2GCAA

Apo form of l. casei fpgs
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
425
structure length
410
Chain Sequence
MNYTETVAYIHSFPRLAKTGDHRRILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLQQQQADFNVTEFEFITALGYWYFRQRQVDVAVIEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPDAAAVVAAKVATTGSQWLRFDRDFSVPKAKLHGWGQRFTYEDQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGILYAAMADRLTAAFSTVYLVPVPGTPRALRLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation of Gly51 to serine in the P-loop of Lactobacillus casei folylpolyglutamate synthetase abolishes activity by altering the conformation of two adjacent loops.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Ligase
molecule keywords Folylpolyglutamate synthase
total genus 135
structure length 410
sequence length 425
ec nomenclature ec 6.3.2.17: Tetrahydrofolate synthase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02875 Mur_ligase_C Mur ligase family, glutamate ligase domain
A PF08245 Mur_ligase_M Mur ligase middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.10 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase Mur-like, catalytic domain 2gcaA01
3.90.190.20 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Mur ligase, C-terminal domain 2gcaA02
2X5OA 3HN7A 2JFGA 1O5ZA 1W7KA 2WJPA 3QCZA 1UAGA 2F00A 5A5EA 2VORA 2UUPA 1JBVA 2GC5A 2VTDA 2Y68A 2XPCA 4ZIYA 4HV4A 2XJAA 2Y67A 4CVKA 2JFHA 2Y1OA 1P31A 3ZM6A 4CVMA 1JBWA 3NRSA 1EEHA 1GQQA 3MVNA 1J6UA 3UAGA 3PYZA 1W78A 1P3DA 4QF5A 3EAGA 2WTZA 4C13A 2GCAA 2VOSA 2GC6A 1FGSA 2Y66A 3ZL8A 4BUCA 2GCBA 3ZM5A 4UAGA 4BUBA 1GQYA 1E0DA 2AM2A 2AM1A 2UAGA 4CVLA 1GG4A 2UUOA 3N2AA 4C12A 4QDIA 3LK7A 5A5FA 2VTEA 2JFFA 1E8CA
chains in the Genus database with same CATH superfamily
