2GC5A

G51s mutant of l. casei fpgs
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
425
structure length
407
Chain Sequence
MNYTETVAYIHSFPRLAKDHRRILTLLHALGNPQQQGRYIHVTGTNGKSSAANAIAHVLEASGLTVGLYTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLQQQQADFNVTEFEFITALGYWYFRQRQVDVAVIEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKHAGIIKRGIPVVTGNLVPDAAAVVAAKVATTGSQWLRFDRDFSVPKAKLHGWGQRFTYEDQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGIYAAMADRLTAAFSTVYLVPVPGTPRALPRLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation of Gly51 to serine in the P-loop of Lactobacillus casei folylpolyglutamate synthetase abolishes activity by altering the conformation of two adjacent loops.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Ligase
molecule keywords Folylpolyglutamate synthase
total genus 128
structure length 407
sequence length 425
ec nomenclature ec 6.3.2.17: Tetrahydrofolate synthase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02875 Mur_ligase_C Mur ligase family, glutamate ligase domain
A PF08245 Mur_ligase_M Mur ligase middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.10 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase Mur-like, catalytic domain 2gc5A01
3.90.190.20 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Mur ligase, C-terminal domain 2gc5A02
2WJPA 3ZM6A 4C12A 2GCAA 1O5ZA 3UAGA 2JFGA 4UAGA 3ZM5A 2Y67A 2GC5A 2Y66A 2VTEA 1P3DA 2JFHA 1P31A 1GQYA 2F00A 2VORA 4CVMA 2AM1A 3QCZA 2XJAA 5A5FA 2UAGA 4BUCA 4C13A 4HV4A 1W7KA 2GC6A 3LK7A 4QDIA 1JBWA 1FGSA 1J6UA 2JFFA 2UUOA 2WTZA 4ZIYA 3MVNA 3NRSA 1GQQA 2Y1OA 1JBVA 3HN7A 4BUBA 1E8CA 4CVLA 2UUPA 3ZL8A 5A5EA 2VTDA 2Y68A 3EAGA 2VOSA 1EEHA 2AM2A 2GCBA 4QF5A 1E0DA 3N2AA 2XPCA 3PYZA 1W78A 4CVKA 2X5OA 1UAGA 1GG4A
chains in the Genus database with same CATH superfamily
