2GCDA

Tao2 kinase domain-staurosporine structure
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
309
structure length
308
Chain Sequence
DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TAO2
publication title Crystal structure of the MAP3K TAO2 kinase domain bound by an inhibitor staurosporine.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 96
structure length 308
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gcdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gcdA01
3KEXA 2UW3A 2JKMA 3CGFA 5CT7A 4OTDA 3UNJA 3ZDUA 4KWPA 4U79A 5HOAA 3RK7A 1OUYA 3E3PA 4M69A 1Z9XA 4XV2A 5CS6A 3ANRA 2O2UA 3HA8A 3RZFA 5BPYA 3HAMA 4X3FC 4Q5HA 3ZLSA 5ANEA 4DEEA 2PVMA 2VAGA 3PVUA 4AT4A 1V1KA 3QF9A 2VX3A 3D7TA 4M68A 3IO7A 4X0MA 5HGIA 3GC0A 2GQSA 3BLQA 4K9YA 1ZOGA 3DFAA 4A9RA 2C5YA 2C6LA 4XV1A 1PXLA 3W2QA 5BUEA 3P5KA 2CMWA 2XRWA 4NZWB 2R9SA 3TUDA 3H0ZA 3CKXA 2VTLA 5D7AA 1RDQE 4LV5A 4GYGA 2XUUA 3MPAA 2VTRA 4QP8A 5EG3A 3TL8A 5HLNA 4XHKB 3AC3A 4IAZA 4CFMA 4FTMA 4G5PA 4OAVB 5G6VA 4FEUA 4FOCA 2YITA 1JQHA 4RIYA 5ANKA 3ORIA 3MVMA 3TCPA 1YXSA 3QXPA 4ZSEA 2QI8A 4FT7A 3QUPA 4PPCA 1YDRE 3P7AA 4EOLA 3PA4A 1XH5A 4QQTA 4AXAA 1G8AA 4I1ZA 4RFMA 3MTLA 3TWJA 2QKWB 2P55A 3FUPA 4GVJA 3QTSA 4JR3A 5JGDA 3CQWA 2UZWE 2C6TA 3LCTA 4RIYB 3BPRA 1PXNA 2YLEA 3C0IA 4CFUA 2BRBA 2UW6A 3F7ZA 3EFWA 4GG5A 5D10A 3R83A 2R3MA 1TKIA 3PVGA 5AM7A 2V7OA 4EZ7A 3SGCA 2X8DA 4EHVA 1BL7A 5EI8A 2X7OA 1SYKA 2WQMA 5ETAA 2OFVA 4FICA 4PWNA 3TTJA 4OT6A 5BMSA 1WVYA 2BZIB 2XNNA 4QMNA 5IEVA 3P9JA 4UWBA 2X4ZA 1G3NA 2I6LA 4RQVA 3VUTA 3WZEA 4QYHA 2JITA 3CKWA 4FT9A 3RI1A 3T9IA 3AMBA 2XMYA 4IVDA 3EN5A 4JRNA 4YURA 5AWMA 4ANBA 4B4LA 3PG1A 5BUJA 2QVSE 4EOIA 4BBEA 4AOIA 1B6CB 3NCZA 3V5WA 4UWCA 3C4WA 4O6LA 2WHBA 1LEWA 3PP1A 1Q41A 2PWLA 4EUTA 4TW9A 3NVKI 3ELJA 4CG9A 2J7TA 4ENYA 3E7OA 3COMA 2JBPA 5B2MA 4ITJA 1BLXA 4PPBA 4KUJA 3IKAA 2OZAA 3B2WA 5AMNA 5DI1A 3EQIA 1W7HA 4TN6A 3ET7A 4FKWA 2QHNA 4ZTSA 2F2UA 4U81A 3VW8A 4HCTA 4LYNA 3WILA 3L8SA 3H3CA 4H1MA 5IQDA 3QLGA 5LOHA 4BBMA 1L3RE 4IJPA 4MNFA 4HYIA 2F4JA 2BZKB 2OZAB 3FI4A 3ZHPC 3V5LA 4UMRA 3MVLA 3TEIA 4KABA 4YU2A 5LVLA 3MJ1A 3OY3A 4ZTHA 3PA3A 3TDVA 4AG8A 4BL1A 2G9XA 5HESA 3ULZA 2W0JA 3S3IA 3W55A 4XX9A 4IX6A 2QONA 3DNDA 2E9PA 3QLFA 5DIAA 3R00A 2BHEA 4RIWB 1O6KA 2Y9QA 3WI6A 3LXNA 4RIOA 3UG2A 1Y6AA 5I0BA 5FG8A 4OTFA 3ZMMA 3FL5A 4IDTA 5DR6A 4YZCA 4GJ3A 3K5VA 3R7EA 2PZRA 3CD8A 5AJQA 5AEPA 1SZMA 2WU7A 4C4EA 4NYEA 3HMNA 2B9IA 4BKJA 4K77A 4M15A 3GT8A 2WTJA 4LUEA 4ZJIA 4XG9A 5ANDA 2ZDUA 4GK2A 4DTAA 4QD6A 4X2JA 1VZOA 2XNBA 1OPKA 4I5PA 3NW5A 4QYGA 4TPTA 4TZRA 3R8UA 4F6UA 3L9LA 2XZSA 4BC6A 1PXMA 2BPMA 3RPSA 5KMKA 4RZVA 3A7GA 5HNBA 2XNOA 4D4YA 1OBDA 3IONA 5HU9A 2YERA 2H34A 3O71A 5J5TA 4FNYA 1UWJA 4WHZA 5GZ9A 3ANQA 4TWNA 2Z60A 3BHTA 4YJNA 2UZEA 4BZOA 1T45A 2JFMA 4FL3A 2JAVA 4FSZA 4FTNA 3KREA 3DK3A 3LMGA 5HNIX 3ZDIA 1S9JA 4CLIA 2BROA 5FP6A 5IISA 3BLHA 3DB8A 4H3PA 5I9XA 3KRJA 4U41A 5KMNA 3ITZA 5HBEA 3RVGA 2C5XA 4O81A 4D1XA 3PY3A 5CZIA 3R8ZA 5IQAA 4NSTA 4DF3A 2ITYA 2VGOA 3ZLWA 4C37A 2JKOA 2R3HA 2WTKB 3PXRA 2WMQA 3P79A 2C5OA 2UVYA 3E8CA 3QQFA 4UYNA 3HLLA 4RRVA 1XH7A 1ZAOA 2VTAA 3Q9WA 4I4EA 3UTOA 2QOQA 2EXEA 4D2VA 4ZZNA 1IAJA 3RGFA 2WTDA 4U44A 1PMVA 2C3IB 4IM0A 4KD1A 1BX6A 2HY81 1H0WA 3F82A 3IPHA 4G31A 4IH8A 4FVPA 5AM6A 2BALA 2FO0A 3EH9A 5A4QA 2EVAA 3OFMA 4AQCA 5K5XA 4L52A 1IRKA 1ZOEA 3QD3A 3PPKA 4RLLA 3VUGA 4AACA 3KXZA 3P08A 2C6MA 4YC8A 3R8VA 2HWOA 2WGJA 2ONLC 2WOUA 3UQFA 3FSFA 5B2LA 4RMZA 4FV5A 3QWKA 1U46A 2XRUA 3K54A 2YACA 5ANJA 3W8QA 3SAYA 3VS5A 3ZO2A 4ZEGA 4BY9E 2J0KA 2I0HA 3PUPA 4HGEA 1VJYA 1V0BA 5FD2A 3V51A 2QG5A 5EYKA 5C03A 2W4OA 3VS3A 3GXLA 4MBJA 2PMNX 2ZJWA 3KGAA 4K0YA 1H01A 2XJ2A 5HCZA 5EK7A 2RF9A 5CT0A 3VUIA 4LMNA 4C58A 4DA5A 2VGPA 3MTFA 1NA7A 3PIZA 3FJQE 4F7LA 5CF6A 2HIWA 2P0CA 4MD9E 3E93A 4YBJA 2JIVA 2F7EE 5H8BA 2WQOA 1P2AA 2G1TA 2Z2WA 2WO6A 4XOZA 3A4OX 3DKCA 3G0FA 5L4QA 5LQFA 1SNUA 4FYOA 3A62A 4QO9A 2YIXA 5HG9A 3BQRA 5AADA 4FK6A 4HZSA 3NUAA 3RPYA 4EK8A 4FTCA 3JPVA 4PX6A 1Q5KA 3L8VA 3LCSA 5CNOA 5HG8A 1SVGA 4JI9A 5EFQA 2JDTA 3DBFA 3TIZA 4BZDA 4RWLA 2BFYA 4N0SA 4DEIA 3ZLYA 2GS2A 3ID6C 4D1SA 4NTSA 5TOZA 1ERKA 2DS1A 4YJVA 2BILB 2ITTA 3PXQA 2CSNA 2XKFA 1H0VA 1STCE 4TNDA 5FBOA 4I22A 4CGAA 2VNYA 2HELA 1WAKA 3TG1A 4EH2A 5I4NA 3DU8A 4E5WA 4CT1A 3QAME 4KIPA 2PVJA 2X7FA 4D55A 5BNJA 4WO5A 4JG6A 1SVEA 2BFXA 3LLTA 4QYEA 3GCPA 4BICA 1ZOHA 1JAMA 3MS9A 1NY3A 3AC1A 2W9FB 2BDWA 2VTPA 2QU5A 5DR9A 5KMIA 5HCYA 4N4SA 4G2FA 3HYHA 4ITIA 1YI4A 2XEYA 4CVAA 3CIKA 4AOJA 5DHJA 4YTFA 2B1PA 3I6UA 3JYAA 3NX8A 5IQCA 4W4YA 2VTMA 3AGLA 4IADA 2X39A 2B7AA 4BKYA 4A06A 1GIHA 3C13A 4M3QA 3BV2A 5AX9A 4IQ6A 3R73A 3RAHA 1DAYA 1UNGA 1TQMA 2YCQA 3JXWA 4EOQA 3UOJA 2BR1A 1Q99A 4QQJA 2YIQA 3OWKA 1APME 3KXGA 1WBTA 2ESMA 2OJJA 4IACA 4EK4A 5HIDA 4IX5A 1X8BA 3UZRA 2DQ7X 3KULA 2QR8A 3CTQA 4U3ZA 5L2IA 4WUNA 2WQNA 5DVRA 4DFNA 1CMKE 4YBKA 2CKOA 4FZAB 3GU7A 3MVJA 4PQNA 5B0XA 2VWVA 3FQEA 4MEDA 4X2NA 2KULA 3D94A 2O63A 5ETCA 2C0IA 1ZZ2A 4MQ2A 5M09A 4I23A 2VTNA 4GU6A 2W1HA 5FTGA 5CF8A 3TZMA 3ZFXA 1Q3DA 