM3 A;  5KA2 A;  2UUP A;  3EAG A;  3RT7 A;  3B1O A;  3NCA A;  4KBE A;  1G4W R;  2CNE A;  2JFH A;  2J16 B;  2NZ6 A;  3QCJ A;  4GRY A;  2NT2 A;  4S1M A;  1NZ7 A;  4GWF A;  1P3D A;  2CNH A;  3OMH A;  3A5K A;  1OET A;  2F6Y A;  4J51 A;  4E69 A;  2R3E A;  4HV4 A;  3NC2 A;  4WOH A;  2SHP A;  1JBV A;  2DDO A;  1QXK A;  4GE6 A;  2XJA A;  5EYN A;  3NBV A;  1P15 A;  1O5Z A;  4BUC A;  4QBW A;  2QBR A;  1V3A A;  3QCK A;  2GC5 A;  1GG4 A;  1FPR A;  2B3O A;  1OEM X;  3V0H A;  3RQH A;  2Q5R A;  2OOQ A;  4LC4 A;  1WAX A;  4YAA A;  5BUG A;  1LIJ A;  2GP0 A;  2CMB A;  2UUO A;  1YGU A;  3MOZ A;  1Q6S A;  2B49 A;  2P6X A;  4RDD A;  1ZC0 A;  2NTA A;  3JUL A;  3UAG A;  5F11 A;  1DGM A;  5KA4 A;  2B4O A;  3QCF A;  1ONY A;  3V0G A;  4WTY A;  2HW1 A;  3O5X A;  4RKK A;  1LII A;  4TVV A;  1G1F A;  1RKD A;  1ZCL A;  4O1L A;  1MKP A;  1PYN A;  1LAR A;  2QEP A;  4R0T A;  4UBE A;  2CMA A;  3IQ0 A;  2I6B A;  4ERC A;  1I9T A;  5KAA A;  3F9A A;  3V0D A;  3B1N A;  1C84 A;  2BGD A;  2PQ5 A;  4WU3 A;  4ZN5 A;  3D1Q A;  2G59 A;  5J8R A;  1EKK A;  3I80 A;  1RPM A;  2I6I A;  3GO7 A;  2I6J A;  2QBP A;  3F81 A;  2VTE A;  2H4V A;  4RH9 A;  4O1G A;  1NO6 A;  3RTA A;  2E0T A;  3SME A;  4B8S A;  1YPT A;  3U96 A;  1I9S A;  2A9Z A;  4ZIY A;  3RSS A;  1U26 A;  2CMC A;  2F7K A;  2X5O A;  2A3K A;  1YTS A;  4PYH A;  1ESQ A;  1G1H A;  3SR9 A;  4XF7 A;  4B04 A;  1VM7 A;  2FJM A;  2F6W A;  2VEU A;  3EB1 A;  4KAH A;  1GWZ A;  5KAB A;  3RTG A;  4E8W A;  5C3Y A;  1VK4 A;  3BLT A;  1L8G A;  2CFV A;  2OUD A;  2H02 A;  1EKQ A;  4I8N A;  3LJS A;  2PKN A;  4NWF A;  1FPZ A;  3DZV A;  3B7O A;  1UA4 A;  2ESB A;  4C5N A;  3FHX A;  3S3K A;  2H04 A;  2JG5 A;  3QCG A;  3RZ2 A;  4S1I B;  1T4J A;  2NLK A;  2F6V A;  2AHS A;  2I6O A;  5BYC A;  3AWG A;  1C86 A;  4JNB A;  5K9V A;  5K24 A;  4K8P A;  5CM5 A;  2B4P A;  3ZM2 A;  4BUB A;  1C3Q A;  3BM8 A;  5LXQ B;  1AAX A;  1R6H A;  2QDM A;  2VOS A;  1NNY A;  3UMP A;  2BV5 A;  2JJD A;  4N09 A;  4S1I A;  3KTN A;  3RM5 A;  4UAG A;  3N2A A;  1M3G A;  3QCN A;  1X24 A;  1V1S A;  4DU5 A;  1PA9 A;  3UBO A;  