3KZHA 3NL6A 1RFUA 1GWZA 1Q6JA 1QXKA 2C4EA 2Y68A 2FJMA 3DZVA 3B1OA 1OHCA 3QKQA 3I7ZA 2XJAA 3QKPA 4J51A 4GRZA 1GQTA 4S1IA 3UQ6A 3RPZA 4KANA 1PTUA 1PXHA 4QUNA 1ZCLA 3ZM1A 1KYHA 5F0ZA 3MMJA 3HICA 3D9CA 1ONZA 5C41A 3EAGA 4ZN5A 4K8CA 1V19A 3UQ9A 1RXDA 1J4XA 4IKCA 5BYEA 2ESBA 4BPCA 3B1RA 1LHPA 3RQ6A 3N2AA 4NNDA 2H4KA 1XBOA 2YDUA 3QCHA 4D3QA 1PYNA 2JG5A 3PL2A 4S0GA 2J16A 1ZC0A 4PVVA 4X8FA 2PSZA 4TVVA 2HLZA 1C86A 2OOQA 3NM3A 2I6BA 4WJMA 3RQXA 2I1YA 3RPHA 4KYRA 3CM3A 3RSGA 1NO6A 4DGXA 1JBWA 1U25A 3K9EA 2I5XA 5K9VA 3BLUA 2QBPA 2QEPA 4DC3A 1JF7A 2OUDA 3IKHA 1G1FA 1YHJA 4O1GA 4GM6A 2QCJA 1RPMA 2DDMA 1E0DA 3V0EA 2ZN7A 2VEUA 1V1AA 5A5FA 2JFFA 3RRFA 3H2XA 1UAGA 3N0AA 3I3YA 4E8YA 5BYDA 3A5JA 4UBEA 2NV5A 3B7OA 3EWMA 2H02A 5BUGA 4ZI4A 5EHPA 2BGEA 2CM2A 3NC9A 1C83A 2G59A 3B1QA 2H03A 2I3RA 2I5BA 1ZZWA 1W78A 4HJQA 4DGPA 3UBOA 4C5LA 3V0DA 3S3KA 2SHPA 2G6ZA 2Y2FA 3LHXA 5K24A 3ZM2A 3SR9A 2F6VA 3Q92A 1G1HA 1RKSA 5IBSA 1RKAA 1NNYA 3RT7A 1M3GA 3LJSA 2PKKA 1Q6PA 2PKMA 4K8PA 2P4DA 3RREA 3B1PA 4OHLA 1YGKA 3NBVA 4RH5A 2FV7A 5KA1A 3V0FA 3RTEA 4R0SA 1TZ3A 3QCJA 4O1LA 2Q05A 1NWLA 3PYZA 2DDWA 1T49A 2QBQA 3ZMPA 5BYFA 2NT7A 3UQDA 3S3FA 2HXPA 5J8RA 1LHRA 1JLNA 1TYYA 1FPZA 4JNBA 3HYOA 4EBUA 2JJDA 4C12A 2R3BA 2AB8A 5EHRA 1YGJA 4D3RA 3RSFA 1ECVA 3RO4A 1Q6NA 4YWRA 2FJNA 1U2XA 2F46A 2I4EA 1OEVA 1G7FA 2Y67A 2F6WA 1P15A 3BF5A 3D1QA 4KADA 3ZS7A 4JMKA 1XXVA 3O4TA 3S4OA 3IE7A 2B07A 2C49A 1YTNA 2P6XA 4B8SA 4K9IA 1V1SA 3FHYA 4AZ1A 1I9SA 3BGKA 3D1HA 2C7SA 1RFTA 4WU2A 1R6HA 5KADA 3IH0A 2DCNA 5F11A 2B3OA 2JFGA 1O5ZA 2WJPA 3QCLA 2NZ6A 1SUGA 4K93A 4YAAA 4D3PA 2F6TA 3OMHA 1YGRA 1JBVA 2CNIA 2NTAA 1VM7A 2OZ5A 2VEVA 2QDCA 2H4VA 4OHEA 4EOHA 3LKIA 2AX3A 3RQ8A 4KYQA 5IBMA 1C87A 2F02A 2F70A 1AAXA 4B04A 1U26A 3F99A 3H49A 4QF5A 3B1NA 3S3HA 1X24A 5KA8A 1V1BA 2HC2A 3UMOA 1GQYA 4GE5A 2AM1A 2PBNA 2WGPA 4B8RA 1I57A 2VTEA 2HC1A 2X5OA 2VEXA 2QBSA 3RGOA 5LXQB 5A5EA 3O4UA 3K5WA 1PA9A 2VORA 1Q6MA 4C5NA 5KAAA 3RU3A 2PA5A 1C88A 3RTDA 4ZRTA 1OEUA 3NCAA 2GWOA 1OEOX 2HNPA 1UA4A 4KALA 2I6PA 1JXHA 1I9TA 4E8WA 3EZZA 3B3LA 2CMBA 2I6OA 2AJPA 2R3EA 3KEUA 4XCKA 4HJPA 3RGQA 3RRJA 2QDMA 1NZ7A 2AFBA 3ZL8A 1YTWA 2NLKA 2B4OA 2I4GA 2F6YA 1PTVA 2IMGA 5AWXA 2UUOA 1TZ6A 3RTBA 1WRMA 5HDEA 