2GC6A

S73a mutant of l. casei fpgs
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
425
structure length
406
Chain Sequence
MNYTETVAYIHSFPRLADHRRILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTAPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLQQQQADFNVTEFEFITALGYWYFRQRQVDVAVIEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKHAGIIKRGIPVVTGNLVPDAAAVVAAKVATTGSQWLRFDRDFSVPKAKLHGWGQRFTYEDQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGILYAAMADRLTAAFSTVYLVPVPGTPRALRLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation of Gly51 to serine in the P-loop of Lactobacillus casei folylpolyglutamate synthetase abolishes activity by altering the conformation of two adjacent loops.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Ligase
molecule keywords Folylpolyglutamate synthase
total genus 132
structure length 406
sequence length 425
ec nomenclature ec 6.3.2.17: Tetrahydrofolate synthase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02875 Mur_ligase_C Mur ligase family, glutamate ligase domain
A PF08245 Mur_ligase_M Mur ligase middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.10 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase Mur-like, catalytic domain 2gc6A01
3.90.190.20 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Mur ligase, C-terminal domain 2gc6A02
2AM1A 2Y68A 3N2AA 2Y66A 1GG4A 1GQYA 1J6UA 2AM2A 3PYZA 2WJPA 4C13A 2VOSA 2JFFA 3EAGA 4UAGA 1W7KA 2GC6A 4C12A 1JBVA 2X5OA 1FGSA 1O5ZA 4QF5A 2GC5A 1E8CA 2GCBA 4CVKA 3MVNA 3NRSA 2XJAA 4CVLA 3QCZA 5A5EA 2UUOA 2UUPA 1EEHA 2VORA 2JFGA 3LK7A 3ZL8A 1JBWA 1P3DA 4QDIA 3ZM5A 2XPCA 2UAGA 3UAGA 4CVMA 2VTEA 2WTZA 3HN7A 5A5FA 4BUBA 1W78A 4HV4A 1E0DA 1P31A 1UAGA 2F00A 2GCAA 4ZIYA 4BUCA 3ZM6A 2JFHA 1GQQA 2Y1OA 2Y67A 2VTDA
chains in the Genus database with same CATH superfamily