1YN9 A;  3O4U A;  2C7S A;  4LBG A;  3HIC A;  2VEX A;  3RU2 A;  4AZ1 A;  5K23 A;  3D42 A;  3EZZ A;  3IKH A;  4C5K A;  4QAH A;  1PA1 A;  3RO4 A;  3BGK A;  3S3E A;  4K8K A;  1YTN A;  4QAP A;  2ZN7 A;  4PVG A;  3AWE A;  4D3Q A;  3D44 A;  2F00 A;  1OEU A;  2JG1 A;  3D1O A;  4Y2E A;  3GBU A;  3UQ6 A;  3PL2 A;  3DRW A;  4JMJ A;  3ZL8 A;  1PXH A;  5KA0 A;  3PZS A;  3I36 A;  3A5J A;  3KEU A;  2CNF A;  2F6Z A;  4CVL A;  1WCH A;  2I5X A;  1NWE A;  1PTT A;  4LBX A;  4K9C A;  3MMJ A;  2CM7 A;  2AM2 A;  2AWD A;  4YR8 B;  1L8K A;  4NWG A;  1YGR A;  2NT7 A;  2XTB A;  3HYO A;  2Y2F A;  1TYY A;  3AWF A;  5M43 A;  3N1C A;  1G7G A;  3CWE A;  2VEW A;  2C46 A;  4QUM A;  1KAK A;  4BJO A;  2Y68 A;  4CVK A;  5K9W A;  2DXP A;  2FV7 A;  2Q05 A;  1RFT A;  4RHG A;  1LIO A;  5EHR A;  3PYZ A;  3F9B A;  1JLN A;  3FHY A;  1T49 A;  3QCC A;  3B1Q A;  4N08 A;  1V1B A;  2I3R A;  4X8F A;  2BIJ A;  3RSG A;  1XXV A;  3RT9 A;  1I57 A;  4JKU A;  1GC5 A;  3H74 A;  4DGP A;  2HB1 A;  4KAL A;  4EUM A;  3ZM6 A;  4GM6 A;  2PA5 A;  2C49 A;  1FQ1 A;  2JFF A;  4E8Z A;  4H1O A;  4JMK A;  1TD2 A;  1U24 A;  3IH0 A;  3F41 A;  4K93 A;  2I6A A;  3UQE A;  1KYH A;  3OTX A;  5F0Z A;  2R0B A;  3RS8 A;  1RK2 A;  4OHD A;  3CM3 A;  3LKI A;  4RH5 A;  4Z6B A;  4XF6 A;  2CM8 A;  2Y96 A;  3RSF A;  1TZ3 A;  2ABQ A;  2P4D A;  3OLR A;  2B4S A;  3S4E A;  4XCK A;  1YFO A;  2RF6 A;  2AJP A;  1XXP A;  2C4E A;  4WU2 A;  3GO6 A;  2M3V A;  2QBS A;  5CGA A;  3UMO A;  3PS5 A;  1E0D A;  5COJ A;  3ZS7 A;  2XPC A;  3IN1 A;  4KI9 A;  3RY7 A;  3RQX A;  2HCM A;  1V19 A;  5C3Z A;  2I6P A;  4KYR A;  2AB8 A;  5KA7 A;  3O3L A;  1LYV A;  4WJM A;  3ZM0 A;  2HNQ A;  4EOH A;  2I1Y A;  2FH7 A;  3I3Y A;  2HC1 A;  1Q1M A;  1G1G A;  4NX8 A;  3Q92 A;  3LK7 A;  3RQ2 A;  5K25 A;  4JBC A;  4CVM A;  5K22 A;  3GXH A;  2HXP A;  1E8C A;  1ZCK A;  4Y14 A;  1PTV A;  2GJT A;  4D3R A;  5HDE A;  3NME A;  2IMG A;  1XRI A;  1EEH A;  4OHE A;  2VAR A;  5EY7 A;  4QUN A;  3QCL A;  5TQI A;  1BZH A;  1PH0 A;  1YGK A;  3QAI A;  3S4O A;  3D9C A;  2WGP A;  2Y1O A;  1EEO A;  2NV5 A;  2GCB A;  