2GCDA

Tao2 kinase domain-staurosporine structure
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
309
structure length
308
Chain Sequence
DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the MAP3K TAO2 kinase domain bound by an inhibitor staurosporine.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase TAO2
total genus 96
structure length 308
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gcdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gcdA01
1SNXA 3LXLA 5JSMA 1UA2A 3GVUA 4IMYA 1U54A 2VO3A 5LMKA 2ITUA 1MRVA 3OXIA 3P1AA 4Y5HA 4D2TA 4KSPA 5DI1A 2J0LA 1F5QA 3C4ZA 3HVCA 3P78A 3EL8A 4IWQA 4PF4A 5E4HA 4FR4A 2VX0A 3HECA 3R1YA 1Q5KA 1KUTA 2X2LA 4DGMA 2B0QA 4YZ9A 4FL2A 4AUAA 5EM8A 2PSQA 2F7XE 3OCTA 5HESA 3GOPA 5HO8A 2PE0A 5A46A 4RBLA 2GHMA 4FVQA 4I24A 4BDBA 4AT5A 2ERZE 3B8QA 4EORA 3DJ5A 3W8QA 2GTMA 2UVZA 1PMNA 3LOKA 1OUYA 3BV2A 4W4WA 2C6LA 3KREA 4D4SA 1ZY5A 2QO2A 4FNWA 3ODYX 4F7NA 5HX8A 3Q53A 2Z60A 3QUEA 5M4CA 4NKAA 4KNBA 4D1ZA 1WVXA 3GNIB 3PY3A 4W9XA 3E88A 2IVTA 3U6HA 4ZSLA 4BDEA 3KVXA 2NP8A 3VS7A 3NLBA 2AYPA 3WZUA 1OVEA 3AGMA 1CM8A 4C4EA 4BCIA 4BKZA 4ZZOA 1DAYA 1NY3A 4QQCA 4RJ4A 1UU7A 3R9OA 3FMDA 5IEVA 3COKA 3CQEA 5CZHA 5CVFA 4X2KA 4EZ5A 5FDPA 1OKWA 4FK3A 4M69B 4L52A 4WSQA 4L7FA 4MH7A 3R7UA 5G1XA 3PIXA 4IWOA 4YC8A 2PE2A 3ZUUA 4YR8A 5ANKA 4Z3VA 1XR1A 1YDRE 1NVQA 3DJ7A 4HCVA 4EOLA 2ETMA 3S1HA 4UX9A 4DGNA 4BGHA 2X2MA 2BKKA 3NVKI 2UZLA 4N0SA 3ULZA 2J6MA 4XRLA 3UNZA 3VUIA 5J8IA 5L2TA 4CZTA 3HA6A 3HAMA 2OFUA 3BELA 3EJ1A 5LWNA 5G6VA 3EZRA 3QRIA 3MY0A 5AV2A 2XEYA 1XKKA 1OBGA 4EC9A 3C9WA 4CFUA 2R7BA 2CGVA 2X81A 1I44A 1XH6A 2XM9A 3F3VA 4M3QA 5CY3A 1YHWA 3OHTA 2R3JA 3VBWA 3K5UA 5KZ0A 2ITOA 5IA2A 1YI3A 4BTJA 1FOTA 3HP2A 2C0TA 2VTJA 4JBPA 4LOPA 4YBJA 3E93A 5CVGA 4AWIA 5IA0A 4CGAA 4U80A 1E1XA 4RLKA 3ORXA 4MNEA 3QUDA 5AV3A 4TYIA 4NK9A 2P3GX 3FYJX 2PVKA 2O0UA 2C6IA 4USDA 3MJ1A 1OECA 4I0TA 1Y8YA 2ZB1A 2RGPA 2YAAA 2XK9A 3A7FA 5FWKK 2IG7A 5BNJA 3OEFX 2GNJA 4ZJJA 3SHEA 1RDQE 3E5AA 3DDPA 3FAAA 2C1BA 2ITQA 2O63A 5EHOA 4AS0A 3F2NA 5IF1A 2GNFA 2QR8A 5I9UA 3W2RA 1UNLA 1JWHA 1PXPA 2XUUA 2Z7LA 1OGUA 4LI5A 5AM6A 3ZDUA 4I21A 4A9TA 4AFJA 1NA7A 1JSTA 3ZEWA 3QQKA 3OW3A 4DFLA 2V62A 3P23A 5GIOE 3DT1A 5FTGA 2XNEA 2C6EA 5ICPA 3BGZA 2JFMA 3DQWA 5K5XA 4ZMFA 3LLAA 3PIYA 1OIRA 5HCYA 3R01A 3RI1A 3T3VA 3VS1A 4CQGA 5CANA 2RF9A 4S32A 5E90A 4ZS4A 5I3OA 4YNOA 4B0GA 4B8MA 3QUPA 2W1ZA 1Q3WA 3COHA 4FV8A 3GC9A 4WUAA 3VJOA 4AOTA 3OWLA 4ERWA 5CSPA 4DEEA 4GS6A 1MQBA 3WILA 2OJGA 5J9LA 3QWKA 4BBMA 3R8ZA 4V05A 3MWUA 5EQYA 5L6PA 4ZTHA 5BVOA 1ZYDA 1OZ1A 4NZWB 4FKPA 4LL5A 1UKHA 2FH9A 2ITNA 2PZIA 4OTDA 3VW6A 3W2CA 3Q3BA 4CQEA 2C3KA 2WU6A 3PXZA 3BGPA 2BCJA 3QYZA 4O7TA 4AZTA 1WBPA 3KRWA 3RTPA 5L8LA 4CSVA 2J0KA 4FKOA 4BHZA 4N57A 3OT3A 3Q60A 3QHRA 2J90A 5AMNA 2X9FA 2F7EE 4S2ZA 3ZZEA 4EJ7A 4XH6A 1JAMA 3H30A 3PP0A 4M12A 4M67A 4LG4A 4W4VA 3O71A 3RPSA 3WBLA 4Y95A 4AW0A 4JIAA 2XM8A 2QG5A 5T3QA 2PUUA 5C1QB 3TZ8A 1TQMA 5LWMA 4FV3A 4CG9A 4I23A 4WKQA 5A4QA 4IVDA 2ZMDA 3EQDA 2FO0A 3WF7A 3D15A 4U5JA 2C6OA 2OU7A 2OZAA 1JSUA 1QPCA 3AC5A 5KZIA 5JEBA 2HZ0A 5CSHA 5B2LA 4XG9A 2ZJWA 5H3QA 4MYGA 3F3WA 5C8NA 3UP2A 4L53A 3QQUA 1OBDA 4FKQA 2X39A 2VTAA 4FV0A 5ANEA 3UG2A 4EWQA 5I5ZA 3FJQE 4IVBA 4DA5A 4C61A 5C26A 3ZBXA 4C2WA 4CKRA 3NPCA 4PQNA 3BWJA 4PY1A 4WA9A 3VBYA 2WOTA 3UNJA 1RQQA 4EH5A 2PMLX 4JX3A 3ZUTA 4FT9A 3E7VA 4F9BA 3KXGA 3HDNA 4E73A 3ZXZA 3R7YA 3NCZA 3ATSA 4EQCA 2BDJA 2F9GA 4O1OA 3F2RA 2W17A 4DGLC 3VS2A 1Z9XA 5BUIA 4EZ7A 5KMKA 5I9ZA 3TZ7A 3QRKA 2P2HA 5HD4A 4KABA 4O0TA 5EW8A 3CJGA 4ZJIA 4HVGA 4FT5A 1V0BA 4ZOGA 3U54A 3DCVA 4M15A 3AC2A 5FD2A 3TTJA 3L8PA 3ORZA 3EMGA 5CVHA 4R8QA 3UIMA 2YN8A 4IXPA 4CXAA 3RHKA 1G3NA 5B2MA 5KKRB 5LCJA 1PKGA 3UVPA 3NAYA 3MY5A 4PP9A 3B2WA 3BKBA 4OTIA 3FXZA 4FNYA 4GT4A 5LCKA 1YOMA 5J1VA 4DFBA 4QMVA 3F5UA 4BDKA 2ETKA 3AOXA 4IB0A 3BYSA 4TTHB 4QMYA 4X2NA 3TZMA 4UY9A 4BCHA 2QOHA 3QZHA 4M13A 1AQ1A 2YCQA 1GIJA 1H27A 4JI9A 2R7IA 5EH0A 4C8BA 2FSMX 4EH2A 2ITWA 2YM7A 3FZPA 5AUZA 3ZONA 4O0WA 4AGDA 4XEYA 4Z7HA 5IISA 4ZK5A 5FXQA 4J97A 4GW8A 4YBKA 3FLQA 5E92A 2WB8A 2BHEA 3JUHA 4WOVA 3KEXA 3D5XA 4BDJA 3GP0A 3O0GA 5LVNA 4RRVA 4QTAA 1SNUA 4F0IA 3NUYA 5DVRA 5JZNA 5J79A 4TYHA 1ND4A 2BTRA 1WBTA 4Y83A 1M52A 3UJGA 1R0PA 3OW4A 4KS8A 2VTTA 3EYHA 4V01A 3VIDA 3VF8A 5M06A 1L3RE 2QNJA 1W84A 5BYYA 3C0HA 3RGFA 3F6XA 5AM7A 2IZRA 4FG7A 1DM2A 2ZV2A 2R4BA 3PRFA 4DFUA 3QYWA 4P90A 3ZCLA 2UZEA 3F7ZA 4RJ5A 4R5SA 3QKKA 4BICA 3LMHA 3FQEA 2BZJA 2R0IA 3BYOA 4O21A 1S9IA 4FIEA 3BLQA 3BU6A 3GU6A 4EONA 4FKRA 2HZ4A 4GU6A 1Q97A 3QTIA 3OBJA 2V7OA 2HZIA 4F65A 2Y9QA 3KMWA 4JBVA 4PX6A 2OG8A 4FZ6A 2BR1A 2F7ZE 4DEGA 4UEUA 5GNKA 1FVRA 4PP7A 1A9UA 4FTMA 4ZTSA 1O6LA 4C2VA 1ZZLA 3QRUA 5ETCA 2JAVA 4BTMA 4MX9A 4UYNA 4X3JA 3IW7A 1J7IA 2PZPA 1WBNA 2I1MA 4FKSA 4LYNA 4QMPA 4RGJA 3F61A 3QCXA 4I22A 3FBVA 4RIWA 4YC6A 4XP3A 3SQQA 5EYCA 4DBNA 2B4SB 4TNBA 4CFMA 3QKLA 4MXYA 3HV3A 1PKDA 3L9PA 4Y8DA 5I9WA 3LXNA 4O7RA 2OZAB 4ANOA 3UO5A 5AAGA 3FL4A 4GIIA 4CT1A 4FYOA 2Z7SA 3AC1A 2WMAA 5HVJA 1O9UA 4HCUA 2G2HA 2VTMA 3EFKA 