1VI9A 3RZ2A 3RQ5A 3NL2A 1WYEA 2ESBA 1YPTA 2FH7A 2R3BA 5KA0A 5M43A 5BYDA 5K25A 1YTNA 1JBVA 4PYHA 5KADA 3RSGA 4KYRA 3QCMA 1G7FA 2I4HA 1NNYA 2XJAA 4CVLA 1D5RA 1L8GA 1LARA 3K5WA 4LBXA 4EBUA 3V0HA 1A5YA 4RH9A 3QCLA 2F6ZA 1BX4A 3B1NA 4LCAA 4JBCA 3RU2A 5KAAA 3RGQA 2G59A 3Q92A 3NM3A 1JF7A 1QZ0A 1P31A 1PTVA 1ZCKA 4YR8B 1V1SA 4KADA 2QBPA 4ZIYA 2NLKA 3BLTA 3N2AA 2A9ZA 4D3RA 2AM2A 2AFBA 1MKPA 2I6JA 2J16B 2I3RA 3ZMPA 1YGKA 1DGMA 2BIJA 3F9AA 3V0EA 3MVNA 5MMZB 5CGEA 1G1GA 3RTDA 4KBEA 1WRMA 4I8NA 2SHPA 3RQXA 3ZM3A 1ZC0A 2F6WA 2PQ5A 4WU3A 3S4EA 1LHRA 1RFUA 4EN4A 3MMJA 2NTAA 3BGKA 4BUBA 3VASA 2VARA 3UQ9A 1PA9A 1Q6MA 2FV7A 3IN1A 4XCKA 4S0GA 4LC4A 5TRWA 3CM3A 1YGRA 1RFTA 4ZN5A 1TD2A 4NWGA 3V0JA 2I3UA 3D1QA 1GG4A 5BZZA 1SUGA 2H03A 2FJNA 4OHEA 4E3AA 3RO1A 1Q6NA 5CM5A 1FQ1A 4C12A 4E8ZA 2Q47A 3QCBA 1XM2A 2GC5A 5EY7A 3I80A 4NYHA 3QCDA 2H04A 4GE5A 2OUDA 3RTBA 1VHRA 1U24A 2F70A 3BM8A 2CM8A 3RM5A 3RQ8A 1OESA 4AZ1A 2NZ6A 3S3KA 1NZ7A 4JMKA 5EYNA 2HNPA 3AWEA 3MOWA 1LIJA 2NT7A 5KA2A 3RTAA 3RT7A 5IBMA 3OTXA 1L8KA 1LQFA 4NX8A 4UBEA 4JNBA 2ZMMA 4B8SA 1PTUA 4H34A 4D3QA 2A8BA 2GWOA 3JULA 4EOHA 1OETA 2QDPA 3NC2A 3VAQA 3QCZA 4LBGA 2UUPA 2I6PA 1TZ6A 4K8TA 4BJOA 3DZVA 5K23A 1RKSA 3QCHA 4B04A 3MOZA 1UAGA 1G4WR 4DGXA 1XRIA 5K24A 1YZ4A 3GXGA 5K9VA 2F46A 3UMPA 1I9TA 2CMBA 5K22A 3PL2A 2H02A 2QHPA 2C49A 3IQ0A 1OEUA 4EUMA 1NWEA 2CNFA 1V1BA 3HYOA 3ZS7A 2B3OA 2GC6A 1J4XA 2HXPA 3S3EA 4K9IA 1E8CA 4CVKA 4GE2A 1LIOA 1GQTA 2PKNA 4TVVA 3NL3A 2VORA 1YHJA 2AHSA 3D42A 1T48A 2DDMA 2I6MA 3O4UA 2JGVA 1PXHA 3W4SA 4RI4A 5J8RA 3CQDA 4YWRA 2HCMA 5IBSA 3ZM6A 2Y1OA 3V0DA 4C5MA 2AM1A 5B6AA 2Y68A 4O1LA 3EAXA 3B1QA 3UQ6A 1RXDA 2CM2A 4GRZA 3OLRA 3D1HA 1T4JA 4B8RA 3RGOA 3RRBA 3EZZA 4NWFA 4C5KA 3QCFA 3S3FA 2JFGA 2HB1A 2HC2A 4DGPA 4QBWA 2UAGA 4K8PA 3RRJA 1C88A 2QCJA 2AWDA 4S1HA 1FPZA 1PYNA 2F00A 1C3QA 4YL5A 1PH0A 4GS0A 1L2LA 4S1IB 1OHDA 2VEXA 4KALA 1EEOA 3U96A 1ONZA 4XF6A 4PVVA 2Y66A 2OZ5A 4PVGA 2CNHA 4R0SA 2JFFA 4XDAA 5C3ZA 1W7KA 2QDMA 3ZV2A 3Q1YA 3HICA 1G1HA 2GCBA 1UA4A 1VK4A 4K8KA 3QCCA 1GC5A 2F02A 1EKKA 1G7GA 1YWFA 2CMCA 1P3DA 2J16A 1YTSA 3A5JA 2AJPA 2YDUA 3H49A 3HPDA 3RTGA 4DC3A 4KANA 2QBSA 4OHDA 1YN9A 2RBCA 