3QD2B 2W1GA 5JQ5A 4JQ8A 4DGGA 3FWQA 1J1BA 4YSMA 1A06A 1WVXA 4NJ3A 2ITPA 4RLKA 4XYFA 4DFLA 5J7HA 2XIYA 3SDJA 4DGLC 2C69A 3L9MA 3ZFYA 3OBGA 4EHZA 3FKNA 3CR0A 2OIDA 4XG8A 5AUZA 2VWUA 1CSNA 3LM5A 5A14A 3HMMA 1IASA 4EC9A 2XM8A 2ZB0A 5E8UA 2C6DA 4Y83A 4KBAA 2OSCA 4E26A 4YHFA 3LMIA 1BL6A 3ACKA 5AP6A 4M66A 5D12A 1U5QA 2RG6A 3ORKA 3V04A 3FMEA 3LCOA 3EKNA 5ACKA 4C36A 3JVRA 3N51A 3FLYA 4RVKA 3QHRA 4F64A 2BRHA 3PSDA 4KS8A 4KKGA 3OMVA 1H24A 3QZGA 4RFYA 1ZMWA 4LOOA 3NYNA 4FTIA 4JBQA 3S1HA 2X6EA 3LPBA 4IZAA 4ZY5A 4BBFA 1YXXA 4C57A 2VN9A 3BELA 3RNIA 1BI7A 1VR2A 1J3HA 2O0UA 4O0TA 3GUBA 5BVEA 4FKLA 1OL6A 3Q9YA 1MRYA 5EQYA 5IQBA 4HPUE 4M0ZA 4UMPA 1DI9A 4BHZA 1MRVA 5GJDA 3RPVA 3PJ8A 5LMKC 2GTNA 4BCPA 3VW6A 5L2TA 1WBPA 4YNOA 2YCRA 3NCGA 3FLZA 5HQ0A 4AA4A 5FBNC 1JWHA 3V8SA 4O7SA 4J99A 5EDQA 3AT3A 2AYPA 2SRCA 2XP2A 5LMAA 5HORA 3LXPA 2E9OA 4DEGA 3OWJA 2R64A 1YWNA 3QUDA 4ONAA 4AZVA 5BVFA 4CMOA 4RA4A 1PXJA 2GNGA 3EN7A 3LJ2A 4LGGA 4AGUA 4LGHA 2ETMA 2CN5A 3QHWA 4FV6A 4GS6A 2PSQA 1BMKA 1OB3A 2XA4A 2XBAA 3PIXA 3QFVA 3KU2A 3NNUA 3DK6A 5ACBC 4C62A 3HV5A 4JL9A 3NWWA 2IPXA 3GCUA 3UMWA 2UW0A 4AW2A 3EFKA 4BTMA 3MB6A 3F5XA 1FMOE 2VX0A 1HOWA 2ZV8A 5DRDA 4FTJA 2W7XA 5D1JA 1W8CA 3EQPA 1YVJA 4J52A 5HLWA 4F9WA 3AOXA 4L53A 4RBLA 1R3CA 1JSTA 2R2PA 2WMSA 2UZVA 2WXVA 2R3QA 3GQLA 3P4KA 4R78A 2OJGA 4YLJA 2ITOA 4LRJA 2W99B 5BMMA 3BU3A 4GK3A 4BCNA 4E20A 1Q61A 1Y6BA 4RJ8A 5BVNA 4D2PA 5JRQA 4D2WA 5FEEA 4H36A 4AAAA 1KOBA 4E1ZA 2W1ZA 2I0EA 3VBVA 5JQ8A 5FLFA 2PVRA 4FUYA 4RFZA 3NNWA 4R7HA 2EUFB 3MYGA 2YM6A 4AOTA 4F0GA 4I6FA 4OTGA 2PVKA 1PY5A 3AXWA 4MBIA 3ALNA 4O38A 4O1PA 5FXRA 1WBSA 4UBAA 4Y72A 4ASXA 3OXIA 5DG5A 3OXZA 4D0WA 3PJ3A 1B38A 3LVPA 4FVRA 4MYGA 2OG8A 2XEZA 3DZOA 3G6HA 5CQUA 5HBHA 3PY0A 1PYEA 1PYXA 4OBPA 3VC4A 4J1RA 4MXAA 2B9FA 4QP9A 3OTUA 3RM6A 4WIHA 3VQHA 4ALVA 3ATSA 3QALE 3ZC6A 4ZTNA 4PNKA 3FEGA 3FDNA 5CU0A 3Q2JA 4JBPA 4LG4A 2VWYA 3FE3A 2A4LA 4I6QA 2GNFA 1XO2B 4L3LA 4M84A 3KRWA 4UMTA 2J50A 3PYYA 3UOLA 3AD5A 1W84A 4AE6A 3QQUA 1R0PA 4MKCA 5KHWA 3G33A 5H3QA 5A4EA 4IB3A 2JIUA 4OTPA 2J4ZA 1UKIA 3N4TA 4BTFA 4EI4A 4QNAA 3ZM4A 3ATTA 4KSQA 4XS2A 4IFGA 3RAKA 3PDTA 4FE2A 4ZMFA 1CTPE 1QPCA 2P33A 2CCIA 3DKOA 5E8WA 2QQ7A 4TRLA 4TYGA 3GU6A 1W82A 2UW4A 2HW6A 4TYEA 2VO0A 2BUJA 1PXIA 4C33A 3U6IA 5DT4A 4FEVA 4D5HA 4CEGA 2Q0NA 1IEPA 3EJ1A 2WMAA 3I60A 2WTVA 3QCYA 4DLIA 5M57A 2REIA 3LQ8A 4KKHA 4DN5A 3E7VA 3Q52A 2CNUA 4MBLA 4CD0A 3CQEA 2V22A 3TKUA 4BZNA 3GCVA 4L3JA 3DKGA 3R8MA 3EL8A 3PA5A 4F9BA 1O6LA 1PKDA 3RBWA 2VWXA 3DT1A 5E1SA 2VD5A 2F7ZE 3HRBA 1ZRZA 2HWPA 3KF7A 3KA0A 4W4WA 4I4FA 3W10A 4XEYA 4F63A 3ORNA 3UIUA 3Q4UA 3R63A 3QGYA 4XG2A 5AUWA 2G01A 2X2LA 3LJ0A 3PVWA 2W4KA 4JIAA 5AV3A 5EKNA 5JGAA 1DS5A 2X1NA 2ZOQA 4ZLZA 4YC3A 4EYMA 3FKOA 4FUXA 2FH9A 4FTLA 4P7EA 4C34A 2UUEA 4F6WA 2DUVA 2V62A 3OP5A 3QQKA 4B8LA 1R0EA 1QCFA 4H1JA 2CNQA 3VS0A 3FXWA 3GEQA 5KHXA 2B52A 2Z8CA 5HG5A 1NVQA 1OKZA 5DN3A 5I3RA 3TIYA 2O5KA 2R3RA 3G51A 3M11A 3ROYA 3LFBA 3HRCA 4PPAA 4EH9A 5CAOA 2F7XE 3U87A 4EHEA 3VUMA 5I9YA 4OTHA 2QCSA 4XG4A 4ZY4A 1HCLA 2QO7A 4AN2A 4EYJA 2OJIA 3ALOA 2R7IA 3ZEPA 5DE2A 1ATPE 3CPBA 3FXXA 3LFDA 3DQWA 1WFCA 1R39A 3GNIB 3ODYX 4FSMA 4U40A 3ZRMA 3DLSA 5TF9A 4EK5A 4EWQA 5KMLA 4JG8A 2J90A 2WMUA 4WNKA 3NDMA 2PK9A 3D5XA 2YISA 3GU5A 4I94A 4IWPA 3SXSA 3PPZA 3F88A 3DPKA 4GH2A 3BZ3A 4BF2A 5JGBA 4L3PA 4K1BA 5C4LA 3PG3A 5A4LA 5IDNA 5J8IA 2IZRA 1KV2A 5JK3A 3FZOA 5LWNA 2O3PA 3WZUA 4ZJVA 4QP1A 2E2BA 3UYTA 3BYUA 4OW8A 1UA2A 3MN3A 4ARKA 5CSWA 2YWPA 3EQHA 1Q3WA 5E90A 3TNIA 2B9HA 4DCEA 1RW8A 1OIYA 5CEPA 4AGWA 4FG8A 2HY0A 3ZLXA 3ZUTA 4IAKA 4FYNA 3FPMA 3IOPA 2X9FA 4FG9A 3QRIA 4HVGA 4FTKA 5K4JA 2NNWB 3CD3A 1JOWB 3EQCA 3RCDA 3NR9A 2PPQA 3ACJA 4YZ9A 4GCJA 3IDPA 4PNIA 1Q8TA 3KRRA 4CMTA 5IG1A 4XG7A 2CCHA 4YZMA 4QTEA 2IVVA 4X2GA 5AR8A 4DHFA 3NNXA 2OXDA 3BYOA 3C0HA 4D58A 1PKGA 4IVAA 5HD7A 2GNHA 4YJQA 5EM5A 3PWYA 3RCJA 2GQGA 4JRVA 4L8MA 3QD4A 2QLUA 4FKUA 4V05A 3KXMA 3EIDA 3Q60A 3R28A 4EH7A 4PMPA 3F7WA 3FL4A 4ASEA 3QZFA 2BIKB 3D83A 3HKOA 4FL1A 2XK8A 4G6OA 2BVAA 1AGWA 2X81A 1H26A 3NRMA 4FIIA 5IZFA 3IOKA 4W9XA 4E4LA 3MJ2A 3R30A 3F2AA 2BCJA 4A4LA 4FKTA 4FEWA 1WBOA 5J95A 4XBUA 2XYUA 1PRYA 4CFNA 3F5PA 1IG1A 3IW6A 4RC3A 4I5MA 1XKKA 3PXZA 4M67A 4WT6A 5CVFA 3DXPA 4P5QA 2CDZA 2QOLA 3IDBA 3QQJA 4EOPA 3CSVA 3REPA 3M2WA 3AT4A 2IZUA 4S31A 3RINA 4AZWA 1IR3A 4ENXA 3ERKA 3G9LX 3HDMA 5K3YA 5HE2A 2BRMA 4TYHB 2WQEA 4F1TA 3O51A 4JAJA 4HOKA 3RWPA 3LFEA 4D1ZA 1F5QA 4X2KA 5M08A 1BYGA 4MXYA 4IZYA 2VTIA 3OCGA 3RALA 3TNHA 4EJNA 2WTKC 3FMLA 3DB6A 2W06A 4FZ7A 4JJRA 4TWOA 4V0GB 3SRVA 4C4GA 2BZJA 3W33A 3E88A 3CY3A 4C59A 1OKVA 1R78A 2X9EA 4U3YA 2WMRA 4I5CA 3V5PA 4ZLYA 5C4KA 4GV1A 1OZ1A 3P0MA 2J6MA 5EQEA 3BWJA 5K0KA 4M69B 4B99A 5AR7A 4NFNA 4XH6A 1SM2A 3GU4A 4FSUA 4AUAA 4HNIA 4QQCA 4EJ7A 3FKLA 4BDKA 2EXCX 3D7TB 4HYUA 4ZXTA 1M7QA 3VAPA 5GJGA 4CZTA 4HCVA 4L7SA 4JX3A 4PTCA 3DA6A 2BAQA 4L7FA 5GNKA 2VTQA 5AUVA 3OS3A 5AV1A 5E92A 1ZZLA 4CLJA 2PULA 1JKLA 4ID7A 4O0UA 3R2BA 4FV2A 2XNEA 3ZUUA 2Q0BA 2C3KA 3I4BA 1OI9A 3BX5A 3C51A 3CCNA 5KZIA 4D2SA 4MHAA 5JRSA 4FIHA 