4PVVA 1U26A 5CGAA 2GCAA 1L8GA 3V0FA 5KA9A 4RHGA 3ZV2A 2B49A 1YHJA 2I5BA 1OHEA 1RFUA 3EB1A 4O1GA 1Q6TA 2JGVA 4JMKA 3U96A 1LIOA 1GWZA 3QCJA 2Q05A 2I6OA 2QDMA 1ZC0A 1W7KA 1BZJA 2B4SA 4GFVA 1U25A 4R30A 2Q5RA 2DDWA 1WRMA 1RKDA 4IKCA 3RO4A 4QUNA 2CNFA 1OEUA 1ZCLA 3H2XA 3IH0A 2I6AA 1G4WR 2FV7A 3CQDA 4U7XA 2VEUA 1DGMA 4S1IB 2YDUA 3D1HA 3Q92A 2HNPA 3RQ5A 1ZCKA 2DCNA 2CFVA 2CM7A 3F99A 2VTEA 3CM3A 5BYEA 2CJZA 2NV5A 2MBCA 2ZN7A 1L2LA 1YZ4A 3IE7A 3ZM0A 1RKAA 4E84A 2JFFA 1PTYA 3I3YA 3LJSA 4JKSA 4R0SA 1Q6NA 3B1NA 3RY7A 1GC5A 3NCAA 5EHRA 2CNHA 2JG5A 5COJA 4JNBA 4WU2A 3LKIA 2V78A 2GJTA 3RTCA 1U2XA 2PQ5A 2HY3A 2CMCA 2HW1A 2G6ZA 4C12A 2PA5A 3NL6A 3BGKA 1YGRA 1GFYA 4K9CA 1D5RA 2C46A 3D9CA 2GC5A 5LXQB 2AJPA 1PA1A 1OHDA 4ERCA 2Y96A 4QAHA 1YGJA 5C3ZA 4GE5A 3UQEA 1OEOX 4QDIA 3QCIA 2QBPA 4K8KA 3RO1A 2PKMA 3UQDA 4C5KA 4E3AA 3S3KA 3NM3A 3UMOA 2VOSA 4PYHA 3N2AA 1Q1MA 4QBWA 3K9EA 3RPHA 2HXPA 4ICZA 4K8CA 2HNQA 3SMEA 1LIIA 3NBWA 1ZZWA 2G59A 5KA3A 3NC9A 3ZMPA 2F6WA 2XJAA 1LHRA 5BZZA 1YFOA 2CM3A 1QXKA 3BLUA 2QDPA 1PTUA 5C40A 1T4JA 2F70A 2GWOA 2QHPA 1G1GA 5K9VA 3B1OA 4LC4A 4XF6A 1QZ0A 4K9IA 2FH7A 2IMGA 3S3HA 2HLZA 3O4TA 2BV5A 1E0DA 2RBCA 2R0BA 1YGKA 2WTZA 3HPDA 3EU0A 2I6MA 3Q1YA 1LIKA 3OTXA 1G4US 1XRIA 3MOZA 4RH9A 4QUMA 5K25A 3EZZA 4E8YA 2P4DA 3UQ6A 2F00A 4KYRA 2J16B 4B8SA 1KYHA 3A5KA 5KA1A 1ESJA 2H4KA 3LHXA 2CNEA 2VARA 4C5LA 4Z6BA 4K93A 2HC2A 1KAKA 1LHPA 4BUBA 4NWGA 3KTNA 1VM7A 4E8WA 2QEPA 2J17A 2B4OA 1RPMA 4BPCA 4CVKA 2X5OA 1OETA 4GRZA 1RK2A 2WJPA 5C3YA 4GRYA 3BF5A 4O1LA 4YR8B 1JXIA 4PVGA 3GO7A 3RT9A 1G1FA 1NNYA 4B8RA 4YL5A 4DU5A 2F6YA 3RTBA 3BLTA 3QCLA 1LIJA 4WJMA 4HV4A 2CM2A 3HICA 3HJ6A 2GC6A 3EAXA 4ZIYA 3N1CA 3F81A 4LBGA 3KEUA 3AWEA 1GQTA 2JG1A 4D3RA 1FPZA 1NZ7A 4EN4A 2UUPA 3ZL8A 4RKKA 2I5XA 2AWDA 1UB0A 3RS8A 1EEOA 2R3EA 2I1YA 4Y2EA 4WTYA 3B3LA 3UBOA 2F6ZA 4N08A 1RFVA 3O4SA 1XXVA 4HRFA 3B7OA 3RRFA 4OHIA 3V0JA 1RKSA 2C49A 3RREA 4C5JA 1V1SA 1FQ1A 2XTBA 4QAPA 2OC3A 1YGUA 1JF7A 4C13A 5F0ZA 3QCHA 4JBCA 1RXDA 1R6HA 3V0DA 3D42A 2ABQA 4C5MA 1JBWA 3RQ2A 1C84A 4RI5A 2B4PA 4C5NA 3QCBA 4CVLA 2NT2A 1VHRA 2QCVA 5EYNA 1Q6PA 3M4UA 1TZ6A 1ESQA 3RSQA 1V1AA 1J4XA 5GTJA 3S3FA 3DZVA 1OEMX 1GG4A 