1C87A 2B4OA 1U2XA 3N1CA 5GTJA 3O4SA 2CFVA 2I4GA 2F7KA 3GBUA 3M4UA 3AWFA 2XTBA 3LHXA 1PTTA 5KA3A 1BZJA 1JLNA 3PZSA 4QF5A 1Q6PA 2Y96A 4QAHA 3RTCA 2BGEA 2PBNA 4KI9A 1I57A 3HJ6A 3RO4A 3I36A 5LXQB 3NCAA 1ONYA 3RY7A 4C5LA 1OEMX 1ZCLA 4E8YA 2PA5A 1EENA 3QCKA 3UMOA 3UQDA 2C46A 5KABA 1C85A 1YGJA 1VM7A 4DU5A 2PSZA 2E0TA 2WGPA 3BLUA 2QBQA 3SR9A 4R30A 1AAXA 5K9WA 2VEYA 4U7XA 2PT0A 3EAGA 2JG5A 2CNIA 2Q5RA 2GJTA 1FGSA 3BF5A 4Y2EA 1UB0A 2VEWA 3V0GA 4QAPA 1ESQA 4XF7A 3MBHA 3NRSA 4K9CA 4RHGA 5A5EA 3KTNA 3D44A 3UBOA 5C40A 2A3KA 1ECVA 3RQ6A 4QDIA 4CVMA 3RRFA 5EHPA 1BZCA 1OEOX 4K93A 4BPCA 3K9EA 2F71A 1J6UA 2QEPA 1ZZWA 1C86A 3V0FA 2NT2A 2B49A 5KACA 3RQQA 1KAVA 2M3VA 1G4US 1OEVA 3AWGA 2P6XA 1U25A 3RSQA 4QUNA 4Z6BA 1V1AA 4HJQA 3H74A 3RREA 4RDDA 3S3HA 1RK2A 5A5FA 3EWMA 5KA8A 1T49A 3QKQA 4J51A 1WCHA 5EHRA 3I7ZA 2Y67A 2VTDA 1RPMA 4S1IA 4JKSA 2DXPA 2NWHA 2BZLA 1Q6JA 3F41A 3S4OA 3ZMQA 3EU0A 1LIKA 3MBJA 3NL6A 1C84A 4HJPA 4UAGA 1R6HA 2X5OA 3NBVA 1OHCA 3GXHA 2B4SA 2C4EA 2AA0A 4O1GA 2B4PA 2H4KA 2AX3A 4D3PA 3KD6A 2R3EA 2R0BA 3RSSA 3RTEA 4GFUA 5BYCA 3H2XA 3B1PA 2ZN7A 2HC1A 2VTEA 3HN7A 2I1YA 2Y2FA 4S1MA 4RKKA 3RQHA 4HV4A 1E0DA 1KAKA 4BUCA 3O3LA 3QCGA 3NM1A 1V19A 4OHIA 1WAXA 2VEVA 1JXIA 1TZ3A 4KYQA 2V78A 3O5XA 1GFYA 3QCNA 5BUGA 2DDOA 3KZHA 3RPZA 1LYVA 2I5XA 3NC9A 5BYFA 1XBOA 2Q05A 5BYEA 2I4EA 4GRYA 3QCEA 3LK7A 5C3YA 3ZL8A 1PA1A 3PS5A 3ZM0A 2OOQA 1X24A 3IBQA 1KYHA 5KA9A 3NL5A 3GO6A 5AWXA 2PKKA 3QA2A 1EKQA 2JG1A 1C83A 2AB8A 5KA4A 1RFVA 2QDCA 4JJPA 2HLZA 2F6TA 3QKPA 2NV5A 2WTZA 4GFVA 2ABSA 2JJDA 4JMJA 2YXTA 1Q6SA 2CM7A 4H1OA 3RPHA 4MBBA 2QCVA 1LIIA 3RSFA 1ESJA 3PYZA 1YGUA 2H4GA 4RH5A 1LHPA 4X8FA 1V3AA 1RKDA 3FHXA 3NMEA 2ABQA 2FJMA 5C41A 2F6VA 4N08A 2PKFA 5F0ZA 4WU2A 4QBEA 2UUOA 1G1FA 3OMHA 4WTYA 2H4VA 1TYYA 3LJ8A 5COJA 3V0IA 2VEUA 2I6BA 1W78A 4OHLA 4RI5A 2PKMA 1P15A 2OC3A 2JFHA 4E84A 2I42A 4IKCA 3NBWA 2QBRA 2IMGA 1PTYA 3LOOA 2WJPA 2CJZA 2DDWA 2A9YA 2BGDA 4E8WA 3UQEA 4K8CA 3SMEA 2HQQA 2F6FA 2YXUA 4NNDA 4KAHA 3B3LA 2PI7A 3FHYA 1OHEA 3LJSA 2CM3A 