4AE9A 3D2IA 3R01A 4CXAA 1Q8YA 5HHWA 5BVKA 4XP0A 5IA5A 4BCHA 4YZNA 1J91A 4F6SA 2RIOA 4OTWA 4OR5A 4IB5A 2CNVA 3C5UA 1YW2A 1GAGA 3ORZA 3O96A 4IMYA 5AUYA 5HO7A 5M4IA 4M13A 1LPUA 2V0DA 3KMUA 3Q6UA 4AZFA 4ORKA 2WEVA 5D41A 5A54A 2YAKA 4U42A 4TYJA 3UPXA 4AGCA 3BCEA 4JG7A 4DH3A 4X3JA 5K5NA 1Q8WA 1YHWA 4LRKA 4QMUA 4RVTA 3UO6A 5CALA 3COIA 3BYVA 3ZSGA 4GG7A 3FSKA 2PUPA 2W1IA 1U54A 5CANA 3MFRA 4S33A 3HRFA 5JFSA 2HYYA 2ZB1A 1H4LA 3OXTA 4QPAA 1IA9A 3EHAA 4PP9A 3TNWA 1FVTA 3BU5A 4A9YA 2PMLX 2OJ9A 3QL8A 4FV8A 4A9SA 4NW5A 3JR1A 1OMWA 2YHVA 3RZBA 4H58A 4QMTA 1KE8A 3NNVA 1U54B 1JKSA 2W1CA 3MDYA 3R21A 4M97A 4WSQA 5DT0A 3GI3A 3UG1A 4A9UA 5TR6A 2ZYBA 3VF8A 5IEYA 2JBOA 3R0TA 5EDPA 3DTCA 3VBQA 3TI1A 3F3UA 4APCA 4CRLA 5HD4A 3R1NA 1NT2A 2H6DA 1YDTE 4AN3A 4YR8A 3Q9ZA 3Q32A 2RFNA 5FDPA 3R1QA 3IW4A 5LARA 1XH6A 5KMMA 5IKWA 3EQFA 4ANLA 3QBNA 3CS9A 3ETAA 4BIEA 2XIXA 2HOGA 3NGAA 2F49A 2OIQA 4NEUA 2PL0A 2F9GA 3QX2A 4C0TA 3RAWA 4J98A 2BKKA 4O7TA 1UU8A 2XJ1A 2X2MA 4QPSA 4Y73A 2UZLA 4EH6A 1URCA 2XK6A 3QTZA 4AA5A 3M1SA 5FWKK 3ZYAA 3E8NA 2CGXA 3A7JA 2CGVA 2EU9A 2X4FA 4QMSA 3FMJA 1WBVA 4TT7A 4FG7A 4BGGA 4TL0A 2Y8OA 2PUIA 3TM0A 2YIRA 4JAIA 3BV3A 3Q04A 3NW7A 4KBKA 4RC4A 4QMMA 5ANOA 3DJ5A 2PHKA 3R7VA 3R9NA 3U4UA 3UZTA 3C5IA 3WE4A 2UZUE 3KRXA 1XQZA 4U80A 5HBJA 5I5ZA 3F5GA 3GVUA 3MFTA 4FF8A 4JDHA 2XCHA 3FZSA 2ETRA 4Q2AA 4WBBB 4P90A 3PRIA 5KKRC 3TZ8A 3VUKA 3E87A 5AV0A 1FMKA 2FSMX 3F69A 4JX7A 2R7BA 3ZH8A 4E6AA 5EKOA 3KXNA 4UWYA 4FIJA 4RWKA 1SMHA 2ZM1A 4FIGA 2FYSA 2NO3A 3L1SA 2JC6A 2UZTA 3QQLA 3HVCA 4HYHA 3KQ7A 1MQ4A 4D2TA 3NAXA 1VYZA 2PE1A 2PMOX 3E64A 4UMUA 5DMZA 4MK0A 5IPJA 2W05A 3DNEA 1H08A 5DT3A 4R5YA 1VEBA 4UZHA 4ZLOA 4YJTA 2W4JA 2IW6A 5AUUA 4LL0A 2ZV2A 3UGCA 3QZHA 3ZRLA 4QMXA 4F08A 4JBVA 2VWZA 4E6QA 4BCGA 3GC9A 5C9CA 4J53A 3PXFA 1FBNA 3Q5ZA 2J9MA 4NCTA 3V01A 5C1QB 3WF8A 1CKIA 2C3JA 2ITUA 3DAKA 4DFBA 5KBQA 4UY9A 4O7VA 5HG7A 1UV5A 2GSFA 2GCDA 3QWJA 1H25A 4HW7A 3DZQA 2VWWA 3VIDA 3ZSHA 3ZONA 3HV3A 4RWJA 3TNQB 4EBVA 4ERKA 4RJ7A 5AAGA 3UO5A 2XBJA 2JDSA 4CYJA 4ZY6A 5AA9A 3FAAA 5LVNA 1YXVA 4DGOA 2OXYA 5IH5A 3KCKA 4A4OA 2ZVAA 2RFEA 2OBJA 3GGFA 3FYKX 3D5VA 3SG9A 1PMUA 5LMBA 1Q24A 4L00A 3U55A 2BRNA 2GPHA 5DBXA 1W0XC 3EZVA 3IW7A 4U9AA 3BRBA 5DYJA 4WG4A 4LFIA 3W2OA 2QODA 2R4BA 4G9RA 3UBDA 1XHAA 4FVQA 3U54A 2RFDA 3R7YA 5EI2A 4ZOGA 4FKSA 1P4FA 5CAPA 1PHKA 3ZSIA 5D9HA 4O0XA 5IA1A 4R77A 1GZ8A 4UEUA 5TT7A 4Y5QA 3UZPA 2QO2A 1YHVA 5CSVA 1JLUE 3W8LA 4Z16A 2YJSA 5M4FA 5F94A 1SNXA 5A3XA 3LCKA 3RJCA 3UC3A 3PXYA 1YI3A 5CXZA 3C9WA 3CBLA 4YPDA 2A19B 3GC8A 4LUDA 5HVKA 5CU6A 3GC7A 3QTXA 5IDPA 1KV1A 3DV3A 4XOYA 3PXKA 4LOQA 3TKIA 3ZXTA 4FTTA 5M4CA 2WIHA 3BHYA 3R71A 3QD0A 2LAVA 4QMYA 3PSBA 4CFFA 2BAKA 4QYYA 3H10A 2ZV7A 3UIBA 3DDPA 1OPLA 1QPDA 2CJMA 2J0JA 3HECA 5ANIA 4ZTQA 5CASA 3SVVA 5CEOA 3I5ZA 5JZJA 1OM1A 3TKHA 2Z7SA 3MPMA 4O7LA 4AX8A 5EW3A 4BYJA 3OW3A 2IW8A 4AA0A 2GU8A 3QTWA 3IDCA 2PVNA 5I9UA 4C8BA 1LUFA 5D11A 3MY0A 5L3AA 4O2PA 4CT2A 1MUOA 4MWIA 4FSQA 4EH4A 2WOTA 2YM5A 5CQWA 3FZPA 5HNGA 4AFEA 5AV2A 4O1OA 5KO1A 2BTRA 4ZK5A 3QYZA 1XH9A 2IG7A 3S95A 4GK4A 4K8AA 4ANQA 4YTCA 4DITA 2FSLX 3OY1A 4ZTRA 4DC2A 2YM4A 3R2YA 2YAAA 2ITZA 5EM8A 3VS2A 3BEGA 3VS1A 4OUCA 4GMYA 4KAOA 4RX7A 4EWHA 5GINE 3MIAA 3FI3A 3U9CA 2PUNA 3S00A 1OKWA 3O23A 4DLJA 3UODA 4EUUA 2W1DA 3F2NA 3NAYA 3QTRA 3PIYA 3SX9A 3ZZEA 3QTIA 2PTKA 2XNPA 1XBAA 4PDOA 1ZWSA 4JNWA 4F9CA 3QCXA 5E7RA 3RPRA 4MD7E 3ZTXA 1KOAA 3RK9A 3E5AA 2WKMA 4KSPA 4O0SA 4YZDA 3Q9XA 5E91A 3A8XA 5FXSA 5HIBA 5J9ZA 4EOSA 3OG7A 3NUUA 1YOMA 3H0YA 4JVGA 4C38A 3WYXA 5CX9A 5HZNA 5ETFA 5AP5A 4LGDA 3HP2A 2QOBA 4YJOA 3IS5A 5BYZA 3N4UA 1WZYA 4JR7A 5KKRB 4R3RA 2E9NA 3KULB 1FVVA 4EK6A 2XIRA 4YHTA 5CAUA 1MRUA 4USDA 3SLSA 2VWBA 3EN6A 5M06A 4I3ZA 3DBEA 4H39A 4MCVA 1FGKA 2PZPA 4J7BA 5CXHA 4QP3A 3SW4A 3DXQA 1XR1A 3V8WA 5L6OA 4E73A 2JGZA 5E8XA 4IAIA 3F3TA 4G9CA 5IUIA 3O7LD 5HE3A 3NUXA 5C01A 1E1VA 2C6EA 2C4GA 2BMCA 4LOPA 2VO3A 4DH5A 3G15A 3ZBXA 5I9ZA 1FINA 2PVYA 3K3JA 3R7GA 4Y8DA 1ND4A 4J95A 3RNYA 3UIMA 4NM7A 4IEBA 4ZSAA 3MA6A 2YEXA 4DG3E 2JKKA 3NIEA 4BCKA 3PY1A 3ULIA 4BWPA 5CTPA 4JLCA 1JKKA 4WRSA 5L2SA 2Y6MA 5J9YA 4ASDA 3A4PA 2CHLA 3D14A 4IE9A 2P3GX 2G15A 3CPCA 5KE0A 1Y8YA 5ANGA 3IGGA 1F0QA 3O2MA 4X7QA 1Y8GA 4DH1A 2XF0A 1H1WA 3LXKA 3C4CA 3A7IA 4GUBA 4AU8A 4ANOA 2XKCA 2XCKA 4D5KA 3OEZA 4F09A 5IF1A 3CJFA 1PW2A 5E8ZA 1CKPA 4EZ3A 1A48A 4G5JA 2IO6A 3AD4A 4FODA 4EL9A 1M52A 2IZTA 4BDEA 4HYSA 2PE2A 3BGZA 2CKEA 3QRUA 1OL5A 4LV8A 2Y4IC 5B2KA 4CQGA 3NYVA 4LI5A 3RMFA 3OROA 3QYWA 4QTDA 3AC8A 3UIXA 4IBMA 3OCBA 4AT5A 3HGKA 3I1AA 1QMZA 3R7OA 3UQGA 4BKZA 3BGQA 1YWRA 4Y46A 4C02A 3O8PA 5T6KA 3COKA 2R3GA 4A7CA 3F3WA 2YFXA 4O0WA 4ACDA 3SA0A 4E4NA 4FZ6A 3BHHA 5I3OA 5AA8A 4O96A 4F7NA 3ZRKA 1YRPA 4PMTA 1DAWA 2W5HA 2I0VA 2JDRA 2W1EA 3EQRA 5AP0A 1OITA 3HV6A 3NMUF 4KB8A 3TACA 3WZDA 1G8SA 2EXMA 4HVHA 2UW8A 3QTUA 4KINA 5A6OA 2WTWA 3UPZA 2W17A 4BR3A 3BYSA 3VS6A 4EOOA 3KVWA 3UP2A 3VRZA 4RJ5A 4BGHA 4N57A 2QOFA 4F7SA 3DJ7A 3ZS5A 4F65A 2UVXA 3OUNB 1KE7A 4R6VA 3R8LA 3WF9A 5HX8A 5JH6A 1JVPP 5CEMA 5AP4A 4G6LA 3C7QA 4YC6A 2YWVA 