3H49A 3PS5A 4UBEA 3ZM5A 2A8BA 1EKQA 5F11A 1G1HA 5J8RA 4H1OA 3K5WA 1P31A 3KZHA 5HDEA 2PKFA 4CVMA 1OEVA 3QKQA 5B6AA 4LCAA 1MKPA 2R3BA 2DXPA 5KA7A 3ZM1A 1ECVA 4EUMA 5CM5A 1M3GA 2UUOA 4N09A 4YAAA 1BZCA 1GQQA 4KALA 3A5JA 4GS0A 2VEXA 5M43A 2HB1A 1WYEA 2VTDA 1P15A 1PXHA 2QBQA 3I36A 4OHHA 5KAAA 3CWEA 3N0AA 4JMJA 2I6BA 3RQHA 2HC1A 4BJOA 3ZM6A 2BGDA 1V3AA 3D1QA 3RTAA 3VAQA 3RRJA 5CGEA 2JFGA 2C4EA 2I6JA 4XF7A 1P3DA 3ZMQA 2OOQA 3D1OA 5K24A 1YWFA 3V0GA 3RU3A 2I4GA 2I3RA 3MMJA 4NNDA 3RQ6A 3ZM2A 2NT7A 4WOHA 4WU3A 3W4SA 1FGSA 1J6UA 2I42A 3EMUA 3NRSA 5KA4A 1C86A 2E0TA 2I75A 3NBVA 1NL9A 1LARA 4D3QA 4E69A 4J51A 3RT7A 1YTWA 2ESBA 4Y14A 3LJ8A 3NL5A 4KANA 3OLRA 1O5ZA 2B3OA 2QBSA 2AFBA 2QDCA 3QA2A 2Y67A 3QCMA 3F41A 4NX8A 5KA8A 3RSGA 2I6IA 3V0EA 3HYOA 4YWRA 2F6FA 4RI4A 2OZ5A 1Q6JA 3V0IA 3EWMA 5BUGA 2AHSA 1OESA 4R0TA 2BGEA 5IBSA 3LOOA 1I9TA 2WGPA 2SHPA 4JKUA 3H74A 4KBEA 2CMBA 5MMZB 2ABSA 1ONZA 2AM2A 1NWEA 3S4OA 4S1IA 5BYFA 2HVLA 4GFUA 4GE6A 3NM1A 3IKHA 2F7KA 2B07A 2FJMA 4AZ1A 2AJRA 4S0GA 3JULA 4GE2A 2CMAA 2AB8A 2J16A 3RGQA 5A5FA 4KI9A 2PT0A 3O4UA 1PYNA 2A9ZA 2F02A 4B04A 2BIJA 3QCCA 3PL2A 4ZRTA 1T48A 2NWHA 2Y1OA 3S3EA 3S4EA 1TZ3A 1I9SA 4NYHA 1BZHA 2A9YA 1ONYA 2ZMMA 1I57A 2DDMA 4EOHA 5AWXA 3BM8A 3ZM3A 1C88A 1X24A 3PYZA 3QCNA 4TVVA 4QBEA 1TD2A 3PZSA 3RRBA 2Q47A 1L8KA 3I80A 5EY7A 2F71A 4KAHA 2CNGA 4BUCA 2YXUA 2H4VA 4K8TA 4GWFA 3RZ2A 3RSSA 5BYCA 4OHDA 3AWGA 2H03A 3RM5A 3NC2A 2I3UA 5KA2A 2NLKA 3MBJA 3IQ0A 2F6VA 1KAVA 2H04A 4K8PA 4RDDA 2Y2FA 2XPCA 3RGOA 3RPZA 5IBMA 1VI9A 3QAIA 1C85A 1PA9A 2AZRA 5K22A 4ZN5A 3I7ZA 4MBBA 1XBOA 4D3PA 2JFHA 1A5YA 1SUGA 4DGPA 4I8NA 3O3LA 3RSFA 5C41A 3GXHA 1AAXA 5BZXA 1LYVA 2RF6A 3QCDA 1LQFA 3NMEA 2BZLA 1JBVA 1E8CA 2AA0A 3D44A 2Y68A 3NL2A 2VEWA 5BYDA 3V0HA 3O5XA 3F9AA 1WCHA 1U24A 3QCGA 4HJPA 4UAGA 3F9BA 1YTNA 3UQ9A 3QCKA 1V1BA 1EKKA 2QCJA 3B1QA 3IBQA 2PBNA 2Y66A 1Q6MA 1T49A 2A3KA 1JXHA 2VORA 2M3VA 4S1MA 1G7FA 1JLNA 2AM1A 4DC3A 3QCZA 2FJNA 5K23A 3GO6A 2PKNA 2PKKA 1PTTA 2CM8A 1G7GA 5KADA 2VEVA 2PSZA 5TQIA 4H34A 