2QCTA 3ZM1A 3EB1A 4ERCA 5I6VA 3ZM5A 2XPCA 4E69A 3RU3A 1XXVA 3UAGA 1YFOA 1GWZA 2CNEA 1I9SA 3N0AA 3I3YA 5KA7A 4HRFA 4C5NA 2I5BA 2MBCA 1XXPA 4ICZA 3IE7A 1YTWA 2C7SA 1GQYA 2HW1A 4N09A 4C13A 2P4DA 3KEUA 3GO7A 2J17A 2BV5A 1NL9A 1QXKA 2AJRA 5F11A 3O4TA 3LKIA 4C5JA 2DCNA 2AZRA 3CWEA 3B7OA 3RQ2A 4JKUA 3A5KA 1JXHA 1EEHA 2CMAA 4GE6A 1JBWA 3EMUA 5HDEA 3IH0A 4WJMA 3BRHA 2GP0A 2I6IA 4Y14A 2GCAA 5CGAA 1NO6A 1Q1MA 1GQQA 3DRWA 2I6OA 3D9CA 3ZM2A 3B1RA 1NWLA 3F99A 2F6YA 4GM6A 3F9BA 4GWFA 4WOHA 2I75A 1BZHA 5BX1A 1M3GA 2VOSA 1FPRA 3QCJA 2HY3A 4OHHA 3D1OA 2B07A 5KA1A 1O5ZA 2B4UA 3RT9A 4ZI4A 3IKHA 2HNQA 3F81A 3QAIA 3RS9A 1U26A 2RF6A 3B1OA 3RS8A 2I6AA 5TQIA 3QCIA 4YAAA 4ZRTA 4R0TA 2CNGA 4QUMA 1RKAA 2HVLA 5BZXA 1Q6TA 2G6ZA
chains in the Genus database with same CATH topology
2AM1A 2Y68A 3N2AA 2Y66A 1GG4A 1GQYA 1J6UA 2AM2A 3PYZA 2WJPA 4C13A 2VOSA 2JFFA 3EAGA 4UAGA 1W7KA 2GC6A 4C12A 1JBVA 2X5OA 1FGSA 1O5ZA 4QF5A 2GC5A 1E8CA 2GCBA 4CVKA 3MVNA 3NRSA 2XJAA 4CVLA 3QCZA 5A5EA 2UUOA 2UUPA 1EEHA 2VORA 2JFGA 3LK7A 3ZL8A 1JBWA 1P3DA 4QDIA 3ZM5A 2XPCA 2UAGA 3UAGA 4CVMA 2VTEA 2WTZA 3HN7A 5A5FA 4BUBA 1W78A 4HV4A 1E0DA 1P31A 1UAGA 2F00A 2GCAA 4ZIYA 4BUCA 3ZM6A 2JFHA 1GQQA 2Y1OA 2Y67A 2VTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AM1 A;  2Y68 A;  3N2A A;  2Y66 A;  1GG4 A;  1GQY A;  1J6U A;  2AM2 A;  3PYZ A;  2WJP A;  4C13 A;  2VOS A;  2JFF A;  3EAG A;  4UAG A;  1W7K A;  2GC6 A;  4C12 A;  1JBV A;  2X5O A;  1FGS A;  1O5Z A;  4QF5 A;  2GC5 A;  1E8C A;  2GCB A;  4CVK A;  3MVN A;  3NRS A;  2XJA A;  4CVL A;  3QCZ A;  5A5E A;  2UUO A;  2UUP A;  1EEH A;  2VOR A;  2JFG A;  3LK7 A;  3ZL8 A;  1JBW A;  1P3D A;  4QDI A;  3ZM5 A;  2XPC A;  2UAG A;  3UAG A;  4CVM A;  2VTE A;  2WTZ A;  3HN7 A;  5A5F A;  4BUB A;  1W78 A;  4HV4 A;  1E0D A;  1P31 A;  1UAG A;  2F00 A;  2GCA A;  4ZIY A;  4BUC A;  3ZM6 A;  2JFH A;  1GQQ A;  2Y1O A;  2Y67 A;  2VTD A; 
#chains in the Genus database with same CATH topology