3TJDA 4FI1A 4U6RA 4BDCA 5DR2A 4P4CA 2P2HA 4O83A 4IW0A 1PXOA 2X7GA 2YDKA 3F3ZA 3IK3A 2WD1A 5IU2A 5K0XA 2NP8A 2B0QA 4NK9A 4MTAA 3LHJA 2Y0AA 3SKCA 3KXHA 2OICA 4D4RA 1CKJA 2VRXA 2X2KA 3HMPA 4V01A 3ZFMA 3FYJX 4XBRA 4QMLA 3SG8A 4DG0E 3NPCA 5EM7A 3E63A 2ZM3A 3DY7A 4YO6A 4IFCA 5KUPA 4FMQA 4GT3A 4FSYA 4Y5HA 4NJDA 2PZ5A 5AX3A 3RAIA 2QHMA 1VYWA 4BFMA 4YO4A 3LQ3A 2GNIA 5AP7A 2W96B 5JFWA 4G3GA 1U5RA 2QOCA 3R1SA 2V7AA 1BUHA 3FHRA 4IXPA 5F20A 4BN1A 1EH4A 5CU4A 3OOGA 3FC2A 3LXLA 4EONA 4AS0A 5C27A 4HZRA 5F1ZA 4IC7A 3TTIA 3KKVA 4FNZA 4JOAA 3BHUA 4FOBA 3W18A 4CKRA 4MQ1A 5AFVA 2GS7A 4ZS0A 1YXUA 4J97A 4WG3A 1FPUA 1Q4LA 2HENA 3T3UA 5H9BA 5JKGA 3TUBA 4QTCA 4EH3A 4IVCA 3OEFX 4ZMEA 3CTJA 2H9VA 3U4WA 3UNKA 4J96A 5G1XA 1F3MC 3ZU7A 5L6PA 3LCDA 3K3IA 4FTOA 4KIQA 2R3LA 4EOKA 2IW9A 2IN6A 3QUEA 4LMUA 4XP3A 2UZOA 2VU3A 4Y95A 5LWMA 3JY0A 1O9UA 4I20A 5JN2A 2E9VA 2Y7JA 4QP4A 3VVHA 3RHKA 3NUPA 4KNBA 4CFWA 4Z3VA 4CMUA 3LFNA 4F99A 3DGKA 3GOPA 3BU6A 4IZ7A 4CCUA 2O8YA 3VF9A 3U6JA 3OW4A 4B6LA 4PDYA 3UMXA 3G0EA 1XBCA 4MXXA 4Q5EA 5DEYA 3NUNA 3PJ2A 1QL6A 3CXWA 5CYIA 2IVUA 4L67A 1W98A 1YXTA 4GW8A 2WTIA 1KE6A 3BBWA 5T68A 3O8UA 3UVQA 3V5TA 3F9NA 4C3PA 3MSSA 4MAOA 5AR3A 3VHEA 2C0OA 5ITAA 5B7VA 3LFAA 3TT0A 5FGKA 3ZEWA 4DFZE 5L8LA 4NM0A 2HW7A 3MH1A 2OKRA 2GNLA 2VNWA 4MXZA 3RP9A 4YPSA 2W5BA 4O0VA 2JD5A 4JDKA 2YM7A 4EEVA 2CGWA 3RM7A 3HL7A 4O7WA 3EN4A 1UNHA 4CFVA 4BDDA 2BDJA 1H27A 4I41A 3TN8A 3P1AA 3FC1X 5J87A 3R6XA 4Q9SA 4UZDA 4R3CA 1TQPA 4XRLA 4XUFA 2UW7A 2YDIA 4C3RA 3BHVA 4WA9A 4JDJA 4BDAA 2ITNA 5JFXA 2V55A 2XIKA 5IQHA 1PMEA 3CQUA 4RX9A 2Y4IB 3HMOA 4UXLA 4OAUC 3O7LB 5CZHA 1OL1A 5FP5A 5EYDA 4ITHA 4EKKA 3QQHA 4GJ2A 4NIFA 4QMOA 3L9PA 4D4SA 4XP2A 3I0QA 3WIKA 4BCJA 3KF4A 4CKJA 2BAJA 2R0UA 4E4XA 4HNFA 2BIYA 4CG8A 3HNGA 4D4VA 4G6NA 4W4XA 1WBNA 2CGUA 5FRIA 3Q5IA 4FV1A 3W2SA 1DM2A 3FMMA 2CLQA 3F5UA 1H28A 4NIFB 3MV5A 2XK9A 5BYYA 1GZKA 2BHHA 4BCMA 3OOMA 1J7LA 2Z7RA 4FGBA 3A61A 3D0EA 4E4MA 4L9IA 3NLBA 3VBYA 1UU9A 3C50A 4PF4A 3Q4CA 2WMBA 3FMDA 4O0YA 2X8EA 1ZLTA 2O65A 3QX4A 3R22A 1KUTA 2I7QA 2WU6A 2XM9A 4DG2E 2C68A 3EQGA 4EHGA 2HZNA 5E4HA 4II5A 3FPQA 4YHJA 4E8AA 4B9DA 3IW8A 2QURA 3IGOA 3MH0A 3LAUA 3ORLA 4AWIA 5J5SA 3DDQA 4GRBA 4PP7A 4WOVA 3TUCA 3UYSA 1KWPA 3OF0A 2R5TA 4YNEA 3GQIA 4IVBA 1Q8ZA 4AT3A 4B7TA 2F57A 5H8EA 3MWUA 5LVPA 4IAAA 4RPVA 3MH2A 4RJ4A 3FMNA 4ACCA 1PMNA 2EWAA 1GIIA 3H30A 3Q6WA 4FV7A 4IX4A 4MF1A 5CEIA 2XB7A 3VHKA 3L8PA 4YGAA 4E3CA 2ITWA 5J1WA 4FIEA 4GT4A 4DAWA 3K5UA 3VN9A 4TWPA 3MH3A 4BWKA 2O64A 5C8MA 3OZ6A 2OLCA 4PTGA 3MI9A 4CQEA 5L8JA 5EW8A 3TXOA 3PPJA 4FKGA 4C4FA 2J5EA 3LQ5A 4RX8A 1Q8UA 4WNOA 3C4FA 4BDBA 4LRMA 2PMIA 3ORMA 4FNXA 4GYIA 4YJPA 4ERWA 4PY1A 3OT3A 4F9AA 1URWA 5FTQA 4AZTA 5IMXA 2C5VA 5DNRA 2XNMA 3DCVA 3FXZA 3DQXA 3LFQA 5M55A 3N9XA 3ZUVA 3TV7A 2XH5A 3H9RA 4FGRA 2PVHA 3E8EA 5TE0A 3DS6A 4QOXA 5CEKA 5LVOA 1WMKA 1ZYJA 4UX9A 4EBWA 4HGLA 5DWRA 4M8TA 3UC4A 2P2IA 2XK4A 4I21A 4PL5A 3D15A 4D9UA 3P7BA 3KY2A 3I79A 1A9UA 3FMHA 4OTRA 2CKPA 1GOLA 3IG7A 4ACHA 3QKLA 3MGYA 3R7UA 4BTKA 4NCTC 2H8HA 3W2RA 2GFCA 2QNJA 4IZ5A 3FLNC 4QP2A 3RKBA 3QRTA 4WUAA 4O82A 4Z55A 5LVMA 3SRVB 1V0PA 3FLSA 2VX1A 2YABA 2YCFA 4FV0A 4RWIA 4EH8A 2OO8X 4DFXE 1JBPE 4DGNA 2PVLA 4XG6A 2Z7LA 5M51A 4E6CA 5A4CA 3GFWA 4GIHA 2C6KA 2PU8A 5GIPE 1QPEA 1GJOA 3IECA 2OFUA 2G2FA 3WE8A 1OIUA 3O17A 2OH4A 3CP9A 4FTQA 3FZ1A 5HE0A 2YIYA 3HX4A 1B39A 2RG5A 3V8TA 5AP1A 5IQGA 4RJ3A 4IX3A 3VRYA 5CNNA 5J9LA 2X8IA 5HVJA 4JXFA 5IEXA 3ORPA 5CF5A 4HVIA 2FB8A 4I0SA 3JUHA 2JAMA 4IANA 4XCUA 3BI6A 3RHXA 3F6XA 5KX8A 3A7FA 1G5SA 1ZYSA 3SXFA 1H1SA 2ITXA 1OECA 2ERZE 3EYHA 3FLWA 2ZDTA 4O7NA 4HPTE 4EK3A 3NVMB 3QZIA 1XJDA 2YZAA 3TV6A 4K6ZA 3MIYA 1YQJA 4FKIA 1JKTA 2OF2A 2YM3A 4IB1A 5KZ0A 1ZY5A 2JDVA 5C26A 4W8EA 5CAQA 4FT5A 4Z7HA 4W8DA 5I9WA 4E93A 4DT9A 4C4IA 3P78A 3DAEA 4IDVA 2X6DA 3A7HA 3G90X 4K2RA 5AP2A 4BDJA 1XH4A 3A2CA 3KK8A 3MPTA 4N70A 4AW1A 4KA3A 3VULA 4RJ6A 3U9NA 2GFSA 4MH7A 2KTYA 4O91A 3AT2A 4BDFA 2QO9A 4YTHA 3NEWA 4AZSA 3FHIA 1BI8A 3G9NA 3HA6A 1GNGA 3T8OA 5EI6A 2GS6A 3EKKA 2DWBA 3SD0A 4PV0A 4FNWA 4G3EA 4FK3A 3VO3A 1ZYDA 3KN6A 4IWDA 4JIKA 4YLKA 4ZIMA 4RT7A 4A07A 5BVOA 4O7RA 3UVRA 3VBWA 3ENMA 4I6HA 4L46A 4MXCA 4QPMA 3R9OA 3HV7A 4BRXA 1H00A 2W9ZB 4M7IA 4AW5A 4EOJA 4WD5A 3QCQA 4PMSA 3GENA 3UQCA 1ZMUA 3EFJA 3PE2A 1JPAA 2RFSA 4O2ZA 5JFVA 3CC6A 5EHLA 3R9RA 1E9HA 1KE9A 2Z02A 3OVVA 2WAJA 3Q96A 4IC8A 5E8SA 1JNKA 2ETKA 2VV9A 3BBTB 5JMSA 3OTVA 4TKSA 1KE5A 1M2QA 4PTEA 3MESA 2WPAA 4U43A 5HKMA 3VNTA 5GIOE 4C2WA 4M12A 3KVXA 4F7JA 3PE1A 3W2PA 4CSVA 1NVSA 2XKEA 3BIZA 3RPOA 4ZS4A 4JT3A 4RIWA 3JVSA 2PE0A 4F1MA 2CLXA 4JQEA 3PRFA 1V0OA 3CGOA 3KCFA 5H8GA 4A9TA 1OUKA 2DYLA 4UMQA 4DFUA 2XNGA 1J7UA 3FBVA 5BQ0A 3AGMA 2VTHA 4D2RA 3HUBA 3HP5A 5CSXA 3UNZA 4UXQA 2ZAZA 1T46A 4IAYA 3I6WA 4OLIA 5FXQA 4WSYA 5KCVA 2LGCA 3O8TA 3ZXZA 3Q53A 1OBGA 3U51A 4GUEA 2UZNA 3QKKA 2QOHA 5DPVA 2C3LA 1IA8A 2GMXA 2FGIA 4A4XA 1UWHA 4GFOA 2UZDA 3Q4ZA 4XV3A 5AUTA 5M56A 5HI2A 2R0IA 5BYLA 2GHMA 3QGWA 4O6EA 4E7WA 4ZTMA 4DEAA 4FKJA 2ERKA 3Q3BA 4R7IA 3ODZX 4ZAUA 4CZUA 3DBQA 3C4EA 4BCOA 3FZRA 