2QBRA 2HCMA 2AX3A 4GM6A 3AWFA 2B4UA 3EAGA 1EEHA 4E8ZA 3RTEA 3QCFA 3FHYA 1W78A 3B1RA 1YN9A 2NZ6A 1UAGA 1C87A 2QCTA 1V19A 1OHCA 2VEYA 3BRHA 4KADA 1BX4A 1YPTA 5EHPA 1FPRA 5K9WA 1VK4A 2DDOA 2UAGA 1C3QA 1PTVA 1XM2A 4XDAA 3LK7A 2I4EA 2GP0A 3MOWA 4KYQA 3MVNA 3RQXA 5KACA 1PH0A 3GXGA 4NWFA 5A5EA 2PI7A 3DRWA 2I6PA 3QKPA 5KABA 1C83A 3MBHA 3RQ8A 4HJQA 4OHLA 4XCKA 4EBUA 3HN7A 1WAXA 2HQQA 2CNIA 1RFTA 4OHEA 2OUDA 3UAGA 4DGXA 3B1PA 1Q6SA 2NTAA 3FHXA 4LBXA 1EENA 1GQYA 2H4GA 3VASA 2YXTA 1XXPA 3IN1A 5KA0A 1UA4A 2P6XA 2H02A 1NWLA 1YTSA 5I6VA 5BX1A 1TYYA 2JJDA 3OMHA 2I4HA 3RTGA 4ZI4A 3SR9A 4S1HA 3RS9A 1NO6A 3GBUA 3UMPA 3ZS7A 3KD6A 3NL3A 2C7SA 2F46A 4RH5A 4X8FA 3RQQA 2F6TA 4QF5A 2GCBA 3QCEA 5TRWA 4JJPA 3RTDA 3RU2A
chains in the Genus database with same CATH topology
2WJPA 3ZM6A 4C12A 2GCAA 1O5ZA 3UAGA 2JFGA 4UAGA 3ZM5A 2Y67A 2GC5A 2Y66A 2VTEA 1P3DA 2JFHA 1P31A 1GQYA 2F00A 2VORA 4CVMA 2AM1A 3QCZA 2XJAA 5A5FA 2UAGA 4BUCA 4C13A 4HV4A 1W7KA 2GC6A 3LK7A 4QDIA 1JBWA 1FGSA 1J6UA 2JFFA 2UUOA 2WTZA 4ZIYA 3MVNA 3NRSA 1GQQA 2Y1OA 1JBVA 3HN7A 4BUBA 1E8CA 4CVLA 2UUPA 3ZL8A 5A5EA 2VTDA 2Y68A 3EAGA 2VOSA 1EEHA 2AM2A 2GCBA 4QF5A 1E0DA 3N2AA 2XPCA 3PYZA 1W78A 4CVKA 2X5OA 1UAGA 1GG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WJP A;  3ZM6 A;  4C12 A;  2GCA A;  1O5Z A;  3UAG A;  2JFG A;  4UAG A;  3ZM5 A;  2Y67 A;  2GC5 A;  2Y66 A;  2VTE A;  1P3D A;  2JFH A;  1P31 A;  1GQY A;  2F00 A;  2VOR A;  4CVM A;  2AM1 A;  3QCZ A;  2XJA A;  5A5F A;  2UAG A;  4BUC A;  4C13 A;  4HV4 A;  1W7K A;  2GC6 A;  3LK7 A;  4QDI A;  1JBW A;  1FGS A;  1J6U A;  2JFF A;  2UUO A;  2WTZ A;  4ZIY A;  3MVN A;  3NRS A;  1GQQ A;  2Y1O A;  1JBV A;  3HN7 A;  4BUB A;  1E8C A;  4CVL A;  2UUP A;  3ZL8 A;  5A5E A;  2VTD A;  2Y68 A;  3EAG A;  2VOS A;  1EEH A;  2AM2 A;  2GCB A;  4QF5 A;  1E0D A;  3N2A A;  2XPC A;  3PYZ A;  1W78 A;  4CVK A;  2X5O A;  1UAG A;  1GG4 A; 
#chains in the Genus database with same CATH topology