4NM3A 4IB1A 5DBXA 3GC0A 1KE8A 3LJ1A 4DTAA 1OIUA 2P2IA 4UXQA 2QOLA 5EYDA 4YJVA 4OTPA 4AZWA 1ZYJA 5HLPA 3RAWA 5IUHA 5J87A 4FGRA 4J1RA 1PW2A 3KY2A 4QMWA 4BF2A 3JR1A 3EN5A 4BL1A 4ZTQA 4E5BA 4HVHA 4RVMA 2IO6A 1PYEA 2ITYA 3QTQA 5CU2A 4FOCA 3W2OA 3WZJA 3RK5A 2C0OA 5BQ0A 5HQ0A 1BL6A 3PUPA 3PZEA 3Q6UA 5CXHA 1YWRA 2H9VA 4YLJA 4D58A 2VNYA 4YUQA 3CY2A 3MA6A 3UOHA 3CXWA 3ZH8A 4LOQA 3NNWA 3W2QA 4Z9LA 2ZMCA 5KE0A 5FXRA 2I6LA 4BIBA 1K3AA 1JKSA 4OTFA 4HYHA 2W5BA 2QOQA 4H1JA 4F99A 2XK6A 3OUNB 5GIPE 2QURA 4GIHA 2UZTA 3EQHA 3QALE 4LV8A 3OWKA 5C03A 5EK7A 4ALWA 2RFNA 1R1WA 3PWDA 3E8NA 4RX7A 3UO4A 1PMEA 1PXJA 3GXLA 4GSBA 4H36A 3BE2A 4YO6A 4EOOA 3EQRA 4Z7GA 2PVYA 4FODA 4OBPA 4Q9SA 2PWLA 4EH4A 2GHLA 5DFPA 3T9TA 4GYGA 4UWYA 3KRRA 4FC0A 4NU1A 2J2IB 4X6QC 3PJ2A 2BAKA 3U9CA 5JQ5A 4EK8A 1PXMA 4NIFA 4FKLA 5TF9A 1T46A 4G3DA 3HLLA 3ZFXA 4FEUA 2VTSA 3A2CA 3SRVB 3V6RA 4Q2AA 5CAUA 5CQUA 1UVRA 3LVPA 2WPAA 3AG9A 2P4IA 3ZSGA 4ZMEA 2RSVA 5D1JA 1GZ8A 2B9FA 4QMQA 4YTCA 5KO1A 4FIFA 4BCPA 3MFRA 1URWA 2ONLC 1JSVA 2YM3A 4U3YA 5F20A 1QCFA 3M11A 4XCUA 3UZPA 3WZKA 4CZUA 3MB7A 3KRXA 3WF9A 3NYNA 4QQ5A 4RC2A 5DNRA 5LXMA 3CC6A 4XMOA 3GEQA 4FKJA 1Q8WA 1AGWA 1Z5MA 1PXOA 5D7AA 2OJJA 4DINA 5E1EA 3EWHA 2PVJA 2XH5A 2O2UA 4LGGA 4LRJA 3ZRKA 4PMSA 5BMSA 5CAQA 1PXIA 4G6NA 3SG9A 5F95A 5BUJA 3HP5A 4BDCA 4F9AA 4FV9A 1O6KA 3SAYA 1ZMWA 3LZBA 5AV1A 3MA3A 4QOXA 4FZFB 3R28A 4JG6A 4DT8A 1W8CA 2I0EA 4QYFA 4B7TA 4WUNA 3NUXA 3ROCA 2GPHA 4U0IA 2QOFA 4TXCA 4QMTA 3LFEA 3HRFA 2H34A 3ZFMA 4OBOA 2V0DA 4XJ0A 1WCCA 3ZHPC 5I9VA 4PNKA 3PG3A 2ZM4A 2WMWA 4IC7A 4DT9A 5BPYA 2HW7A 4Y72A 3RAIA 1YXSA 3KXZA 5JFXA 2WXVA 3F7WA 3WARA 1NXKA 4I93A 3EQGA 1BUHA 5L2QA 1T45A 2A4LA 2JIUA 5AP4A 1REJA 4RWKA 3IKAA 2G9XA 5HE2A 4CLJA 4MXCA 2EB3A 3V04A 5BVDA 5I9XA 3GU7A 4IHPA 4KD1A 2J7TA 2XKEA 3AMBA 1FPUA 3D7TA 5EM7A 3RPRA 4G2FA 3ZUVA 3WF8A 3FHRA 2J4ZA 3R02A 2WZJA 3ZSHA 4D2WA 3AC4A 5FTQA 4JAJA 4W4YA 4FNZA 4DEIA 2W1CA 5GZ9A 2W5HA 4YZMA 4RVTA 4J7BA 2VTNA 5FUTA 3TNHA 2X6DA 3R21A 2QLQA 3QQFA 4CTCA 5I9YA 4D28A 2QG7A 3IW6A 2J0JA 4ZLOA 1UNGA 3PYYA 4R3PA 5GINE 4BFMA 4J98A 3OOMA 2J5FA 3FLYA 4DG0E 1KE6A 3FMJA 2UVYA 2VAGA 4CCUA 2ZV9A 5KHWA 5E8SA 5A54A 2R3LA 3NUNA 4R1VA 4FG8A 4R6VA 5HCZA 4GFOA 3I81A 2EUFB 4BCKA 2WTVA 4R7HA 4QNYA 2GS2A 3EYGA 3JPVA 3RWPA 2ZDTA 3P08A 2QC6A 3UO6A 2WIHA 3IOKA 2OW3A 2AC5A 4HZRA 4V0GB 2Y6OA 2BIYA 2W1IA 4QP7A 4MF1A 4O82A 2C69A 3UYSA 3GB2A 3ZLYA 4FOBA 2XK8A 5FRIA 1O6YA 3DXQA 3FXXA 2Z02A 3FZRA 2OFVA 4QTBA 4RIWB 3KF4A 2HELA 4RQKA 2YA9A 4JDKA 4F1OA 3R71A 2J0IA 2XZSA 3RZFA 5BYLA 2R3RA 5DWRA 5A4CA 1J1BA 1YWVA 3BPRA 5FG8A 3RAKA 3ZYAA 3TWJA 4GL9A 2UVXA 3DKGA 5M08A 1BLXA 3SA0A 3NX8A 4LV5A 3LXPA 4NW5A 4I6QA 3ENHA 3RP9A 3TIZA 4EOJA 4R78A 3PPZA 5IA3A 4QRCA 4AN9A 4TWNA 4GYIA 4DCAA 5HBJA 2GNGA 3M42A 2WEIA 4FTOA 4S34A 3DY7A 4AX8A 1NVRA 3KXMA 3P7CA 5AIKA 4MBJA 1P14A 1QMZA 2HZNA 4WG5A 4RVKA 3W8LA 2EXEA 2UZOA 3KKVA 3AC8A 5ETIA 1R39A 3C50A 3QQHA 3IGOA 3MTFA 3WIKA 2AUHA 5H9BA 5JK3A 3U6JA 4O7VA 4LOOA 4GH2A 4U8ZA 2DQ7X 2WTWA 5KMJA 3D7TB 3NUSA 2XIYA 2W0JA 2NPQA 2ZOQA 1H4LA 4FVPA 4IWDA 5AAFA 3S3IA 1A06A 3W10A 4EH6A 3DK6A 4IB5A 5E8WA 3V5WA 4RLLA 4DITA 4IIRA 3LFDA 3VS0A 2BHHA 3VRZA 4CFWA 1M17A 3VHKA 2WELA 2CCHA 4PTEA 4K9YA 3EIDA 2OGVA 3Q32A 4PDSA 3OOGA 4F9CA 4AA0A 5AA8A 4KBAA 5A9UA 3VC4A 2H96A 2A19B 3GU5A 4GJ3A 3VQUA 4IZAA 1PYXA 4O0SA 4ANMA 5HEZA 4B8LA 4O7WA 5IH4A 3I6UA 3QD2B 1PXNA 3WF6A 4NJDA 3N51A 3LAUA 2VWXA 4MD7E 3EH9A 4DHFA 5GJDA 1YKRA 3RINA 2ITTA 2I0YA 4OTQA 4YHFA 5L2SA 4ALUA 1HCLA 3UPXA 4C4GA 3NVMB 4TYHB 4WG3A 3LM0A 1STCE 4MQ1A 5AUVA 1OIQA 2UW4A 1H01A 1BI8A 1YHVA 3W1FA 3H9FA 2C6KA 4C3RA 2HIWA 5HO6A 5CF5A 4F6WA 2A27A 3FI2A 4RFMA 4HVSA 4QMNA 2XKCA 3NS9A 3K3IA 3O8TA 3PRIA 2XNNA 3VW8A 2FUMA 5LOHA 4WNMA 2WMBA 4IAAA 4EBWA 4BN1A 5HLWA 3KXHA 3MB6A 4FTNA 3OCGA 4X2GA 5AP6A 4D9TA 1X8BA 4P4CA 4EQUA 1KOAA 1R78A 4G5PA 4K77A 4LM5A 4QP4A 4XX9A 5AR7A 5AAEA 4IAYA 3L9MA 5L6WL 5HE0A 2PU8A 3EN4A 3G6HA 3EL7A 4IDTA 4JRVA 4RJ3A 4BCOA 1PXKA 4X3FA 4KSQA 2HCKA 2C6DA 3QD0A 4CCBA 4A9SA 2B7AA 2O64A 3DNEA 5ETFA 2VO0A 3VBXA 3IK3A 1BKXA 1ZAOA 2RFEA 3ZZWA 4FSNA 5LMBA 5L4QA 2QOIA 4YP8A 1XH9A 3FHIA 4W9WA 2PVRA 3CGOA 4F9YA 5IQBA 1XH8A 1UKIA 4JJRA 5AV0A 3SOCA 5EM6A 4FV5A 1ZMVA 3JY9A 4GKHA 2IW6A 3BLHA 3KVWA 3SXFA 4LGDA 3S4QA 1Q99A 3EFWA 2UZVA 4BWKA 1WMKA 3HKOA 1Y57A 2WKMA 3M1SA 3KF7A 3VVHA 2CNQA 1Q3DA 3V5PA 2VNWA 4WIHA 1YHSA 3FUPA 4D2PA 1Q61A 4NH1A 3OT8A 3TT0A 2HY0A 2JKKA 2V22A 3MDYA 3F5PA 3MVLA 4QP1A 1PRYA 4G1WA 4O2ZA 2V5QA 3KCKA 3FMLA 3G2FA 4BCMA 4C4IA 4C38A 2UW6A 4TYJA 1KWPA 3PXQA 4M69A 2WMQA 2X4ZA 4FIGA 4TPTA 4YSJA 1B6CB 5EM5A 1KE7A 2R5TA 5FDXA 3VNTA 3QXOA 4DBXA 2ETRA 2WMRA 3QTRA 2X1NA 5TT7A 4HOKA 3SW4A 4DG2E 5B7VA 4CG8A 3ZEPA 2Y4PA 3V5QA 3ZO1A 5AADA 3HZTA 3UZRA 3TUBA 1YI6A 4UBAA 5CTPA 1ZYLA 2WMUA 3BRBA 4X2JA 3MJ2A 3M2WA 5DOSA 3CP9A 4UZHA 3E7OA 4IADA 4YJNA 1JKKA 3LCKA 3ALNA 3AQVA 3OG7A 4DYMA 2JDVA 5HORA 4HYUA 3R8UA 4EOPA 2B1PA 1H8FA 5AUWA 3RPOA 2ITZA 4AA4A 1M2PA 1UWHA 3HA8A 4L9IA 5IUIA 3FKOA 2UZNA 3IDPA 4FTTA 4X6RA 2BZIB 1Q62A 2YJSA 3GU4A 3HGKA 4IM2A 5M56A 4U41A 