3NBWA 1E8CA 2FH7A 1OESA 1W7KA 3RRBA 2MBCA 2AZRA 4ICZA 2XTBA 4GE6A 4KI9A 4JMJA 1YZ4A 4GE2A 4RHGA 2BGDA 3ZMQA 4C5KA 2A8BA 3NL5A 3MVNA 3F9BA 1EKQA 2DDOA 4K8TA 1YTSA 5CGAA 2GC6A 2Y66A 2BZLA 3IBQA 1VHRA 3RS9A 4E69A 2I3UA 3GO7A 3O3LA 2AM2A 1ESQA 4OHIA 1LIJA 2GJTA 4LC4A 2C46A 3I36A 4NWFA 3NM1A 5KA3A 3GO6A 5KA4A 4C5MA 2HVLA 2B4SA 5KA2A 2E0TA 1OEMX 5M43A 1LYVA 2Y1OA 3JULA 2PKNA 1BX4A 4JJPA 3NL2A 2ABSA 4N08A 2PQ5A 3SMEA 1P3DA 1C85A 2F6FA 1VK4A 2VOSA 5TRWA 3RQQA 3IN1A 4OHDA 4UAGA 4BUBA 1L2LA 1BZCA 2HQQA 1G7GA 2I4HA 3PS5A 3GBUA 1EEOA 1ONYA 2H04A 4RH9A 3LK7A 4K8KA 4QAHA 1T4JA 3AWGA 3KD6A 1BZJA 1KAKA 4WU3A 2CNEA 2GC5A 2M3VA 5BX1A 4HV4A 4JKSA 5B6AA 3V0HA 4C5JA 1RKDA 3ZM3A 1Q6SA 5BZXA 1YFOA 3VASA 2JGVA 2I42A 4Y14A 1LIIA 1J6UA 3UAGA 4H34A 2I6JA 4NX8A 3CWEA 2QBRA 1OHDA 1LIOA 1C3QA 2VARA 2PKFA 1C84A 4BUCA 2Y96A 2CJZA 2A3KA 3D44A 4XDAA 2CNGA 1ESJA 1A5YA 4RI5A 2AHSA 4RKKA 2CM8A 3BLTA 2BV5A 3RTGA 4MBBA 1ZCKA 1LQFA 2J17A 3V0JA 1QZ0A 4JKUA 5C40A 1WCHA 3PZSA 1JXIA 3OLRA 1EKKA 3QCDA 4PYHA 2NT2A 2PT0A 4RI4A 4XF7A 1G4WR 2VEYA 3D42A 1RFVA 3QA2A 3RS8A 4ERCA 2GCAA 4OHHA 1RK2A 3W4SA 4DU5A 1OETA 2CFVA 3MOZA 1T48A 3MOWA 5K25A 1PTYA 5GTJA 5BYCA 2I6AA 3CQDA 4LCAA 3HN7A 2HNQA 3EU0A 2H4GA 3V0GA 2YXUA 4BJOA 3RZ2A 3RT9A 5CM5A 2CNHA 1OHEA 3F9AA 4NWGA 2CM3A 1XRIA 2CNFA 3UMPA 4JBCA 4XF6A 2QDPA 3RM5A 2JFHA 3ZM6A 1PH0A 1DGMA 3KTNA 3QCEA 1V3AA 2I6MA 2A9ZA 2WTZA 4C13A 3QCBA 4YL5A 2QHPA 1XM2A 3FHXA 4R30A 3RU2A 5K9WA 2DXPA 2QCTA 3F81A 4Y2EA 3RO1A 1YWFA 3V0IA 3GXHA 1L8KA 2RF6A 3IQ0A 2ZMMA 3QCZA 4S1IB 2F00A 3QCCA 3DRWA 5COJA 4QBEA 1G1GA 3QCFA 2CMCA 2HW1A 2NWHA 2XPCA 2RBCA 4N09A 4PVGA 4WOHA 4S1HA 3O5XA 4GFUA 1MKPA 4GWFA 3RQ2A 1P31A 4EUMA 4CVMA 4K9CA 2GP0A 1EEHA 2AA0A 2Q47A 1NWEA 4GRYA 2HB1A 3RY7A 3N1CA 3QCKA 3U96A 2J16B 2F6ZA 1VI9A 4RDDA 4Z6BA 5KACA 3LJ8A 4CVLA 1GG4A 1EENA 3MBJA 5MMZB 3H74A 3RSQA 1YN9A 5TQIA 3EMUA 2OC3A 3EAXA 5BZZA 2UUPA 1BZHA 4NYHA 1FPRA 1U24A 2B4UA 1YPTA 5I6VA 4EN4A 3NMEA 3A5KA 3VAQA 3NRSA 1G4US 5KA9A 1Q1MA 1D5RA 3BRHA 3ZV2A 2V78A 