 4PVV A;  1U26 A;  5CGA A;  2GCA A;  1L8G A;  3V0F A;  5KA9 A;  4RHG A;  3ZV2 A;  2B49 A;  1YHJ A;  2I5B A;  1OHE A;  1RFU A;  3EB1 A;  4O1G A;  1Q6T A;  2JGV A;  4JMK A;  3U96 A;  1LIO A;  1GWZ A;  3QCJ A;  2Q05 A;  2I6O A;  2QDM A;  1ZC0 A;  1W7K A;  1BZJ A;  2B4S A;  4GFV A;  1U25 A;  4R30 A;  2Q5R A;  2DDW A;  1WRM A;  1RKD A;  4IKC A;  3RO4 A;  4QUN A;  2CNF A;  1OEU A;  1ZCL A;  3H2X A;  3IH0 A;  2I6A A;  1G4W R;  2FV7 A;  3CQD A;  4U7X A;  2VEU A;  1DGM A;  4S1I B;  2YDU A;  3D1H A;  3Q92 A;  2HNP A;  3RQ5 A;  1ZCK A;  2DCN A;  2CFV A;  2CM7 A;  3F99 A;  2VTE A;  3CM3 A;  5BYE A;  2CJZ A;  2NV5 A;  2MBC A;  2ZN7 A;  1L2L A;  1YZ4 A;  3IE7 A;  3ZM0 A;  1RKA A;  4E84 A;  2JFF A;  1PTY A;  3I3Y A;  3LJS A;  4JKS A;  4R0S A;  1Q6N A;  3B1N A;  3RY7 A;  1GC5 A;  3NCA A;  5EHR A;  2CNH A;  2JG5 A;  5COJ A;  4JNB A;  4WU2 A;  3LKI A;  2V78 A;  2GJT A;  3RTC A;  1U2X A;  2PQ5 A;  2HY3 A;  2CMC A;  2HW1 A;  2G6Z A;  4C12 A;  2PA5 A;  3NL6 A;  3BGK A;  1YGR A;  1GFY A;  4K9C A;  1D5R A;  2C46 A;  3D9C A;  2GC5 A;  5LXQ B;  2AJP A;  1PA1 A;  1OHD A;  4ERC A;  2Y96 A;  4QAH A;  1YGJ A;  5C3Z A;  4GE5 A;  3UQE A;  1OEO X;  4QDI A;  3QCI A;  2QBP A;  4K8K A;  3RO1 A;  2PKM A;  3UQD A;  4C5K A;  4E3A A;  3S3K A;  3NM3 A;  3UMO A;  2VOS A;  4PYH A;  3N2A A;  1Q1M A;  4QBW A;  3K9E A;  3RPH A;  2HXP A;  4ICZ A;  4K8C A;  2HNQ A;  3SME A;  1LII A;  3NBW A;  1ZZW A;  2G59 A;  5KA3 A;  3NC9 A;  3ZMP A;  2F6W A;  2XJA A;  1LHR A;  5BZZ A;  1YFO A;  2CM3 A;  1QXK A;  3BLU A;  2QDP A;  1PTU A;  5C40 A;  1T4J A;  2F70 A;  2GWO A;  2QHP A;  1G1G A;  5K9V A;  3B1O A;  4LC4 A;  4XF6 A;  1QZ0 A;  4K9I A;  2FH7 A;  2IMG A;  3S3H A;  2HLZ A;  3O4T A;  2BV5 A;  1E0D A;  2RBC A;  2R0B A;  1YGK A;  2WTZ A;  3HPD A;  3EU0 A;  2I6M A;  3Q1Y A;  1LIK A;  3OTX A;  1G4U S;  1XRI A;  3MOZ A;  4RH9 A;  4QUM A;  5K25 A;  3EZZ A;  4E8Y A;  2P4D A;  3UQ6 A;  2F00 A;  4KYR A;  2J16 B;  4B8S A;  1KYH A;  3A5K A;  5KA1 A;  1ESJ A;  2H4K A;  3LHX A;  2CNE A;  2VAR A;  4C5L A;  4Z6B A;  4K93 A;  2HC2 