 1VI9 A;  3RZ2 A;  3RQ5 A;  3NL2 A;  1WYE A;  2ESB A;  1YPT A;  2FH7 A;  2R3B A;  5KA0 A;  5M43 A;  5BYD A;  5K25 A;  1YTN A;  1JBV A;  4PYH A;  5KAD A;  3RSG A;  4KYR A;  3QCM A;  1G7F A;  2I4H A;  1NNY A;  2XJA A;  4CVL A;  1D5R A;  1L8G A;  1LAR A;  3K5W A;  4LBX A;  4EBU A;  3V0H A;  1A5Y A;  4RH9 A;  3QCL A;  2F6Z A;  1BX4 A;  3B1N A;  4LCA A;  4JBC A;  3RU2 A;  5KAA A;  3RGQ A;  2G59 A;  3Q92 A;  3NM3 A;  1JF7 A;  1QZ0 A;  1P31 A;  1PTV A;  1ZCK A;  4YR8 B;  1V1S A;  4KAD A;  2QBP A;  4ZIY A;  2NLK A;  3BLT A;  3N2A A;  2A9Z A;  4D3R A;  2AM2 A;  2AFB A;  1MKP A;  2I6J A;  2J16 B;  2I3R A;  3ZMP A;  1YGK A;  1DGM A;  2BIJ A;  3F9A A;  3V0E A;  3MVN A;  5MMZ B;  5CGE A;  1G1G A;  3RTD A;  4KBE A;  1WRM A;  4I8N A;  2SHP A;  3RQX A;  3ZM3 A;  1ZC0 A;  2F6W A;  2PQ5 A;  4WU3 A;  3S4E A;  1LHR A;  1RFU A;  4EN4 A;  3MMJ A;  2NTA A;  3BGK A;  4BUB A;  3VAS A;  2VAR A;  3UQ9 A;  1PA9 A;  1Q6M A;  2FV7 A;  3IN1 A;  4XCK A;  4S0G A;  4LC4 A;  5TRW A;  3CM3 A;  1YGR A;  1RFT A;  4ZN5 A;  1TD2 A;  4NWG A;  3V0J A;  2I3U A;  3D1Q A;  1GG4 A;  5BZZ A;  1SUG A;  2H03 A;  2FJN A;  4OHE A;  4E3A A;  3RO1 A;  1Q6N A;  5CM5 A;  1FQ1 A;  4C12 A;  4E8Z A;  2Q47 A;  3QCB A;  1XM2 A;  2GC5 A;  5EY7 A;  3I80 A;  4NYH A;  3QCD A;  2H04 A;  4GE5 A;  2OUD A;  3RTB A;  1VHR A;  1U24 A;  2F70 A;  3BM8 A;  2CM8 A;  3RM5 A;  3RQ8 A;  1OES A;  4AZ1 A;  2NZ6 A;  3S3K A;  1NZ7 A;  4JMK A;  5EYN A;  2HNP A;  3AWE A;  3MOW A;  1LIJ A;  2NT7 A;  5KA2 A;  3RTA A;  3RT7 A;  5IBM A;  3OTX A;  1L8K A;  1LQF A;  4NX8 A;  4UBE A;  4JNB A;  2ZMM A;  4B8S A;  1PTU A;  4H34 A;  4D3Q A;  2A8B A;  2GWO A;  3JUL A;  4EOH A;  1OET A;  2QDP A;  3NC2 A;  3VAQ A;  3QCZ A;  4LBG A;  2UUP A;  2I6P A;  1TZ6 A;  4K8T A;  4BJO A;  3DZV A;  5K23 A;  1RKS A;  3QCH A;  4B04 A;  3MOZ A;  1UAG A;  1G4W R;  4DGX A;  1XRI A;  5K24 A;  1YZ4 A;  3GXG A;  5K9V A;  2F46 A;  3UMP A;  1I9T A;  2CMB A;  5K22 A;  3PL2 A;  2H02 A;  2QHP A;  2C49 A;  3IQ0 A;  1OEU A;  4EUM A;  1NWE A;  2CNF A;  1V1B A;  3HYO A;  3ZS7 A;  