2EWAA 1OPLA 4M0ZA 4F0GA 4FYNA 3NNXA 3MPAA 3ITZA 3N9XA 1TVOA 4AZFA 1JPAA 4BZDA 3BWFA 4MBLA 3VBTA 3VRYA 3TDVA 1W83A 4FZ7A 3OVVA 3GUBA 3FZOA 2Z2WA 2W1FA 1MQ4A 3V8WA 2UUEA 3SG8A 3ZSIA 1LEZA 2W5AA 5HIDA 3VUGA 5HVYA 3KN5A 4ANNA 4BCGA 3OXZA 3C0GA 3GGFA 4G16A 4JBQA 4C34A 2C3JA 1PF8A 2YDJA 5CT0A 3THBA 4FTJA 1WFCA 2R2PA 2ZDUA 3VAPA 2I0HA 4AACA 4C02A 4AGCA 3BYVA 3PLSA 5EG3A 2B54A 3R2YA 4IDVA 4EOKA 3KRJA 1H28A 3DPKA 4XG2A 3A8XA 4JG8A 2R64A 5M07A 1ZOGA 2XK4A 3FZTA 4K2RA 4O27B 3ZXTA 4YHJA 4ERKA 4XP2A 3UE4A 3ATTA 5HCXA 3I0QA 4I0RA 4IBMA 1VJYA 2Y7JA 4MVFA 2ZVAA 5AR5A 5TE0A 3QCQA 2WD1A 1LUFA 4WG4A 4YURA 4H3BA 3LLTA 4D0XA 3QF9A 5HNBA 3EQIA 3HUCA 5AP5A 3U8WA 5E8ZA 1GZNA 3IDBA 4FKIA 3TACA 4ORKA 1LR4A 1OIYA 3G9NA 3NRMA 3OP5A 4DH8A 2DUVA 4A9RA 3MIYA 2ZB0A 3LMGA 4K11A 4NWMA 4CYIA 3VWAA 3E3PA 4PMMA 1J7UA 4JX7A 5CX9A 2VTLA 3DBCA 4C62A 4DEAA 4I5CA 2PVNA 2W4KA 1GIIA 2JAMA 1HCKA 2OF2A 3OZ6A 3QKMA 5EDQA 2B53A 1H26A 4WD5A 3OC1A 4EOIA 4DLJA 4O7SA 3KMMA 1OKYA 4QMOA 4XLIA 5ACBC 2PHKA 5IEYA 4BWPA 5JKGA 2ITPA 4AW2A 1R3CA 4OT6A 4EK4A 3OMVA 3LFFA 2BRNA 3RVGA 3VS5A 1WZYA 3FE3A 3O2MA 1M7NA 3VJNA 4BGGA 5AP7A 3C5UA 3CJFA 3DXNA 1ZWSA 4XG3A 4BDGA 4YO4A 5I3RA 4FIJA 2YIYA 4XG7A 1IG1A 1YOLA 2YDKA 2QOKA 5JGAA 3QTXA 4ZLYA 4P5ZA 4C59A 3ANRA 4KBCA 4Q9ZA 2EVAA 4FSQA 3QBNA 5KMMA 4AT3A 3CGFA 2OH4A 5AUXA 5CAVA 1CDKA 3BHVA 3JVSA 1DAWA 5CI7A 2XIKA 4O2PA 4RX8A 2OXDA 5AP0A 3RMFA 3ZRLA 5D10A 4JR7A 3UODA 3A7JA 2XRWA 5JMSA 2XP2A 4G5JA 5C4LA 2CGWA 3D83A 5J7HA 1LPUA 1IR3A 4FV4A 5M53A 4ZY5A 4FTQA 3A7IA 1GY3A 3POOA 3IW8A 4FKVA 4XG6A 2C5NA 4D2RA 4D2SA 3HMMA 1H00A 4O0XA 1VYWA 5J7BA 3IG7A 4E5AX 5LQFA 3IGGA 4J8MA 4EEVA 2YAKA 4FSTA 4MBIA 5FTOA 3TJDA 4RC3A 5EI6A 2OO8X 3O50A 4WT6A 3S00A 4TWOA 3FI8A 5AFVA 4MTAA 1IAHA 4KBKA 3DAEA 4ASEA 3U4WA 2QHNA 2WIPA 3VUHA 3ZC6A 4G3GA 5HX6A 3TV7A 5H2UA 2KTYA 4L67A 4RWJA 4EBVA 2RIOA 4N4SA 4EKKA 4PTCA 3Q9XA 2G1TA 2W96B 3P86A 1ERKA 4X2FA 2E9OA 2YDIA 2LGCA 2JFLA 3RHXA 1EH4A 4NIFB 1U59A 4WSYA 2O3PA 3PFQA 3VBQA 3QX4A 3QA8A 2XKDA 2V7AA 2XIRA 3RKBA 2YCRA 4OTHA 4ZTLA 4S33A 2YACA 2BKZA 2OJ9A 4IX5A 5DEYA 5JRQA 5HI2A 2PUIA 4RIYB 5CF6A 2ZV7A 2B9HA 2Y4IC 4GRBA 5EYKA 1SMHA 3TUCA 3A8WA 3G15A 3R8LA 4JAIA 4YZDA 1OUKA 1K9AA 5HBHA 2X0GA 4D4YA 3BE9A 3UP7A 2NNWB 4K1BA 2IZTA 4PNIA 3DQXA 5AP1A 3I7BA 5FM3A 4AGUA 4B4LA 4JVGA 4FT0A 4E5WA 2YIRA 4ZAUA 4MXZA 4NW6A 1YXXA 3E87A 5FBOA 3V6SA 3NIZA 1XH7A 3ZTXA 5M51A 4BCNA 2BALA 3UOLA 2OI4X 4J99A 5C27A 1XH5A 4PTGA 1KE9A 2VGOA 3OROA 4UWBA 4QMLA 2IZSA 2XB7A 3O7LD 4TWCA 4CFVA 4EH9A 3E92A 4U6RA 3HL7A 3UBDA 1XBCA 4C4FA 3ENMA 4KAOA 3CD8A 5B2KA 4C37A 4A4OA 2CLQA 3R63A 3QTZA 3LCTA 4OTWA 1ATPE 2FGIA 3LPBA 2OJFE 3WYYA 3ZO2A 4E7WA 5BUEA 2QU5A 4IACA 3FV8A 3O17A 5CAPA 2VN9A 4FF8A 3PXFA 4IB3A 1OPJA 5GJFA 3BCEA 1URCA 3MFTA 4QTCA 4U79A 5DN3A 3WYXA 4C3FA 4ZJVA 2Y8OA 1WVYA 4C35A 4LQMA 5CU6A 4KWPA 4FEVA 1QL6A 3H0ZA 4GFGA 2YZAA 2C47A 4DH1A 3UYTA 4ZSGA 3R7OA 2VTPA 3N4TA 5DH3A 4CMTA 3MYGA 2CN8A 2O8YA 4QYEA 3SLSA 4EK3A 5JGBA 2Z8CA 3FYKX 3FXWA 3EN6A 3R1NA 5CLPA 4OAUC 3AGLA 4J8NA 4ENXA 3C4WA 3DAKA 4ACCA 2CNVA 2HYYA 4K8AA 3C5IA 1H07A 4G6LA 2R9SA 4AOJA 5CZIA 3ID6C 4KA3A 2QHMA 3OD6X 5A14A 5HIEA 3HMIA 3MGYA 3NUUA 4PRJA 3G0FA 3LKMA 3U55A 2HAKA 3W2PA 5KMOA 5E9EA 2YCFA 2EXCX 4YGAA 2YERA 4BI1A 5JRSA 3QXPA 4K18A 3R8MA 4Z55A 3R7IA 4DH5A 2F2CB 3ORTA 4QMXA 3SGCA 1OL7A 2O5KA 5HKMA 3GT8A 3QGYA 4FIHA 1PY5A 4TKSA 5BMMA 2BIKB 4JQEA 3GCUA 4O22A 3R7GA 3PY1A 4MNFA 5ANOA 2PVLA 5E8YA 4O38A 4BDAA 2CSNA 3Q9WA 5IQGA 2X8IA 3HMPA 4TW9A 4XOZA 1R0EA 3F3UA 3I7CA 3TN8A 1CMKE 3G9LX 3GFWA 5CEIA 4FL3A 1XBBA 2XBJA 1U54B 3OTUA 2BAJA 4BIEA 3LXKA 4GG7A 4HVDA 3UQGA 5JT2A 3CTQA 3MBLA 1L8TA 4WBBB 4R3CA 4DEDA 3DDQA 2JBPA 3ROYA 2YM5A 3KGAA 3SD0A 1Q4LA 1E9HA 4BYJA 5TKDA 5GZAA 5CXZA 3UC4A 3EHAA 4F0FA 1SVHA 1NVSA 3OCBA 3EQCA 4BZNA 1J7LA 2R3GA 3R30A 3UVRA 4YPDA 3NAXA 4XOYA 2CKQA 4ID7A 2QKWB 1YDSE 4NM5A 4L6QA 3MVMA 4RFZA 3TXOA 1PHKA 2IVVA 4NYEA 5K5NA 2GNLA 4C7TA 4UYAA 3P79A 3GOKA 4ZTMA 3PJ8A 4KB8A 1XWSA 2C3IB 4ASXA 2BZKB 4DGOA 3N4VA 4IX4A 2RKUA 3MPTA 3RCJA 2DS1A 1YI4A 4ITIA 5CU4A 3QCSA 4JR3A 3L8XA 4V0GA 2C30A 1BYGA 4FEXA 2OIDA 1SZMA 4L01A 4F1TA 5M55A 5IQDA 3DB8A 4QMMA 1H25A 1Q41A 4FZAB 4ZIMA 4AN2A 3POZA 5J5TA 2W7XA 3BHUA 3NEWA 4FTAA 1Q8TA 2RFDA 3BQCA 3UIXA 2PL0A 2SRCA 2VTOA 4BDHA 4EOMA 5LVOA 3FPQA 3Q4UA 3KFAA 4IX6A 4C0TA 1SVEA 3UMXA 4W4XA 5BVNA 3FMEA 5KBRA 4FX3A 2VWWA 3L8SA 2E9NA 4J53A 5DE2A 2W99B 3I79A 3MN3A 3OCSA 2BFXA 3BZ3A 5FXSA 4A07A 3W32A 2XK7A 3R1QA 2WMXA 5GHVA 3NIEA 2ITVA 3KB7A 4XP0A 1YDTE 4WBOA 5CS6A 4M84A 2UW9A 5ANJA 5E8VA 5HNGA 5IH5A 2BRBA 2VWUA 2VZ6A 4AN3A 4AXAA 2XKFA 4FI1A 5HICA 1H1PA 4O6LA 1LEWA 3C4XA 4IAZA 4PL4A 2OXYA 5JFWA 1ZOHA 4G9RA 1J1CA 3EKNA 3NZ0A 4FSMA 3LFQA 1FQ1B 5CASA 3HYHA 2JDTA 3EN9A 3P4KA 4M97A 4MQ2A 4O1PA 4EHVA 3K54A 4W8DA 4Y5QA 4I1ZA 2WMTA 5D11A 4D5HA 3U6IA 3R22A 2VD5A 1XBAA 5DLSA 5C8KA 5T68A 5AWMA 3DBDA 3AD4A 3QRJA 2AC3A 1GNGA 4O0YA 3MIAA 3RM6A 3MH1A 4XBRA 3RNYA 3ORNA 3K3JA 3NWWA 4BR3A 1WBVA 2GQRA 3Q2JA 2Z7RA 3D5UA 5DT0A 4LRMA 4RIOA 3UVQA 2QKRA 4O86A 3GCQA 1W7HA 3P5KA 1Y6BA 2CJMA 