A;  1KAK A;  1LHP A;  4BUB A;  4NWG A;  3KTN A;  1VM7 A;  4E8W A;  2QEP A;  2J17 A;  2B4O A;  1RPM A;  4BPC A;  4CVK A;  2X5O A;  1OET A;  4GRZ A;  1RK2 A;  2WJP A;  5C3Y A;  4GRY A;  3BF5 A;  4O1L A;  4YR8 B;  1JXI A;  4PVG A;  3GO7 A;  3RT9 A;  1G1F A;  1NNY A;  4B8R A;  4YL5 A;  4DU5 A;  2F6Y A;  3RTB A;  3BLT A;  3QCL A;  1LIJ A;  4WJM A;  4HV4 A;  2CM2 A;  3HIC A;  3HJ6 A;  2GC6 A;  3EAX A;  4ZIY A;  3N1C A;  3F81 A;  4LBG A;  3KEU A;  3AWE A;  1GQT A;  2JG1 A;  4D3R A;  1FPZ A;  1NZ7 A;  4EN4 A;  2UUP A;  3ZL8 A;  4RKK A;  2I5X A;  2AWD A;  1UB0 A;  3RS8 A;  1EEO A;  2R3E A;  2I1Y A;  4Y2E A;  4WTY A;  3B3L A;  3UBO A;  2F6Z A;  4N08 A;  1RFV A;  3O4S A;  1XXV A;  4HRF A;  3B7O A;  3RRF A;  4OHI A;  3V0J A;  1RKS A;  2C49 A;  3RRE A;  4C5J A;  1V1S A;  1FQ1 A;  2XTB A;  4QAP A;  2OC3 A;  1YGU A;  1JF7 A;  4C13 A;  5F0Z A;  3QCH A;  4JBC A;  1RXD A;  1R6H A;  3V0D A;  3D42 A;  2ABQ A;  4C5M A;  1JBW A;  3RQ2 A;  1C84 A;  4RI5 A;  2B4P A;  4C5N A;  3QCB A;  4CVL A;  2NT2 A;  1VHR A;  2QCV A;  5EYN A;  1Q6P A;  3M4U A;  1TZ6 A;  1ESQ A;  3RSQ A;  1V1A A;  1J4X A;  5GTJ A;  3S3F A;  3DZV A;  1OEM X;  1GG4 A;  3H49 A;  3PS5 A;  4UBE A;  3ZM5 A;  2A8B A;  1EKQ A;  5F11 A;  1G1H A;  5J8R A;  4H1O A;  3K5W A;  1P31 A;  3KZH A;  5HDE A;  2PKF A;  4CVM A;  1OEV A;  3QKQ A;  5B6A A;  4LCA A;  1MKP A;  2R3B A;  2DXP A;  5KA7 A;  3ZM1 A;  1ECV A;  4EUM A;  5CM5 A;  1M3G A;  2UUO A;  4N09 A;  4YAA A;  1BZC A;  1GQQ A;  4KAL A;  3A5J A;  4GS0 A;  2VEX A;  5M43 A;  2HB1 A;  1WYE A;  2VTD A;  1P15 A;  1PXH A;  2QBQ A;  3I36 A;  4OHH A;  5KAA A;  3CWE A;  3N0A A;  4JMJ A;  2I6B A;  3RQH A;  2HC1 A;  4BJO A;  3ZM6 A;  2BGD A;  1V3A A;  3D1Q A;  3RTA A;  3VAQ A;  3RRJ A;  5CGE A;  2JFG A;  2C4E A;  2I6J A;  4XF7 A;  1P3D A;  3ZMQ A;  2OOQ A;  3D1O A;  5K24 A;  1YWF A;  3V0G A;  3RU3 A;  2I4G A;  2I3R A;  3MMJ A;  4NND A;  3RQ6 A;  3ZM2 A;  2NT7 A;  4WOH A;  4WU3 A;  3W4S A;  1FGS A;  1J6U A;  2I42 A;  3EMU A;  3NRS