3F41A 3NL3A 3RQHA 1LARA 2CMAA 1Q6TA 4H1OA 1FGSA 4KAHA 2B4PA 4I8NA 1PA1A 2F71A 3OTXA 3RTCA 4HRFA 4QUMA 2B49A 5CGEA 2UAGA 1WAXA 1NL9A 4QAPA 2I75A 3UQEA 4E84A 1YGUA 2HCMA 4S1MA 3GXGA 3Q1YA 3ZM0A 3QCNA 4GS0A 3LOOA 2AWDA 2QCVA 3QCGA 2VTDA 1XXPA 2CM7A 3AWFA 4ZIYA 4QBWA 4CVKA 3D1OA 1KAVA 3BM8A 1GC5A 4U7XA 3QCIA 1GQQA 3AWEA 3S4EA 2R0BA 5C3YA 2YXTA 3O4SA 3MBHA 3HJ6A 5K22A 5EY7A 4LBXA 2ABQA 1TD2A 3RSSA 2A9YA 1GFYA 3I80A 4QDIA 2JG1A 1LIKA 1FQ1A 3M4UA 2F7KA 3NC2A 4R0TA 1L8GA 4YR8B 5EYNA 3EB1A 1UB0A 2PI7A 3QCMA 5C3ZA 4WTYA 4GFVA 3RQ5A 5K23A 4E3AA 2VEWA 2I6IA 3HPDA 1WYEA 1PTTA 2HY3A 5KA0A 3RTAA 3S3EA 2BIJA 4LBGA 5KA7A 2GCBA 3QAIA 3ZM5A 2AJRA 5KABA 2Q5RA 4KBEA 4E8ZA
chains in the Genus database with same CATH topology
2X5OA 3HN7A 2JFGA 1O5ZA 1W7KA 2WJPA 3QCZA 1UAGA 2F00A 5A5EA 2VORA 2UUPA 1JBVA 2GC5A 2VTDA 2Y68A 2XPCA 4ZIYA 4HV4A 2XJAA 2Y67A 4CVKA 2JFHA 2Y1OA 1P31A 3ZM6A 4CVMA 1JBWA 3NRSA 1EEHA 1GQQA 3MVNA 1J6UA 3UAGA 3PYZA 1W78A 1P3DA 4QF5A 3EAGA 2WTZA 4C13A 2GCAA 2VOSA 2GC6A 1FGSA 2Y66A 3ZL8A 4BUCA 2GCBA 3ZM5A 4UAGA 4BUBA 1GQYA 1E0DA 2AM2A 2AM1A 2UAGA 4CVLA 1GG4A 2UUOA 3N2AA 4C12A 4QDIA 3LK7A 5A5FA 2VTEA 2JFFA 1E8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5O A;  3HN7 A;  2JFG A;  1O5Z A;  1W7K A;  2WJP A;  3QCZ A;  1UAG A;  2F00 A;  5A5E A;  2VOR A;  2UUP A;  1JBV A;  2GC5 A;  2VTD A;  2Y68 A;  2XPC A;  4ZIY A;  4HV4 A;  2XJA A;  2Y67 A;  4CVK A;  2JFH A;  2Y1O A;  1P31 A;  3ZM6 A;  4CVM A;  1JBW A;  3NRS A;  1EEH A;  1GQQ A;  3MVN A;  1J6U A;  3UAG A;  3PYZ A;  1W78 A;  1P3D A;  4QF5 A;  3EAG A;  2WTZ A;  4C13 A;  2GCA A;  2VOS A;  2GC6 A;  1FGS A;  2Y66 A;  3ZL8 A;  4BUC A;  2GCB A;  3ZM5 A;  4UAG A;  4BUB A;  1GQY A;  1E0D A;  2AM2 A;  2AM1 A;  2UAG A;  4CVL A;  1GG4 A;  2UUO A;  3N2A A;  4C12 A;  4QDI A;  3LK7 A;  5A5F A;  2VTE A;  2JFF A;  1E8C A; 
#chains in the Genus database with same CATH topology