3H4JA 3MV5A 4ZSJA 3FWQA 3MFUA 3PSBA 4KRDA 5D41A 4HW7A 2XIXA 4CKIA 1H1SA 4ITJA 4U43A 2PZ5A 3GENA 2OZOA 4A9UA 2QODA 4KIPA 4RFYA 4U97A 3QZIA 2W1GA 4FT3A 1ZARA 5LJJA 2WTKC 4U7ZA 4RMZA 3VULA 4CVAA 5DRBA 3D5WA 2XNMA 4I0SA 4FSWA 3NNUA 4DEHA 2BMCA 3P0MA 4RJ6A 3VUKA 3A99A 3PXRA 4DC2A 3P7AA 2HW6A 4LFIA 5BVKA 1NT2A 4I6FA 2LAVA 2UZUE 3I5ZA 5TO8A 2B9IA 2GU8A 4G3EA 1YVJA 4K6ZA 1IA8A 1B39A 2EU9A 4M0YA 5AUTA 5I0BA 5HU3A 5KHXA 1FVVA 3G6GA 5HOAA 3SVVA 4KIKA 2QVSE 4QD6A 4GU9A 5DEWA 3BI6A 1OL6A 4L46A 1REKA 2R3FA 5EHLA 3QA0A 3FLZA 4ARKA 3R9DA 4CMUA 4O81A 2W05A 4BI2A 2IW8A 4I41A 4QQJA 3PVBA 5DPVA 1GJOA 2R3KA 4IVCA 3TL8A 4CV8A 2OWBA 3PJCA 3FDNA 3PXYA 5K9IA 5ANGA 3MH0A 3RNIA 3QCYA 4D2VA 3E8CA 3HV6A 4G17A 3PVUA 4PDOA 2XNOA 2RFSA 5DHJA 4XUFA 3OTVA 3ZC5A 2Z7QA 4FVRA 2E9VA 5JGDA 5M4IA 3DBFA 4L8MA 3LW0A 1UWJA 3PG1A 3A4OX 5LMKC 4O84A 2H8HA 2FSTX 3FLNC 4TT7A 1ZXEA 3E8DA 4CT2A 5IQCA 4QPSA 2XNPA 3R04A 3Q2MA 3AD5A 3O23A 1U5RA 2OIQA 2R3HA 5E8UA 5JH6A 1IAJA 2ACXA 1PMUA 4AOIA 1ZYSA 4ZS0A 3E62A 2Q0NA 3QLFA 2QI8A 2UZDA 4QO9A 4B6LA 4AU8A 2X8EA 4FZDB 1MRYA 4O0RA 4WHZA 1FGIA 1OKZA 2UW5A 3BYUA 4BBEA 5KBQA 4FTRA 3ELJA 2FB8A 4I4FA 4FTUA 3PXKA 2BRMA 2UV2A 3G0EA 4PPCA 4NTSA 3NYOA 2GFCA 3ULIA 1TQPA 4F08A 4PUZA 3U9NA 4E6DA 4M66A 3F82A 4JRNA 4FIIA 2R3QA 3S0OA 5M4UA 4YTIA 3CTJA 2HY81 2WTIA 1OPKA 2WMVA 3FKNA 4F63A 2ERKA 2GQGA 4I3ZA 5EQPA 3ZRMA 2PE1A 4XBUA 5FEEA 3R83A 3PLAE 3KCFA 4QP3A 2XS0A 3G5DA 5AP3A 5AIRA 4BCQA 4DAWA 5CEQA 4D0WA 1F0QA 3UNKA 4YJPA 4XV1A 3TDWA 3AD6A 3F9NA 4RIYA 4WNOA 3HDMA 3SC1A 4AZSA 4FSUA 4WRGA 4HNFA 2C5XA 3GCSA 2PUNA 2C5OA 4AZEA 4UMRA 4H58A 2WAJA 3WE4A 4L44A 5CEOA 4ASZA 2VWIA 3DZOA 3EQFA 3QL8A 3OEZA 5DT4A 3ZDIA 2VWVA 4TYGA 1H08A 1WVWA 4O0VA 4O6EA 5EHYA 1MUOA 3S2PA 2J0MB 2JGZA 4IZ7A 4RWIA 4OLIA 1P4OA 4FT7A 3TTIA 4F4PA 2KULA 3PTGA 3SKCA 2J5EA 1CKJA 1BL7A 4EHGA 5L8KA 5ETAA 1XQZA 4HYSA 3Q9YA 2XJ2A 3O96A 3PA4A 3V5TA 1Z57A 4MD8E 5AUYA 1DI8A 3F3ZA 5TOZA 1M14A 2BZHB 4A4LA 5IUGA 4O7YA 4HPUE 3KA0A 4KIOA 2F49A 2WOUA 3Q9ZA 3GC8A 4WRSA 4C36A 4E4XA 2JEDA 4U9AA 3VBVA 3ZO3A 2X8DA 5HNIX 4L3JA 5IH6A 3I4BA 3WOWA 3A62A 4U42A 2XYUA 2E9PA 4IAFA 4F7LA 2YLEA 5C9CA 4EK6A 1KV2A 3FMMA 4YHTA 3VS6A 3NSZA 1OITA 4GVJA 4BC6A 2YABA 3BHYA 5DMZA 4ZSAA 3TUDA 4BWXA 2X7OA 3R6XA 2J50A 2VV9A 2C5VA 4YJOA 1OL5A 4E8AA 3BBWA 1VYZA 2UW0A 2VO6A 4CZYB 3TG1A 4L7SA 5EDRA 2CGXA 4G3CA 3BLRA 3HMNA 2C6MA 4O0UA 4XHKB 5DR9A 4QYYA 4OW8A 4JLCA 4OUCA 1IEPA 1ZLTA 1APME 2C3LA 2CDZA 3QU0A 5F1ZA 5CI6A 5BVWA 3SXSA 2YZLA 3BQRA 3KQ7A 4DFYA 4PL3A 2ZV8A 3FC2A 3QQLA 4V04A 3MVJA 4CRLA 4Y46A 2JD5A 1WBSA 4IH8A 3BV3A 2XJ1A 3NR9A 4NFNA 5A4TA 3D2IA 4L43A 4RA4A 4HPTE 4QYHA 2W1EA 4L3LA 5BVFA 3PJ3A 4TZRA 4KKEA 2UW7A 4R1YA 3VO3A 4CTBA 4RJ8A 2VTQA 4DCEA 3P7BA 3UGCA 3JVRA 4XG8A 4U3ZA 3BYMA 1WBWA 4KS7A 4MEDA 3ORIA 2R3OA 3BHTA 4NJ3A 4OTRA 2NRYA 5JFSA 3NW5A 2J9MA 3P9JA 2HWPA 4ZEGA 1J3HA 1SM2A 4DFNA 3WI6A 3H9RA 1YXTA 3PIZA 4U45A 4QMUA 4XNEA 5JZJA 2ZM3A 4WO5A 2OIBA 1QPJA 4R7IA 5L6OA 4ZZMA 5IQEA 2QR7A 1U4DA 3HMOA 4I92A 4ZY6A 3ZM4A 4F6UA 2XA4A 4RX9A 4QTDA 2JDSA 3SV0A 4BZOA 1M7QA 4IVAA 3R9HA 3D14A 3D5VA 4APPA 2PUPA 4LMUA 4I5HA 3UOKA 4FSYA 4ANLA 2C5YA 5CNNA 2CCIA 4X3FB 2CN5A 3L9LA 1DS5A 1W0XC 2WTCA 1PMVA 1QPDA 2W9FB 3ZOSA 2QD9A 4R5YA 4BIDA 3DV3A 3U4UA 4UMUA 3EB0A 5A4LA 4GK3A 5KMNA 3KULA 3D0EA 2JIIA 1NW1A 1P5EA 1GIHA 4N70A 4RA5A 3WZEA 4F7JA 2BPMA 3ANQA 3GCPA 2OICA 3IECA 3ZLSA 3E3BX 2HENA 4EJNA 2WNTA 4OT5A 3NUPA 3HRCA 3PZHA 1W98A 4C57A 1JLUE 2ESMA 3H10A 3R00A 3I0OA 4TRLA 5IDNA 2XF0A 4F6SA 3RWQA 3PSCA 3TV6A 4PMPA 3C4FA 4RT7A 3R9NA 5M09A 3KL8A 4FKTA 4XV2A 4GKIA 3ZM9A 3B8RA 4P5QA 3W33A 3FLWA 5FM2A 4DF3A 1JVPP 3UC3A 3A61A 1UU9A 3C4EA 5LARA 4QPAA 2IWIA 4MWIA 2QO9A 4IEBA 1BI7A 3OUKA 3W55A 3HV5A 5CEPA 4U44A 3K5VA 1FBNA 4UMQA 3DS6A 4X0MA 3KC3A 5DRDA 5F4NA 3BHHA 2YWVA 4DTBA 4IE9A 4H3PA 1G8SA 1CKIA 2BAQA 3CKWA 3CSVA 2C68A 3LE6A 3PSDA 1OI9A 2A2AA 2X6EA 3LQ8A 3T9IA 4FV6A 4J95A 4G9CA 4Z16A 5HE3A 1OM1A 4F7SA 2UZBA 5KNJA 3IO7A 3NYVA 4M8TA 4RPVA 4Y85A 4FEWA 2IJMA 3UPZA 3ZU7A 4FKGA 4DEBA 2G2FA 4FL1A 4OAVB 3FQHA 2R3IA 4H39A 5CEKA 4I6HA 5C4KA 4GV1A 2PK9A 1H0VA 3ZO4A 3DNDA 3KK8A 4O96A 5GJGA 4D1SA 3QX2A 5HG7A 3I60A 4JIKA 3IOPA 4UMTA 2GFSA 4E3CA 2JKQA 4PMTA 4FV7A 1VZOA 1W82A 1OB3A 2F4JA 5CEMA 3EKKA 4FEQA 3DKCA 5FGKA 4HVIA 4YSMA 4ALVA 3V51A 5BVEA 3GCVA 3QC4A 4FTKA 5CWZA 4CV9A 3O8UA 2GNHA 3O7LB 3OBGA 2YCSA 1E1VA 1TKIA 3CY3A 4FICA 3LQ3A 4USFA 3IS5A 1XHAA 3TV4A 1FGKA 4L42A 4YNEA 5IU2A 3ET7A 4GK4A 4WNPA 5D12A 3N4UA 5EOBA 3TCPA 2WQNA 4H3QA 2EB2A 5EOLA 3QTUA 3DK3A 3TIYA 4YLKA 3HEGA 4C33A 4DN5A 3W18A 5DR6A 2B52A 1H24A 4XYFA 2WO6A 3ORKA 4FKUA 4ACDA 5CU0A 4CRSA 3BIZA 3CBLA 4AGWA 4MNEB 5CNOA 4YTFA 4CFNA 4BCJA 5F9EA 4BYIA 3QD4A 2XIZA 1JQHA 3SRVA 3UMWA 3NMUF 3PA3A 4TWPA 2C0IA 4MXXA 3UIBA 5CU3A 1PXLA 3RJCA 5L3AA 4BDDA 4MXOA 4Q5HA 2GQSA 2BUJA 3Q96A 4DH7A 4A9YA 1Q8YA 2GSFA 5CF8A 4GT3A 2V55A 4F70A 3DAJA 2DWBA 4PV0A 4RVLA 4YZNA 3VS4A 4GT5A 4GG5A 4EOSA 5KMLA 4R77A 2EXMA 5C01A 4ZZNA 3ZLXA 3LFAA 4EH7A 3GFEA 3CE3A 1YRPA 2WQBA 3A7HA 5HTIA 5L2WA 2F2UA 1Y6AA 3MESA 4B9DA 3A60A 3BEGA 