2GCJA

Crystal structure of the pob3 middle domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
237
structure length
229
Chain Sequence
b'AGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHLLVLAIEPPLRKGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
publication title The Structure of the yFACT Pob3-M Domain, Its Interaction with the DNA Replication Factor RPA, and a Potential Role in Nucleosome Deposition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 50
structure length 229
sequence length 237
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gcjA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 2gcjA01
4GZUA 5DHFB 2D11A 4MK0A 2DHKA 2MFQA 4Z2NA 5EFXA 3PEGA 2K2UA 4PQ0A 1FOEA 1XR0B 4YL8A 1XD4A 3TVVA 4EJNA 2RUKB 4A5KA 4KHOA 1NI2A 3ODOA 3KZ1A 3GYPA 2YT1A 1KZGA 1OMWA 4HB0B 1OY2A 3KRWA 1X1FA 1H4RA 4DX8A 3A8PA 4DBBA 2IFSA 2DKPA 2YS3A 5C79A 1K5GB 5C5BB 1ISNA 1UNRA 2LOXA 4YONA 2AEHA 4KVGB 3VOQA 4Y94A 2P0HA 4DX90 2P0DA 2DTCA 1E5WA 4HDQA 3PVLA 1RJ2A 2P8VA 2J0KA 3KRXA 3PP2A 4CYEA 4HB2B 5FI0A 2RGNB 2EJ8A 1K5DB 1PMSA 2YT0A 1AWEA 3SUZA 4KHAA 1X1GA 1MAIA 1NU2A 2OQBA 2R0DA 2NZ8B 2N23A 4NY0A 4F7GA 1P6SA 1M7EA 1UEFA 3DXDA 2D9YA 3HK0A 3ULBA 2M14A 2PZ1A 4IOYX 1FGYA 1DDWA 2MDXA 3A8QA 4B6HA 4ZRKA 4HAXB 2LOZA 3A98B 1V89A 5DIFB 1BTNA 1QC6A 1WGQA 3TFMA 1EGXA 3N7CA 4P7IA 3OANA 2DA0A 3F5RA 1WJMA 4HHVA 2CRFA 5D3WA 3F0WA 1UPRA 2D9ZA 5HE0A 1X05A 4K81A 1W1DA 2D9XA 5D3VA 2HE7A 2K00A 2EMSA 2J0JA 2YVCA 4ZRJA 1BTKA 4A6FB 2Q13A 1FHXA 4HAYB 4K17A 2DX5A 5CLLB 4MY6A 3QBVB 3DXEA 2GS0A 2YF0A 4BBKA 3ML4A 2RVBB 3PG7A 4PNKA 1B55A 3HQCA 2LYDA 3T06A 5DH9B 1FHOA 2G35A 2H7DA 1ZC4B 4HATB 3P7ZA 2DKQA 2LG1A 1FB8A 2HTHB 3D8FA 2UVMA 2XQNM 3SV1A 4A6KA 1NTVA 2EMTA 4IFSA 1QQGA 4A6FA 1U2BA 4XWXA 3LJUX 2GJYA 1Y5OA 1WI1A 5D3YA 2I5FA 2CODA 5GOWB 2VSZA 1NTYA 2I5CA 3X23A 3BJIA 5KCVA 1J19A 3MDBC 3AU5A 5J3YA 2CAYA 4H8SA 1EVHA 3ULCA 3WA0A 3KY9A 2J59M 1XKEA 2CY5A 2KUPA 2Y7BA 4CHJA 3BINA 1ZC3B 1SHCA 2BCJA 2W2XD 1V5MA 3TO1A 5D27A 3PVUA 1ZM0A 1U5FA 2RNRB 1Y19B 1I2HA 1EAZA 2Y8GA 2CY4A 