2GCDA

Tao2 kinase domain-staurosporine structure
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
309
structure length
308
Chain Sequence
b'DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TAO2
publication title Crystal structure of the MAP3K TAO2 kinase domain bound by an inhibitor staurosporine.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 96
structure length 308
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gcdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gcdA01
3DFAA 2OJ9A 5J87A 2R3KA 3ACKA 4DH7A 3UQFA 5BUIA 2XRWA 4HYHA 2G9XA 3I7BA 3PJ2A 1PXLA 3O8TA 4L67A 3K5VA 3RNIA 3A99A 1FVTA 2R0UA 5IDPA 4HCTA 1Q99A 4JIAA 4O7NA 3ZO4A 4FNYA 2IZRA 2NO3A 5J79A 4CQEA 1XH6A 3WIKA 4AX8A 1IA8A 2HK5A 3E93A 3MVJA 4BYJA 4OTPA 2R3GA 5BNJA 1SNUA 3R28A 2FH9A 2XS0A 3A7FA 4FC0A 4FOBA 3N9XA 1H07A 2ZDUA 4D2PA 1PMNA 1JNKA 3O96A 3E3BX 5L8JA 4O96A 4RT7A 2C3JA 3GC0A 4AXAA 3MH2A 4Q9ZA 4BCJA 2BKKA 5EYCA 2I40A 1ZYLA 3R8PA 3QGYA 3BBWA 3IOPA 5LCKA 3D94A 4BDFA 4C35A 3CBLA 4O81A 4YLKA 3K54A 3EFWA 5CVFA 3F3WA 1GY3A 1Z57A 3TNPC 5CQWA 2C1AA 1ZY4A 2OFVA 3B8RA 2Y0AA 3HL7A 4QP4A 4OTDA 4RVLA 2WMBA 5HCXA 4HGSA 1BI8A 5HBEA 2ITWA 4Z7GA 4CFMA 2OKRA 3A2CA 5F4NA 2XRUA 3KN5A 2BZJA 2ZV8A 3ENMA 3H10A 2W1DA 3NS9A 2C0TA 4FSUA 4EZ3A 2W5HA 5AJQA 3ZFXA 3OT3A 3LQ8A 1YXXA 4D2TA 1B38A 5D7AA 3QD4A 3QA0A 3BGZA 4JX3A 4MHAA 4KIKA 5AUWA 3W18A 4PF4A 3EYGA 2XK6A 3CD3A 4Z55A 3E64A 4CKJA 4FKLA 5CAQA 4DBNA 3C5UA 2YITA 3OWJA 3DDQA 4M7IA 4JDHA 5DGZA 5EW8A 3SXFA 2IN6A 3UODA 2CCIA 1X8BA 5H8BA 5DG5A 2JKKA 2RFNA 3ET7A 3DJ6A 4LL5A 5B2MA 3MS9A 3Q5ZA 3D7TB 4IXPA 5CX9A 1ZYCA 4MQ2A 3QBNA 3LMIA 3LFSA 3PXYA 5AV4A 4FNXA 4OT5A 1PW2A 5HOAA 1BX6A 5M4IA 3R9RA 4APPA 5I3OA 2UZVA 4EOKA 2QR8A 3RTPA 3PG1A 5AP6A 2IVVA 4YU2A 4AGCA 2XYUA 2VO0A 3D9VA 3FI2A 4BTMA 4YJTA 3AC2A 1OBDA 3QTUA 3TN8A 3WZJA 1GOLA 4O0VA 1G3NA 4IQ6A 4EJNA 3KVXA 2YACA 4RGJA 4WKQA 3ZC6A 4O86A 4FV5A 3KQ7A 3VNTA 3COKA 5BUJA 4JQEA 3FKLA 3K3IA 2WIHA 3FY0A 3KXZA 4G5JA 2R4BA 4QMTA 5HG8A 1XH4A 4XRLA 4EC8A 2WIPA 4K33A 3QYZA 3MTLA 2E9PA 3P9JA 4FSNA 4K2RA 3L8SA 2WFYA 2YCQA 3FV8A 3V6RA 4N4SA 4EK8A 3DTCA 4XV3A 4UXQA 3FEGA 3W8LA 4BWXA 2Y8OA 4C8BA 3BCEA 3TTJA 3QXPA 4CMTA 4NJDA 4YO4A 1YI6A 5E8WA 3VS3A 2QOOA 3R1QA 5M06A 4XG8A 1BL6A 3VUMA 3QX4A 2PVFA 3HMOA 4M15A 5EFQA 3QQHA 3OTUA 4CMOA 4O22A 3FPMA 1UVRA 2V55A 3LCOA 4K6ZA 2B9HA 3QHRA 2H34A 4TYGA 3NUAA 3CJGA 3ORKA 1WVYA 3MJ2A 4ZY4A 5KMIA 2J0KA 2WU7A 2WOTA 4GVJA 3Q2JA 2PY3A 3K5UA 2I1MA 4TNDA 4PQNA 3TNWA 4QMMA 3R73A 5AR8A 4AW5A 3NUYA 4GK2A 4EC9A 5KMKA 4GUEA 5FEEA 2QLQA 4X7QA 4HW7A 3O7LD 2PE2A 2ITXA 3HV6A 3I60A 1OKZA 2R3JA 2YM8A 3KXMA 3RAKA 3C51A 2PMNX 1UU3A 4LV8A 2Z7LA 3UIMA 4CFFA 2ZJWA 3DZQA 4HPTE 3CCNA 4QPSA 4DCAA 3AMYA 3BQRA 3WE8A 2BAKA 2QO9A 4ANLA 3DQWA 2WAJA 2BRHA 2OIQA 3BV3A 3BX5A 5KX8A 3EFLA 3GCSA 1O9UA 1Q97A 1URWA 2C6IA 2ITYA 1AGWA 2V5QA 5HE3A 3WF8A 2IJMA 5CT0A 2BILB 2UVYA 3MB6A 3QX2A 4Y72A 5CU4A 4LUDA 3OWKA 4J53A 1EH4A 4EUUA 2YHVA 2OFUA 2ZAZA 4XG2A 5CF4A 4RWLA 2WQMA 4CFWA 2ZB0A 3DU8A 3BU6A 3FMLA 3H9OA 4NTSA 5A4LA 5JKGA 1YDRE 1RQQA 4IM2A 4AZEA 4BI2A 3QWKA 1V0BA 4FKWA 4HYSA 2REIA 4FTNA 2CHLA 3QRIA 3R2BA 3A7GA 2W5BA 1XH5A 3PXKA 4WHZA 3DBFA 3LJ1A 4HCUA 5H8GA 4IB0A 1OL5A 3QCXA 4R5YA 2V7AA 1H27A 1PJKA 1Z5MA 5L2WA 3TWJA 1W83A 1E1XA 1Q4LA 3O71A 1PXIA 1ZYSA 1M52A 3QTSA 4NKAA 4Y95A 3ACJA 1ATPE 4IB1A 3HV4A 4KIKB 2PUNA 3TNHA 4KIOA 2QD9A 4O84A 4ZSJA 2XCKA 4YLJA 3VAPA 2UW0A 3WE4A 2WTCA 2JIUA 2X2LA 3LFNA 4QTAA 4DAWA 3N4VA 4E4LA 3ZXTA 2X39A 3QZHA 1MRVA 3L8XA 1H08A 4U45A 3TZ7A 3UC3A 5CF8A 3FDNA 4AOIA 2V7OA 4A9RA 3QTWA 3NUUA 4NK9A 4FTRA 2C6KA 5AFVA 4PP7A 3MFSA 4L45A 3LLAA 3KMUA 3MIAA 4V01A 4MXOA 2QQ7A 5DT0A 1WBWA 4MBJA 3FQSA 3DAJA 3R9OA 2CNUA 2UZDA 3QU0A 4D1XA 4RA4A 5HCYA 3PVWA 1T45A 3BYSA 3RM6A 3D14A 3FMJA 3PSDA 3AT2A 1K2PA 4H3BA 3R30A 4JX7A 3SW4A 4GJ3A 4EUTA 5K9IA 2HWOA 3EQIA 4U0IA 3P7CA 3LPBA 3D0EA 4F6WA 2O3PA 1IG1A 2EWAA 2BHEA 3BHYA 3HMPA 4KKHA 4X2KA 2WHBA 1KWPA 3D2KA 3FYKX 4I24A 3GC9A 4NW5A 4OLIA 2YWVA 4AP7A 4E4XA 2CN8A 4CEGA 2PVNA 3ZLYA 2Y7JA 1MQ4A 4FG7A 4GU6A 2GMXA 4RJ7A 1ZMVA 3VBTA 4ANNA 3EQDA 3QUPA 3EN6A 3AD6A 1ZRZA 4EHEA 4EQUA 4IM3A 1GIJA 5AUUA 4EORA 3C9WA 3WBLA 3DNDA 4JOAA 4QMQA 4JBOA 5A4CA 2VX1A 3PSBA 4ZOGA 4OTRA 4NH1A 4CXAA 3HVCA 5HLWA 5JZJA 3ZU7A 5TKDA 4RX7A 2XKFA 4Z16A 4BZNA 3GNIB 4FEUA 3T9TA 5F95A 4CQGA 5CEOA 5AP7A 5JZNA 4APCA 3RK7A 1JSVA 4PMSA 3VS0A 4DGOA 2HW7A 3NW6A 3ID6C 1WMKA 4L44A 4D28A 3H0ZA 3GCUA 3I0QA 3ETAA 2BRGA 2YCFA 3PG3A 4QYEA 4BFMA 4JBQA 4FT0A 4ZMFA 2VTHA 5GINE 2R3MA 3BYOA 3KC3A 4E93A 3N4UA 2GFSA 4FT3A 4R1YA 2XJ1A 3Q32A 2ZV7A 2VO3A 3JXWA 3KULA 3G15A 2ZV9A 3LFDA 4C3PA 2RKUA 3QRUA 2R3OA 4B7TA 1F3MC 2YCSA 4FTIA 2UW7A 4IVCA 2ETKA 4RC2A 3W2PA 1LUFA 4CSVA 2RGPA 3F66A 3NX8A 2BDWA 1MRUA 4O7SA 2JD5A 2W1FA 2WPAA 3EKKA 3MA6A 5IPJA 4NKSA 3I7CA 1H01A 1W7HA 4C57A 3CEKA 3H3CA 1YVJA 4G17A 4KKGA 4RPVA 4FTUA 3Q6UA 4F9CA 1UU9A 4F6SA 2FA2A 2R0IA 4BHZA 5ANEA 3ZTXA 2Z7RA 5DHJA 4F08A 4F6UA 2CSNA 3NYXA 4JDKA 3Q53A 2NPQA 3KK9A 5FUTA 3FZRA 3LMGA 4FV7A 4YJOA 4IAAA 4WA9A 2YWPA 1JOWB 4OW8A 5LMBA 