3QLGA 4MK0A 4UALA 1CKPA 5DT3A 3NW6A 2ZM1A 4DGGA 1KSWA 1KOBA 5HG5A 3RPYA 5DIAA 1FINA 4O7NA 3A4PA 2QOOA 3DLZA 5EKOA 3DB6A 4EUUA 2GCDA 5GZ8A 2VUWA 2YM6A 2DYLA 3OF0A 2QU6A 3CQWA 3CPCA 1JKTA 3SDJA 4UV0A 3EQPA 5E8TA 4Y73A 5FQDC 1OKVA 2VWBA 3DK7A 3OY3A 3ERKA 4NKSA 5IMXA 3VUDA 4G34A 3UTOA 2FSLX 3HV4A 5EW9A 4N6ZA 3CPBA 3VUMA 3DKOA 1SYKA 3ORPA 4RJ7A 3NYXA 2R0UA 3SX9A 3V3VA 4CMOA 3R2BA 3OS3A 3OWPA 2IPXA 3TNIA 4UZDA 4EHEA 1WBOA 2E9UA 3TKUA 2PMNX 3LCDA 4IM0A 4EI4A 4EH3A 4ZTRA 5AP2A 4HNIA 2XYNA 3LFBA 2JITA 5IDPA 4IFGA 4I6BA 3D2KA 3F5XA 3Q4TA 5DGZA 2W06A 3R7VA 4EUTA 3QZFA 4USEA 3QD3A 3QWJA 2XNGA 4TYEA 4AW1A 3DKFA 5HD7A 3LQ5A 2PMOX 2XCHA 4IANA 5CYIA 2X7GA 4M68A 3R8PA 1IA9A 3AT4A 4WNKA 3TNPC 4L68A 5K0KA 1ZMUA 4DLIA 5J5SA 5LVPA 1FVTA 3VF9A 2PTKA 2UZWE 5EYMA 3D7ZA 5H8BA 4KKHA 4YU2A 2PY3A 2PVMA 2QOBA 4KRCA 1K2PA 4O7LA 3F66A 3KXXA 5IG1A 3ZLWA 3EQBA 4E93A 2XEZA 4W8EA 3COMA 3V5JA 4E20A 4F64A 4XLVA 3OWJA 5I4NA 2NO3A 3OFMA 2BTSA 3QQGA 4LRKA 4IZ5A 4JDIA 4A06A 1ZZ2A 4EKLA 2IN6A 3Q5ZA 3MPMA 1G8AA 5A4EA 2ITXA 4NCTC 3T8OA 2IZUA 2WTDA 4D5KA 3MY1A 4NEUA 2XNBA 3PE2A 3FC1X 3F69A 2BRGA 4F9WA 4FTCA 1P4FA 5AR4A 2IW9A 5M4FA 1YOJA 3FMNA 4P2KA 2F57A 3PVWA 5E91A 4FUXA 3V8SA 3MH2A 4UXLA 4MAOA 2BDFA 2GNIA 4IX3A 2ONLA 3QZGA 2YJRA 3FSKA 3BU3A 4D1XA 5HGIA 2XBAA 2OKRA 2FVDA 3LFNA 3QFVA 2PULA 2HXQA 1RW8A 1BX6A 2REIA 3H0YA 3BX5A 4H05A 4IM3A 1Q8UA 4EC8A 3KMUA 4FV2A 4I4EA 5EDPA 4CNHA 5A6NA 2W4JA 1GAGA 1XH4A 5FP5A 5IQFA 3RK9A 3WF5A 2PPQA 4P7EA 3OY1A 2O65A 2YIQA 3HV7A 3TJCA 5IEXA 1RJBA 3NDMA 3E63A 3QHWA 3MW1A 1ZOEA 2OXXA 2X7FA 2Y4IB 5IKWA 2CLXA 5CAOA 4XS2A 3G90X 4DG3E 1YW2A 5JN2A 1JKLA 2YHVA 4RIXB 4E26A 2IVSA 4YTHA 4I20A 4UB7A 2Y0AA 4GVAA 3UZTA 3HRBA 3TNQB 2VX3A 2C1AA 4BDFA 4IJPA 3ZMMA 3JY0A 3UQFA 3E64A 2RL5A 1GZOA 2BROA 3VUTA 4CYJA 5BX0A 5J9ZA 3MSSA 2WTKB 3L8VA 2OJIA 1FMOE 4MKCA 3FLSA 4JDHA 4ITHA 4S31A 3HNGA 3MS9A 2NRUA 3FZ1A 3NGAA 3ETAA 3H9OA 4AP7A 3SOAA 3R9RA 3GI3A 5EW3A 4EH8A 3DOGA 2VTIA 4EL9A 3QAME 1Y91A 3Q04A 5DG5A 2WGJA 2WQEA 4XV9A 1PJKA 4KINA 4ZSEA 1Y8GA 3IW5A 4M7IA 3TM0A 4YC3A 1UV5A 3UIUA 1CTPE 4AG8A 4I5MA 2W9ZB 4AT4A 4QP6A 4APCA 3FQSA 5HHWA 5LMAA 5EQEA 4UN0C 4RIXA 4JBOA 2WTJA 5J1WA 5HIBA 5E8XA 3CTHA 4NT4A 4FSZA 4QT1A 3KU2A 2PVFA 4PPBA 4YLLA 3II5A 4ZP5A 3UDBA 2XCKA 3ZBFA 2CKEA 4FSRA 3DXPA 4BTFA 2VX1A 1QPEA 3DGKA 3EFJA 3RALA 3TKHA 5ANDA 1YWNA 5EFQA 4JNWA 4YMJA 3UQCA 2ZYBA 4FG9A 4CEGA 4CFXA 4DFZE 4R3RA 4PPAA 2YFXA 3MTLA 4L3PA 4RC4A 4ANQA 3C1XA 5AJQA 4QNAA 2GTNA 4HGTA 3WE8A 2YM4A 2WU7A 3D9VA 1GOLA 5KCVA 3NUAA 1H0WA 2JKOA 2Q0BA 4LUDA 3KXNA 3PPJA 5EI8A 2BFYA 4F09A 5EKNA 4E4MA 1B38A 4FGBA 4PL5A 2Q83A 3ODZX 4BTKA 5AUUA 3DLSA 4GJ2A 3PWYA 4GUEA 5HE1A 2HXLA 4MXAA 2IVUA 2PZRA 3AMYA 4UMPA 4YJQA 2G2IA 4LGHA 1IASA 4AZVA 5FEDA 4EHZA 5FEQA 3ZFYA 4JQ8A 2CKPA 4BKYA 3GQIA 5K4JA 2JKMA 4D4VA 5ANIA 4ASDA 4YZCA 1ZRZA 4JG7A 4TY1A 5A3XA 4CLIA 4D55A 3PJ1A 1J91A 1U5QA 4FV1A 3ALOA 1H1RA 3CD3A 3LFCA 4IQ6A 3AMAA 4IAIA 3FMKA 3ZS5A 4OTGA 3PDTA 1OL1A 3COIA 4JS8A 4S30A 4YJRA 4G6OA 3REPA 1GZKA 5KKRC 3Q6WA 4AE9A 3I6WA 3Q5IA 3S95A 3U87A 2I7QA 2XVDA 3GC7A 3KULB 4ACMA 5K0XA 3SW7A 3QTWA 4NFMA 4LMNA 4QQTA 4J96A 4J71A 5IA1A 4QP8A 1BMKA 3OXTA 4YPSA 4NUSA 4G31A 2W4OA 5C8MA 1VEBA 2YEXA 4GEOA 4BGQA 5CT7A 3MFSA 3D94A 4H1MA 3JYAA 3AXWA 3C0IA 5AX3A 3C13A 4BKJA 3F5GA 1UU3A 2WQOA 3HUBA 5FBNC 3VHEA 3TI1A 4UWCA 3H3CA 5IQAA 5DA3A 3B2TA 3BEAA 5HTBA 2VO7A 4ZLZA 4NM7A 4K0YA 4ANBA 4O7ZA 1ZYCA 4CFFA 3NNVA 4XG4A 4IFCA 4X7QA 4E4LA 3F3TA 3DFCB 3FI4A 5ACKA 4CD0A 4EZ3A 2PZYA 4ANSA 3R1SA 4E4NA 3CIKA 4IC8A 2R3NA 4GCJA 2FSOX 4IAKA 1YXVA 2J51A 3Q52A 4HZSA 2GS6A 4OGRA 2PVHA 1JOWB 3EFLA 2VRXA 3LJ2A 5HG8A 3RAHA 3FSFA 3I5NA 1WAKA 3IDCA 2XMYA 4O91A 5KMIA 3HX4A 1XJDA 4AFEA 3DTCA 4MD9E 2I0VA 3TKIA 4RG0A 4CKJA 3QQJA 1A48A 3RCDA 4FA2A 3KK9A 4NM0A 5E1SA 3RK7A 1OL2A 3F2AA 3QRTA 2XRUA 4QMSA 4ZTNA 2CKOA 5CSXA 5HZNA 2OBJA 4HGEA 2JLDA 3PP1A 2WHBA 2QQ7A 3VS3A 4ACHA 3Q4CA 3PPKA 4M14A 3V01A 2YIXA 4O83A 3GQLA 3W2SA 2RG5A 2XJ0A 4RSSA 3FPMA 5CQWA 3FMHA 5HTCA 4L00A 2JBOA 4HGSA 4RQVA 5HVKA 4JT3A 2OF4A 1Q24A 4JXFA 5L8JA 4MHAA 5IA4A 2CPKE 3LCOA 3VQHA 1VR2A 2RG6A 2X9EA 3FY0A 4TNDA 4BHNA 4AA5A 4N6YA 5HU9A 2W1HA 4XV3A 4XRJA 4IJ9A 4BBFA 2H6DA 1SVGA 4TN6A 2YIWA 3LM5A 2JIVA 3MH3A 4U40A 2QLUA 3CKXA 4AW5A 4BDIA 2PYWA 1OMWA 3C4CA 3ORMA 2YISA 5J95A 2OK1A 4I94A 2R3MA 5CSWA 3PE1A 4OBQA 4KUJA 3LIJA 4YJUA 5H8EA 2QONA 4BVUA 1YQJA 2A1AB 3RZBA 5E7RA 3CQUA 5AA9A 2UW8A 3DU8A 4KIKB 5T6KA 2OLCA 3DA6A 4QTEA 5K4IA 4II5A 3KRLA 3R73A 2GDOA 4GFMA 4NSTA 3DFAA 1P2AA 1H1WA 3BU5A 3RM7A 4ZY4A 4I5PA 3DZQA 5ITAA 3AT3A 3C51A 3QGWA 3FKLA 5HO7A 4K33A 4R7BA 3CS9A 4PDYA 3NCGA 4RZVA 4EOQA 2GS7A 4KIQA 3EN7A 5IMEA 4YJTA 4G3FA 2VTHA 1I09A 5DYJA 1TQIA 3EOCA 5KUPA 2WMSA 3UG1A 2E2BA 5IPJA 3FEGA 3R7EA 3G33A 4RZWA 5A6OA 5J9YA 1CSNA 4C3PA 3C7QA 4U81A 4DFXE 3I1AA 2P55A 2UW3A 3MVHA 2GMXA 4YJSA 4JOAA 4FUYA 2BILB 5AV4A 2I40A 3LJ0A 5JQ8A 1KV1A 2VTRA 2WQMA 4BCFA 1ZY4A 4FTLA 4X21A 4HGLA 5M44A 3IPHA 3LCSA 1H1QA 2HWOA 4ONAA 3LMIA 3ACJA 2C6TA 5HG9A 3CEKA 4NCTA 4FKWA 5IA5A 2Y6MA 3TEIA 2A0CX 2QCSA 4BB4A 4EK5A 