1C88 A;  2J17 A;  1WRM A;  1FGS A;  4B8R A;  2PKK A;  1OEO X;  3EAX A;  3I7Z A;  4D3P A;  1A5Y A;  2Q47 A;  5I6V A;  3HPD A;  2PSZ A;  1JXI A;  4R30 A;  4YWR A;  2ABS A;  1PTY A;  2AZR A;  2QBQ A;  3HN7 A;  2F70 A;  2AM1 A;  5BYE A;  5CGE A;  1L2L A;  3K5W A;  1KAV A;  3M4U A;  4QBE A;  3IBQ A;  1RKA A;  1Q6M A;  2QDP A;  5A5E A;  1OES A;  1J6U A;  1GQQ A;  3RPH A;  1NL9 A;  1VI9 A;  2CM2 A;  3O4S A;  2H4K A;  4KYQ A;  1YWF A;  3RTB A;  3VAS A;  1UB0 A;  3RRB A;  3LOO A;  4ICZ A;  4MBB A;  5C41 A;  5KAD A;  3LJ8 A;  1D5R A;  4K8T A;  4EBU A;  1W7K A;  2HVL A;  2PT0 A;  2YDU A;  1JF7 A;  5BYF A;  1U2X A;  4IKC A;  4OHI A;  3RS9 A;  1Q6J A;  1GFY A;  1OHD A;  1RXD A;  2HLZ A;  4ZRT A;  1G7F A;  1JBW A;  2YXT A;  3K9E A;  2G6Z A;  4GS0 A;  5BZX A;  1LIK A;  1BZJ A;  1TZ6 A;  3QCZ A;  1UAG A;  4GFU A;  3QKP A;  1T48 A;  4R0S A;  2I75 A;  1NWL A;  3QCI A;  5KA3 A;  2UAG A;  2A8B A;  1OHC A;  3D1H A;  3EWM A;  3EU0 A;  3EMU A;  2CNI A;  2NWH A;  3RRF A;  3RQ5 A;  4C13 A;  3MOW A;  2MBC A;  1RFU A;  3BRH A;  1YZ4 A;  3QCE A;  3RQ8 A;  4OHH A;  1SUG A;  3LHX A;  1C85 A;  4NYH A;  3QCH A;  2OZ5 A;  1EEN A;  2H03 A;  5KA8 A;  1LHR A;  4BPC A;  2VOR A;  4XDA A;  4KAD A;  3QCD A;  4LCA A;  3RGO A;  3NRS A;  4NND A;  2OC3 A;  3QA2 A;  2B4U A;  4GFV A;  4HJQ A;  5A5F A;  3IE7 A; 
#chains in the Genus database with same CATH homology
 4ZIY A;  1E0D A;  2X5O A;  3QCZ A;  2GC5 A;  1GG4 A;  1UAG A;  2XPC A;  3ZM6 A;  3ZM5 A;  4C12 A;  5A5E A;  2JFF A;  2GC6 A;  1EEH A;  1J6U A;  1GQQ A;  2UAG A;  3MVN A;  2WJP A;  1GQY A;  2WTZ A;  4BUB A;  5A5F A;  2UUP A;  3EAG A;  1W78 A;  2Y68 A;  4CVK A;  2JFH A;  2UUO A;  4C13 A;  2F00 A;  2VOS A;  2JFG A;  2GCA A;  1P3D A;  4QF5 A;  2Y1O A;  3PYZ A;  1W7K A;  2GCB A;  4UAG A;  3N2A A;  3UAG A;  1FGS A;  2VTE A;  3LK7 A;  2Y66 A;  2VOR A;  2Y67 A;  3ZL8 A;  4HV4 A;  1JBV A;  4CVM A;  2XJA A;  4QDI A;  2VTD A;  3NRS A;  4CVL A;  1P31 A;  1E8C A;  1JBW A;  3HN7 A;  1O5Z A;  2AM1 A;  2AM2 A;  4BUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...