2B3O A;  2GC6 A;  1J4X A;  2HXP A;  3S3E A;  4K9I A;  1E8C A;  4CVK A;  4GE2 A;  1LIO A;  1GQT A;  2PKN A;  4TVV A;  3NL3 A;  2VOR A;  1YHJ A;  2AHS A;  3D42 A;  1T48 A;  2DDM A;  2I6M A;  3O4U A;  2JGV A;  1PXH A;  3W4S A;  4RI4 A;  5J8R A;  3CQD A;  4YWR A;  2HCM A;  5IBS A;  3ZM6 A;  2Y1O A;  3V0D A;  4C5M A;  2AM1 A;  5B6A A;  2Y68 A;  4O1L A;  3EAX A;  3B1Q A;  3UQ6 A;  1RXD A;  2CM2 A;  4GRZ A;  3OLR A;  3D1H A;  1T4J A;  4B8R A;  3RGO A;  3RRB A;  3EZZ A;  4NWF A;  4C5K A;  3QCF A;  3S3F A;  2JFG A;  2HB1 A;  2HC2 A;  4DGP A;  4QBW A;  2UAG A;  4K8P A;  3RRJ A;  1C88 A;  2QCJ A;  2AWD A;  4S1H A;  1FPZ A;  1PYN A;  2F00 A;  1C3Q A;  4YL5 A;  1PH0 A;  4GS0 A;  1L2L A;  4S1I B;  1OHD A;  2VEX A;  4KAL A;  1EEO A;  3U96 A;  1ONZ A;  4XF6 A;  4PVV A;  2Y66 A;  2OZ5 A;  4PVG A;  2CNH A;  4R0S A;  2JFF A;  4XDA A;  5C3Z A;  1W7K A;  2QDM A;  3ZV2 A;  3Q1Y A;  3HIC A;  1G1H A;  2GCB A;  1UA4 A;  1VK4 A;  4K8K A;  3QCC A;  1GC5 A;  2F02 A;  1EKK A;  1G7G A;  1YWF A;  2CMC A;  1P3D A;  2J16 A;  1YTS A;  3A5J A;  2AJP A;  2YDU A;  3H49 A;  3HPD A;  3RTG A;  4DC3 A;  4KAN A;  2QBS A;  4OHD A;  1YN9 A;  2RBC A;  1C87 A;  2B4O A;  1U2X A;  3N1C A;  5GTJ A;  3O4S A;  2CFV A;  2I4G A;  2F7K A;  3GBU A;  3M4U A;  3AWF A;  2XTB A;  3LHX A;  1PTT A;  5KA3 A;  1BZJ A;  1JLN A;  3PZS A;  4QF5 A;  1Q6P A;  2Y96 A;  4QAH A;  3RTC A;  2BGE A;  2PBN A;  4KI9 A;  1I57 A;  3HJ6 A;  3RO4 A;  3I36 A;  5LXQ B;  3NCA A;  1ONY A;  3RY7 A;  4C5L A;  1OEM X;  1ZCL A;  4E8Y A;  2PA5 A;  1EEN A;  3QCK A;  3UMO A;  3UQD A;  2C46 A;  5KAB A;  1C85 A;  1YGJ A;  1VM7 A;  4DU5 A;  2PSZ A;  2E0T A;  2WGP A;  3BLU A;  2QBQ A;  3SR9 A;  4R30 A;  1AAX A;  5K9W A;  2VEY A;  4U7X A;  2PT0 A;  3EAG A;  2JG5 A;  2CNI A;  2Q5R A;  2GJT A;  1FGS A;  3BF5 A;  4Y2E A;  1UB0 A;  2VEW A;  3V0G A;  4QAP A;  1ESQ A;  4XF7 A;  3MBH A;  3NRS A;  4K9C A;  4RHG A;  5A5E A;  3KTN A;  3D44 A;  3UBO A;  5C40 A;  2A3K A;  1ECV A;  3RQ6 A;  4QDI A;  4CVM A;  