2R3PA 1DI9A 1HOWA 5IQHA 1YXUA 5BYZA 3IONA 4AF3A 3QC9A 3SXRA 2FYSA 4BI0A 4EYMA 5CSVA 3FI3A 3NW7A 3DBQA 5CALA 1V0OA 3GU8A 2X2KA 4J52A 5JFVA 4JDJA 4ACGA 4KKGA 4FMQA 5LVLA 1IRKA 4QP9A 3RBWA 2VWYA 4QPMA 4NL0A 3O8PA 1V0PA 3CLYA 3LHJA 4BRXA 1V1KA 2JDRA 1JBPE 5D7VA 5AR3A 1AD5A 1RE8A 5TR6A 4MCVA 3MI9A 3PA5A 4Q5EA 2HK5A 3PVGA 4IWPA 3F88A 4D4RA 4FK6A 2YLFA 1M2RA 2G15A 4EWHA 3G51A 3W16A 4RX5A 4DE4A 1M2QA 4AAAA 5AEPA 5KX8A 5AX9A 3AC3A 4L45A 3JS2A 5FLFA 4C4JA 3E8EA 3R0TA 4OR5A 3WIGA 3CCNA 3ORLA 2PMIA 2W1DA 2HOGA 3A7GA 4FNXA 2VU3A 5HLNA 3JXWA 4LL0A 1LP4A 1U46A 1KE5A 4DTKA 3AT2A 3V5LA 4GK2A 4MWHA 2ZAZA 3FZSA 5D9HA 5IZFA 4BY9E 4TL0A 3DBEA 4E1ZA 5H8GA 1G5SA 5CENA 1UNHA 3R8VA 3WZDA 3DTWA 4JQ7A 3TZ9A 4AQCA 4C58A 5B0XA 2P0CA 3L9NA 4E6AA 3K2LA 4F1MA 2JC6A 3ACKA 1MRUA 1FMKA 5DR2A 4GMYA 3DJ6A 2P33A 4NTTA 4HJOA 2G01A 2VGPA 2QOCA 2OSCA 5IQIA 3IW4A 3O51A 4FTIA 4GUBA 3KN6A 4IZYA 3PY0A 3FY2A 5LVMA 2B9JA 3QTSA 4MF0A 3T3UA 2OH0E 3FL5A 2QO7A 3BGQA 2BVAA 4ENYA 4HCTA 5F94A 4LUEA 4FBXA 5EI2A 1UU8A 4E6QA 3U51A 4DH3A 1XO2B 2XK3A 4PDPA 2WEVA 3GBZA 2CGUA 4JL9A 3LFSA 4X3FC 4D9UA 3V8TA 4EQMA 5M57A 4E6CA 3L1SA 4EYJA 2YM8A 3D4QA 4PWNA 3IQ7A 1JNKA 1S9JA 2JDOA 5L2IA 2CMWA 4IW0A 1F3MC 2B55A 4QP2A 5CF4A 5AR2A 2YWPA 2X4FA 3RPVA 4YZBA 3UOJA 1Q8ZA 3VN9A 5K3YA 2GHGA 2BRHA 2VWZA 2YITA 3Q4ZA 3CR0A 4QYGA 4QMZA 2FA2A 3TNWA 4FE2A 4A7CA 4RWLA 5AR8A 4B99A 4HYIA 2CNUA 3EZVA 1MP8A 3BBTB 4AE6A 3HAVA 2C4GA 5FP6A 4ZXTA 2WFYA 2BDWA 2CHLA 5HBEA 4A4XA 4C4HA
chains in the Genus database with same CATH superfamily
1SNXA 3LXLA 5JSMA 1UA2A 3GVUA 4IMYA 1U54A 2VO3A 5LMKA 2ITUA 1MRVA 3OXIA 3P1AA 4Y5HA 4D2TA 4KSPA 5DI1A 2J0LA 1F5QA 3C4ZA 3HVCA 3P78A 3EL8A 4IWQA 4PF4A 5E4HA 4FR4A 2VX0A 3HECA 3R1YA 1Q5KA 1KUTA 2X2LA 4DGMA 2B0QA 4YZ9A 4FL2A 4AUAA 5EM8A 2PSQA 2F7XE 3OCTA 5HESA 3GOPA 5HO8A 2PE0A 5A46A 4RBLA 2GHMA 4FVQA 4I24A 4BDBA 4AT5A 2ERZE 3B8QA 4EORA 3DJ5A 3W8QA 2GTMA 2UVZA 1PMNA 3LOKA 1OUYA 3BV2A 4W4WA 2C6LA 3KREA 4D4SA 1ZY5A 2QO2A 4FNWA 3ODYX 4F7NA 5HX8A 3Q53A 2Z60A 3QUEA 5M4CA 4NKAA 4KNBA 4D1ZA 1WVXA 3GNIB 3PY3A 4W9XA 3E88A 2IVTA 3U6HA 4ZSLA 4BDEA 3KVXA 2NP8A 3VS7A 3NLBA 2AYPA 3WZUA 1OVEA 3AGMA 1CM8A 4C4EA 4BCIA 4BKZA 4ZZOA 1DAYA 1NY3A 4QQCA 4RJ4A 1UU7A 3R9OA 3FMDA 5IEVA 3COKA 3CQEA 5CZHA 5CVFA 4X2KA 4EZ5A 5FDPA 1OKWA 4FK3A 4M69B 4L52A 4WSQA 4L7FA 4MH7A 3R7UA 5G1XA 3PIXA 4IWOA 4YC8A 2PE2A 3ZUUA 4YR8A 5ANKA 4Z3VA 4O4CA 1XR1A 1YDRE 1NVQA 3DJ7A 4HCVA 4EOLA 2ETMA 3S1HA 4UX9A 4DGNA 4BGHA 2X2MA 2BKKA 3NVKI 2UZLA 4N0SA 3ULZA 2J6MA 4XRLA 3UNZA 3VUIA 5J8IA 5L2TA 4FRFA 4CZTA 3HA6A 3HAMA 2OFUA 3BELA 3EJ1A 5LWNA 5G6VA 3EZRA 3QRIA 3MY0A 5AV2A 2XEYA 1XKKA 1OBGA 4EC9A 3C9WA 4CFUA 2R7BA 2CGVA 2X81A 1I44A 1XH6A 2XM9A 3F3VA 4M3QA 5CY3A 1YHWA 3OHTA 2R3JA 3VBWA 3K5UA 5KZ0A 2ITOA 5IA2A 1YI3A 4BTJA 1FOTA 3HP2A 2C0TA 2VTJA 4JBPA 4LOPA 4YBJA 3E93A 5CVGA 4AWIA 5IA0A 4CGAA 4U80A 1E1XA 4RLKA 3ORXA 4MNEA 3QUDA 5AV3A 4TYIA 4NK9A 2P3GX 3FYJX 2PVKA 2O0UA 2C6IA 4USDA 3MJ1A 1OECA 4I0TA 1Y8YA 2ZB1A 2RGPA 2YAAA 2XK9A 3A7FA 5FWKK 2IG7A 5BNJA 3OEFX 2GNJA 4ZJJA 3SHEA 1RDQE 3E5AA 3DDPA 3FAAA 2C1BA 2ITQA 2O63A 5EHOA 4AS0A 3F2NA 5IF1A 2GNFA 2QR8A 5I9UA 3W2RA 1UNLA 1JWHA 1PXPA 2XUUA 2Z7LA 1OGUA 4LI5A 5AM6A 3ZDUA 4I21A 4A9TA 4AFJA 1NA7A 1JSTA 3ZEWA 3QQKA 3OW3A 4DFLA 2V62A 3P23A 5GIOE 3DT1A 5FTGA 2XNEA 2C6EA 5ICPA 3BGZA 2JFMA 3DQWA 5K5XA 3W0QA 4ZMFA 3LLAA 3PIYA 1OIRA 5HCYA 3R01A 3RI1A 3T3VA 3VS1A 4CQGA 5CANA 2RF9A 4S32A 5E90A 4ZS4A 5I3OA 4YNOA 4B0GA 4B8MA 3QUPA 2W1ZA 1Q3WA 3COHA 4FV8A 3GC9A 4WUAA 3VJOA 4AOTA 3OWLA 4ERWA 5CSPA 4DEEA 4GS6A 1MQBA 3WILA 2OJGA 5J9LA 3QWKA 4BBMA 3R8ZA 4V05A 3MWUA 5EQYA 5L6PA 4ZTHA 5BVOA 1ZYDA 1OZ1A 4NZWB 4FKPA 4LL5A 1UKHA 2FH9A 2ITNA 2PZIA 4OTDA 3VW6A 3W2CA 3Q3BA 4CQEA 2C3KA 2WU6A 3PXZA 3BGPA 2BCJA 3QYZA 4O7TA 4AZTA 1WBPA 3KRWA 3RTPA 5L8LA 4CSVA 2J0KA 4FKOA 4BHZA 4N57A 3OT3A 3Q60A 3QHRA 2J90A 5AMNA 2X9FA 2F7EE 4S2ZA 3ZZEA 4EJ7A 4XH6A 1JAMA 3H30A 3PP0A 4M12A 4M67A 4LG4A 4W4VA 3O71A 3RPSA 3WBLA 4Y95A 4AW0A 4JIAA 2XM8A 2QG5A 5T3QA 2PUUA 5C1QB 3TZ8A 1TQMA 5LWMA 4FV3A 4CG9A 4I23A 4WKQA 5A4QA 4IVDA 2ZMDA 3EQDA 2FO0A 3WF7A 4QDVA 3D15A 4U5JA 2C6OA 2OU7A 2OZAA 1JSUA 1QPCA 3AC5A 5KZIA 5JEBA 2HZ0A 5CSHA 5B2LA 4XG9A 2ZJWA 5H3QA 4MYGA 3F3WA 5C8NA 3UP2A 4L53A 3QQUA 1OBDA 4FKQA 2X39A 2VTAA 4FV0A 5ANEA 3UG2A 4EWQA 5I5ZA 3FJQE 4IVBA 4DA5A 3VONA 4C61A 5C26A 3ZBXA 4C2WA 4CKRA 3NPCA 4PQNA 3BWJA 4PY1A 4WA9A 3VBYA 2WOTA 3UNJA 1RQQA 4EH5A 1XMMA 2PMLX 4JX3A 3ZUTA 4FT9A 3E7VA 4F9BA 3KXGA 3HDNA 4E73A 3ZXZA 3R7YA 3NCZA 3ATSA 4EQCA 2BDJA 2F9GA 4O1OA 3F2RA 2W17A 4DGLC 3VS2A 1Z9XA 5BUIA 4EZ7A 5KMKA 5I9ZA 3TZ7A 3QRKA 2P2HA 5HD4A 4KABA 4O0TA 5EW8A 3CJGA 4ZJIA 4HVGA 4FT5A 1V0BA 4ZOGA 2XANA 3U54A 3DCVA 4M15A 3AC2A 5FD2A 3TTJA 3L8PA 3ORZA 4I6LA 3EMGA 5CVHA 4R8QA 3UIMA 2YN8A 4IXPA 4CXAA 3RHKA 1G3NA 5B2MA 5KKRB 5LCJA 1PKGA 3UVPA 3NAYA 3MY5A 4PP9A 3B2WA 3BKBA 4OTIA 3FXZA 4FNYA 4GT4A 5LCKA 1YOMA 5J1VA 4DFBA 4QMVA 3F5UA 4BDKA 2ETKA 3AOXA 4IB0A 3BYSA 4TTHB 4QMYA 4X2NA 3TZMA 4UY9A 4BCHA 2QOHA 3QZHA 4M13A 1AQ1A 2YCQA 1GIJA 1H27A 4JI9A 2R7IA 5EH0A 