5ETIA 4F9BA 3NYVA 4F1MA 4DFBA 3MFTA 4MCVA 4DLIA 3UOHA 3OCSA 4NUSA 2A27A 5FP6A 4KD1A 4XCUA 2ZB1A 2CNQA 4DEEA 4R3PA 5BMMA 4C4IA 4DGGA 4XOYA 4GIIA 5TO8A 3A4PA 4MF1A 2UUEA 3T8OA 1YDSE 2P33A 4WT6A 3SDJA 3PVGA 4KSQA 5M53A 1ZY5A 3GUBA 4I5CA 3FHIA 4CZUA 5JFVA 4XV2A 2OH4A 2C3IB 5DEYA 2XP2A 4X2GA 3MY1A 2F2CB 3ORZA 3TV4A 5M57A 5C1QB 2UZNA 3OWLA 2C5OA 5C4KA 2VTLA 2B53A 3PVUA 3QZGA 3G9NA 3BV2A 5ITAA 3LE6A 1SMHA 2JDTA 2A0CX 2E2BA 4KINA 2F7XE 4ZSAA 3RCDA 3WIGA 3ZLWA 5E8SA 4E6CA 3P79A 5E8XA 3FC2A 5AV2A 3C0GA 4CTCA 3UQCA 3AC1A 2AUHA 3NNUA 4TW9A 2YZAA 3AT4A 2BFXA 4KS8A 5EH0A 4BTKA 3QTRA 2W17A 1FGKA 2HELA 5HLPA 5DWRA 3RZBA 4BTFA 4F0IA 2EB3A 4Y85A 2YIQA 4E26A 1OITA 4XG6A 5E90A 2UZWE 4YPDA 4YZ9A 4UMUA 4GK4A 1CM8A 3DNEA 3FC1X 2XIRA 4AS0A 3HV5A 4QTBA 1XH7A 4JQ8A 3ZMMA 1FVRA 5BVDA 3OS3A 1E1VA 3BPRA 2HZNA 3GCPA 4PDOA 4F1TA 5IDNA 2CJMA 1WCCA 4ACDA 2B1PA 2W1IA 2VUWA 3MY5A 3L8PA 4Q5HA 4BBFA 2BR1A 1IR3A 4FV1A 1GZNA 3NCZA 5EHOA 1QPEA 2PSQA 4R78A 4P4CA 4QTDA 3UDBA 2HOGA 4G3FA 3O8UA 3RALA 2GHLA 1JKSA 4CRSA 3SW7A 4AG8A 4E1ZA 5KHXA 3FMKA 5IA3A 4MD8E 4M69A 2W05A 3RKBA 4BF2A 4WUNA 2VTAA 4GG5A 4DF3A 5J5TA 2OU7A 3H30A 3IKAA 3TACA 4O7YA 4J1RA 1AD5A 4RFZA 2Z7QA 4D1SA 4YJVA 3BU5A 3EMGA 3A7IA 3NCGA 3PY1A 5AIRA 3U8WA 4YURA 3OF0A 3TIYA 2CMWA 4FIGA 5A54A 3EJ1A 4IAIA 5AA9A 2CKOA 2PE1A 1CMKE 3RBWA 3F3UA 4TWNA 1F5QA 4M68A 4P5ZA 4YZNA 3SA0A 4BDIA 4ORKA 4A4XA 2BHHA 4D4SA 4EOSA 5L4QA 3ATSA 3LKMA 5CEIA 4IAYA 3C0IA 4IC8A 3RAWA 3TT0A 3E5AA 3U4WA 3W32A 2JBPA 5CAOA 5LMKC 3PWYA 2ZM4A 4M14A 4OAVB 3DBEA 5BQ0A 5ANDA 4X3JA 4G31A 4G9RA 4E8AA 5BYZA 4ZTMA 1YOLA 3EFJA 3EFKA 2BPMA 2B52A 3U6IA 2QO2A 3IGOA 2UW6A 4GT4A 2PVHA 3NYNA 3KULB 1TKIA 5DEWA 4OBPA 3VIDA 1I44A 3OHTA 5ACBC 4RZVA 4ZZMA 5GNKA 5CAPA 2VWYA 3UVQA 2YAKA 5AR7A 3FZ1A 4H39A 1OPJA 4FV6A 4P90A 5E8YA 1KE8A 1DAYA 5CASA 5BX0A 1FMOE 4HVSA 2J0JA 2P4IA 4F0FA 1W82A 3GEQA 4EK5A 4O0RA 4PMTA 4YZMA 3ULIA 3WZUA 4BDCA 1M2PA 3SOAA 5HD7A 4BGHA 4NM5A 1Y91A 3FMMA 2RG6A 3FLSA 3HZTA 4RC4A 1P2AA 4FKPA 4BDHA 3ZEPA 3IW6A 2PZ5A 4FYNA 3OW3A 4DEDA 1U5QA 3SG8A 4O0XA 5AWMA 4PTCA 4JBPA 4RIWA 5HO8A 1XHAA 5I9UA 1Y6AA 3F5UA 1OVEA 3AMAA 3NPCA 1WZYA 2ZMCA 2P3GX 4FGRA 3C7QA 1JLUE 4FUYA 4NCTC 2P2IA 2EU9A 4ITJA 4WBBB 3R8ZA 2OXYA 3HNGA 2FSTX 3IDCA 3P7BA 3VULA 3EZVA 3CQWA 2W99B 3RINA 4EL9A 5DT4A 5ANOA 3UNKA 1YI3A 3COHA 4FICA 4DCEA 3COMA 5AUXA 4H1MA 3PZEA 2PZIA 4AE6A 3AC4A 2WQOA 4QQTA 1XR1A 3QKMA 2G1TA 4MQ1A 4U40A 3R8MA 1O6LA 1M7QA 4FBXA 4CFVA 5AP3A 3TM0A 3W2QA 4MBIA 4UMPA 4Z3VA 4CYIA 4YNOA 4PDYA 4A9TA 2UZBA 2QC6A 4UXLA 3R7YA 2WEIA 3F82A 3UZPA 4ASEA 3CQUA 5AA8A 1Q5KA 4O2PA 3QALE 5IQGA 5CWZA 2OJGA 3EL7A 4FIJA 3Q9WA 5J7BA 2BMCA 4XP2A 3IW8A 2GSFA 2FYSA 5HIEA 1Q3DA 4IDVA 4IDTA 2X9EA 4S31A 1ZMWA 3I6WA 5HE2A 2ZVAA 2RG5A 5IQFA 1OL2A 3DCVA 3BEGA 3LFQA 3OY3A 2QLUA 1XWSA 1KE9A 4FKTA 4FTAA 4X3FA 4DBXA 3V04A 3PRIA 4YP8A 1BI7A 3OXTA 3FXWA 2BIYA 5T3QA 3VJNA 4DGLC 4LRJA 4IBMA 4JIKA 3TZMA 3PXFA 4FTJA 2OWBA 3PUPA 3DAEA 4K9YA 3QD0A 4LRMA 5JRQA 2B4SB 4KB8A 3E63A 3NW7A 4ZK5A 2VTOA 1Z9XA 1PXMA 2C3LA 4ZY5A 5H3QA 3WZKA 4M0YA 5L6WL 3D15A 5HU3A 2W1CA 3G9LX 3UG2A 3E92A 3UP2A 3QZIA 4M69B 1WBOA 1P4OA 3EWHA 2YIXA 3TKIA 3KMWA 3DQXA 4O2ZA 4DFUA 4NFMA 2OG8A 5GZ9A 2NRUA 5IUGA 4O7WA 2BROA 3V8TA 2J0IA 4L52A 5JRSA 2QU5A 3UP7A 4BHNA 2C47A 5I5ZA 2IWIA 1ZZ2A 2G15A 1YW2A 3THBA 2PK9A 1PXOA 1JSUA 2WU6A 3KU2A 1KOBA 4BCQA 5HGIA 1WBSA 4YPSA 3RVGA 4YC8A 2YAAA 5AP0A 5A6OA 4DG2E 2ETMA 1XBBA 5EK7A 1DAWA 3QRJA 3SV0A 2CPKE 3GI3A 4EKKA 5LWNA 1Y8YA 4AGDA 3LAUA 1OL1A 5G6VA 4FKSA 5HE0A 4JR3A 3KKVA 4QMVA 3RCJA 4ZS0A 4ZTSA 3DB6A 1IA9A 5CEKA 3PSCA 4KSPA 4GYGA 4XRJA 2HW6A 3EN4A 1J1CA 3GCVA 4S2ZA 2XM9A 5ANKA 3CIKA 3GU4A 3IO7A 4TY1A 5E92A 5AUTA 2WMQA 3DPKA 3FL5A 4AN2A 4BDGA 2WQNA 2AC3A 3QLGA 4HNFA 5K4JA 4ZLZA 2VRXA 4HZRA 1U54A 2GNGA 5EM7A 1V0OA 5CAVA 3AT3A 2P2HA 4MNEA 5IF1A 1PXKA 4DC2A 4MXXA 5AADA 3TDWA 5I3RA 4BGGA 4AGUA 4IJ9A 3ZO2A 3TTIA 2WMVA 4F70A 3AOXA 1NVSA 4AOJA 5BPYA 4RX8A 5BVOA 2EXCX 3QF9A 4GKIA 4Q5EA 3ORLA 5HG9A 4A06A 2BCJA 2Y4PA 2YM3A 4RIWB 1YXSA 3HDNA 2B9FA 5M4UA 4Q2AA 2X6EA 4EWQA 4YTFA 5I0BA 4AA4A 2EXEA 2OXXA 3CY3A 4DFYA 5AEPA 5J9YA 4ZTRA 4C3RA 5AAFA 1SVEA 1R1WA 2ONLA 3D5XA 3D5UA 3QQGA 4GKHA 1ND4A 3QL8A 1UKHA 4GEOA 4ASZA 3G0EA 5J5SA 4R77A 4I6QA 4EQMA 3HUCA 3SD0A 2E9OA 3DK3A 4GMYA 5CZIA 4OGRA 5TOZA 3C5IA 1H1QA 4L43A 3Q96A 4EK3A 4XG7A 3PPKA 3SC1A 2PVRA 4AGWA 4C59A 5FD2A 4D2SA 2E9NA 4Z7HA 4QMNA 3UNJA 2QHMA 3H9RA 1H4LA 2YCRA 3IW7A 3ORXA 5FRIA 2ACXA 4JG8A 2XJ0A 2KULA 1E9HA 3WYXA 1FPUA 3V8SA 1BL7A 2WEVA 4C2VA 1A06A 4FIEA 4MD9E 4YZDA 3MV5A 5CSXA 1SNXA 3D5WA 3K3JA 2X1NA 2BDJA 3CQEA 2B54A 3UOKA 3PZHA 4RX5A 5EDRA 3NWWA 1CSNA 3R6XA 5HTCA 3D5VA 4EH7A 3CE3A 2F9GA 4BKYA 5KMOA 4QYFA 4BI1A 1OGUA 3LXPA 4TNBA 4UWYA 5E8VA 3ZOSA 3F5PA 4LRKA 2O5KA 2XK7A 3VBQA 4EK4A 3DTWA 2PZYA 3BHVA 1J3HA 2UW8A 4ZTNA 3RPVA 2J90A 3FMDA 2W7XA 4X3FB 1RJBA 4IWQA 4K77A 3DKCA 2PMLX 3IPHA 4KBCA 4LOPA 1R0PA 3TJCA 3ZLSA 2JKQA 3M11A 4ERWA 3F61A 5HE1A 1YWNA 2YISA 2X8DA 1FGIA 2WD1A 2UW9A 5EOLA 3QKLA 5HTBA 4DFXE 4MF0A 4O83A 4Y5HA 5GJFA 1YI4A 5B2KA 4HNIA 4QTEA 