A;  5KA4 A;  1C86 A;  2E0T A;  2I75 A;  3NBV A;  1NL9 A;  1LAR A;  4D3Q A;  4E69 A;  4J51 A;  3RT7 A;  1YTW A;  2ESB A;  4Y14 A;  3LJ8 A;  3NL5 A;  4KAN A;  3OLR A;  1O5Z A;  2B3O A;  2QBS A;  2AFB A;  2QDC A;  3QA2 A;  2Y67 A;  3QCM A;  3F41 A;  4NX8 A;  5KA8 A;  3RSG A;  2I6I A;  3V0E A;  3HYO A;  4YWR A;  2F6F A;  4RI4 A;  2OZ5 A;  1Q6J A;  3V0I A;  3EWM A;  5BUG A;  2AHS A;  1OES A;  4R0T A;  2BGE A;  5IBS A;  3LOO A;  1I9T A;  2WGP A;  2SHP A;  4JKU A;  3H74 A;  4KBE A;  2CMB A;  5MMZ B;  2ABS A;  1ONZ A;  2AM2 A;  1NWE A;  3S4O A;  4S1I A;  5BYF A;  2HVL A;  4GFU A;  4GE6 A;  3NM1 A;  3IKH A;  2F7K A;  2B07 A;  2FJM A;  4AZ1 A;  2AJR A;  4S0G A;  3JUL A;  4GE2 A;  2CMA A;  2AB8 A;  2J16 A;  3RGQ A;  5A5F A;  4KI9 A;  2PT0 A;  3O4U A;  1PYN A;  2A9Z A;  2F02 A;  4B04 A;  2BIJ A;  3QCC A;  3PL2 A;  4ZRT A;  1T48 A;  2NWH A;  2Y1O A;  3S3E A;  3S4E A;  1TZ3 A;  1I9S A;  4NYH A;  1BZH A;  2A9Y A;  1ONY A;  2ZMM A;  1I57 A;  2DDM A;  4EOH A;  5AWX A;  3BM8 A;  3ZM3 A;  1C88 A;  1X24 A;  3PYZ A;  3QCN A;  4TVV A;  4QBE A;  1TD2 A;  3PZS A;  3RRB A;  2Q47 A;  1L8K A;  3I80 A;  5EY7 A;  2F71 A;  4KAH A;  2CNG A;  4BUC A;  2YXU A;  2H4V A;  4K8T A;  4GWF A;  3RZ2 A;  3RSS A;  5BYC A;  4OHD A;  3AWG A;  2H03 A;  3RM5 A;  3NC2 A;  2I3U A;  5KA2 A;  2NLK A;  3MBJ A;  3IQ0 A;  2F6V A;  1KAV A;  2H04 A;  4K8P A;  4RDD A;  2Y2F A;  2XPC A;  3RGO A;  3RPZ A;  5IBM A;  1VI9 A;  3QAI A;  1C85 A;  1PA9 A;  2AZR A;  5K22 A;  4ZN5 A;  3I7Z A;  4MBB A;  1XBO A;  4D3P A;  2JFH A;  1A5Y A;  1SUG A;  4DGP A;  4I8N A;  3O3L A;  3RSF A;  5C41 A;  3GXH A;  1AAX A;  5BZX A;  1LYV A;  2RF6 A;  3QCD A;  1LQF A;  3NME A;  2BZL A;  1JBV A;  1E8C A;  2AA0 A;  3D44 A;  2Y68 A;  3NL2 A;  2VEW A;  5BYD A;  3V0H A;  3O5X A;  3F9A A;  1WCH A;  1U24 A;  3QCG A;  4HJP A;  4UAG A;  3F9B A;  1YTN A;  3UQ9 A;  3QCK A;  1V1B A;  1EKK A;  2QCJ A;  3B1Q A;  3IBQ A;  2PBN A;  2Y66 A;  1Q6M A;  1T49 A;  2A3K A;  1JXH A;  2VOR A;  2M3V A;  4S1M