 3KZH A;  3NL6 A;  1RFU A;  1GWZ A;  1Q6J A;  1QXK A;  2C4E A;  2Y68 A;  2FJM A;  3DZV A;  3B1O A;  1OHC A;  3QKQ A;  3I7Z A;  2XJA A;  3QKP A;  4J51 A;  4GRZ A;  1GQT A;  4S1I A;  3UQ6 A;  3RPZ A;  4KAN A;  1PTU A;  1PXH A;  4QUN A;  1ZCL A;  3ZM1 A;  1KYH A;  5F0Z A;  3MMJ A;  3HIC A;  3D9C A;  1ONZ A;  5C41 A;  3EAG A;  4ZN5 A;  4K8C A;  1V19 A;  3UQ9 A;  1RXD A;  1J4X A;  4IKC A;  5BYE A;  2ESB A;  4BPC A;  3B1R A;  1LHP A;  3RQ6 A;  3N2A A;  4NND A;  2H4K A;  1XBO A;  2YDU A;  3QCH A;  4D3Q A;  1PYN A;  2JG5 A;  3PL2 A;  4S0G A;  2J16 A;  1ZC0 A;  4PVV A;  4X8F A;  2PSZ A;  4TVV A;  2HLZ A;  1C86 A;  2OOQ A;  3NM3 A;  2I6B A;  4WJM A;  3RQX A;  2I1Y A;  3RPH A;  4KYR A;  3CM3 A;  3RSG A;  1NO6 A;  4DGX A;  1JBW A;  1U25 A;  3K9E A;  2I5X A;  5K9V A;  3BLU A;  2QBP A;  2QEP A;  4DC3 A;  1JF7 A;  2OUD A;  3IKH A;  1G1F A;  1YHJ A;  4O1G A;  4GM6 A;  2QCJ A;  1RPM A;  2DDM A;  1E0D A;  3V0E A;  2ZN7 A;  2VEU A;  1V1A A;  5A5F A;  2JFF A;  3RRF A;  3H2X A;  1UAG A;  3N0A A;  3I3Y A;  4E8Y A;  5BYD A;  3A5J A;  4UBE A;  2NV5 A;  3B7O A;  3EWM A;  2H02 A;  5BUG A;  4ZI4 A;  5EHP A;  2BGE A;  2CM2 A;  3NC9 A;  1C83 A;  2G59 A;  3B1Q A;  2H03 A;  2I3R A;  2I5B A;  1ZZW A;  1W78 A;  4HJQ A;  4DGP A;  3UBO A;  4C5L A;  3V0D A;  3S3K A;  2SHP A;  2G6Z A;  2Y2F A;  3LHX A;  5K24 A;  3ZM2 A;  3SR9 A;  2F6V A;  3Q92 A;  1G1H A;  1RKS A;  5IBS A;  1RKA A;  1NNY A;  3RT7 A;  1M3G A;  3LJS A;  2PKK A;  1Q6P A;  2PKM A;  4K8P A;  2P4D A;  3RRE A;  3B1P A;  4OHL A;  1YGK A;  3NBV A;  4RH5 A;  2FV7 A;  5KA1 A;  3V0F A;  3RTE A;  4R0S A;  1TZ3 A;  3QCJ A;  4O1L A;  2Q05 A;  1NWL A;  3PYZ A;  2DDW A;  1T49 A;  2QBQ A;  3ZMP A;  5BYF A;  2NT7 A;  3UQD A;  3S3F A;  2HXP A;  5J8R A;  1LHR A;  1JLN A;  1TYY A;  1FPZ A;  4JNB A;  3HYO A;  4EBU A;  2JJD A;  4C12 A;  2R3B A;  2AB8 A;  5EHR A;  1YGJ A;  4D3R A;  3RSF A;  1ECV A;  3RO4 A;  1Q6N A;  4YWR A;  2FJN A;  1U2X A;  2F46 A;  2I4E A;  1OEV A;  1G7F A;  2Y67 A;  2F6W A;  1P15 A;  3BF5 A;  3D1Q A;  4KAD A;  3ZS7 A;  4JMK A;  1XXV A;  3O4T A;  3S4O A;  