4YJSA 2XM8A 1JKTA 2IZUA 3CKXA 4ZSEA 2SRCA 4Y8DA 5CALA 3NAYA 2JKOA 4PTGA 5IH4A 4GV1A 3FI8A 3U55A 5D41A 4PDPA 1XH8A 3C4XA 2X7OA 2I0YA 4X2NA 4S34A 5FTGA 4X6RA 5K0KA 3ZDIA 3R83A 3HA6A 3A4OX 4CGAA 5D10A 3LLTA 5HEZA 3S3IA 5M55A 3FXXA 4G3GA 3R7GA 3GU6A 4V0GA 2UV2A 2UZTA 2WQBA 3QTXA 4UWBA 3UJGA 4XOZA 1OI9A 3C4WA 4LL0A 4WG3A 4I5MA 3RAIA 2CKEA 3NUNA 3L8VA 4FYOA 1KSWA 4I6HA 3IOKA 5ACKA 3V8WA 3BE2A 5K5NA 3TEIA 1GZKA 3UZRA 4HPUE 2W9ZB 3N51A 3ITZA 3PP1A 5AR2A 4FTTA 2R5TA 3EOCA 4ZY6A 2VZ6A 1PKDA 1RW8A 4JS8A 5EHYA 2LAVA 3W2RA 4CLIA 3MWUA 1H1PA 3F9NA 4JNWA 4BICA 3FLWA 4PMMA 5J8IA 4W9WA 4W9XA 4CV8A 3LXLA 2DQ7X 3W16A 5KHWA 3VWAA 3R1NA 4AZTA 3CPCA 1H00A 4TYIA 4EOOA 3V01A 4YSJA 5AUVA 4FKRA 3L9LA 5IG1A 5EDQA 3ZZWA 4F7NA 4KS7A 5FEDA 3G6GA 4YJRA 4O7TA 1U54B 3ZO1A 4EH4A 3KA0A 3QA8A 3DXQA 3JYAA 4MNEB 1PKGA 2UZOA 2YM6A 2J4ZA 3FHRA 4FIHA 2YN8A 3B2WA 4GL9A 2CGUA 2QR7A 3W33A 4CYJA 4PMPA 5KO1A 3F88A 3VUDA 3Q4ZA 5HNBA 3PPZA 4F99A 3MGYA 4AN9A 4QP7A 5FXSA 2R3PA 4FSQA 2UZEA 3LJ0A 4BYIA 4EHZA 2OW3A 4EOIA 3SXSA 5A9UA 4FK3A 5LARA 4UZHA 2VTMA 4F9AA 4RLKA 2QVSE 4RRVA 3OOMA 3KRJA 3W2SA 3CD8A 5JK3A 3FMNA 3R8UA 1U5RA 3F6XA 1LEWA 4DH3A 4HVDA 3IDPA 3V5LA 1Q8UA 5DT3A 3WI6A 2C5XA 3TXOA 4DYMA 2X81A 5CZHA 1J7LA 3E3PA 5HNGA 4F0GA 5AR5A 1U59A 3JVRA 3FY2A 1JQHA 2ITVA 4A4LA 3OWPA 3V5WA 2WMSA 3A7HA 4X2JA 4MYGA 4XLVA 3QZFA 3BLQA 5ANGA 4S30A 4M8TA 4WRSA 2VO6A 5KBQA 2RIOA 4M66A 4PUZA 1PRYA 1JWHA 2X2MA 5CANA 5IEYA 2E9VA 1PXJA 5LJJA 5JN2A 4JDIA 4HGEA 3UG1A 2WMTA 4USFA 4MK0A 3ORMA 5M4FA 4RQKA 2VWXA 4DE4A 4HVIA 4ERKA 4NT4A 4QMLA 4BDEA 4XX9A 3OROA 2IVTA 5I9VA 4ANBA 3ZRKA 1PY5A 3MVMA 4FODA 1MRYA 2XK3A 3KRWA 2VD5A 3JY9A 4ZS4A 5L2IA 3UC4A 5LQFA 2GNHA 1J7IA 4UYAA 2OF4A 4IHPA 3SRVA 4A07A 3TV7A 5ETCA 1OBGA 3BEAA 4FZ7A 5HVKA 3F7WA 4FZDB 3PXQA 2C4GA 3WZEA 5JT2A 3COIA 2OF2A 4DFLA 4QMZA 3FXZA 5CXZA 4I1ZA 4BCKA 1WVWA 2BALA 2XKCA 3EQPA 4FV2A 4MTAA 4WSQA 5AP4A 3RMFA 5IA2A 2IG7A 5BYLA 4JG7A 1YHWA 2C6DA 2GNLA 3EYHA 4U97A 4C4HA 1GIIA 4C58A 4KABA 2WTIA 4KRDA 1YOMA 3QQLA 4I92A 4UMQA 3F2AA 5IQAA 1XBCA 1W8CA 3OEFX 3DFCB 4KKEA 1B39A 5BVNA 1ZLTA 2F4JA 3CSVA 4RJ8A 2J5EA 4YBKA 4O7VA 4LOQA 1WAKA 3ULZA 3R8VA 2Y9QA 4W8DA 2JFLA 4YBJA 2VTRA 4XG4A 5E91A 2DUVA 4O1OA 3VS7A 1NT2A 4U8ZA 3TKHA 2XKDA 3C50A 2HZ0A 5J95A 4MBLA 4QNYA 2XK4A 4MD7E 3D83A 3A8XA 3BKBA 5IQHA 3BBTB 2WTVA 3EIDA 4EYJA 3VBVA 4F63A 4FX3A 4OTHA 3GFEA 4LFIA 5B7VA 4XLIA 2BRBA 3ZDUA 4G16A 5D1JA 3TJDA 4V0GB 3VBXA 1H28A 5AUZA 2R3LA 3CY2A 2PVLA 3UVPA 4E6AA 4EOMA 3PIYA 5IA1A 3FLZA 4W4VA 5CU3A 2C6EA 3ODYX 1UNLA 3G90X 2FO0A 3BGPA 4IADA 3KRRA 3CGFA 4CG8A 2WMXA 5B0XA 3G33A 4UB7A 4QNAA 5E7RA 3AGMA 1KV1A 3LIJA 1O6YA 4IIRA 5CI6A 5BYYA 4L68A 3HAVA 5AP2A 3ZCLA 4DTBA 4DT8A 3ZUTA 3FYJX 2VN9A 3RWQA 4PNKA 3LM5A 5AV3A 4FV3A 1K3AA 4ITHA 2XIYA 3NSZA 4UEUA 3A60A 4NTTA 5CS6A 1FINA 3IGGA 4GFGA 2OO8X 3LFEA 3Q4CA 4M84A 5AM6A 5E8UA 2ZM3A 4FZ6A 4CKRA 4PTEA 4N57A 3IDBA 3MI9A 5C8NA 3PYYA 3QQJA 3Q2MA 3CLYA 5CU2A 5D9HA 3TNIA 1TVOA 4EOLA 4G1WA 2PU8A 1HCLA 1TQIA 4GT5A 2WNTA 3DJ7A 3GU7A 5FDXA 3Q9YA 2GFCA 2W4KA 4D4RA 2RFEA 4JDJA 2GNFA 4L00A 3IS5A 1OM1A 5HHWA 2YLEA 3BE9A 2QU6A 3AQVA 3TG1A 4D2VA 4EJ7A 1REJA 3HX4A 2GDOA 1GIHA 1VR2A 3R8LA 4DEHA 4HCVA 4M12A 3O7LB 4FKJA 2PVKA 4YZBA 4FSYA 3WF5A 4C34A 3V5JA 4JQ7A 3P0MA 4ARKA 1JAMA 1KE5A 4FL2A 3E8DA 4PL4A 5L3AA 3WYYA 5IMXA 3OBGA 1XO2B 3KVWA 1LEZA 2GTNA 5EM5A 4C37A 3IONA 4PX6A 2GQRA 3MDYA 4ZZNA 4A9YA 1LR4A 3C13A 4TKSA 4GW8A 5KCVA 4M3QA 1NVQA 4IE9A 4ACGA 4HVHA 4WO5A 5BMSA 4J99A 3R2YA 3R7EA 2X9FA 3OW4A 5CSVA 2ESMA 3TCPA 4D0XA 4JAIA 2AC5A 2UVXA 2UZUE 3A61A 2NP8A 4MWHA 4XHKB 5HVYA 5IZFA 4J8MA 4BDJA 4IWDA 2WO6A 4NW6A 4ZJJA 1WVXA 2W0JA 3R00A 4XUFA 2OXDA 3RPSA 5DOSA 4YNEA 1UV5A 2NNWB 2PULA 3PWDA 4J52A 4QQCA 5JSMA 1GAGA 4FA2A 2HWPA 4F1OA 5KBRA 2JIIA 1PHKA 4HGLA 2XCHA 5D12A 1H25A 5EM6A 3CC6A 4IM0A 3VF9A 1Q3WA 3KCKA 4DINA 3F69A 5H8EA 3LQ5A 3GOKA 3MA3A 4QP2A 2GNIA 3FZTA 3R1SA 3SRVB 5L6PA 5DPVA 2QG5A 4I5PA 5DLSA 4GCJA 3OEZA 4GU9A 4G9CA 2XIZA 5A14A 3QCQA 4WOVA 5J1VA 3N4TA 5HO6A 3ZSHA 5ICPA 5IH5A 1QPJA 3EH9A 3PDTA 1IASA 1SVHA 2VV9A 4BBEA 4BWKA 4C4FA 4HVGA 3E8EA 2JAVA 1BUHA 2QCSA 3NEWA 4G3EA 5GZ8A 5CT7A 4FKOA 5EKNA 1ZMUA 5HBJA 4NFNA 4GH2A 3SAYA 2LGCA 4XYFA 2VWWA 3FZPA 2WXVA 3DA6A 4J98A 4OBQA 1F0QA 2OI4X 2YIRA 3P86A 5LVLA 3LW0A 3DY7A 3FLNC 3SKCA 5M07A 1HOWA 3FPQA 2W9FB 3FWQA 5L2TA 2R3FA 3FKNA 3I6UA 4FZFB 4EQCA 5TR6A 4O38A 1UU7A 2A4LA 1NXKA 3FI3A 2BIKB 2JDSA 2FB8A 1JPAA 4U6RA 3ROCA 2Q0BA 3HGKA 5IA0A 3HRBA 5K5XA 4QMYA 2GHMA 2IW8A 5FLFA 3P5KA 5IQIA 3BHUA 3IQ7A 3OY1A 5GHVA 5IQCA 2XEZA 4GRBA 4U43A 4YZCA 5TF9A 3BI6A 3RGFA 3VQHA 4KNBA 5IQDA 2XKEA 4D2RA 3GU8A 4QRCA 3I4BA 5DH3A 1GZOA 4IWOA 3VUKA 4MXCA 1ZOHA 4FVQA 2OH0E 2ITTA 3OCBA 4AZVA 3EQCA 4PPCA 2Z2WA 4TZRA 3PTGA 5F1ZA 4NEUA 3QCYA 4EHGA 1OB3A 5AV1A 3KF7A 4QMUA 4KA3A 1PF8A 3ZBXA 3AGLA 3OUKA 3MYGA 5CEQA 4AFEA 1GZ8A 4WRGA 5A4EA 5M51A 3F3VA 3VHKA 5CSPA 2G01A 4PNIA 5GJDA 4CCUA 4AA0A 1QPCA 1K9AA 3RHKA 5FXQA 3OT8A 3UOLA 4QP9A 5FDPA 4C4EA 1VEBA 3HMMA 5BVFA 2X7GA 4XJ0A 3UPXA 3TNQB 3OVVA 4FSRA 3P7AA 4G6NA 5HTIA 4O0SA 2YDIA 4RG0A 