3EB0A 3LIJA 5AIRA 2HXLA 4E5BA 2IVSA 1DI8A 3BLRA 4ANMA 4TY1A 5E1EA 3BE2A 4C2VA 4UB7A 5LXMA 2WIPA 4ZTLA 5M53A 2C6OA 2XVDA 5L6WL 4S34A 4F0FA 1YHSA 5FTOA 2C1BA 2HZ4A 3ORXA 3ZO3A 4UYAA 3ZO4A 3LW0A 4ZSLA 4O86A 4IB0A 2WMTA 4DYMA 2A0CX 3RWQA 5C8NA 1LP4A 5AIKA 5IQFA 4IM3A 5IA3A 2AC3A 4FR4A 3PVBA 5D7VA 5DOSA 3SXRA 3VBTA 4X3FA 4BDIA 5JT2A 4Z7GA 5AUXA 3WYYA 4YJSA 4K33A 2ZM4A 5DGZA 1FGIA 4FKOA 1NVRA 4XRJA 5HLPA 4B0GA 4QT1A 3VS7A 2XKDA 5A6NA 2HXQA 5M07A 4XJ0A 3HV4A 5HIEA 4QMVA 3OT8A 4X3FB 4FV9A 1XWSA 3R1YA 3Q4TA 4GEOA 3LFFA 5CVHA 2V5QA 4ZZMA 3H9OA 3LKMA 2F2CB 4GIIA 5IQIA 1H1PA 4RIXA 5CF4A 1O6YA 3G5DA 1L8TA 4MX9A 2QR7A 5CWZA 5CU3A 3NUYA 4KS7A 4TXCA 1LR4A 3TZ9A 4WRGA 2OF4A 5HO8A 2A2AA 4KKEA 4WG5A 3ENHA 2ITQA 1KSWA 1OGUA 1I44A 3W16A 4F0IA 5IH6A 3V5QA 1H1QA 3OWPA 4RIXB 2NRUA 4I93A 1PXPA 4YZBA 3V6SA 4ASZA 3NS9A 4BDHA 2IVTA 4IAFA 2ACXA 3BE9A 4N6ZA 2BDFA 4FKPA 3UO4A 4Q9ZA 3GOKA 3GP0A 3PZHA 2R3IA 4TYIA 3EN9A 3O50A 5IH4A 2PUUA 3ZO1A 4BIDA 3QCSA 5DA3A 4C4JA 4TWCA 3GCSA 2GDOA 1ZARA 4JQ7A 3ZCLA 1OVEA 5HTIA 4PMMA 2CPKE 3R02A 4D0XA 5J1VA 3F66A 1OIRA 5EHOA 3OC1A 4EC8A 4AGDA 5DH3A 3ZM9A 5KNJA 1YDSE 2J5FA 3FV8A 5KMOA 3AC4A 2QC6A 4BGQA 1M17A 3AMYA 4JBOA 4EH5A 3JS2A 1UKHA 4C35A 1JSVA 4I0RA 4IHPA 3UOKA 3VBXA 4U45A 3HUCA 1TVOA 5CEQA 2W1FA 5BX0A 5HO6A 5H2UA 2C30A 4O0RA 1RE8A 4DTKA 5IUHA 4AW0A 2VWIA 4QTAA 3K2LA 3EZRA 3MY1A 3UP7A 3KB7A 3KFAA 4FKVA 3OD6X 4X6QC 5CY3A 3VUHA 4H05A 4FSWA 5EDRA 4S2ZA 1BKXA 2B54A 4HVDA 4GT5A 2WZJA 1Q62A 1SVHA 2RGPA 4YSJA 3POZA 4CTBA 4QP6A 2WMWA 3DFCB 3GCQA 3QC4A 4ANSA 1Y91A 3CJGA 5CLPA 5BUIA 3NW6A 4O84A 3F3VA 1J7IA 4QTBA 3QQGA 5FEQA 1FOTA 1M2PA 4AZEA 2HAKA 3A60A 4CKIA 1Y57A 2XJ0A 4BWXA 4DGMA 5J79A 5EH0A 4I0TA 5DLSA 5HCXA 3VWAA 1J1CA 4FTUA 4PL3A 2YM8A 2QU6A 3A99A 4BHNA 4DH8A 4G1WA 5AR4A 4RA5A 1H8FA 3I7BA 3QA8A 3R8PA 4N6YA 4MD8E 4U97A 4FSRA 4NKSA 2J2IB 2IZSA 4ZJJA 3LJ1A 2GTMA 4RX5A 3KN5A 3B2TA 3NZ0A 4AN9A 4D28A 3T9TA 2JKQA 5EM6A 2NPQA 4FTAA 3E92A 3ZBFA 3FI2A 2WMXA 3UOHA 4ACGA 5A46A 4GSBA 5KMJA 4BDGA 2PYWA 2IJMA 3BGPA 4FT0A 4I5HA 4KIKA 1M2RA 2PY3A 4X21A 3AQVA 2VTTA 3EYGA 1ZY4A 4UALA 3UE4A 4NUSA 2B9JA 1RQQA 4QMWA 4BCQA 2OWBA 4KIKB 5ETIA 4DTBA 4DBXA 3G6GA 5DFPA 3KMWA 2YIWA 4QMPA 4ZSGA 2OU7A 4HCUA 5EYCA 3KXXA 3L9NA 3TV4A 4FV4A 1OIQA 4YJUA 4MXOA 3EMGA 1NXKA 4Z9LA 3VJNA 4C7TA 1YI6A 4I92A 3TNPC 4G16A 4FEQA 3AD6A 3FY0A 1AD5A 3C4XA 5CSHA 2QOOA 3PJCA 3NIZA 3Q2MA 1P5EA 3ORTA 4G3FA 5GHVA 4AP7A 4D9TA 5IMEA 3AC5A 4FC0A 3DK7A 4X2FA 4DH7A 3GB2A 1P14A 4F1OA 3P23A 5BVWA 4DEDA 4H3BA 3D7ZA 4KRCA 4K18A 5HE1A 4BI0A 2WFYA 2XS0A 4R1VA 2JDOA 4XLIA 5FUTA 2C5NA 3BEAA 3TZ7A 4UN0C 4NH1A 3O0GA 2WELA 1M7NA 2HZ0A 4X6RA 4G17A 5DEWA 3W1FA 5I9VA 3E3BX 4YTIA 4MVFA 4L01A 5EOLA 2JEDA 3SV0A 1IAHA 3CLYA 3KMMA 2PZYA 4L42A 1OKYA 5FDXA 4RSSA 3SC1A 3WZJA 3ZC5A 2YZLA 2YCSA 4W4VA 2FSTX 1P4OA 3SHEA 2J0IA 1YWVA 3QC9A 2X0GA 5JEBA 2JIIA 3E62A 4PRJA 2VUWA 4FSTA 3DBDA 5K9IA 4IJ9A 2ONLA 1YOLA 1S9IA 4G3CA 3LFSA 5CU2A 2RL5A 2WEIA 1REKA 3HMIA 3RTPA 1RJBA 1GIJA 4E5AX 4F4PA 2QOKA 3LLAA 3MVHA 2ZV9A 5LCKA 3OBJA 4ALWA 4CNHA 3SW7A 4DFYA 5IUGA 3CY2A 4QQ5A 2CKQA 2UZBA 3MA3A 3LOKA 4GU9A 4CV8A 3ROCA 3TJCA 5HTBA 2R3NA 3PJ1A 3DAJA 4CTCA 4YUQA 4AFJA 4QYFA 2AUHA 4NM3A 4NL0A 2C0TA 3E8DA 3QXOA 4XLVA 4BIBA 4U8ZA 4RG0A 5T3QA 3VUDA 3QKMA 4ANNA 1GY3A 2OJFE 5FM2A 3I7CA 4RGJA 4AF3A 3GU8A 2VTJA 4J8NA 2QLQA 4CFXA 1TQIA 3OHTA 4BI1A 2UW5A 4CYIA 3FI8A 4HVSA 1ZMVA 5IQEA 3P7CA 2OI4X 4GFMA 5CI7A 2VO7A 2QG7A 3D5WA 3QRKA 2Y6OA 4NM5A 4F70A 3I81A 2HK5A 3DJ6A 2OK1A 1ZXEA 3OUKA 4NT4A 4RC2A 3EWHA 5DRBA 2Q83A 5E8YA 5EQPA 5FQDC 3SOAA 4ALUA 1W83A 4KRDA 3QRJA 4GL9A 5AP3A 3VJOA 1E1XA 3VS4A 4EOMA 5IA0A 4E6DA 2P4IA 4DE4A 3COHA 2VTOA 4EQMA 2WMVA 4R8QA 3D4QA 4APPA 4QMZA 3C0GA 2EB2A 2R3JA 2UV2A 4FSNA 4O21A 4WNPA 3D9VA 3QU0A 2J51A 4OTIA 4H3QA 3JY9A 1Z5MA 2NRYA 4HJOA 2OXXA 3KRLA 4MF0A 5JZNA 4NW6A 3MW1A 3POOA 4OTQA 4BCIA 5M44A 4TNBA 4USFA 4QRCA 2RKUA 3NSZA 1ZYCA 2XK7A 4S30A 4FZDB 3RK5A 2OZOA 4GVAA 4LL5A 5FEDA 2WQBA 3QTQA 2XIZA 5TKDA 4DBNA 5M4UA 2I0YA 4L68A 5J7BA 2CN8A 2R3FA 4O7YA 4CZYB 3PFQA 4BCFA 3FLQA 4C61A 4DEBA 2ITVA 3ZOSA 5EW9A 4ZP5A 4CRSA 3I0OA 3C4ZA 3SQQA 5LCJA 3N4VA 5HICA 4XMOA 2A27A 2FA2A 3D2KA 3S0OA 4RZWA 3OCTA 4OGRA 4TTHB 5AR2A 4EZ5A 2YA9A 4U7ZA 1GZNA 4U5JA 5BVDA 4IIRA 5TO8A 5AR5A 1YOJA 1CM8A 4CV9A 5K4IA 5KBRA 4IM2A 4KBCA 4OBOA 4BTJA 3HZTA 3F2RA 2JLDA 1U4DA 3FMKA 4ACMA 4CCBA 2ZMCA 5LJJA 4YMJA 3A8WA 5E8TA 2IWIA 1U59A 3WARA 4FEXA 2WTCA 3UJGA 4YLLA 3MY5A 2BKZA 1K2PA 3IQ7A 3W2CA 1WCCA 4O27B 3EOCA 2WNTA 4B8MA 4O7ZA 2GHLA 3PLSA 4W9WA 4HGSA 3WF5A 3NUSA 4BI2A 1AQ1A 1UNLA 3OWLA 4LM5A 4GKIA 4I24A 1PXKA 5JSMA 2OIBA 1PJKA 1M14A 3MFSA 3G2FA 3LM0A 4OBQA 4XNEA 4XG3A 4U0IA 2BZHB 4EQUA 1CDKA 2OGVA 3AC2A 4PL4A 4FT3A 4FTRA 5AV4A 3II5A 4OT5A 2Y4PA 3M42A 4DINA 4FX3A 2B4SB 3KC3A 3PWDA 4V04A 3DBCA 3S4QA 1NW1A 1QPJA 1Q97A 3IW5A 4FV3A 3FQHA 4L6QA 3R9DA 1UU7A 4G3DA 4PUZA 2W5AA 2E9UA 4XV9A 4L45A 4QMQA 2ZMDA 3BKBA 3AG9A 3HAVA 2BRGA 3BYMA 2C47A 2VTSA 2RSVA 3EL7A 4O22A 3GBZA 4FKRA 2AC5A 2QKRA 3B8RA 4DCAA 2R3PA 3H9FA 1H07A 4MNEA 1I09A 2WB8A 3R9HA 4USEA 2GHGA 