3IE7 A;  2B07 A;  2C49 A;  1YTN A;  2P6X A;  4B8S A;  4K9I A;  1V1S A;  3FHY A;  4AZ1 A;  1I9S A;  3BGK A;  3D1H A;  2C7S A;  1RFT A;  4WU2 A;  1R6H A;  5KAD A;  3IH0 A;  2DCN A;  5F11 A;  2B3O A;  2JFG A;  1O5Z A;  2WJP A;  3QCL A;  2NZ6 A;  1SUG A;  4K93 A;  4YAA A;  4D3P A;  2F6T A;  3OMH A;  1YGR A;  1JBV A;  2CNI A;  2NTA A;  1VM7 A;  2OZ5 A;  2VEV A;  2QDC A;  2H4V A;  4OHE A;  4EOH A;  3LKI A;  2AX3 A;  3RQ8 A;  4KYQ A;  5IBM A;  1C87 A;  2F02 A;  2F70 A;  1AAX A;  4B04 A;  1U26 A;  3F99 A;  3H49 A;  4QF5 A;  3B1N A;  3S3H A;  1X24 A;  5KA8 A;  1V1B A;  2HC2 A;  3UMO A;  1GQY A;  4GE5 A;  2AM1 A;  2PBN A;  2WGP A;  4B8R A;  1I57 A;  2VTE A;  2HC1 A;  2X5O A;  2VEX A;  2QBS A;  3RGO A;  5LXQ B;  5A5E A;  3O4U A;  3K5W A;  1PA9 A;  2VOR A;  1Q6M A;  4C5N A;  5KAA A;  3RU3 A;  2PA5 A;  1C88 A;  3RTD A;  4ZRT A;  1OEU A;  3NCA A;  2GWO A;  1OEO X;  2HNP A;  1UA4 A;  4KAL A;  2I6P A;  1JXH A;  1I9T A;  4E8W A;  3EZZ A;  3B3L A;  2CMB A;  2I6O A;  2AJP A;  2R3E A;  3KEU A;  4XCK A;  4HJP A;  3RGQ A;  3RRJ A;  2QDM A;  1NZ7 A;  2AFB A;  3ZL8 A;  1YTW A;  2NLK A;  2B4O A;  2I4G A;  2F6Y A;  1PTV A;  2IMG A;  5AWX A;  2UUO A;  1TZ6 A;  3RTB A;  1WRM A;  5HDE A;  3NBW A;  1E8C A;  2FH7 A;  1OES A;  1W7K A;  3RRB A;  2MBC A;  2AZR A;  4ICZ A;  2XTB A;  4GE6 A;  4KI9 A;  4JMJ A;  1YZ4 A;  4GE2 A;  4RHG A;  2BGD A;  3ZMQ A;  4C5K A;  2A8B A;  3NL5 A;  3MVN A;  3F9B A;  1EKQ A;  2DDO A;  4K8T A;  1YTS A;  5CGA A;  2GC6 A;  2Y66 A;  2BZL A;  3IBQ A;  1VHR A;  3RS9 A;  4E69 A;  2I3U A;  3GO7 A;  3O3L A;  2AM2 A;  1ESQ A;  4OHI A;  1LIJ A;  2GJT A;  4LC4 A;  2C46 A;  3I36 A;  4NWF A;  3NM1 A;  5KA3 A;  3GO6 A;  5KA4 A;  4C5M A;  2HVL A;  2B4S A;  5KA2 A;  2E0T A;  1OEM X;  5M43 A;  1LYV A;  2Y1O A;  3JUL A;  2PKN A;  1BX4 A;  4JJP A;  3NL2 A;  2ABS A;  4N08 A;  2PQ5 A;  3SME A;  1P3D A;  1C85 A;  2F6F A;  1VK4 A;  2VOS A;  5TRW A;  3RQQ A;  3IN1 A;  4OHD A;  4UAG A;  4BUB A;  1L2L A;  1BZC A;  2HQQ A;  