3SOCA 2HXLA 3R7OA 1BMKA 4QMWA 1OUYA 2PVYA 4AT4A 3BELA 5HI2A 2PZPA 4Z9LA 4B4LA 5HG7A 1U4DA 2QOLA 4BY9E 1ZOEA 4LGHA 2EVAA 3QC9A 2PUIA 5HNIX 4BI0A 4FIIA 3RPOA 5KNJA 5ANJA 1NA7A 4I22A 3LOKA 3QWJA 3BIZA 3H9FA 3R22A 4OBOA 3UMXA 2WMWA 2CCHA 3E7VA 3BWFA 2R2PA 4EOPA 3FAAA 5AAEA 2C5NA 3UE4A 4DFNA 2OJJA 5AIKA 3UVRA 4FR4A 1XH9A 4P5QA 3BU3A 2JDRA 5HIBA 3DKFA 4CG9A 5CVHA 1CKIA 2RL5A 4O0WA 2QO7A 4YGAA 3IW4A 3VHEA 3RHXA 2GNJA 4ALUA 4CD0A 2Z02A 4ITIA 1WBTA 4XS2A 4RX9A 5LWMA 2YIWA 2VTPA 4BDBA 5M09A 3VBWA 4A9SA 4GFMA 4IWPA 5JFXA 2JC6A 4HYIA 1R3CA 1PYXA 4HOKA 4XG3A 3NAXA 4QQJA 3ALOA 2J51A 3I81A 3L9PA 5FQDC 2Y6MA 2PPQA 2RFDA 2GS2A 2PUUA 3LFFA 3GU5A 4K18A 4D0WA 2XB7A 3R04A 5H2UA 4L3JA 4DGNA 4YUQA 2W4OA 4FTCA 2CLQA 2QOKA 2WTKB 4E7WA 4FEVA 2O2UA 2QHNA 1R78A 1SVGA 2O65A 2X8EA 3U9NA 4NWMA 3C1XA 3T3UA 3RI1A 4X3FC 1OUKA 4OTFA 2RSVA 3W2OA 5FG8A 1H26A 3UMWA 2Y6OA 2A2AA 4ZMEA 3G6HA 4MX9A 4U3YA 5EYMA 1YDTE 3TIZA 2HY0A 5CF6A 4B6LA 1YOJA 1A9UA 4O7ZA 3W1FA 4L8MA 4LGDA 4ZJVA 1S9IA 3JY0A 3KXHA 3BQCA 1VZOA 2HY81 3CJFA 2VWZA 3CTJA 4TWPA 3S2PA 4QQ5A 3ZFYA 1KE7A 4BDDA 5EQEA 3VJOA 4BZDA 4EOQA 4YR8A 3HECA 2GPHA 5IA4A 2GQSA 3P78A 3R9NA 2W1HA 3IG7A 5I9YA 1UWHA 2PVJA 5HQ0A 3MW1A 3ANRA 3PP0A 5FGKA 2IPXA 3QTIA 2VWIA 5DA3A 4HGTA 2GS7A 3DK6A 3VO3A 1G8AA 4ZLYA 3PJ1A 4AE9A 3IK3A 2CGXA 4DH8A 5BVWA 2WMRA 4CFXA 2QI8A 3BYUA 1ERKA 1W0XC 2OIBA 3LJ2A 4Y73A 5CY3A 2C68A 4FOCA 4N6ZA 4B8MA 3UNZA 5CLPA 4R7BA 3OTVA 3F5GA 4XBUA 5T6KA 2IVUA 3NUSA 4KIPA 2VTTA 3D7ZA 3G51A 4GUBA 4DTAA 4WNKA 3QRTA 2QKWB 4EZ7A 5LXMA 4LV5A 4AA5A 4TRLA 3TI1A 3PXZA 3ODZX 3HAMA 4D4YA 3AC5A 3FZOA 1Q8YA 1KV2A 4YMJA 1CKPA 5DIAA 4DA5A 3FQHA 4F7LA 2ZM1A 3VN9A 4O0UA 4ANOA 4EYMA 1XBAA 5LVMA 2ITPA 4PV0A 5CTPA 3PIZA 3Q5IA 4FV0A 3AXWA 3UBDA 4BCPA 3WF7A 3DXNA 3HMIA 1Y8GA 5HVJA 5CAUA 5JMSA 5DR2A 2ZOQA 3MFUA 4FEWA 5DN3A 1Y6BA 4MVFA 3UTOA 1DS5A 4W4XA 2WKMA 1NVRA 3P1AA 2W5AA 5E1SA 5CSHA 1WFCA 1L3RE 4FL1A 5FTQA 5IQEA 3DOGA 2X7FA 4ID7A 5AUYA 4ZIMA 4JBVA 2HYYA 2ITZA 3NNXA 2WMUA 4RVKA 4ALVA 4QMSA 2XNBA 4C36A 4OTQA 3DK7A 2GTMA 4IJPA 4P7EA 4UV0A 4PP9A 5KKRB 3H0YA 3MTFA 3LVPA 4FSMA 4RBLA 3NIEA 2WZJA 5EQYA 5I9WA 4L7SA 4QMPA 4I21A 1W98A 2W1ZA 4JT3A 3ZC5A 3WILA 3KRLA 4OTGA 3TL8A 3E8CA 3IECA 4AW0A 4BVUA 2C6TA 2C1BA 4FT7A 2ONLC 3NIZA 4FVRA 4IAZA 2I7QA 3T9IA 2QOHA 3OC1A 4QP3A 4CFUA 4QP1A 4U41A 4JAJA 3A7JA 1REKA 4JL9A 4QPMA 5F94A 3PE1A 5IA5A 2O0UA 3BWJA 4M67A 1LP4A 3SHEA 3HEGA 3KB7A 3VW8A 4YTCA 3KN6A 4U7ZA 4DG3E 4UWCA 2I6LA 2ZDTA 5CYIA 1H1WA 2V22A 3R9HA 4C62A 2XBJA 3EB0A 3P08A 4XV9A 3GCQA 2PMOX 3Q3BA 3TUDA 5JQ8A 3FL4A 5E4HA 4I6BA 4QYHA 5IEXA 2QOCA 3TUBA 4BCOA 5EHLA 3MPAA 5HX8A 4OTIA 3A8WA 4JRVA 4USDA 4YHTA 3KGAA 4IMYA 3CS9A 4EEVA 4O7RA 4NM3A 3OD6X 4MKCA 4BKZA 3NNVA 4WSYA 1PMVA 2BVAA 4BCMA 4FEXA 4JLCA 3DAKA 3GVUA 3EN5A 4TWOA 4B0GA 5HO7A 1JBPE 1Q24A 4BRXA 3QD3A 5DR6A 2WTWA 3LFCA 3U4UA 5CU0A 3V51A 4BCGA 2PYWA 2B0QA 2YFXA 3GQIA 2WOUA 1XJDA 3CGOA 2AYPA 2OZAA 4RQVA 5KZ0A 4DGMA 4OT6A 2YM5A 1L8TA 4O1PA 2VTSA 2VTQA 3O23A 2HXQA 5TT7A 2IO6A 4AZSA 1AQ1A 3U9CA 2QKRA 3D2IA 4FF8A 4C61A 1SYKA 4AWIA 4KAOA 3EZRA 3C4FA 4JR7A 4AZFA 4C2WA 4IVDA 1QMZA 4FK6A 3NMUF 1STCE 4E5BA 2B9IA 3DS6A 3P4KA 4MEDA 5HORA 2FUMA 4I0SA 2C6OA 4FKGA 5JEBA 2F57A 4JJRA 5EDPA 5EW3A 3C4EA 4J97A 3LCDA 4H1JA 5GIPE 5CNOA 4ZP5A 2QOBA 4RMZA 3UGCA 1DI9A 3GFWA 3CR0A 3GOPA 4NSTA 5FXRA 4PL5A 4LG4A 1I09A 2RF9A 2WMAA 3POOA 2A1AB 1ZYDA 3GBZA 4FIFA 1FVVA 2FVDA 4FL3A 4O6LA 4DH5A 2YA9A 3MVLA 4KIQA 5J1WA 4D4VA 3S95A 3BLHA 2EUFB 3GENA 3HA8A 3OZ6A 4J96A 2OJFE 4O7LA 3UPZA 3AG9A 3FKOA 1P4FA 2IZTA 3MIYA 4IH8A 4QYGA 2BAJA 4AAAA 3AD4A 1OIRA 3ERKA 4OAUC 2BZKB 4FSZA 4R5SA 4RFMA 3W10A 3ZLXA 4R7HA 3ZSGA 2HCKA 4LMUA 3QYWA 1M2QA 5CF5A 2O64A 4EI4A 5AX9A 4BIDA 3EHAA 3Q9ZA 3BYMA 3ZO3A 1IAHA 5EM8A 2WELA 1J91A 1YHSA 3R0TA 3KFAA 2XBAA 2WQEA 2G2HA 2ZV2A 3LCKA 5DRBA 5BUEA 5ANIA 4YJNA 4GK3A 5IKWA 4GIHA 4UN0C 4TT7A 3DJ5A 4IANA 2XVDA 4GYIA 3EQGA 5HIDA 4FTMA 4IX3A 4ZSLA 3ZZEA 2OJIA 3MESA 3GP0A 3ZS5A 4D1ZA 3LZBA 3DLSA 2BZHB 3I79A 4QMOA 5CI7A 4G2FA 3REPA 3UO4A 5F9EA 3DBCA 2O63A 3V5TA 2C0OA 2XUUA 4BCHA 1OKYA 3OG7A 5HG5A 4K11A 4R8QA 5E8ZA 3OXZA 2C30A 2ETRA 3U6JA 1G5SA 3GQLA 4U3ZA 3LCTA 1ZAOA 1VJYA 2QNJA 5L6OA 2XNOA 4IVAA 3QD2B 4BCFA 3VUTA 3CPBA 3VF8A 5HLNA 5A6NA 1DM2A 1Q62A 5CQUA 2BTSA 3VVHA 2BZIB 1YKRA 4ALWA 3RPRA 4I4EA 4IACA 4LUEA 4D2WA 4AF3A 4KRCA 4OUCA 5HESA 3QUEA 3PRFA 2Y4IB 3L1SA 4CKIA 2FSMX 4L53A 4CZTA 2JLDA 2WB8A 2J7TA 4DFZE 4I0RA 1JVPP 4FNWA 5CEMA 5IH6A 3QLFA 2CGWA 4FVPA 2IW6A 2HAKA 2R3NA 4EH2A 2VWBA 3VUIA 4X2FA 5HX6A 2B55A 4WUAA 5I9XA 2CKQA 1QPDA 2H6DA 4PDSA 5LOHA 4IVBA 2X6DA 4FMQA 2ITNA 3POZA 5FM2A 2HENA 4CV9A 1CKJA 3MPMA 2R64A 4CRLA 3QHWA 4DEAA 1XKKA 1PXNA 4IZYA 5J7HA 4L46A 4ZEGA 1ZZLA 1CDKA 4U5JA 4GS6A 5CSWA 2YDKA 4B99A 2VX0A 5A46A 2P55A 5K3YA 3DXPA 1YWRA 3R7IA 3VUGA 2GQGA 4IC7A 3MSSA 1MQBA 5LMAA 2PWLA 4B9DA 4TPTA 4O91A 4FEQA 3AC3A 2DYLA 5ETAA 3CTQA 4CTBA 4RA5A 2X2KA 4IX6A 3FSKA 1R0EA 4M13A 3ORPA 2VTIA 4NM7A 3OCTA 1YWVA 4V04A 2JBOA 5DRDA 3VUHA 3OFMA 4YC6A 2VWVA 4BCIA 4U42A 3ZRMA 2NRYA 5LVNA 4MXZA 3F2NA 4O0TA 2OZAB 