3RRF A;  5EHP A;  1BZC A;  1OEO X;  4K93 A;  4BPC A;  3K9E A;  2F71 A;  1J6U A;  2QEP A;  1ZZW A;  1C86 A;  3V0F A;  2NT2 A;  2B49 A;  5KAC A;  3RQQ A;  1KAV A;  2M3V A;  1G4U S;  1OEV A;  3AWG A;  2P6X A;  1U25 A;  3RSQ A;  4QUN A;  4Z6B A;  1V1A A;  4HJQ A;  3H74 A;  3RRE A;  4RDD A;  3S3H A;  1RK2 A;  5A5F A;  3EWM A;  5KA8 A;  1T49 A;  3QKQ A;  4J51 A;  1WCH A;  5EHR A;  3I7Z A;  2Y67 A;  2VTD A;  1RPM A;  4S1I A;  4JKS A;  2DXP A;  2NWH A;  2BZL A;  1Q6J A;  3F41 A;  3S4O A;  3ZMQ A;  3EU0 A;  1LIK A;  3MBJ A;  3NL6 A;  1C84 A;  4HJP A;  4UAG A;  1R6H A;  2X5O A;  3NBV A;  1OHC A;  3GXH A;  2B4S A;  2C4E A;  2AA0 A;  4O1G A;  2B4P A;  2H4K A;  2AX3 A;  4D3P A;  3KD6 A;  2R3E A;  2R0B A;  3RSS A;  3RTE A;  4GFU A;  5BYC A;  3H2X A;  3B1P A;  2ZN7 A;  2HC1 A;  2VTE A;  3HN7 A;  2I1Y A;  2Y2F A;  4S1M A;  4RKK A;  3RQH A;  4HV4 A;  1E0D A;  1KAK A;  4BUC A;  3O3L A;  3QCG A;  3NM1 A;  1V19 A;  4OHI A;  1WAX A;  2VEV A;  1JXI A;  1TZ3 A;  4KYQ A;  2V78 A;  3O5X A;  1GFY A;  3QCN A;  5BUG A;  2DDO A;  3KZH A;  3RPZ A;  1LYV A;  2I5X A;  3NC9 A;  5BYF A;  1XBO A;  2Q05 A;  5BYE A;  2I4E A;  4GRY A;  3QCE A;  3LK7 A;  5C3Y A;  3ZL8 A;  1PA1 A;  3PS5 A;  3ZM0 A;  2OOQ A;  1X24 A;  3IBQ A;  1KYH A;  5KA9 A;  3NL5 A;  3GO6 A;  5AWX A;  2PKK A;  3QA2 A;  1EKQ A;  2JG1 A;  1C83 A;  2AB8 A;  5KA4 A;  1RFV A;  2QDC A;  4JJP A;  2HLZ A;  2F6T A;  3QKP A;  2NV5 A;  2WTZ A;  4GFV A;  2ABS A;  2JJD A;  4JMJ A;  2YXT A;  1Q6S A;  2CM7 A;  4H1O A;  3RPH A;  4MBB A;  2QCV A;  1LII A;  3RSF A;  1ESJ A;  3PYZ A;  1YGU A;  2H4G A;  4RH5 A;  1LHP A;  4X8F A;  1V3A A;  1RKD A;  3FHX A;  3NME A;  2ABQ A;  2FJM A;  5C41 A;  2F6V A;  4N08 A;  2PKF A;  5F0Z A;  4WU2 A;  4QBE A;  2UUO A;  1G1F A;  3OMH A;  4WTY A;  2H4V A;  1TYY A;  3LJ8 A;  5COJ A;  3V0I A;  2VEU A;  2I6B A;  1W78 A;  4OHL A;  4RI5 A;  2PKM A;  1P15 A;  2OC3 A;  2JFH A;  4E84 A;  2I42 A;  4IKC A;  3NBW A;  2QBR A;  2IMG A;  1PTY A;  3LOO A;  2WJP A;  2CJZ A;  2DDW