1G7G A;  2I4H A;  3PS5 A;  3GBU A;  1EEO A;  1ONY A;  2H04 A;  4RH9 A;  3LK7 A;  4K8K A;  4QAH A;  1T4J A;  3AWG A;  3KD6 A;  1BZJ A;  1KAK A;  4WU3 A;  2CNE A;  2GC5 A;  2M3V A;  5BX1 A;  4HV4 A;  4JKS A;  5B6A A;  3V0H A;  4C5J A;  1RKD A;  3ZM3 A;  1Q6S A;  5BZX A;  1YFO A;  3VAS A;  2JGV A;  2I42 A;  4Y14 A;  1LII A;  1J6U A;  3UAG A;  4H34 A;  2I6J A;  4NX8 A;  3CWE A;  2QBR A;  1OHD A;  1LIO A;  1C3Q A;  2VAR A;  2PKF A;  1C84 A;  4BUC A;  2Y96 A;  2CJZ A;  2A3K A;  3D44 A;  4XDA A;  2CNG A;  1ESJ A;  1A5Y A;  4RI5 A;  2AHS A;  4RKK A;  2CM8 A;  3BLT A;  2BV5 A;  3RTG A;  4MBB A;  1ZCK A;  1LQF A;  2J17 A;  3V0J A;  1QZ0 A;  4JKU A;  5C40 A;  1WCH A;  3PZS A;  1JXI A;  3OLR A;  1EKK A;  3QCD A;  4PYH A;  2NT2 A;  2PT0 A;  4RI4 A;  4XF7 A;  1G4W R;  2VEY A;  3D42 A;  1RFV A;  3QA2 A;  3RS8 A;  4ERC A;  2GCA A;  4OHH A;  1RK2 A;  3W4S A;  4DU5 A;  1OET A;  2CFV A;  3MOZ A;  1T48 A;  3MOW A;  5K25 A;  1PTY A;  5GTJ A;  5BYC A;  2I6A A;  3CQD A;  4LCA A;  3HN7 A;  2HNQ A;  3EU0 A;  2H4G A;  3V0G A;  2YXU A;  4BJO A;  3RZ2 A;  3RT9 A;  5CM5 A;  2CNH A;  1OHE A;  3F9A A;  4NWG A;  2CM3 A;  1XRI A;  2CNF A;  3UMP A;  4JBC A;  4XF6 A;  2QDP A;  3RM5 A;  2JFH A;  3ZM6 A;  1PH0 A;  1DGM A;  3KTN A;  3QCE A;  1V3A A;  2I6M A;  2A9Z A;  2WTZ A;  4C13 A;  3QCB A;  4YL5 A;  2QHP A;  1XM2 A;  3FHX A;  4R30 A;  3RU2 A;  5K9W A;  2DXP A;  2QCT A;  3F81 A;  4Y2E A;  3RO1 A;  1YWF A;  3V0I A;  3GXH A;  1L8K A;  2RF6 A;  3IQ0 A;  2ZMM A;  3QCZ A;  4S1I B;  2F00 A;  3QCC A;  3DRW A;  5COJ A;  4QBE A;  1G1G A;  3QCF A;  2CMC A;  2HW1 A;  2NWH A;  2XPC A;  2RBC A;  4N09 A;  4PVG A;  4WOH A;  4S1H A;  3O5X A;  4GFU A;  1MKP A;  4GWF A;  3RQ2 A;  1P31 A;  4EUM A;  4CVM A;  4K9C A;  2GP0 A;  1EEH A;  2AA0 A;  2Q47 A;  1NWE A;  4GRY A;  2HB1 A;  3RY7 A;  3N1C A;  3QCK A;  3U96 A;  2J16 B;  2F6Z A;  1VI9 A;  4RDD A;  4Z6B A;  5KAC A;  3LJ8 A;  4CVL A;  1GG4 A;  1EEN A;  3MBJ A;  5MMZ B;  3H74 A;  3RSQ A;  1YN9 A;  5TQI