1Q8TA 4JI9A 4TYHA 1OMWA 3A62A 3MFRA 3O2MA 4EOJA 3UO5A 4RJ4A 4PY1A 5IUIA 2C6LA 4R6VA 3QQUA 3SXRA 4O21A 5LCJA 4IEBA 4FT5A 5C4LA 3RNYA 3TZ9A 3V6SA 5BVEA 1IEPA 1IAJA 3FE3A 4HJOA 1FQ1B 4KBKA 3KREA 3GC8A 4O6EA 1OIQA 2W96B 4U44A 3MH1A 4JVGA 4RIXA 2OZOA 4BZOA 4EH5A 5AP1A 4V05A 2YERA 4G34A 4MAOA 5T68A 5M44A 4PPAA 5BVKA 1QL6A 3OXIA 1GNGA 3GXLA 2BRMA 2FSOX 4H05A 3ZONA 1A48A 3KK8A 4I94A 5KMNA 4L01A 2BDFA 4WNMA 3HLLA 3VRYA 3VS6A 2OIDA 4G6OA 1B6CB 4U9AA 5I9ZA 5KUPA 2P0CA 2QG7A 4DH1A 3W2CA 4F09A 1OECA 3F3TA 5FEQA 4UX9A 2EXMA 4ZTHA 2Q0NA 4NZWB 3TZ8A 3UYTA 5EI6A 4D55A 1UKIA 2HIWA 2R9SA 4XNEA 3PIXA 4BIBA 5AAGA 3NRMA 4ENXA 1OPKA 3PLSA 2ITUA 3RAHA 3PJCA 4LYNA 5EYKA 5KMJA 3VRZA 3BGQA 2W1EA 1S9JA 2G2IA 5E1EA 1ZOGA 1OL6A 4YJUA 4E4MA 3JPVA 4EBVA 3KL8A 2QONA 5FWKK 3M2WA 4X0MA 3ALNA 1JKLA 4D9UA 2CKPA 3LFBA 4K1BA 3ZUUA 3OUNB 1VYZA 4G5PA 3ZH8A 4DHFA 3LXKA 5HU9A 2PHKA 3R1YA 3SX9A 1G8SA 4AACA 1ZYJA 3NUXA 5IEVA 4G6LA 3MBLA 5DE2A 4F9WA 5M4CA 3SLSA 3E87A 4IB5A 2Z60A 1BLXA 5JFSA 5JFWA 5HD4A 1IRKA 3KCFA 4DG0E 3HMNA 1UA2A 4AZWA 4FTOA 3UYSA 4D5HA 4R3CA 3R7UA 3P23A 3ZSIA 3NW5A 2C3KA 3VS5A 3BHTA 3R71A 4FSTA 5AMNA 5GJGA 2R3RA 3Q04A 3FBVA 5M08A 4UY9A 5J9ZA 3BZ3A 2XMYA 4ZTQA 4XG9A 1V1KA 3W55A 4ENYA 5C26A 3PPJA 4K8AA 4H3PA 4L3PA 4AUAA 5HICA 4DN5A 4OTWA 4XMOA 1LPUA 1MP8A 5AM7A 5GIOE 3GB2A 2G2FA 4XEYA 4WD5A 4KBAA 4QD6A 4AW1A 2F2UA 3ZRLA 3V5QA 3ORTA 4RIYA 4C0TA 3DV3A 3NVMB 2WTDA 4ANSA 3I1AA 4G3CA 2XNPA 4TWCA 3O8PA 4K0YA 4EZ5A 4A4OA 5L2SA 1GJOA 4EH9A 4WNOA 3ZM4A 4PRJA 4FT9A 3CXWA 3TUCA 3B8QA 4J95A 3HRCA 3QGWA 2BFYA 4R1VA 5D11A 4D9TA 4YTIA 3AC8A 3B2TA 3ORIA 1TQPA 3PA3A 3WF9A 3UZTA 2H8HA 3HRFA 3FMEA 3MY0A 2XNMA 3KXGA 3OMVA 1YXTA 4JRNA 3E88A 3VQUA 3Q6WA 3O0GA 4AFJA 5EI2A 4C33A 1H1RA 4ZLOA 2PUPA 4R7IA 2BUJA 3MH0A 4N6YA 4O0YA 4EBWA 3F2RA 3Q52A 3FLYA 2VU3A 3HKOA 3HYHA 3PJ8A 4J8NA 4OR5A 3NLBA 3AD5A 2UVZA 5DBXA 4ANQA 4C7TA 4DT9A 3CP9A 2C69A 2WTKC 4I41A 2I0HA 4ANMA 4FNZA 1SM2A 2YM4A 3AMBA 3QQFA 3L9MA 1UU8A 4UYNA 4F7SA 4RVMA 2F49A 3C0HA 4EKLA 4TYHB 2OGVA 4BDKA 3SVVA 4H58A 4DTKA 3F3ZA 3CKWA 2UZLA 2GHGA 2FSLX 4E3CA 3WOWA 5F20A 3VS4A 2XJ2A 4QYYA 3DKOA 1NY3A 3EL8A 4FSWA 2VO7A 2W06A 3C4ZA 2JGZA 3DKGA 3D4QA 3Q4UA 1YHVA 3EN7A 3TV6A 2J6MA 2UW4A 2PTKA 1J7UA 5JGDA 4NIFA 3DT1A 2DWBA 2JFMA 4C4GA 1WBPA 4RIXB 3KXNA 3T3VA 1Q41A 4CLJA 2UW5A 3RWPA 4RJ6A 5EW9A 4GT3A 1M17A 3EN9A 4S33A 4AN3A 4ZZOA 5K0XA 1H8FA 1V0PA 4I3ZA 4YSMA 3QAME 3K2LA 4FG9A 5DFPA 1YXVA 4FG8A 4FKIA 1M2RA 4LQMA 4W8EA 4CT1A 3MN3A 3NUPA 3R7VA 3ZEWA 2I0EA 1M14A 4BL1A 4I5HA 2R3QA 2VAGA 3U87A 2ITQA 1PXPA 3MPTA 3WF6A 3DGKA 3QKKA 3QFVA 2XYNA 4LMNA 4AU8A 2J2IB 5C01A 2E9UA 3HDMA 2VX3A 3RP9A 5IMEA 4ONAA 3U51A 3F7ZA 4GFOA 2YM7A 4CVAA 4WG4A 3I5ZA 4TYJA 4DEIA 4U79A 1O6KA 3RPYA 3NR9A 5JGBA 4RJ3A 5K4IA 3QQKA 5EG3A 4EH6A 2O8YA 2YLFA 4EH8A 2PMIA 3KXXA 3R21A 4Y46A 2PVMA 1QCFA 5EYDA 1UWJA 4IX4A 4I4FA 3VS2A 4BDAA 4QPAA 4RWJA 2VTNA 3FLQA 3LFAA 3NZ0A 4C4JA 2BRNA 4FUXA 3Q60A 4EONA 3BRBA 3VBYA 3W8QA 4NJ3A 4MH7A 5IUHA 1FOTA 2OSCA 2ZMDA 4L7FA 2XZSA 5L2QA 4C02A 2YZLA 2X4ZA 3KEXA 2J9MA 5CENA 4MNFA 4FKQA 3V5PA 2XNGA 5HZNA 4E73A 2JKMA 4F4PA 2Q83A 4CZYB 2YIYA 2QURA 3NNWA 1YRPA 4DITA 4AOTA 4IZ5A 3KF4A 2QODA 3M1SA 3QXOA 4IB3A 2H96A 2XF0A 4XV1A 3RK9A 4UBAA 3R02A 2C5VA 2ZYBA 1APME 1XQZA 3BHHA 4FGBA 4QOXA 4UMTA 2YDJA 4W4WA 1UNGA 5C27A 5KKRC 2XK9A 3FI4A 3QRKA 4FV4A 2BKZA 3HUBA 4KUJA 4IZAA 4IW0A 2YABA 5AV0A 4IAFA 1M7NA 2R7IA 4UMRA 1J1BA 1WBVA 3ZXZA 3O17A 4ASDA 1PMEA 2V0DA 3QC4A 4QMXA 5E8TA 4I0TA 4BB4A 3LXNA 2IZSA 4GVAA 4E20A 5EQPA 3SG9A 4G3DA 3O50A 3LM0A 4RSSA 2IVSA 5GZAA 4IAKA 5L8KA 2YEXA 4RIYB 3ELJA 4BBMA 4EH3A 3EKNA 1ZWSA 3R01A 3EQBA 3JS2A 1KE6A 3E8NA 4FZAB 4YO6A 3UQGA 3ZYAA 3HV3A 3ROYA 3DBDA 3S00A 3DBQA 4DEBA 4MXAA 1H24A 1Q61A 5IISA 4NL0A 2C5YA 3ORNA 2VGPA 1UNHA 4C3FA 2ERZE 2J0LA 2X0GA 1JKKA 4AW2A 3QTZA 3ZUVA 4AT5A 2XEYA 1P5EA 2GS6A 5AR4A 3G2FA 1Y57A 2F7EE 4S32A 4IFCA 4TL0A 4NM0A 2V62A 1NW1A 3GT8A 2XIKA 2HZIA 3M42A 4MXYA 3NDMA 5DVRA 4BWPA 1OKWA 4D5KA 4CNHA 5C8KA 1ZXEA 4YHFA 4TTHB 5J9LA 4YHJA 1SZMA 5EOBA 3R9DA 4PPBA 3FMHA 4WBOA 5C9CA 2OBJA 4YJPA 4ACCA 1FBNA 4M97A 2J50A 2VGOA 1U46A 4DEGA 2RFSA 2WGJA 4N0SA 3MVHA 1ZARA 3BYVA 3HP5A 4BN1A 1BKXA 2JEDA 3QCSA 2CLXA 4ZTLA 2EB2A 4JG6A 1TQMA 5FBNC 5JH6A 4CT2A 2R3IA 5IQBA 2C6MA 3MB7A 2B9JA 4TN6A 2H9VA 5KZIA 4L42A 3Q9XA 2GU8A 4NIFB 5KMMA 3FJQE 3DZOA 1Q8WA 4DLJA 4XH6A 5CXHA 1OKVA 5FTOA 4UZDA 4B8LA 2FGIA 5CU6A 5CEPA 2QOFA 3LCSA 1RE8A 2J5FA 2VWUA 3HP2A 2PL0A 3LHJA 4I93A 3RJCA 4ZSGA 1KOAA 1R39A 2CGVA 4U80A 4XBRA 3VW6A 4FTLA 1MUOA 2VTJA 5FP5A 5TE0A 4IZ7A 5LMKA 4FE2A 4PL3A 5HKMA 3SQQA 3BLRA 4FTQA 2DS1A 4QT1A 1OZ1A 2IW9A 3EQFA 4ZXTA 4ZJIA 4A7CA 2VNWA 3S1HA 4E6DA 3HV7A 1JSTA 2W4JA 3VS1A 4BGQA 4E5WA 3RM7A 3V3VA 3EQHA 2XA4A 1OPLA 4BIEA 2BAQA 3LMHA 3JR1A 3E7OA 2XNEA 3UIBA 2ERKA 1DI8A 3ZHPC 4PWNA 5FM3A 4RIOA 1YQJA 3OOGA 5KMLA 4U81A 1Q8ZA 4N70A 4L3LA 5A3XA 3RK5A 4RWKA 4BCNA 2JDVA 2YJSA 5IU2A 5JGAA 3KMMA 5AP5A 3FUPA 2PE0A 4ASXA 2OLCA 2Z8CA 4BR3A 5I4NA 3PVBA 4H3QA 4F9YA 3WARA 3ZM9A 4XP3A 3PLAE 2XK8A 2Z7SA 4QP8A 4RZWA 4WIHA 2R7BA 4AQCA 1PYEA 