5EOBA 5CSPA 3FQSA 2J0LA 2XYNA 3NYXA 2YDJA 3H4JA 4MWHA 3BWFA 2FUMA 2VZ6A 4LQMA 1XBBA 5IA4A 5HVYA 3EQBA 4UV0A 4JS8A 4IWOA 4MNEB 4WNMA 4Y85A 2Z7QA 3L8XA 1UU3A 4M0YA 3I5NA 4QP7A 3WIGA 1OL2A 2A1AB 5HU3A 5F4NA 5L2WA 5LMKA 5CI6A 3THBA 3CEKA 2GQRA 3PLAE 4BVUA 1XH8A 1OPJA 4PDSA 2R3KA 1K9AA 3DOGA 5AAFA 1JSUA 3QA0A 3FY2A 4C3FA 5ICPA 5A9UA 4BYIA 1Z57A 5EYMA 4M14A 5A4TA 4FIFA 3WZKA 5GZ8A 4J8MA 4GKHA 2UVZA 3MFUA 2G2IA 4EQCA 3KL8A 4NU1A 3BQCA 4FKQA 3R04A 4RQKA 4GFGA 4YP8A 3P86A 4P5ZA 4EKLA 1FQ1B 4WBOA 3F61A 1MP8A 2HZIA 3GFEA 2C1AA 3NYOA 2GNJA 4I6BA 4P2KA 4R3PA 3S2PA 3ZZWA 5EHYA 5AAEA 2FVDA 5FM3A 3HEGA 5E9EA 3UVPA 1GZOA 4QNYA 5HTCA 2H96A 5L8KA 3T3VA 2UW9A 3DLZA 4EORA 2G2HA 3C1XA 1R1WA 2XK3A 2R3OA 2YN8A 3LE6A 3W32A 4C4HA 2J0MB 2PVFA 3V6RA 3B8QA 4WKQA 3D5UA 3VQUA 2YJRA 4R5SA 2VO6A 3KK9A 3WF6A 3MBLA 4DT8A 1UVRA 1YKRA 2JFLA 2I40A 3AMAA 3DXNA 3OCSA 4FBXA 4HGTA 4NWMA 5CAVA 5F95A 3U6HA 4ZZOA 4KIOA 1K3AA 1MQBA 4RVMA 3V5JA 3SOCA 2QOIA 2PZIA 4RVLA 2B53A 2YLFA 1WVWA 4NTTA 2OH0E 4L43A 3FZTA 4F9YA 4R1YA 3HDNA 5C8KA 5E8VA 3EQDA 3R7IA 1FVRA 3PTGA 5IA2A 3LMHA 4G34A 2EB3A 3DTWA 4S32A 5L2QA 2QD9A 2C6IA 4FL2A 1OL7A 5CVGA 4NFMA 1LEZA 3PSCA 3CE3A 2FSOX 1WBWA 3U8WA 3EFLA 4K11A 4YJRA 5GZAA 4L44A 3MB7A 3DKFA 1H1RA 5HEZA 3WBLA 3PP0A 4IWQA 1REJA 4ZSJA 3V3VA 4DEHA 2I1MA 2OW3A 4TYHA 4JDIA 1HCKA 2HCKA 1ZYLA 2BTSA 4FZFB 4BB4A 2B55A 1PF8A 3UDBA 3PZEA 4NKAA 3LFCA 4R7BA 4PDPA 3TDWA 4FA2A 3LZBA 3CTHA 3WF7A 3WOWA 5F9EA 5CENA 4V0GA 5HX6A 4J71A 5GJFA
chains in the Genus database with same CATH superfamily
3KEXA 2UW3A 2JKMA 3CGFA 5CT7A 4OTDA 3UNJA 3ZDUA 4KWPA 3W0RA 4U79A 5HOAA 3RK7A 1OUYA 3E3PA 4M69A 1Z9XA 4XV2A 5CS6A 3ANRA 2O2UA 3HA8A 3RZFA 5BPYA 3HAMA 4X3FC 4Q5HA 3ZLSA 5ANEA 4DEEA 2PVMA 2VAGA 3PVUA 4AT4A 1V1KA 3QF9A 2VX3A 3D7TA 4M68A 3IO7A 4X0MA 5HGIA 3GC0A 2GQSA 3BLQA 4K9YA 1ZOGA 3DFAA 4A9RA 2C5YA 2C6LA 4XV1A 1PXLA 3W2QA 5BUEA 3P5KA 2CMWA 2XRWA 4NZWB 2R9SA 3TUDA 3H0ZA 3CKXA 2VTLA 5D7AA 1RDQE 4LV5A 4GYGA 2XUUA 3MPAA 2VTRA 4QP8A 5EG3A 3TL8A 5HLNA 4XHKB 3AC3A 4IAZA 4CFMA 4FTMA 4G5PA 4OAVB 5G6VA 4FEUA 3AKJA 4FOCA 2YITA 1JQHA 4RIYA 5ANKA 3ORIA 3MVMA 3TCPA 1YXSA 3QXPA 3W0OA 4ZSEA 2QI8A 4FT7A 3QUPA 4PPCA 1YDRE 3P7AA 4EOLA 3PA4A 1XH5A 4QQTA 4AXAA 1G8AA 4I1ZA 4RFMA 3MTLA 3TWJA 2QKWB 2P55A 3FUPA 4GVJA 3QTSA 4JR3A 5JGDA 3CQWA 2UZWE 2C6TA 3LCTA 4RIYB 3BPRA 1PXNA 2YLEA 3C0IA 4CFUA 2BRBA 2UW6A 3F7ZA 3EFWA 4GG5A 5D10A 3R83A 2R3MA 1TKIA 3PVGA 5AM7A 2V7OA 4EZ7A 3SGCA 2X8DA 4EHVA 1BL7A 5EI8A 2X7OA 1SYKA 2WQMA 5ETAA 2OFVA 4FICA 4PWNA 3TTJA 4OT6A 5BMSA 1WVYA 2BZIB 2XNNA 4QMNA 5IEVA 3P9JA 4UWBA 2X4ZA 1G3NA 2I6LA 4RQVA 3VUTA 3WZEA 4QYHA 2JITA 3CKWA 4FT9A 3RI1A 3T9IA 3AMBA 2XMYA 4IVDA 3EN5A 4JRNA 4YURA 5AWMA 4ANBA 4B4LA 3PG1A 5BUJA 2QVSE 4EOIA 4BBEA 4AOIA 1B6CB 3NCZA 3V5WA 4UWCA 3C4WA 4O6LA 2WHBA 1LEWA 3PP1A 1Q41A 2PWLA 4EUTA 3PFYA 4TW9A 3NVKI 3ELJA 4CG9A 2J7TA 4ENYA 3E7OA 3COMA 2JBPA 5B2MA 4ITJA 1BLXA 4PPBA 4KUJA 3IKAA 2OZAA 3B2WA 5AMNA 1VLRA 5DI1A 3EQIA 1W7HA 4TN6A 3ET7A 4FKWA 2QHNA 4ZTSA 2F2UA 4U81A 3VW8A 4HCTA 4LYNA 3WILA 3L8SA 3H3CA 4H1MA 5IQDA 3QLGA 5LOHA 4BBMA 1L3RE 4IJPA 4MNFA 4HYIA 2F4JA 2BZKB 3W0PA 2OZAB 3FI4A 3ZHPC 3V5LA 4UMRA 3MVLA 3TEIA 4KABA 4YU2A 5LVLA 3MJ1A 3OY3A 4ZTHA 3PA3A 3TDVA 3UDSA 4AG8A 4BL1A 2G9XA 5HESA 3ULZA 2W0JA 3S3IA 3W55A 4XX9A 4IX6A 2QONA 3DNDA 2E9PA 3QLFA 5DIAA 3R00A 2BHEA 4RIWB 1O6KA 2Y9QA 3WI6A 3LXNA 4RIOA 3UG2A 1Y6AA 5I0BA 5FG8A 4OTFA 3ZMMA 3FL5A 4IDTA 5DR6A 4YZCA 4GJ3A 3K5VA 3R7EA 2PZRA 3CD8A 5AJQA 5AEPA 1SZMA 2WU7A 4C4EA 4NYEA 3HMNA 2B9IA 4BKJA 4K77A 4M15A 3GT8A 2WTJA 4LUEA 4ZJIA 4XG9A 5ANDA 2ZDUA 4GK2A 4DTAA 4QD6A 4X2JA 1VZOA 2XNBA 1OPKA 4I5PA 3NW5A 4QYGA 4TPTA 4TZRA 3R8UA 4F6UA 3L9LA 2XZSA 4BC6A 1PXMA 2BPMA 3RPSA 5KMKA 4RZVA 3A7GA 5HNBA 2XNOA 4D4YA 1OBDA 3IONA 5HU9A 2YERA 2H34A 3O71A 5J5TA 4FNYA 1UWJA 4WHZA 5GZ9A 3ANQA 4TWNA 2Z60A 3BHTA 4YJNA 2UZEA 4BZOA 1T45A 2JFMA 4FL3A 2JAVA 4FSZA 4FTNA 3KREA 3DK3A 3LMGA 5HNIX 3ZDIA 1S9JA 4CLIA 2BROA 5FP6A 5IISA 3BLHA 3DB8A 4H3PA 5I9XA 3KRJA 4U41A 5KMNA 3ITZA 5HBEA 3RVGA 2C5XA 4O81A 4D1XA 3PY3A 5CZIA 3R8ZA 5IQAA 4NSTA 4DF3A 2ITYA 2VGOA 3ZLWA 4C37A 2JKOA 2R3HA 2WTKB 3PXRA 2WMQA 3P79A 2C5OA 2UVYA 3E8CA 3QQFA 4MUQA 4UYNA 3HLLA 4RRVA 1XH7A 1ZAOA 2VTAA 3Q9WA 4I4EA 3UTOA 2QOQA 2EXEA 4D2VA 4ZZNA 1IAJA 3RGFA 2WTDA 4U44A 1PMVA 2C3IB 4IM0A 4DHZA 4KD1A 1BX6A 2HY81 1H0WA 3F82A 3IPHA 4G31A 4IH8A 4FVPA 5AM6A 2BALA 2FO0A 3EH9A 5A4QA 2EVAA 3OFMA 4AQCA 5K5XA 4L52A 1IRKA 1ZOEA 3QD3A 3PPKA 4RLLA 3VUGA 4AACA 3KXZA 3P08A 2C6MA 4YC8A 3R8VA 2HWOA 2WGJA 2ONLC 2WOUA 3UQFA 3FSFA 5B2LA 4RMZA 4FV5A 3QWKA 1U46A 2XRUA 3K54A 2YACA 5ANJA 3W8QA 3SAYA 3VS5A 3ZO2A 4ZEGA 4BY9E 2J0KA 2I0HA 3PUPA 1TZDA 4HGEA 1VJYA 1V0BA 5FD2A 3V51A 2X0OA 2QG5A 5EYKA 5C03A 2W4OA 3VS3A 3GXLA 4MBJA 2PMNX 2ZJWA 3KGAA 4K0YA 1H01A 2XJ2A 5HCZA 5EK7A 2RF9A 5CT0A 3VUIA 4LMNA 4C58A 4DA5A 2VGPA 3MTFA 1NA7A 3PIZA 3FJQE 4F7LA 5CF6A 2HIWA 2P0CA 4MD9E 3E93A 4YBJA 2JIVA 2F7EE 5H8BA 2WQOA 1P2AA 2G1TA 2Z2WA 2WO6A 4XOZA 3A4OX 3DKCA 3G0FA 5L4QA 2XALA 5LQFA 1SNUA 4FYOA 3A62A 4QO9A 2YIXA 5HG9A 