A;  3EMU A;  2OC3 A;  3EAX A;  5BZZ A;  2UUP A;  1BZH A;  4NYH A;  1FPR A;  1U24 A;  2B4U A;  1YPT A;  5I6V A;  4EN4 A;  3NME A;  3A5K A;  3VAQ A;  3NRS A;  1G4U S;  5KA9 A;  1Q1M A;  1D5R A;  3BRH A;  3ZV2 A;  2V78 A;  3F41 A;  3NL3 A;  3RQH A;  1LAR A;  2CMA A;  1Q6T A;  4H1O A;  1FGS A;  4KAH A;  2B4P A;  4I8N A;  1PA1 A;  2F71 A;  3OTX A;  3RTC A;  4HRF A;  4QUM A;  2B49 A;  5CGE A;  2UAG A;  1WAX A;  1NL9 A;  4QAP A;  2I75 A;  3UQE A;  4E84 A;  1YGU A;  2HCM A;  4S1M A;  3GXG A;  3Q1Y A;  3ZM0 A;  3QCN A;  4GS0 A;  3LOO A;  2AWD A;  2QCV A;  3QCG A;  2VTD A;  1XXP A;  2CM7 A;  3AWF A;  4ZIY A;  4QBW A;  4CVK A;  3D1O A;  1KAV A;  3BM8 A;  1GC5 A;  4U7X A;  3QCI A;  1GQQ A;  3AWE A;  3S4E A;  2R0B A;  5C3Y A;  2YXT A;  3O4S A;  3MBH A;  3HJ6 A;  5K22 A;  5EY7 A;  4LBX A;  2ABQ A;  1TD2 A;  3RSS A;  2A9Y A;  1GFY A;  3I80 A;  4QDI A;  2JG1 A;  1LIK A;  1FQ1 A;  3M4U A;  2F7K A;  3NC2 A;  4R0T A;  1L8G A;  4YR8 B;  5EYN A;  3EB1 A;  1UB0 A;  2PI7 A;  3QCM A;  5C3Z A;  4WTY A;  4GFV A;  3RQ5 A;  5K23 A;  4E3A A;  2VEW A;  2I6I A;  3HPD A;  1WYE A;  1PTT A;  2HY3 A;  5KA0 A;  3RTA A;  3S3E A;  2BIJ A;  4LBG A;  5KA7 A;  2GCB A;  3QAI A;  3ZM5 A;  2AJR A;  5KAB A;  2Q5R A;  4KBE A;  4E8Z A; 
#chains in the Genus database with same CATH homology
 2X5O A;  3HN7 A;  2JFG A;  1O5Z A;  1W7K A;  2WJP A;  3QCZ A;  1UAG A;  2F00 A;  5A5E A;  2VOR A;  2UUP A;  1JBV A;  2GC5 A;  2VTD A;  2Y68 A;  2XPC A;  4ZIY A;  4HV4 A;  2XJA A;  2Y67 A;  4CVK A;  2JFH A;  2Y1O A;  1P31 A;  3ZM6 A;  4CVM A;  1JBW A;  3NRS A;  1EEH A;  1GQQ A;  3MVN A;  1J6U A;  3UAG A;  3PYZ A;  1W78 A;  1P3D A;  4QF5 A;  3EAG A;  2WTZ A;  4C13 A;  2GCA A;  2VOS A;  2GC6 A;  1FGS A;  2Y66 A;  3ZL8 A;  4BUC A;  2GCB A;  3ZM5 A;  4UAG A;  4BUB A;  1GQY A;  1E0D A;  2AM2 A;  2AM1 A;  2UAG A;  4CVL A;  1GG4 A;  2UUO A;  3N2A A;  4C12 A;  4QDI A;  3LK7 A;  5A5F A;  2VTE A;  2JFF A;  1E8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...