4I20A 2HZ4A 5C03A 3OP5A 2OICA 4RVTA 4RJ5A 4ACHA 5LVOA 3KRXA 3ENHA 4C38A 2BTRA 3Q4TA 5FBOA 3DDPA 3UIXA 4LI5A 4FTKA 4KWPA 4QTCA 3FQEA 4GJ2A 3PY0A 1OIUA 4LOOA 4R3RA 4WNPA 4Y5QA 3NYOA 5H9BA 2QOIA 3WZDA 5C8MA 3TKUA 3ZFMA 2UW3A 1CTPE 4I6FA 5AR3A 4P2KA 4F64A 4NCTA 4AT3A 4EK6A 1RDQE 1H1SA 3JVSA 1WBNA 3DB8A 4UALA 2Y4IC 4X21A 4Y83A 2WTJA 3PFQA 4USEA 3KY2A 3OCGA 3VC4A 4L6QA 4CMUA 5EKOA 2ITOA 4LM5A 5DR9A 3II5A 3I5NA 2XIXA 4Q9SA 5CNNA 2B7AA 3OBJA 3PA4A 2J0MB 4L9IA 3MH3A 4YLLA 1H0WA 5JQ5A 3PY3A 4E4NA 2KTYA 4I23A 5EI8A 4CFNA 3ATTA 1T46A 4CCBA 4F65A 3JUHA 4A9UA 4X6QC 4F7JA 4IFGA 3UOJA 4RC3A 4RLLA 1PMUA 3D7TA 3ZBFA 4YTHA 2JIVA 3MJ1A 4RWIA 4NU1A 3PXRA 4YC3A 2F7ZE 2XH5A 5HBHA 1BYGA 4J7BA 5KE0A 3I0OA 4BTJA 4QP6A 4M0ZA 1YXUA 2C0IA 4XP0A 5G1XA 4W4YA 4LGGA 3QTQA 3R63A 4TXCA 2QOQA 3G5DA 3UIUA 3C4CA 3L9NA 5AX3A 5DNRA 3EQRA 4HZSA 4TYEA 5B2LA 3ANQA 1HCKA 2PZRA 2JDOA 4BKJA 1P14A 2X4FA 4EWHA 4O82A 2GCDA 2W1GA 3CTHA 4GG7A 4E5AX 5ETFA 3U6HA 5E9EA 3NVKI 4RFYA 1KUTA 3UO6A 2JITA 3E62A 5DYJA 3TDVA 1H0VA 2CN5A 5DI1A 4BC6A 3LQ3A 4FKVA 3GGFA 5A4QA 3H4JA 4E6QA 3DLZA 1FMKA 2YJRA 3O51A 4ACMA 2CDZA 4EHVA 2X8IA 3IW5A 5DMZA 3NGAA 4H36A 1OL7A 3GC7A 4QO9A 1OIYA 5M56A 3F5XA 4FKUA 3G0FA 4JXFA 4GSBA 4J71A 1VYWA 2OK1A 4HYUA 2JAMA 3FSFA 3PA5A 4YJQA 4FV9A 1URCA 2CNVA 2XNNA 1W84A 5L8LA 4NYEA 4IX5A 3SGCA 5A4TA 3U54A 5LVPA 4MWIA 4FI1A 3PJ3A 5D7VA 5CVGA 4FV8A 5HCZA 2R3HA 4II5A 4WG5A 2VNYA 3QUDA 3S4QA 3S0OA 4D58A 2I0VA 3FZSA 3PE2A 2A19B 4O27B 4ZAUA 3RZFA
chains in the Genus database with same CATH superfamily
3DFAA 2OJ9A 5J87A 2R3KA 3ACKA 4DH7A 3UQFA 5BUIA 2XRWA 3BL9A 4HYHA 2XANA 2G9XA 3I7BA 3PJ2A 1PXLA 3O8TA 4L67A 3K5VA 3RNIA 3A99A 1FVTA 2R0UA 5IDPA 4HCTA 1Q99A 4JIAA 4O7NA 3ZO4A 4FNYA 2IZRA 2NO3A 5J79A 4CQEA 1XH6A 3WIKA 4AX8A 1IA8A 2HK5A 3E93A 3MVJA 4BYJA 4OTPA 2R3GA 5BNJA 1SNUA 3R28A 2FH9A 2XS0A 3A7FA 4FC0A 4FOBA 3N9XA 1H07A 2ZDUA 4D2PA 1PMNA 1JNKA 3O96A 3E3BX 5L8JA 4O96A 4QEBA 4RT7A 2C3JA 3GC0A 4AXAA 3MH2A 4Q9ZA 4BCJA 2BKKA 5EYCA 2I40A 1ZYLA 3R8PA 3QGYA 3BBWA 3IOPA 5LCKA 3D94A 4BDFA 4C35A 3CBLA 4O81A 4YLKA 3K54A 3EFWA 5CVFA 3F3WA 1GY3A 1Z57A 3TNPC 5CQWA 2C1AA 1ZY4A 2OFVA 3B8RA 2Y0AA 3HL7A 4QP4A 4OTDA 4RVLA 2WMBA 5HCXA 4HGSA 1BI8A 5HBEA 2ITWA 4Z7GA 4CFMA 2OKRA 3A2CA 5F4NA 2XRUA 3KN5A 2BZJA 2ZV8A 3ENMA 3H10A 2W1DA 3NS9A 2C0TA 4FSUA 4EZ3A 2W5HA 5AJQA 3ZFXA 3OT3A 3LQ8A 1YXXA 4D2TA 1B38A 5D7AA 3QD4A 3QA0A 3BGZA 4JX3A 4MHAA 4KIKA 5AUWA 3W18A 4PF4A 3EYGA 2XK6A 3CD3A 4Z55A 3E64A 4CKJA 4FKLA 5CAQA 4DBNA 3C5UA 2YITA 3OWJA 3DDQA 4M7IA 4JDHA 5DGZA 5EW8A 3SXFA 2IN6A 3UODA 2CCIA 1X8BA 5H8BA 5DG5A 2JKKA 2RFNA 3ET7A 3DJ6A 4LL5A 5B2MA 3MS9A 3Q5ZA 5BV3A 3D7TB 4IXPA 5CX9A 4O4FA 1ZYCA 4MQ2A 3QBNA 3LMIA 3LFSA 3PXYA 5AV4A 4FNXA 4OT5A 1PW2A 5HOAA 1BX6A 5M4IA 3R9RA 4APPA 5I3OA 2UZVA 4EOKA 2QR8A 3RTPA 3PG1A 5AP6A 2IVVA 4YU2A 4AGCA 2XYUA 2VO0A 3D9VA 3FI2A 4BTMA 4YJTA 3AC2A 1OBDA 3QTUA 3TN8A 3WZJA 1GOLA 4O0VA 1G3NA 4IQ6A 4EJNA 3KVXA 2YACA 4RGJA 4WKQA 3ZC6A 4O86A 4FV5A 3KQ7A 2AEGA 3VNTA 3COKA 5BUJA 4JQEA 3FKLA 3K3IA 2WIHA 3FY0A 3KXZA 4G5JA 2R4BA 4QMTA 5HG8A 1XH4A 4XRLA 4EC8A 2XARA 2WIPA 4K33A 3QYZA 3MTLA 2E9PA 3P9JA 4FSNA 4K2RA 3L8SA 2WFYA 2YCQA 3FV8A 3V6RA 4N4SA 4EK8A 3DTCA 4XV3A 4UXQA 3FEGA 3KIOC 3W8LA 4BWXA 2Y8OA 4C8BA 3BCEA 3TTJA 3QXPA 4CMTA 4NJDA 4YO4A 1YI6A 5E8WA 3VS3A 2QOOA 3R1QA 5M06A 4XG8A 1BL6A 3VUMA 3QX4A 2PVFA 3HMOA 4M15A 5EFQA 3QQHA 3OTUA 4CMOA 4O22A 3FPMA 1UVRA 2V55A 3LCOA 4K6ZA 2B9HA 3QHRA 2H34A 4TYGA 3NFFB 3NUAA 3CJGA 3ORKA 1WVYA 3MJ2A 4ZY4A 5KMIA 2J0KA 2WU7A 2WOTA 4GVJA 3Q2JA 2PY3A 3K5UA 2I1MA 4TNDA 4PQNA 3TNWA 4QMMA 3R73A 5AR8A 4AW5A 3NUYA 4GK2A 4EC9A 5KMKA 4GUEA 5FEEA 2QLQA 4X7QA 4HW7A 3O7LD 2PE2A 2ITXA 3HV6A 3I60A 1OKZA 2R3JA 2YM8A 3KXMA 4O4DA 3RAKA 3C51A 2PMNX 1UU3A 4LV8A 2Z7LA 3UIMA 4CFFA 2ZJWA 3DZQA 4HPTE 3CCNA 4QPSA 4DCAA 3AMYA 3BQRA 3WE8A 2BAKA 2QO9A 4ANLA 3DQWA 2WAJA 2BRHA 2OIQA 3BV3A 3BX5A 5KX8A 3EFLA 3GCSA 1O9UA 1Q97A 1URWA 2C6IA 2ITYA 1AGWA 2V5QA 5HE3A 3WF8A 2IJMA 5CT0A 2BILB 2UVYA 3MB6A 3QX2A 4Y72A 5CU4A 4LUDA 3OWKA 4J53A 1EH4A 4EUUA 2YHVA 2OFUA 2ZAZA 4XG2A 5CF4A 4RWLA 2WQMA 4CFWA 2ZB0A 3DU8A 3BU6A 3FMLA 3H9OA 4NTSA 5A4LA 5JKGA 1YDRE 1RQQA 4IM2A 4O4EA 4AZEA 4BI2A 3QWKA 1V0BA 4FKWA 4HYSA 2REIA 4FTNA 2CHLA 3QRIA 3R2BA 3A7GA 2W5BA 1XH5A 3PXKA 4WHZA 3DBFA 3LJ1A 4HCUA 5H8GA 4IB0A 1OL5A 3QCXA 4R5YA 2V7AA 1H27A 1PJKA 1Z5MA 5L2WA 3TWJA 1W83A 1E1XA 1Q4LA 3O71A 1PXIA 1ZYSA 1M52A 3QTSA 4NKAA 4Y95A 3ACJA 1ATPE 4IB1A 3HV4A 4KIKB 2PUNA 3TNHA 4KIOA 2QD9A 4O84A 4ZSJA 2XCKA 4YLJA 3VAPA 2UW0A 3WE4A 2WTCA 2JIUA 2X2LA 3LFNA 4QTAA 4DAWA 3N4VA 4E4LA 3ZXTA 2X39A 3QZHA 1MRVA 3L8XA 1H08A 4U45A 3TZ7A 3UC3A 5CF8A 3FDNA 4AOIA 2V7OA 4A9RA 3QTWA 3NUUA 4NK9A 4FTRA 2C6KA 5AFVA 4PP7A 3MFSA 4L45A 3LLAA 3KMUA 3MIAA 4V01A 4MXOA 2QQ7A 4LDTA 5DT0A 1WBWA 4MBJA 3FQSA 3DAJA 3R9OA 2CNUA 2UZDA 3QU0A 4D1XA 4RA4A 5HCYA 3PVWA 1T45A 3BYSA 3RM6A 3D14A 3FMJA 3PSDA 3AT2A 1K2PA 4H3BA 3R30A 4JX7A 3SW4A 4GJ3A 4EUTA 5K9IA 2HWOA 3EQIA 4U0IA 1ST4A 3P7CA 3LPBA 3D0EA 4F6WA 2O3PA 1IG1A 2EWAA 2BHEA 3BHYA 3HMPA 4KKHA 4X2KA 2WHBA 