3BQRA 5AADA 4FK6A 4HZSA 3NUAA 3RPYA 4EK8A 4FTCA 3JPVA 4PX6A 1Q5KA 3L8VA 3LCSA 5CNOA 5HG8A 1SVGA 4AXEA 4JI9A 5EFQA 2JDTA 3DBFA 3TIZA 4BZDA 4QDEA 4RWLA 2BFYA 4N0SA 4DEIA 3ZLYA 2GS2A 3ID6C 4D1SA 4NTSA 5TOZA 1ERKA 2DS1A 4YJVA 2BILB 2ITTA 3PXQA 2CSNA 2XKFA 1H0VA 1STCE 4TNDA 5FBOA 4I22A 4CGAA 2VNYA 2HELA 1WAKA 3TG1A 4EH2A 5I4NA 3DU8A 4E5WA 4CT1A 3QAME 4KIPA 2PVJA 2X7FA 4D55A 5BNJA 4WO5A 4JG6A 1SVEA 2BFXA 3LLTA 4QYEA 3GCPA 4BICA 4FRFA 1ZOHA 1JAMA 3MS9A 1NY3A 3AC1A 2W9FB 2BDWA 2VTPA 2QU5A 5DR9A 5KMIA 5HCYA 4N4SA 4G2FA 3HYHA 4ITIA 1YI4A 2XEYA 4CVAA 3CIKA 4AOJA 5DHJA 4YTFA 2B1PA 3I6UA 3JYAA 3NX8A 5IQCA 4W4YA 2VTMA 3AGLA 4IADA 2X39A 2B7AA 4BKYA 4A06A 1GIHA 3C13A 4M3QA 3BV2A 5AX9A 4IQ6A 3R73A 3RAHA 1DAYA 1UNGA 1TQMA 2YCQA 3JXWA 4EOQA 3UOJA 2BR1A 1Q99A 2X0PA 4QQJA 2YIQA 3OWKA 1APME 3KXGA 1WBTA 2ESMA 2OJJA 4IACA 4EK4A 5HIDA 4IX5A 1X8BA 3UZRA 2DQ7X 3KULA 2QR8A 3CTQA 4U3ZA 5L2IA 4WUNA 2WQNA 5DVRA 4DFNA 1CMKE 4YBKA 2CKOA 4FZAB 3GU7A 3MVJA 4PQNA 5B0XA 2VWVA 3FQEA 4MEDA 4X2NA 2KULA 3D94A 2O63A 5ETCA 2C0IA 1ZZ2A 4MQ2A 5M09A 4I23A 2VTNA 4GU6A 2W1HA 5FTGA 5CF8A 3TZMA 3ZFXA 1Q3DA 3QD2B 2W1GA 5JQ5A 4JQ8A 4DGGA 3FWQA 1J1BA 4YSMA 1A06A 1WVXA 4NJ3A 2ITPA 4RLKA 4XYFA 4DFLA 5J7HA 2XIYA 3SDJA 4DGLC 2C69A 3L9MA 3ZFYA 4DDIA 3OBGA 4EHZA 3FKNA 3CR0A 4BJJB 2OIDA 4XG8A 5AUZA 2VWUA 1CSNA 3LM5A 5A14A 3HMMA 1IASA 4EC9A 2XM8A 2ZB0A 5E8UA 2AQXA 2C6DA 4Y83A 4KBAA 2OSCA 4E26A 4YHFA 3LMIA 1BL6A 3ACKA 5AP6A 4M66A 5D12A 1U5QA 2RG6A 3ORKA 3V04A 3FMEA 3LCOA 3EKNA 5ACKA 4C36A 3JVRA 3N51A 3FLYA 4RVKA 3QHRA 4F64A 2BRHA 3PSDA 4KS8A 4KKGA 3OMVA 1H24A 3QZGA 4RFYA 1ZMWA 4LOOA 3NYNA 4FTIA 4JBQA 3S1HA 2X6EA 3LPBA 4IZAA 4ZY5A 4BBFA 1YXXA 4C57A 2VN9A 3BELA 3RNIA 1BI7A 1VR2A 1J3HA 2O0UA 4O0TA 3GUBA 5BVEA 4FKLA 1OL6A 3Q9YA 1MRYA 5EQYA 5IQBA 4HPUE 4M0ZA 4UMPA 1DI9A 4BHZA 1MRVA 5GJDA 3RPVA 3PJ8A 5LMKC 2GTNA 4BCPA 3VW6A 5L2TA 1WBPA 4YNOA 2YCRA 3NCGA 3FLZA 5HQ0A 4AA4A 5FBNC 1JWHA 3V8SA 4O7SA 4J99A 5EDQA 3AT3A 2AYPA 2SRCA 2XP2A 5LMAA 5HORA 3LXPA 2E9OA 4DEGA 3OWJA 2R64A 1YWNA 3QUDA 4ONAA 4AZVA 5BVFA 4CMOA 4RA4A 1PXJA 2GNGA 3EN7A 3LJ2A 4LGGA 4AGUA 4LGHA 2ETMA 2CN5A 3QHWA 4FV6A 4GS6A 2PSQA 1BMKA 1OB3A 2XA4A 2XBAA 3PIXA 3QFVA 3KU2A 3NNUA 3DK6A 5ACBC 4C62A 3HV5A 4JL9A 3NWWA 2IPXA 3GCUA 3UMWA 2UW0A 4AW2A 4O4BB 3EFKA 4BTMA 3MB6A 3F5XA 1FMOE 2VX0A 1HOWA 2ZV8A 5DRDA 4FTJA 2W7XA 5D1JA 1W8CA 3EQPA 1YVJA 4J52A 2IF8A 5HLWA 4F9WA 3AOXA 4L53A 4RBLA 1R3CA 1JSTA 2R2PA 2WMSA 2UZVA 2WXVA 2R3QA 3GQLA 3P4KA 4R78A 2OJGA 4YLJA 1W2DA 2ITOA 4LRJA 2W99B 5BMMA 3BU3A 4GK3A 4BCNA 4E20A 1Q61A 1Y6BA 4RJ8A 5BVNA 4D2PA 5JRQA 4D2WA 5FEEA 4H36A 4AAAA 1KOBA 4E1ZA 2W1ZA 2I0EA 3VBVA 5JQ8A 5FLFA 2PVRA 4FUYA 4RFZA 3NNWA 4R7HA 2EUFB 3MYGA 2YM6A 4AOTA 4F0GA 4I6FA 4OTGA 2PVKA 1PY5A 3AXWA 4MBIA 3ALNA 4O38A 4O1PA 5FXRA 1WBSA 4UBAA 4Y72A 4ASXA 3OXIA 5DG5A 3OXZA 4D0WA 3PJ3A 1B38A 3LVPA 4FVRA 4MYGA 2OG8A 2XEZA 3DZOA 3G6HA 5CQUA 5HBHA 3PY0A 1PYEA 1PYXA 4OBPA 3VC4A 4J1RA 4MXAA 2B9FA 4QP9A 3OTUA 3RM6A 4WIHA 3VQHA 4ALVA 3ATSA 3QALE 3ZC6A 4ZTNA 4PNKA 3FEGA 3FDNA 5CU0A 3Q2JA 4JBPA 4LG4A 2VWYA 3FE3A 2A4LA 4I6QA 2GNFA 1XO2B 4L3LA 4M84A 3KRWA 4UMTA 2J50A 3PYYA 3UOLA 3AD5A 1W84A 4AE6A 3QQUA 1R0PA 4MKCA 5KHWA 3G33A 5H3QA 5A4EA 4IB3A 2JIUA 4OTPA 2J4ZA 1UKIA 3N4TA 4BTFA 4EI4A 4QNAA 3ZM4A 3ATTA 4KSQA 4XS2A 4IFGA 3RAKA 3PDTA 4FE2A 4ZMFA 1CTPE 1QPCA 2P33A 2CCIA 3DKOA 5E8WA 2QQ7A 4TRLA 4TYGA 3GU6A 1W82A 2UW4A 2HW6A 4TYEA 2VO0A 2BUJA 1PXIA 4C33A 3U6IA 5DT4A 4FEVA 4D5HA 4CEGA 2Q0NA 1IEPA 3EJ1A 2WMAA 3I60A 2WTVA 3QCYA 4DLIA 5M57A 2REIA 3LQ8A 4KKHA 4DN5A 3E7VA 3Q52A 2CNUA 4MBLA 4CD0A 3CQEA 2V22A 3TKUA 4BZNA 3GCVA 4L3JA 3DKGA 3R8MA 3EL8A 3PA5A 4F9BA 1O6LA 1PKDA 3RBWA 2VWXA 3DT1A 5E1SA 2VD5A 2F7ZE 3HRBA 1ZRZA 2HWPA 3KF7A 3KA0A 4W4WA 4I4FA 3W10A 4XEYA 4F63A 3ORNA 2ZFYA 3UIUA 3Q4UA 3R63A 3QGYA 4XG2A 5AUWA 2G01A 2X2LA 3LJ0A 3PVWA 2W4KA 4JIAA 5AV3A 5EKNA 5JGAA 1DS5A 2X1NA 2ZOQA 4ZLZA 4YC3A 4EYMA 3FKOA 4FUXA 2FH9A 4FTLA 4P7EA 4C34A 2UUEA 4F6WA 2DUVA 2V62A 3OP5A 3QQKA 4B8LA 1R0EA 1QCFA 4H1JA 2CNQA 3VS0A 3FXWA 3GEQA 5KHXA 2B52A 2Z8CA 5HG5A 1NVQA 1OKZA 5DN3A 5I3RA 3TIYA 2O5KA 2R3RA 3G51A 3M11A 3ROYA 3LFBA 3HRCA 4PPAA 4EH9A 5CAOA 2F7XE 3U87A 4EHEA 3VUMA 5I9YA 4OTHA 2QCSA 4XG4A 4ZY4A 1HCLA 2QO7A 4AN2A 4EYJA 2OJIA 3ALOA 2XARA 2R7IA 3ZEPA 5DE2A 1ATPE 3CPBA 3FXXA 3LFDA 3DQWA 1WFCA 1R39A 3GNIB 3ODYX 4FSMA 4U40A 3ZRMA 3DLSA 5TF9A 4EK5A 4EWQA 5KMLA 4JG8A 2J90A 2WMUA 4WNKA 3NDMA 2PK9A 3D5XA 2YISA 3GU5A 4I94A 4IWPA 3SXSA 3PPZA 3F88A 3DPKA 4GH2A 3BZ3A 4BF2A 5JGBA 4L3PA 4K1BA 5C4LA 3PG3A 5A4LA 5IDNA 5J8IA 2IZRA 1KV2A 3ML1A 5JK3A 3FZOA 5LWNA 2O3PA 3WZUA 4ZJVA 4QP1A 2E2BA 3UYTA 3BYUA 4OW8A 1UA2A 3MN3A 4ARKA 5CSWA 2YWPA 3EQHA 1Q3WA 5E90A 3TNIA 2B9HA 4DCEA 1RW8A 1OIYA 5CEPA 4AGWA 4FG8A 2HY0A 3ZLXA 3ZUTA 4IAKA 4FYNA 3FPMA 3IOPA 2X9FA 4FG9A 3QRIA 4HVGA 4FTKA 5K4JA 2NNWB 3CD3A 1JOWB 3EQCA 3RCDA 3NR9A 2PPQA 3ACJA 4YZ9A 4GCJA 3IDPA 4PNIA 1Q8TA 3KRRA 4CMTA 5IG1A 4XG7A 2CCHA 4YZMA 4QTEA 2IVVA 4X2GA 5AR8A 4DHFA 3NNXA 2OXDA 3BYOA 3C0HA 4D58A 1PKGA 4IVAA 5HD7A 3PUFC 2GNHA 4YJQA 5EM5A 