4C8BA 2FSMX 4EH2A 2ITWA 2YM7A 3FZPA 5AUZA 3ZONA 4DDIA 4O0WA 4AGDA 4XEYA 4Z7HA 5IISA 4ZK5A 5FXQA 4J97A 4GW8A 4YBKA 3FLQA 5E92A 2WB8A 2BHEA 3JUHA 4WOVA 3KEXA 3D5XA 4BDJA 3GP0A 3O0GA 5LVNA 4RRVA 4QTAA 1SNUA 4F0IA 3NUYA 5DVRA 5JZNA 5J79A 4TYHA 1ND4A 2BTRA 1WBTA 4Y83A 1M52A 3UJGA 1R0PA 3OW4A 4KS8A 2VTTA 3EYHA 4V01A 3VIDA 3VF8A 5M06A 1L3RE 2QNJA 1W84A 5BYYA 3C0HA 3RGFA 3F6XA 5AM7A 2IZRA 4FG7A 1DM2A 2ZV2A 2R4BA 3PRFA 4DFUA 3QYWA 4P90A 3ZCLA 2UZEA 3F7ZA 4RJ5A 4R5SA 3QKKA 4BICA 3LMHA 3FQEA 2BZJA 2R0IA 3BYOA 4O21A 1S9IA 4FIEA 3BLQA 3BU6A 3GU6A 4EONA 4FKRA 2HZ4A 4GU6A 1Q97A 3QTIA 3OBJA 2V7OA 1OGYA 2HZIA 4F65A 2Y9QA 3KMWA 4JBVA 4PX6A 2OG8A 4FZ6A 2BR1A 2F7ZE 4DEGA 4UEUA 5GNKA 1FVRA 4PP7A 1A9UA 4FTMA 4ZTSA 1O6LA 4AXDA 4C2VA 1ZZLA 3QRUA 5ETCA 2JAVA 4BTMA 4MX9A 4UYNA 4X3JA 3IW7A 1J7IA 2PZPA 1WBNA 2I1MA 4FKSA 4LYNA 4QMPA 4RGJA 3F61A 3QCXA 4I22A 3FBVA 4RIWA 4YC6A 4XP3A 3SQQA 5EYCA 4DBNA 2B4SB 4TNBA 4CFMA 4DDGA 3QKLA 4MXYA 3HV3A 1PKDA 3L9PA 4Y8DA 5I9WA 3LXNA 4O7RA 2OZAB 4ANOA 3UO5A 5AAGA 3FL4A 4GIIA 5BV3A 4CT1A 4FYOA 2Z7SA 3AC1A 2WMAA 5HVJA 1O9UA 4HCUA 2G2HA 2VTMA 3EFKA 4NM3A 4IB1A 3AKJA 5DBXA 3GC0A 1KE8A 3LJ1A 4DTAA 1OIUA 2P2IA 4UXQA 2QOLA 5EYDA 4YJVA 4OTPA 4AZWA 1ZYJA 5HLPA 3RAWA 5IUHA 5J87A 4FGRA 4J1RA 1PW2A 3KY2A 4QMWA 4BF2A 3JR1A 3P5JC 3EN5A 4BL1A 4ZTQA 4E5BA 4HVHA 4RVMA 2IO6A 1PYEA 2ITYA 3QTQA 5CU2A 4FOCA 3W2OA 3WZJA 3RK5A 2C0OA 5BQ0A 5HQ0A 1BL6A 3PUPA 3PZEA 3Q6UA 5CXHA 1YWRA 2H9VA 4YLJA 4D58A 2VNYA 4YUQA 3CY2A 3MA6A 3UOHA 3CXWA 3ZH8A 1XMLA 4LOQA 3NNWA 3W2QA 4Z9LA 2ZMCA 5KE0A 5FXRA 2I6LA 4BIBA 1K3AA 1JKSA 4OTFA 4HYHA 2W5BA 2QOQA 4H1JA 4F99A 2XK6A 3OUNB 5GIPE 2QURA 4GIHA 2UZTA 3EQHA 3QALE 4LV8A 3OWKA 5C03A 5EK7A 4ALWA 2RFNA 1R1WA 3PWDA 3E8NA 4RX7A 3UO4A 1PMEA 1PXJA 3GXLA 4GSBA 4H36A 3BE2A 4YO6A 4EOOA 3EQRA 4Z7GA 2PVYA 4FODA 4OBPA 4Q9SA 2PWLA 4EH4A 2GHLA 5DFPA 3T9TA 4GYGA 4UWYA 3KRRA 4FC0A 4NU1A 2J2IB 4X6QC 3PJ2A 2BAKA 3U9CA 5JQ5A 4EK8A 1PXMA 4NIFA 4FKLA 5TF9A 1T46A 4G3DA 3HLLA 3ZFXA 4FEUA 2VTSA 3A2CA 3SRVB 3V6RA 4Q2AA 5CAUA 5CQUA 1UVRA 3LVPA 2WPAA 3AG9A 2P4IA 3ZSGA 4ZMEA 2RSVA 5D1JA 1GZ8A 2B9FA 4QMQA 4YTCA 5KO1A 4FIFA 4BCPA 3MFRA 1URWA 2ONLC 1JSVA 2YM3A 4U3YA 5F20A 1QCFA 3M11A 4XCUA 3UZPA 3WZKA 4CZUA 3MB7A 3KRXA 3WF9A 3NYNA 4QQ5A 4RC2A 5DNRA 5LXMA 3CC6A 4XMOA 3GEQA 4FKJA 1Q8WA 1AGWA 2ZFYA 1Z5MA 1PXOA 5D7AA 2OJJA 4DINA 5E1EA 3EWHA 2PVJA 2XH5A 2O2UA 4LGGA 4LRJA 3ZRKA 4PMSA 5BMSA 5CAQA 1PXIA 4G6NA 3SG9A 5F95A 5BUJA 3HP5A 4BDCA 4F9AA 4FV9A 1O6KA 3SAYA 1ZMWA 3LZBA 5AV1A 3MA3A 4QOXA 4FZFB 3R28A 4JG6A 4DT8A 1W8CA 2I0EA 4QYFA 4B7TA 4WUNA 3NUXA 3ROCA 2GPHA 4AQKA 4U0IA 2QOFA 4TXCA 4QMTA 3LFEA 3HRFA 2H34A 3ZFMA 4OBOA 2V0DA 4XJ0A 1WCCA 3ZHPC 5I9VA 4PNKA 3PG3A 2ZM4A 2WMWA 4IC7A 4DT9A 5BPYA 2HW7A 4Y72A 3RAIA 1YXSA 3KXZA 5JFXA 2WXVA 3F7WA 3WARA 1NXKA 4I93A 3EQGA 1BUHA 5L2QA 1T45A 2A4LA 2JIUA 5AP4A 1REJA 4RWKA 3IKAA 2G9XA 5HE2A 4CLJA 4MXCA 2EB3A 3V04A 5BVDA 5I9XA 3GU7A 4IHPA 4KD1A 2J7TA 2XKEA 3AMBA 1FPUA 3D7TA 5EM7A 3RPRA 4G2FA 3ZUVA 3WF8A 3FHRA 2J4ZA 3R02A 2WZJA 3ZSHA 4D2WA 3AC4A 5FTQA 4JAJA 4W4YA 4FNZA 4DEIA 2W1CA 5GZ9A 2W5HA 4YZMA 4RVTA 4J7BA 2VTNA 5FUTA 3TNHA 2X6DA 3R21A 2QLQA 3QQFA 4CTCA 5I9YA 4D28A 2QG7A 3IW6A 2J0JA 4ZLOA 1UNGA 3PYYA 4R3PA 5GINE 4BFMA 4J98A 3OOMA 2J5FA 3FLYA 4DG0E 1KE6A 3FMJA 2UVYA 2VAGA 4CCUA 2ZV9A 5KHWA 5E8SA 5A54A 2R3LA 3NUNA 4R1VA 4FG8A 4R6VA 5HCZA 4GFOA 3I81A 2EUFB 4BCKA 2WTVA 2X0OA 4R7HA 4QNYA 2GS2A 3EYGA 3JPVA 3RWPA 2ZDTA 3P08A 2QC6A 3UO6A 2WIHA 3IOKA 3BL9A 2OW3A 2AC5A 4HZRA 4V0GB 2X0PA 2Y6OA 2BIYA 2W1IA 4QP7A 4MF1A 4O82A 2C69A 3UYSA 3GB2A 3ZLYA 4FOBA 2XK8A 5FRIA 1O6YA 3DXQA 3FXXA 2Z02A 3FZRA 2OFVA 4QTBA 4RIWB 3KF4A 2HELA 4RQKA 2YA9A 4JDKA 4F1OA 3R71A 2J0IA 2XZSA 3RZFA 5BYLA 2R3RA 5DWRA 5A4CA 1J1BA 1YWVA 3BPRA 5FG8A 3RAKA 3ZYAA 3TWJA 4GL9A 2UVXA 3DKGA 5M08A 1BLXA 3SA0A 3NX8A 3UDZA 4LV5A 3LXPA 4NW5A 4I6QA 3ENHA 3RP9A 3TIZA 4EOJA 4R78A 3PPZA 5IA3A 4QRCA 4AN9A 4TWNA 4GYIA 4DCAA 5HBJA 2GNGA 3M42A 2WEIA 4FTOA 4S34A 3DY7A 4AX8A 1NVRA 3KXMA 3P7CA 5AIKA 4MBJA 1P14A 1QMZA 2HZNA 4WG5A 4RVKA 3W8LA 2EXEA 2UZOA 3KKVA 3AC8A 5ETIA 1R39A 3C50A 3QQHA 3IGOA 3MTFA 3WIKA 2AUHA 5H9BA 5JK3A 3U6JA 4O7VA 4LOOA 4GH2A 4U8ZA 2DQ7X 2WTWA 5KMJA 3D7TB 3NUSA 2XIYA 2W0JA 2NPQA 2ZOQA 1H4LA 4FVPA 4IWDA 5AAFA 3S3IA 1A06A 3W10A 4EH6A 3DK6A 4IB5A 5E8WA 3V5WA 4RLLA 1G8KA 4DITA 4IIRA 3LFDA 3VS0A 2BHHA 3VRZA 4CFWA 1M17A 3VHKA 2WELA 2CCHA 4PTEA 4K9YA 3EIDA 2OGVA 3Q32A 4PDSA 3OOGA 4F9CA 4AA0A 3KIOC 5AA8A 4KBAA 5A9UA 3VC4A 2H96A 2A19B 3GU5A 4GJ3A 3VQUA 4IZAA 1PYXA 4O0SA 4ANMA 5HEZA 4B8LA 4O7WA 5IH4A 3I6UA 3QD2B 1PXNA 3WF6A 4NJDA 3N51A 3LAUA 2VWXA 4MD7E 3EH9A 4DHFA 5GJDA 1YKRA 3RINA 2ITTA 2I0YA 4OTQA 4YHFA 5L2SA 4ALUA 1HCLA 3UPXA 4C4GA 3NVMB 4TYHB 4WG3A 3LM0A 1STCE 4MQ1A 5AUVA 1OIQA 2UW4A 1H01A 1BI8A 1YHVA 3W1FA 3H9FA 2C6KA 4C3RA 2HIWA 5HO6A 5CF5A 4F6WA 2A27A 3FI2A 4RFMA 4HVSA 4QMNA 2XKCA 3NS9A 3K3IA 3O8TA 3PRIA 2XNNA 3VW8A 2FUMA 5LOHA 4WNMA 2WMBA 4IAAA 4EBWA 4BN1A 5HLWA 3KXHA 3MB6A 4FTNA 3OCGA 4X2GA 5AP6A 4D9TA 1X8BA 4P4CA 4EQUA 1KOAA 1R78A 4G5PA 4K77A 4LM5A 