1KWPA 3D2KA 3FYKX 4I24A 3GC9A 4NW5A 4OLIA 2YWVA 4AP7A 4E4XA 2CN8A 4CEGA 2PVNA 3ZLYA 2Y7JA 1MQ4A 4FG7A 4GU6A 2GMXA 4RJ7A 1ZMVA 3VBTA 4ANNA 3EQDA 3QUPA 1VLRA 3EN6A 3AD6A 1ZRZA 4EHEA 4EQUA 4IM3A 1GIJA 5AUUA 4EORA 3C9WA 3WBLA 3DNDA 4JOAA 4QMQA 4F78A 4JBOA 5A4CA 2VX1A 2XALA 3PSBA 4ZOGA 4OTRA 4NH1A 4CXAA 3W0SA 3HVCA 5HLWA 5JZJA 3ZU7A 5TKDA 4RX7A 2XKFA 4Z16A 4BZNA 3GNIB 4FEUA 3T9TA 5F95A 2IF8A 4CQGA 5AP7A 5CEOA 5JZNA 4APCA 3RK7A 1JSVA 4PMSA 3VS0A 4DGOA 2A98A 2HW7A 3NW6A 3ID6C 1WMKA 4L44A 4D28A 3H0ZA 3GCUA 3I0QA 3ETAA 2BRGA 2YCFA 3PG3A 4QYEA 4BFMA 4JBQA 4FT0A 4ZMFA 2VTHA 5GINE 2R3MA 3BYOA 3KC3A 4E93A 3N4UA 2GFSA 4FT3A 3PFYA 4R1YA 2XJ1A 3Q32A 2ZV7A 2VO3A 3JXWA 3KULA 3G15A 2ZV9A 3LFDA 4C3PA 2RKUA 3QRUA 2R3OA 4B7TA 1F3MC 2YCSA 4FTIA 2UW7A 4IVCA 2ETKA 4RC2A 3W2PA 1LUFA 4CSVA 2RGPA 1W2FA 3F66A 3NX8A 2BDWA 1MRUA 4O7SA 2JD5A 2W1FA 2XAOA 2WPAA 3EKKA 3MA6A 5IPJA 4NKSA 3I7CA 1H01A 1W7HA 4C57A 3CEKA 3H3CA 1YVJA 4G17A 4KKGA 4RPVA 4FTUA 3Q6UA 4F9CA 1UU9A 4F6SA 2FA2A 2R0IA 4BHZA 5ANEA 3ZTXA 2Z7RA 5DHJA 4F08A 3UDSA 4F6UA 2CSNA 3NYXA 4JDKA 3Q53A 2NPQA 3KK9A 5FUTA 3FZRA 3LMGA 4FV7A 4YJOA 4IAAA 1G8JA 4WA9A 2YWPA 1JOWB 4OW8A 5LMBA 5ETIA 4F9BA 3NYVA 4F1MA 4DFBA 3MFTA 4MCVA 4DLIA 3UOHA 3OCSA 4NUSA 2A27A 5FP6A 4KD1A 4XCUA 2ZB1A 2CNQA 4DEEA 4R3PA 5BMMA 4C4IA 4DGGA 4XOYA 4GIIA 5TO8A 3A4PA 4MF1A 2UUEA 3T8OA 1YDSE 2P33A 4WT6A 3SDJA 3PVGA 4KSQA 5M53A 1ZY5A 3P5JC 3GUBA 4I5CA 3FHIA 4CZUA 5JFVA 4XV2A 2OH4A 2C3IB 5DEYA 2XP2A 4X2GA 3MY1A 2F2CB 3ORZA 3TV4A 5M57A 5C1QB 2UZNA 3OWLA 2C5OA 5C4KA 2VTLA 2B53A 3PVUA 3QZGA 3G9NA 3BV2A 5ITAA 3LE6A 1SMHA 2JDTA 2A0CX 2E2BA 4KINA 2F7XE 4ZSAA 2X0PA 3RCDA 3WIGA 3ZLWA 5E8SA 4E6CA 3P79A 5E8XA 3FC2A 5AV2A 3C0GA 4CTCA 3UQCA 3AC1A 2AUHA 3NNUA 4TW9A 3TMOA 2YZAA 3AT4A 2BFXA 4KS8A 5EH0A 4BTKA 3QTRA 2W17A 1FGKA 2HELA 5HLPA 5DWRA 3RZBA 4BTFA 4F0IA 2EB3A 4Y85A 2YIQA 4E26A 1OITA 4XG6A 5E90A 2UZWE 4YPDA 4YZ9A 4UMUA 4GK4A 1CM8A 3DNEA 3FC1X 2XIRA 4AS0A 3HV5A 4QTBA 1XH7A 4JQ8A 3ZMMA 1FVRA 5BVDA 3OS3A 1E1VA 3BPRA 2HZNA 3GCPA 4PDOA 4F1TA 5IDNA 2CJMA 1WCCA 4ACDA 2B1PA 2W1IA 2VUWA 3MY5A 3L8PA 4Q5HA 4BBFA 2BR1A 1IR3A 4FV1A 1GZNA 3NCZA 5EHOA 1QPEA 2PSQA 4R78A 4P4CA 4QTDA 3UDBA 2HOGA 4G3FA 3O8UA 3RALA 2GHLA 1JKSA 4CRSA 3SW7A 4AG8A 4E1ZA 5KHXA 3FMKA 5IA3A 4MD8E 4M69A 2W05A 3RKBA 4BF2A 4WUNA 2VTAA 4GG5A 4DF3A 5J5TA 2OU7A 3H30A 3IKAA 3TACA 4O7YA 4J1RA 1AD5A 4RFZA 2Z7QA 4D1SA 4YJVA 3BU5A 3EMGA 3A7IA 3NCGA 3PY1A 5AIRA 3U8WA 4YURA 3OF0A 3TIYA 2CMWA 4FIGA 5A54A 3EJ1A 4IAIA 5AA9A 2CKOA 2PE1A 1CMKE 3RBWA 3F3UA 4TWNA 1F5QA 4M68A 4P5ZA 4YZNA 3SA0A 4BDIA 4ORKA 4A4XA 2BHHA 4D4SA 4EOSA 5L4QA 3ATSA 3LKMA 5CEIA 4IAYA 3C0IA 4IC8A 3RAWA 3TT0A 3E5AA 3U4WA 3W32A 2JBPA 5CAOA 5LMKC 3PWYA 2ZM4A 4M14A 4OAVB 3DBEA 5BQ0A 5ANDA 4X3JA 4G31A 4G9RA 4E8AA 5BYZA 4ZTMA 1YOLA 3EFJA 3EFKA 2BPMA 2B52A 3U6IA 2QO2A 3IGOA 2UW6A 4GT4A 2PVHA 3NYNA 4JMQA 3KULB 1TKIA 5DEWA 4OBPA 3VIDA 1I44A 3OHTA 5ACBC 4RZVA 4ZZMA 5GNKA 5CAPA 2VWYA 3UVQA 2YAKA 5AR7A 3FZ1A 4H39A 1OPJA 4FV6A 4P90A 5E8YA 1KE8A 1DAYA 5CASA 5BX0A 1FMOE 4HVSA 2J0JA 2ZFYA 2P4IA 4F0FA 1W82A 3GEQA 4EK5A 4O0RA 4PMTA 4YZMA 3ULIA 3WZUA 4BDCA 1M2PA 3SOAA 5HD7A 4BGHA 4NM5A 1Y91A 3FMMA 2RG6A 3FLSA 3HZTA 4RC4A 1P2AA 4FKPA 4BDHA 3ZEPA 3IW6A 2PZ5A 4DHIB 4FYNA 3OW3A 4DEDA 1U5QA 3SG8A 4O0XA 5AWMA 4PTCA 4JBPA 4RIWA 5HO8A 1XHAA 5I9UA 1Y6AA 3F5UA 1OVEA 3AMAA 4BJJA 3NPCA 1WZYA 2ZMCA 2P3GX 4FGRA 3C7QA 1JLUE 4FUYA 4NCTC 2P2IA 2EU9A 4ITJA 4WBBB 3R8ZA 2OXYA 3HNGA 2FSTX 3IDCA 3P7BA 3VULA 3EZVA 3CQWA 2W99B 3RINA 4EL9A 5DT4A 5ANOA 3UNKA 1YI3A 3COHA 4FICA 4DCEA 3COMA 5AUXA 4H1MA 3PZEA 2PZIA 4AE6A 3AC4A 2WQOA 4QQTA 1XR1A 3QKMA 2G1TA 4MQ1A 4U40A 3R8MA 1O6LA 1M7QA 4FBXA 4CFVA 5AP3A 3TM0A 2X0QA 3W2QA 4MBIA 4UMPA 4Z3VA 4CYIA 4YNOA 4PDYA 4A9TA 2UZBA 2QC6A 4UXLA 3R7YA 2WEIA 3F82A 3UZPA 4ASEA 3CQUA 5AA8A 1Q5KA 4O2PA 3QALE 5IQGA 5CWZA 2OJGA 3EL7A 4FIJA 3Q9WA 5J7BA 2BMCA 4XP2A 3IW8A 2GSFA 2FYSA 5HIEA 1Q3DA 4IDVA 4IDTA 2X9EA 4S31A 1ZMWA 3I6WA 5HE2A 2ZVAA 2RG5A 5IQFA 1OL2A 3DCVA 3BEGA 3LFQA 3OY3A 2QLUA 1XWSA 1KE9A 4FKTA 4FTAA 4X3FA 4DBXA 3V04A 3PRIA 4YP8A 1BI7A 3OXTA 3FXWA 2BIYA 5T3QA 3VJNA 4DGLC 4LRJA 4IBMA 4JIKA 3TZMA 3PXFA 4FTJA 2OWBA 3PUPA 3DAEA 4K9YA 3QD0A 4LRMA 5JRQA 2B4SB 4KB8A 3E63A 3NW7A 4ZK5A 2VTOA 1Z9XA 1PXMA 2C3LA 4ZY5A 5H3QA 3WZKA 4M0YA 5L6WL 3D15A 5HU3A 2W1CA 3G9LX 3UG2A 3E92A 3UP2A 3QZIA 4M69B 1WBOA 1P4OA 3EWHA 2YIXA 3TKIA 3KMWA 3DQXA 4O2ZA 4DFUA 4NFMA 2OG8A 5GZ9A 2NRUA 5IUGA 4O7WA 2BROA 3V8TA 2J0IA 4L52A 5JRSA 2QU5A 3UP7A 4BHNA 2C47A 5I5ZA 2IWIA 1ZZ2A 2G15A 1YW2A 3THBA 2PK9A 1PXOA 1JSUA 2WU6A 3KU2A 1KOBA 4BCQA 5HGIA 1WBSA 4YPSA 3RVGA 4YC8A 2YAAA 5AP0A 5A6OA 4DG2E 2ETMA 1XBBA 5EK7A 1DAWA 3QRJA 3SV0A 2CPKE 3GI3A 4EKKA 5LWNA 1Y8YA 4AGDA 3LAUA 1OL1A 5G6VA 4FKSA 5HE0A 4JR3A 3KKVA 4QMVA 3RCJA 4ZS0A 4ZTSA 3DB6A 1IA9A 5CEKA 3PSCA 4KSPA 4GYGA 4XRJA 2HW6A 3EN4A 1J1CA 3GCVA 4S2ZA 2XM9A 5ANKA 3CIKA 3GU4A 3IO7A 4TY1A 5E92A 5AUTA 2WMQA 3DPKA 3FL5A 4AAYA 4AN2A 4BDGA 2WQNA 2AC3A 3QLGA 4HNFA 5K4JA 4ZLZA 2VRXA 4HZRA 1U54A 2GNGA 5EM7A 1V0OA 5CAVA 3AT3A 2P2HA 4MNEA 