3PWYA 3RCJA 2GQGA 4AXCA 4JRVA 4L8MA 3QD4A 2QLUA 4FKUA 4V05A 3KXMA 3EIDA 3Q60A 3R28A 4EH7A 4PMPA 3F7WA 3FL4A 4ASEA 3QZFA 2BIKB 3D83A 3HKOA 4FL1A 2XK8A 4G6OA 2BVAA 1AGWA 2X81A 1H26A 3NRMA 4FIIA 5IZFA 3IOKA 4W9XA 4E4LA 4I6LA 3MJ2A 3R30A 3F2AA 2BCJA 4A4LA 4FKTA 4FEWA 1WBOA 3UDZA 5J95A 4XBUA 2XYUA 1PRYA 4CFNA 3F5PA 1IG1A 3IW6A 4RC3A 4I5MA 1XKKA 3PXZA 1TFFA 4M67A 4WT6A 5CVFA 3DXPA 4P5QA 2CDZA 2QOLA 3IDBA 3QQJA 4EOPA 3CSVA 3REPA 3M2WA 3AT4A 2IZUA 4S31A 3RINA 4AZWA 1IR3A 4ENXA 3ERKA 3G9LX 3HDMA 5K3YA 5HE2A 2BRMA 4TYHB 2WQEA 4F1TA 3O51A 4JAJA 4HOKA 3RWPA 3LFEA 4D1ZA 1F5QA 4X2KA 5M08A 1BYGA 4MXYA 4IZYA 2VTIA 3OCGA 3RALA 3TNHA 4EJNA 2WTKC 3FMLA 3DB6A 2W06A 4FZ7A 4JJRA 4TWOA 4V0GB 3SRVA 4C4GA 2BZJA 3W33A 3E88A 3CY3A 4C59A 1OKVA 1R78A 2X9EA 4U3YA 2WMRA 4I5CA 3V5PA 4ZLYA 5C4KA 4GV1A 1OZ1A 3P0MA 2J6MA 5EQEA 3BWJA 5K0KA 4M69B 4B99A 5AR7A 4NFNA 4XH6A 1SM2A 3GU4A 4FSUA 4AUAA 4HNIA 4QQCA 4EJ7A 3FKLA 4BDKA 2EXCX 3D7TB 4HYUA 4ZXTA 1M7QA 3VAPA 5GJGA 4CZTA 4HCVA 4L7SA 4JX3A 4PTCA 3DA6A 2BAQA 4L7FA 5GNKA 2VTQA 5AUVA 3OS3A 5AV1A 5E92A 1ZZLA 4CLJA 2PULA 1JKLA 4ID7A 4O0UA 3R2BA 4FV2A 2XNEA 3ZUUA 2Q0BA 2C3KA 3I4BA 1OI9A 3BX5A 3C51A 3CCNA 5KZIA 4D2SA 1XMLA 4MHAA 5JRSA 4FIHA 4AE9A 3D2IA 3R01A 4CXAA 1Q8YA 5HHWA 5BVKA 4XP0A 5IA5A 4BCHA 4YZNA 2XANA 1J91A 4F6SA 2RIOA 4OTWA 4OR5A 4IB5A 2CNVA 3C5UA 1YW2A 1XMMA 1GAGA 3ORZA 3O96A 4IMYA 5AUYA 5HO7A 5M4IA 4M13A 1LPUA 2V0DA 3KMUA 4QDVA 3Q6UA 4AZFA 4ORKA 2WEVA 5D41A 5A54A 2YAKA 4U42A 4TYJA 3UPXA 4AGCA 3BCEA 4JG7A 4DH3A 4X3JA 5K5NA 1Q8WA 1YHWA 4LRKA 4QMUA 4RVTA 3UO6A 5CALA 3COIA 3BYVA 3ZSGA 4GG7A 3FSKA 2PUPA 2W1IA 1U54A 5CANA 3MFRA 4S33A 3AKLA 3HRFA 5JFSA 2HYYA 2ZB1A 1H4LA 3OXTA 4QPAA 1IA9A 3EHAA 4PP9A 3TNWA 1FVTA 3BU5A 4A9YA 2PMLX 2OJ9A 3QL8A 4FV8A 4A9SA 4NW5A 3JR1A 1OMWA 2YHVA 3RZBA 4H58A 3BLAA 4QMTA 1KE8A 3NNVA 1U54B 1JKSA 2W1CA 3MDYA 3R21A 4M97A 4WSQA 5DT0A 3GI3A 3UG1A 4A9UA 5TR6A 2ZYBA 3VF8A 5IEYA 2JBOA 3R0TA 5EDPA 3DTCA 3VBQA 3TI1A 3F3UA 4APCA 4CRLA 5HD4A 3R1NA 1NT2A 2H6DA 1YDTE 4AN3A 4YR8A 3Q9ZA 3Q32A 2RFNA 5FDPA 3R1QA 3IW4A 5LARA 1XH6A 5KMMA 5IKWA 3EQFA 4ANLA 3QBNA 3CS9A 3ETAA 4BIEA 2XIXA 2HOGA 3NGAA 2F49A 2OIQA 4NEUA 2PL0A 2F9GA 3QX2A 4C0TA 3RAWA 4J98A 2BKKA 4O7TA 1UU8A 2XJ1A 2X2MA 4QPSA 4Y73A 2UZLA 4EH6A 1URCA 3NFGB 2XK6A 3QTZA 4AA5A 3M1SA 5FWKK 3ZYAA 3E8NA 2CGXA 3A7JA 2CGVA 2EU9A 2X4FA 4QMSA 3FMJA 1WBVA 4TT7A 4FG7A 4BGGA 4TL0A 2Y8OA 2PUIA 3KIOC 2YIRA 4JAIA 3BV3A 3TM0A 3Q04A 3NW7A 4KBKA 4RC4A 4QMMA 5ANOA 3DJ5A 2PHKA 3R7VA 3R9NA 3U4UA 3UZTA 3C5IA 3WE4A 2UZUE 3KRXA 1XQZA 4U80A 5HBJA 5I5ZA 3F5GA 3GVUA 3MFTA 4FF8A 4JDHA 2XCHA 3FZSA 2ETRA 4Q2AA 4WBBB 4P90A 3PRIA 5KKRC 3TZ8A 3VUKA 3E87A 5AV0A 1FMKA 2FSMX 3F69A 4JX7A 2R7BA 3ZH8A 4E6AA 5EKOA 3KXNA 4UWYA 4FIJA 4RWKA 1SMHA 2ZM1A 4FIGA 2FYSA 2NO3A 3L1SA 2JC6A 2UZTA 3QQLA 3HVCA 4HYHA 3KQ7A 1MQ4A 4D2TA 3NAXA 1VYZA 2PE1A 2PMOX 3E64A 4UMUA 5DMZA 4MK0A 5IPJA 3W0QA 2W05A 4AXDA 3DNEA 1H08A 5DT3A 4R5YA 1VEBA 4UZHA 4ZLOA 4YJTA 2W4JA 2IW6A 5AUUA 4LL0A 2ZV2A 3UGCA 3QZHA 3ZRLA 4QMXA 4F08A 4JBVA 2VWZA 4LV7A 4E6QA 4BCGA 3GC9A 5C9CA 4J53A 3PXFA 1FBNA 3Q5ZA 2J9MA 4NCTA 3V01A 5C1QB 3WF8A 1CKIA 2C3JA 2ITUA 3DAKA 4DFBA 5KBQA 4UY9A 4O7VA 5HG7A 1UV5A 2GSFA 2GCDA 3QWJA 1H25A 4HW7A 3DZQA 2VWWA 3VIDA 3ZSHA 3ZONA 3HV3A 4RWJA 3TNQB 4EBVA 4ERKA 4RJ7A 5AAGA 3UO5A 2XBJA 2JDSA 4CYJA 4ZY6A 5AA9A 3FAAA 5LVNA 1YXVA 4DGOA 2OXYA 5IH5A 3KCKA 4A4OA 2ZVAA 1G8KA 2RFEA 2OBJA 3GGFA 3FYKX 3D5VA 3SG9A 1PMUA 5LMBA 1Q24A 4L00A 3U55A 2BRNA 2GPHA 5DBXA 1W0XC 3EZVA 3IW7A 4U9AA 3BRBA 5DYJA 4WG4A 4LFIA 3W2OA 2QODA 2R4BA 4G9RA 3UBDA 1XHAA 4FVQA 3U54A 2RFDA 3R7YA 5EI2A 4ZOGA 4AXFA 4FKSA 1P4FA 5CAPA 1PHKA 3ZSIA 5D9HA 4O0XA 5IA1A 4R77A 1GZ8A 4UEUA 5TT7A 4Y5QA 3UZPA 2QO2A 1YHVA 5CSVA 1JLUE 3W8LA 4Z16A 2YJSA 5M4FA 5F94A 1SNXA 5A3XA 3LCKA 3RJCA 3UC3A 3PXYA 1YI3A 5CXZA 3C9WA 3CBLA 4YPDA 2A19B 3GC8A 4LUDA 5HVKA 5CU6A 3GC7A 3QTXA 5IDPA 1KV1A 3DV3A 4XOYA 3PXKA 4LOQA 3TKIA 3ZXTA 4FTTA 5M4CA 2WIHA 3BHYA 3R71A 3QD0A 2LAVA 4QMYA 3PSBA 4CFFA 2BAKA 4QYYA 3H10A 2ZV7A 3UIBA 3DDPA 1OPLA 1QPDA 2CJMA 2J0JA 3HECA 5ANIA 4ZTQA 5CASA 3SVVA 5CEOA 3I5ZA 5JZJA 1OM1A 3TKHA 2Z7SA 3MPMA 4O7LA 4AX8A 5EW3A 4BYJA 3OW3A 2IW8A 4AA0A 2GU8A 3QTWA 4DHJA 3IDCA 2PVNA 5I9UA 4C8BA 1LUFA 5D11A 3MY0A 5L3AA 4O2PA 4CT2A 1MUOA 4MWIA 4FSQA 4EH4A 2WOTA 2YM5A 5CQWA 3FZPA 5HNGA 4AFEA 5AV2A 4O1OA 5KO1A 2BTRA 4ZK5A 3QYZA 1XH9A 2IG7A 3S95A 4GK4A 4K8AA 4ANQA 4YTCA 4DITA 2FSLX 3OY1A 4ZTRA 4DC2A 2YM4A 3R2YA 2YAAA 2ITZA 5EM8A 3VS2A 3BEGA 3VS1A 4OUCA 4GMYA 4KAOA 4RX7A 4EWHA 5GINE 3MIAA 3FI3A 3U9CA 2PUNA 3S00A 1OKWA 3O23A 4DLJA 3UODA 4EUUA 2W1DA 3F2NA 3NAYA 3QTRA 3PIYA 3SX9A 3ZZEA 3QTIA 2PTKA 2XNPA 1XBAA 4PDOA 1ZWSA 4JNWA 4F9CA 3QCXA 5E7RA 3RPRA 4MD7E 3ZTXA 1KOAA 3RK9A 3E5AA 2WKMA 4KSPA 4O0SA 4YZDA 3Q9XA 5E91A 3A8XA 5FXSA 5HIBA 5J9ZA 4EOSA 3OG7A 3NUUA 1YOMA 3H0YA 4JVGA 4C38A 3WYXA 5CX9A 5HZNA 5ETFA 5AP5A 4LGDA 3HP2A 2QOBA 4YJOA 3IS5A 5BYZA 3N4UA 1WZYA 4JR7A 4O4FA 5KKRB 4R3RA 2E9NA 3KULB 1FVVA 4EK6A 2XIRA 4YHTA 5CAUA 1MRUA 4USDA 3SLSA 2VWBA 3EN6A 5M06A 4I3ZA 3DBEA 4H39A 4MCVA