A;  1G7F A;  1JLN A;  2AM1 A;  4DC3 A;  3QCZ A;  2FJN A;  5K23 A;  3GO6 A;  2PKN A;  2PKK A;  1PTT A;  2CM8 A;  1G7G A;  5KAD A;  2VEV A;  2PSZ A;  5TQI A;  4H34 A;  2QBR A;  2HCM A;  2AX3 A;  4GM6 A;  3AWF A;  2B4U A;  3EAG A;  1EEH A;  4E8Z A;  3RTE A;  3QCF A;  3FHY A;  1W78 A;  3B1R A;  1YN9 A;  2NZ6 A;  1UAG A;  1C87 A;  2QCT A;  1V19 A;  1OHC A;  2VEY A;  3BRH A;  4KAD A;  1BX4 A;  1YPT A;  5EHP A;  1FPR A;  5K9W A;  1VK4 A;  2DDO A;  2UAG A;  1C3Q A;  1PTV A;  1XM2 A;  4XDA A;  3LK7 A;  2I4E A;  2GP0 A;  3MOW A;  4KYQ A;  3MVN A;  3RQX A;  5KAC A;  1PH0 A;  3GXG A;  4NWF A;  5A5E A;  2PI7 A;  3DRW A;  2I6P A;  3QKP A;  5KAB A;  1C83 A;  3MBH A;  3RQ8 A;  4HJQ A;  4OHL A;  4XCK A;  4EBU A;  3HN7 A;  1WAX A;  2HQQ A;  2CNI A;  1RFT A;  4OHE A;  2OUD A;  3UAG A;  4DGX A;  3B1P A;  1Q6S A;  2NTA A;  3FHX A;  4LBX A;  1EEN A;  1GQY A;  2H4G A;  3VAS A;  2YXT A;  1XXP A;  3IN1 A;  5KA0 A;  1UA4 A;  2P6X A;  2H02 A;  1NWL A;  1YTS A;  5I6V A;  5BX1 A;  1TYY A;  2JJD A;  3OMH A;  2I4H A;  3RTG A;  4ZI4 A;  3SR9 A;  4S1H A;  3RS9 A;  1NO6 A;  3GBU A;  3UMP A;  3ZS7 A;  3KD6 A;  3NL3 A;  2C7S A;  2F46 A;  4RH5 A;  4X8F A;  3RQQ A;  2F6T A;  4QF5 A;  2GCB A;  3QCE A;  5TRW A;  4JJP A;  3RTD A;  3RU2 A; 
#chains in the Genus database with same CATH homology
 2WJP A;  3ZM6 A;  4C12 A;  2GCA A;  1O5Z A;  3UAG A;  2JFG A;  4UAG A;  3ZM5 A;  2Y67 A;  2GC5 A;  2Y66 A;  2VTE A;  1P3D A;  2JFH A;  1P31 A;  1GQY A;  2F00 A;  2VOR A;  4CVM A;  2AM1 A;  3QCZ A;  2XJA A;  5A5F A;  2UAG A;  4BUC A;  4C13 A;  4HV4 A;  1W7K A;  2GC6 A;  3LK7 A;  4QDI A;  1JBW A;  1FGS A;  1J6U A;  2JFF A;  2UUO A;  2WTZ A;  4ZIY A;  3MVN A;  3NRS A;  1GQQ A;  2Y1O A;  1JBV A;  3HN7 A;  4BUB A;  1E8C A;  4CVL A;  2UUP A;  3ZL8 A;  5A5E A;  2VTD A;  2Y68 A;  3EAG A;  2VOS A;  1EEH A;  2AM2 A;  2GCB A;  4QF5 A;  1E0D A;  3N2A A;  2XPC A;  3PYZ A;  1W78 A;  4CVK A;  2X5O A;  1UAG A;  1GG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...