5IF1A 1PXKA 4DC2A 4MXXA 5AADA 3TDWA 5I3RA 4BGGA 4AGUA 4IJ9A 3ZO2A 3TTIA 2WMVA 4F70A 4FJVA 3AOXA 1NVSA 4AOJA 5BPYA 4RX8A 5BVOA 2EXCX 3QF9A 4GKIA 4Q5EA 3ORLA 5HG9A 4A06A 2BCJA 2Y4PA 2YM3A 4RIWB 3BL7A 1YXSA 3HDNA 2B9FA 5M4UA 4Q2AA 2X6EA 4BJJB 4EWQA 4YTFA 5I0BA 4AA4A 2EXEA 2OXXA 3CY3A 4DFYA 5AEPA 5J9YA 4ZTRA 4C3RA 5AAFA 1SVEA 1R1WA 2ONLA 3D5XA 3D5UA 3QQGA 4GKHA 1ND4A 3QL8A 1UKHA 4GEOA 4ASZA 3G0EA 5J5SA 4R77A 4I6QA 4EQMA 3HUCA 3SD0A 2E9OA 3DK3A 4GMYA 5CZIA 4OGRA 5TOZA 3C5IA 1H1QA 4L43A 3Q96A 4EK3A 4XG7A 3PPKA 3SC1A 2PVRA 4AGWA 4C59A 5FD2A 4D2SA 2E9NA 4Z7HA 4QMNA 3UNJA 2QHMA 3H9RA 1H4LA 2YCRA 3IW7A 3ORXA 5FRIA 2ACXA 4JG8A 2XJ0A 2KULA 1E9HA 3WYXA 2IEWA 1FPUA 3V8SA 1BL7A 2WEVA 4C2VA 1A06A 4FIEA 4MD9E 4YZDA 3MV5A 5CSXA 4MUQA 1SNXA 3D5WA 3K3JA 2X1NA 2BDJA 3CQEA 2B54A 3UOKA 3PZHA 4RX5A 5EDRA 3NWWA 1CSNA 3R6XA 5HTCA 3D5VA 4EH7A 3CE3A 2F9GA 4BKYA 5KMOA 4QYFA 4BI1A 1OGUA 3LXPA 4TNBA 4UWYA 5E8VA 3ZOSA 3F5PA 4LRKA 2O5KA 2XK7A 3VBQA 4EK4A 3DTWA 2PZYA 3BHVA 1J3HA 2UW8A 4ZTNA 3RPVA 2J90A 3FMDA 2W7XA 4X3FB 1RJBA 4IWQA 4K77A 3DKCA 2PMLX 3IPHA 4KBCA 4LOPA 1R0PA 3TJCA 3ZLSA 2JKQA 3M11A 4ERWA 3F61A 5HE1A 1YWNA 2YISA 2X8DA 1FGIA 2WD1A 2UW9A 5EOLA 3QKLA 5HTBA 3ML1A 4DFXE 4MF0A 3AKJA 4O83A 4Y5HA 5GJFA 1YI4A 5B2KA 4HNIA 4QTEA 4YJSA 2XM8A 1JKTA 2IZUA 3CKXA 4ZSEA 2SRCA 4Y8DA 5CALA 3NAYA 2JKOA 4PTGA 5IH4A 4GV1A 3FI8A 3U55A 5D41A 4PDPA 1XH8A 3C4XA 2X7OA 2I0YA 4X2NA 4S34A 5FTGA 4X6RA 5K0KA 3ZDIA 3R83A 3HA6A 3A4OX 4CGAA 5D10A 3LLTA 3BLAA 5HEZA 3S3IA 5M55A 3FXXA 4G3GA 3R7GA 3GU6A 4V0GA 2UV2A 2UZTA 2WQBA 3QTXA 4UWBA 3UJGA 4XOZA 1OI9A 3C4WA 4LL0A 4WG3A 4I5MA 3RAIA 2CKEA 3NUNA 3L8VA 4FYOA 1KSWA 4I6HA 3IOKA 5ACKA 3V8WA 3BE2A 5K5NA 3TEIA 1GZKA 3UZRA 4HPUE 2W9ZB 3N51A 3ITZA 3PP1A 5AR2A 4O4CA 4FTTA 2R5TA 3EOCA 4ZY6A 2VZ6A 1PKDA 1RW8A 4JS8A 5EHYA 2LAVA 3W2RA 4CLIA 3MWUA 1H1PA 3F9NA 4JNWA 4BICA 3FLWA 4PMMA 5J8IA 4W9WA 4W9XA 4CV8A 3LXLA 2DQ7X 3W16A 5KHWA 3VWAA 3R1NA 4AZTA 3CPCA 1H00A 4TYIA 4EOOA 3V01A 3W0NA 4YSJA 5AUVA 3UDZA 4FKRA 3L9LA 5IG1A 5EDQA 3ZZWA 4F7NA 4KS7A 5FEDA 3G6GA 4YJRA 4O7TA 1U54B 3ZO1A 4EH4A 3KA0A 3QA8A 3DXQA 3JYAA 4MNEB 1PKGA 2UZOA 2YM6A 2J4ZA 3FHRA 4FIHA 2YN8A 3B2WA 4GL9A 2CGUA 2QR7A 3W33A 4CYJA 4PMPA 5KO1A 3F88A 3VUDA 3Q4ZA 5HNBA 3PPZA 4F99A 3MGYA 4AN9A 4QP7A 5FXSA 2R3PA 4FSQA 2UZEA 3LJ0A 4BYIA 4EHZA 2OW3A 4EOIA 3SXSA 5A9UA 4FK3A 5LARA 4UZHA 2VTMA 4F9AA 4RLKA 2QVSE 4RRVA 3OOMA 3KRJA 3W2SA 3CD8A 5JK3A 3FMNA 3R8UA 1U5RA 3F6XA 1LEWA 4DH3A 4HVDA 4DHJA 3IDPA 3V5LA 1Q8UA 5DT3A 3WI6A 2C5XA 3TXOA 4DYMA 2X81A 5CZHA 1J7LA 3E3PA 5HNGA 4F0GA 5AR5A 1U59A 3JVRA 3FY2A 1JQHA 2ITVA 4A4LA 3OWPA 3V5WA 2WMSA 3A7HA 4X2JA 4MYGA 4XLVA 3QZFA 3BLQA 5ANGA 4S30A 4M8TA 4WRSA 2VO6A 5KBQA 2RIOA 4M66A 4PUZA 1PRYA 1JWHA 2X2MA 5CANA 5IEYA 2E9VA 1PXJA 5LJJA 5JN2A 4JDIA 4HGEA 3UG1A 2WMTA 4USFA 4MK0A 3ORMA 5M4FA 4RQKA 2VWXA 4DE4A 4HVIA 4ERKA 4NT4A 4QMLA 4BDEA 4XX9A 3OROA 2IVTA 5I9VA 4ANBA 3ZRKA 1PY5A 3MVMA 4FODA 1MRYA 2XK3A 3KRWA 2VD5A 3JY9A 4ZS4A 5L2IA 3UC4A 5LQFA 2GNHA 1J7IA 4UYAA 2OF4A 4IHPA 3SRVA 4A07A 3TV7A 5ETCA 1OBGA 3BEAA 4FZ7A 5HVKA 3F7WA 4FZDB 3PXQA 2C4GA 3WZEA 5JT2A 3COIA 2OF2A 4DFLA 4QMZA 3FXZA 5CXZA 4I1ZA 4BCKA 1WVWA 2BALA 2XKCA 3EQPA 4FV2A 4MTAA 4WSQA 5AP4A 3RMFA 5IA2A 2IG7A 5BYLA 4JG7A 1YHWA 2C6DA 2GNLA 3EYHA 4U97A 4C4HA 1GIIA 4C58A 4KABA 2WTIA 4KRDA 1YOMA 3QQLA 4I92A 4UMQA 3F2AA 5IQAA 1XBCA 1W8CA 3OEFX 3DFCB 4KKEA 1B39A 5BVNA 1ZLTA 2F4JA 3CSVA 4RJ8A 2J5EA 4YBKA 4O7VA 4LOQA 1WAKA 3ULZA 3R8VA 2Y9QA 4W8DA 2JFLA 4YBJA 2VTRA 4XG4A 5E91A 2DUVA 4O1OA 3VS7A 1NT2A 4U8ZA 3TKHA 2XKDA 3C50A 2HZ0A 1G8KA 5J95A 4MBLA 4QNYA 2XK4A 4MD7E 3D83A 3A8XA 3BKBA 5IQHA 3BBTB 2WTVA 3EIDA 4EYJA 3VBVA 4F63A 4FX3A 4OTHA 3GFEA 4LFIA 5B7VA 4XLIA 2BRBA 2X0OA 3ZDUA 4G16A 5D1JA 3TJDA 4V0GB 3VBXA 1H28A 5AUZA 2R3LA 3CY2A 2PVLA 3UVPA 4E6AA 4EOMA 3PIYA 5IA1A 3FLZA 3W0OA 4W4VA 5CU3A 2C6EA 3ODYX 1UNLA 4DHZA 3G90X 2FO0A 3BGPA 4IADA 3KRRA 3CGFA 4CG8A 2WMXA 5B0XA 3G33A 4UB7A 4QNAA 5E7RA 3AGMA 1KV1A 3LIJA 1O6YA 4IIRA 5CI6A 5BYYA 4L68A 3HAVA 5AP2A 3ZCLA 4DTBA 4DT8A 3ZUTA 3FYJX 2VN9A 3RWQA 4PNKA 3LM5A 5AV3A 4FV3A 1K3AA 4ITHA 2XIYA 3NSZA 4UEUA 3A60A 4NTTA 5CS6A 1FINA 3IGGA 4GFGA 2OO8X 3LFEA 3Q4CA 4M84A 5AM6A 5E8UA 2ZM3A 4FZ6A 4CKRA 4PTEA 4N57A 3IDBA 3MI9A 5C8NA 3PYYA 3QQJA 3Q2MA 3CLYA 5CU2A 5D9HA 3TNIA 1TVOA 4EOLA 4G1WA 2PU8A 1HCLA 1TQIA 4GT5A 4QDVA 2WNTA 3DJ7A 3GU7A 5FDXA 3Q9YA 2GFCA 2W4KA 4D4RA 2RFEA 4JDJA 2GNFA 4L00A 3IS5A 1OM1A 5HHWA 2YLEA 3BE9A 2QU6A 3AQVA 3TG1A 4D2VA 4EJ7A 1REJA 3HX4A 2GDOA 1GIHA 1VR2A 3R8LA 4DEHA 4HCVA 4M12A 3O7LB 4FKJA 2PVKA 4YZBA 4FSYA 3WF5A 4C34A 3V5JA 4JQ7A 3P0MA 4ARKA 1JAMA 1KE5A 4FL2A 3E8DA 4PL4A 5L3AA 3WYYA 5IMXA 3OBGA 1XO2B 3KVWA 4AXFA 1LEZA 2GTNA 5EM5A 4C37A 3IONA 4PX6A 2GQRA 3MDYA 4ZZNA 4A9YA 1LR4A 3C13A 4TKSA 4GW8A 5KCVA 4M3QA 1NVQA 4IE9A 4ACGA 4HVHA 4WO5A 5BMSA 4J99A 3R2YA 3R7EA 2X9FA 3OW4A 5CSVA 2ESMA 3TCPA 4D0XA 4JAIA 2AC5A 2UVXA 2UZUE 3A61A 2NP8A 4MWHA 4XHKB 5HVYA 5IZFA 4J8MA 4BDJA 4IWDA 2WO6A 4NW6A 4ZJJA 1WVXA 2W0JA 3R00A 1OGYA 4XUFA 2OXDA 3RPSA 5DOSA 4YNEA 1UV5A 2NNWB 2PULA