4QP4A 4XX9A 5AR7A 5AAEA 2XAMA 4IAYA 3L9MA 3PUFC 5L6WL 5HE0A 2PU8A 3EN4A 3G6HA 3EL7A 4IDTA 4JRVA 4RJ3A 4BCOA 1PXKA 4X3FA 4KSQA 2HCKA 2C6DA 3QD0A 4CCBA 4A9SA 2B7AA 2O64A 3DNEA 3AKKA 5ETFA 2VO0A 3VBXA 3IK3A 1BKXA 1ZAOA 2RFEA 3ZZWA 4FSNA 5LMBA 5L4QA 2QOIA 4YP8A 1XH9A 3FHIA 4W9WA 2PVRA 3CGOA 4F9YA 5IQBA 1XH8A 1UKIA 4JJRA 5AV0A 3SOCA 5EM6A 4FV5A 1ZMVA 3JY9A 4GKHA 2IW6A 5K3YA 3BLHA 3KVWA 3SXFA 4LGDA 3S4QA 1Q99A 3EFWA 2UZVA 4BWKA 1WMKA 3HKOA 1Y57A 2WKMA 3M1SA 3KF7A 3VVHA 2CNQA 2XARA 1Q3DA 3V5PA 2VNWA 4WIHA 1YHSA 2A98A 3FUPA 4D2PA 1Q61A 4NH1A 3OT8A 3TT0A 2HY0A 2JKKA 2V22A 3MDYA 3F5PA 3MVLA 4QP1A 1PRYA 4G1WA 4O2ZA 2V5QA 3KCKA 3FMLA 3G2FA 4BCMA 4C4IA 4C38A 2UW6A 4TYJA 3ML1A 1KWPA 3PXQA 4M69A 2WMQA 2X4ZA 4FIGA 4TPTA 4YSJA 1B6CB 5EM5A 1KE7A 2R5TA 5FDXA 3VNTA 3QXOA 4DBXA 2ETRA 2WMRA 3QTRA 2X1NA 5TT7A 4HOKA 3SW4A 4DG2E 5B7VA 4CG8A 3ZEPA 2Y4PA 3V5QA 3ZO1A 5AADA 3HZTA 3UZRA 3TUBA 1YI6A 4UBAA 5CTPA 1ZYLA 2WMUA 3BRBA 4X2JA 3MJ2A 3M2WA 5DOSA 3CP9A 4UZHA 3E7OA 4IADA 4YJNA 1JKKA 3LCKA 3ALNA 3AQVA 3OG7A 4DYMA 2JDVA 3TMOA 5HORA 4HYUA 3R8UA 4EOPA 2B1PA 1H8FA 5AUWA 3RPOA 2ITZA 4AA4A 1M2PA 1UWHA 3HA8A 4L9IA 5IUIA 3FKOA 2UZNA 3IDPA 4FTTA 4X6RA 2BZIB 1Q62A 2YJSA 3GU4A 3HGKA 4IM2A 5M56A 4U41A 2EWAA 1OPLA 4M0ZA 4F0GA 4FYNA 3NNXA 3MPAA 3ITZA 3N9XA 1TVOA 4AZFA 1JPAA 4BZDA 3BWFA 4MBLA 3VBTA 3VRYA 3TDVA 1W83A 4FZ7A 3OVVA 3GUBA 3FZOA 2Z2WA 4LV7A 2W1FA 1MQ4A 3V8WA 2UUEA 3SG8A 3TYKA 3ZSIA 1LEZA 2W5AA 5HIDA 3VUGA 5HVYA 3KN5A 4ANNA 4BCGA 3OXZA 3C0GA 3GGFA 4G16A 4JBQA 4C34A 2C3JA 1PF8A 2YDJA 5CT0A 3THBA 4FTJA 1WFCA 2R2PA 2ZDUA 3VAPA 2I0HA 4AACA 4C02A 4AGCA 3BYVA 3PLSA 5EG3A 2B54A 3R2YA 4IDVA 4EOKA 3KRJA 1H28A 3DPKA 4XG2A 3A8XA 4JG8A 2R64A 5M07A 1ZOGA 2XK4A 3FZTA 4K2RA 4O27B 3ZXTA 4YHJA 4ERKA 4XP2A 3UE4A 3ATTA 4QEBA 5HCXA 3I0QA 4I0RA 4IBMA 1VJYA 2Y7JA 4MVFA 2ZVAA 5AR5A 5TE0A 3QCQA 2WD1A 1LUFA 4WG4A 4YURA 4H3BA 3LLTA 4D0XA 3QF9A 5HNBA 3EQIA 3HUCA 5AP5A 3U8WA 5E8ZA 1GZNA 3IDBA 4FKIA 3TACA 3NFGB 4ORKA 1LR4A 1OIYA 3G9NA 3NRMA 3OP5A 4DH8A 2DUVA 4A9RA 3MIYA 2ZB0A 3LMGA 4K11A 4NWMA 4CYIA 3VWAA 3E3PA 4PMMA 1J7UA 4JX7A 5CX9A 4DHIB 2VTLA 3DBCA 4C62A 4DEAA 4I5CA 2PVNA 2W4KA 1GIIA 2JAMA 1HCKA 2OF2A 3OZ6A 3QKMA 5EDQA 2B53A 1H26A 4WD5A 3OC1A 4EOIA 4DLJA 4O7SA 3KMMA 1OKYA 4QMOA 4XLIA 5ACBC 2PHKA 5IEYA 4BWPA 5JKGA 2ITPA 4AW2A 1R3CA 4OT6A 4EK4A 3OMVA 3LFFA 2BRNA 3RVGA 3VS5A 1WZYA 3FE3A 3O2MA 1M7NA 3VJNA 4BGGA 5AP7A 3C5UA 3CJFA 3DXNA 1ZWSA 4XG3A 4BDGA 4YO4A 5I3RA 4FIJA 2YIYA 4XG7A 1IG1A 1YOLA 2YDKA 2QOKA 5JGAA 3QTXA 4ZLYA 4P5ZA 4C59A 3ANRA 4KBCA 4Q9ZA 2EVAA 4FSQA 3QBNA 5KMMA 4AT3A 3CGFA 2OH4A 5AUXA 5CAVA 1CDKA 3BHVA 3JVSA 1DAWA 5CI7A 2XIKA 4O2PA 4RX8A 2OXDA 5AP0A 1G8JA 3RMFA 3ZRLA 5D10A 4JR7A 3UODA 3A7JA 2XRWA 5JMSA 2XP2A 4G5JA 5C4LA 2CGWA 3D83A 5J7HA 1LPUA 1IR3A 4FV4A 5M53A 4ZY5A 4FTQA 3A7IA 1GY3A 3POOA 3IW8A 4FKVA 4XG6A 2C5NA 4D2RA 4D2SA 3HMMA 1H00A 4O0XA 1VYWA 5J7BA 3IG7A 4E5AX 5LQFA 3IGGA 4J8MA 4EEVA 2YAKA 4FSTA 4MBIA 5FTOA 3TJDA 4RC3A 5EI6A 2OO8X 3O50A 4WT6A 3S00A 4TWOA 3FI8A 5AFVA 2XALA 4MTAA 3O5AA 1IAHA 4KBKA 3DAEA 4ASEA 3U4WA 2QHNA 2WIPA 3VUHA 3ZC6A 4G3GA 3W0NA 5HX6A 3TV7A 5H2UA 2KTYA 4L67A 4RWJA 4EBVA 2RIOA 4N4SA 3BLAA 4EKKA 4PTCA 3Q9XA 2G1TA 2W96B 3P86A 1ERKA 4X2FA 2E9OA 2YDIA 2LGCA 2JFLA 3RHXA 1EH4A 4NIFB 1U59A 4WSYA 2O3PA 3PFQA 3VBQA 3QX4A 3QA8A 2XKDA 2V7AA 2XIRA 3RKBA 2YCRA 4OTHA 4ZTLA 4S33A 2YACA 2BKZA 2OJ9A 4IX5A 5DEYA 5JRQA 5HI2A 2PUIA 4RIYB 5CF6A 2ZV7A 2B9HA 2Y4IC 4GRBA 5EYKA 1SMHA 3TUCA 3A8WA 3G15A 3R8LA 4JAIA 4YZDA 1OUKA 1K9AA 5HBHA 2X0GA 4D4YA 4FJVA 3BE9A 3UP7A 2NNWB 4K1BA 2IZTA 2NYAA 4PNIA 3DQXA 5AP1A 3I7BA 5FM3A 4AGUA 4B4LA 4JVGA 4FT0A 4E5WA 2YIRA 4ZAUA 4MXZA 4NW6A 1YXXA 3E87A 5FBOA 3V6SA 3NIZA 1XH7A 3ZTXA 5M51A 4BCNA 2BALA 3UOLA 2OI4X 4J99A 3W0RA 5C27A 1XH5A 4PTGA 3BL7A 1KE9A 2VGOA 3OROA 4UWBA 4QMLA 2IZSA 2XB7A 3O7LD 4TWCA 4CFVA 4EH9A 3E92A 4U6RA 3HL7A 3UBDA 1XBCA 4C4FA 3ENMA 4KAOA 3CD8A 5B2KA 4C37A 4A4OA 2CLQA 3R63A 3QTZA 3LCTA 4OTWA 1ATPE 2FGIA 3LPBA 2OJFE 3WYYA 3ZO2A 4E7WA 5BUEA 2QU5A 4IACA 3FV8A 3O17A 5CAPA 2VN9A 4FF8A 3PXFA 4IB3A 1OPJA 5GJFA 3BCEA 1URCA 3MFTA 4QTCA 4U79A 5DN3A 3WYXA 4C3FA 4ZJVA 2Y8OA 1WVYA 4C35A 4LQMA 5CU6A 4KWPA 4FEVA 1QL6A 3H0ZA 4GFGA 2YZAA 2C47A 4DH1A 3UYTA 4ZSGA 3R7OA 2VTPA 3N4TA 5DH3A 4CMTA 3MYGA 2CN8A 2O8YA 4QYEA 3SLSA 4EK3A 5JGBA 2Z8CA 3FYKX 3FXWA 3EN6A 3R1NA 5CLPA 4OAUC 3AGLA 4J8NA 4ENXA 3C4WA 3DAKA 4ACCA 2CNVA 2HYYA 4K8AA 3C5IA 1H07A 4G6LA 2R9SA 4AOJA 5CZIA 3ID6C 4KA3A 2QHMA 3OD6X 5A14A 5HIEA 3HMIA 3MGYA 3NUUA 4PRJA 3G0FA 3LKMA 3U55A 2HAKA 3W2PA 5KMOA 5E9EA 2YCFA 2EXCX 4YGAA 2YERA 4BI1A 5JRSA 3QXPA 4K18A 3R8MA 4Z55A 3R7IA 4DH5A 2F2CB 3ORTA 4QMXA 3SGCA 1OL7A 2O5KA 5HKMA 3GT8A 3QGYA 4FIHA 1PY5A 4TKSA 5BMMA 2BIKB 4JQEA 3GCUA 4O22A 3R7GA 3PY1A 4MNFA 5ANOA 2PVLA 5E8YA 4O38A 4BDAA 2CSNA 3Q9WA 4AXEA 5IQGA 2X8IA 3HMPA 4TW9A 4XOZA 1R0EA 3F3UA 3I7CA 3TN8A 1CMKE 4DHZA 3G9LX 2AEGA 3GFWA 5CEIA 4FL3A 1XBBA 2XBJA 1U54B 3OTUA 2BAJA 4BIEA 3LXKA 4GG7A 4HVDA 3UQGA 5JT2A 3CTQA 3MBLA 1L8TA 4WBBB 4R3CA 4DEDA 3DDQA 2JBPA 3ROYA 2YM5A 3KGAA 3SD0A