A;  2A9Y A;  2BGD A;  4E8W A;  3UQE A;  4K8C A;  3SME A;  2HQQ A;  2F6F A;  2YXU A;  4NND A;  4KAH A;  3B3L A;  2PI7 A;  3FHY A;  1OHE A;  3LJS A;  2CM3 A;  2QCT A;  3ZM1 A;  3EB1 A;  4ERC A;  5I6V A;  3ZM5 A;  2XPC A;  4E69 A;  3RU3 A;  1XXV A;  3UAG A;  1YFO A;  1GWZ A;  2CNE A;  1I9S A;  3N0A A;  3I3Y A;  5KA7 A;  4HRF A;  4C5N A;  2I5B A;  2MBC A;  1XXP A;  4ICZ A;  3IE7 A;  1YTW A;  2C7S A;  1GQY A;  2HW1 A;  4N09 A;  4C13 A;  2P4D A;  3KEU A;  3GO7 A;  2J17 A;  2BV5 A;  1NL9 A;  1QXK A;  2AJR A;  5F11 A;  3O4T A;  3LKI A;  4C5J A;  2DCN A;  2AZR A;  3CWE A;  3B7O A;  3RQ2 A;  4JKU A;  3A5K A;  1JXH A;  1EEH A;  2CMA A;  4GE6 A;  1JBW A;  3EMU A;  5HDE A;  3IH0 A;  4WJM A;  3BRH A;  2GP0 A;  2I6I A;  4Y14 A;  2GCA A;  5CGA A;  1NO6 A;  1Q1M A;  1GQQ A;  3DRW A;  2I6O A;  3D9C A;  3ZM2 A;  3B1R A;  1NWL A;  3F99 A;  2F6Y A;  4GM6 A;  3F9B A;  4GWF A;  4WOH A;  2I75 A;  1BZH A;  5BX1 A;  1M3G A;  2VOS A;  1FPR A;  3QCJ A;  2HY3 A;  4OHH A;  3D1O A;  2B07 A;  5KA1 A;  1O5Z A;  2B4U A;  3RT9 A;  4ZI4 A;  3IKH A;  2HNQ A;  3F81 A;  3QAI A;  3RS9 A;  1U26 A;  2RF6 A;  3B1O A;  3RS8 A;  2I6A A;  5TQI A;  3QCI A;  4YAA A;  4ZRT A;  4R0T A;  2CNG A;  4QUM A;  1RKA A;  2HVL A;  5BZX A;  1Q6T A;  2G6Z A; 
#chains in the Genus database with same CATH homology
 2AM1 A;  2Y68 A;  3N2A A;  2Y66 A;  1GG4 A;  1GQY A;  1J6U A;  2AM2 A;  3PYZ A;  2WJP A;  4C13 A;  2VOS A;  2JFF A;  3EAG A;  4UAG A;  1W7K A;  2GC6 A;  4C12 A;  1JBV A;  2X5O A;  1FGS A;  1O5Z A;  4QF5 A;  2GC5 A;  1E8C A;  2GCB A;  4CVK A;  3MVN A;  3NRS A;  2XJA A;  4CVL A;  3QCZ A;  5A5E A;  2UUO A;  2UUP A;  1EEH A;  2VOR A;  2JFG A;  3LK7 A;  3ZL8 A;  1JBW A;  1P3D A;  4QDI A;  3ZM5 A;  2XPC A;  2UAG A;  3UAG A;  4CVM A;  2VTE A;  2WTZ A;  3HN7 A;  5A5F A;  4BUB A;  1W78 A;  4HV4 A;  1E0D A;  1P31 A;  1UAG A;  2F00 A;  2GCA A;  4ZIY A;  4BUC A;  3ZM6 A;  2JFH A;  1GQQ A;  2Y1O A;  2Y67 A;  2VTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...