3FM8C 4HAWB 3ODXA 1P3RA 4GMVA 2COFA 2LULA 2RLOA 2KCJA 2ELBA 2DHJA 2V76A 1ZVRA 2ROVA 3GYOA 1MIZB 1GG3A 4WSFA 4HAUB 2Z0QA 1MIXA 1AQCA 3U7DA 3MPXA 1XX0A 1IRSA 2VKIA 1W1HA 2COCA 1KZ7A 3KSYA 2Z0PA 2YRYA 2D4QA 1FGZA 4GPTB 3SYXA 5FI1A 5HE3A 2ZPYA 1LB1A 2AL6A 3P6AA 3SO6A 1MK9B 4Z2MB 3AU4A 1SGHA 3U8ZA 3ZDTA 2LKOA 2P0FA 3NSUA 2YSZA 3G9WA 3PSCA 4NSWA 4WJ7A 1MK7B 2OTXA 1V88A 3D8DA 1X11A 2R09A 1M7RA 1V61A 4GXBA 2X18A 3TW1A 4KAXB 2L1CA 1FHWA 5KQ4A 1XCGA 4A6HA 4C0AA 3FSSA 1EF1A 4MT7A 5KQ1A 4KHBB 4HB3B 2MWNB 5HE2A 1DDVA 5C6RA 1WG7A 2GCJA 5CLQB 5D3XA 3QWMA 1I7AA 3O96A 1GC6A 4HAZB 2QKMA 3RCPA 1XODA 2MKRA 1H10A 1U5EA 2YS1A 2I1KA 2D2QA 2RSGA 3IVFA 2QKLA 3D8EA 3QIJA 1TXDA 3CXBB 3WYFB 2H7EA 2DYQA 4K2PA 5J3TA 2D10A 1DDMA 3PZDA 1Q67A 2DHIA 1DROA 5JP4A 5JHGA 4EMOA 1DBHA 4TKNA 2UZSA 2ELAA 3SNHA 1PFJA 2GCLA 3VIAA 3PVWA 1BWNA 2J0MA 3CIKA 1GC7A 2L2IA 3ZVRA 1OQNA 2DN6A 4GMXB 4EKUA 1UNPA 1MKEA 4HDOA 4D0NB 1U29A 5HE1A 5C16A 4ZRIA 2JP2A 2Y8FA 2ADZA 2DX1A 2FJLA 1ZSQA 4IAPA 5C5BA 5L81A 2W2WA 2DLWA 1LW3A 1J0WA 1Z87A 3ODWA 4K2OA 3TCAA 2D9VA 1WGUA 1U5DA 5LOPB 5DI9B 3HW2B 5JHHA 2DYNA 3DXCA 1WJ1A 2NMBA 2IYBA 1BAKA 5J3QA 2Z0OA 1DYNA 2W2XC 1MPHA 4HAVB 5DHAB 1PLSA 3UZTA 1TQZA 1U5GA 1UNQA 1WVHA 4HB4B 4CHMA 1X86A 1V5UA 1RRPB 1TJ6A 4DXAB 4L6EA 1UPQA 2ROZB 2K2JA 1N3HA 5LONB 1KI1B 1P5TA 2I1JA 4F7HA 2N0YA 3V5WA 4GN1A 2EC1A 5JLJB 3M1IB 2KGXB 1U27A 2COAA 2DFKA 3AJ4A 2YS5A 4TYZA 1FAOA 4F7UP 2VRWB 2E2XA 2UZRA 1V5PA 4WVFB 1W1GA 3FEHA 2M38A 2D9WA
chains in the Genus database with same CATH superfamily
4GZUA 5DHFB 2D11A 4MK0A 2DHKA 2MFQA 4Z2NA 5EFXA 2KIGA 3PEGA 2K2UA 4PQ0A 1FOEA 2K8EA 1XR0B 4YL8A 1XD4A 3TVVA 4EJNA 2RUKB 1T77A 4A5KA 4KHOA 1NI2A 3ODOA 3KZ1A 3GYPA 2YT1A 1KZGA 2R2YA 1OMWA 4HB0B 1OY2A 3KRWA 4CSQA 1X1FA 1H4RA 2FJUB 4DX8A 3A8PA 4DBBA 2IFSA 2DKPA 5I2MA 2YS3A 5C79A 1K5GB 5C5BB 1ISNA 1UNRA 2LOXA 4YONA 2AEHA 4KVGB 3VOQA 4Y94A 2P0HA 4DX90 2P0DA 2DTCA 1E5WA 4HDQA 3PVLA 1RJ2A 2P8VA 2J0KA 3KRXA 3NW8A 3PP2A 4CYEA 4HB2B 5FI0A 2RGNB 2EJ8A 1K5DB 1PMSA 2YT0A 1AWEA 3A58A 3SUZA 4KHAA 1X1GA 1MAIA 1NU2A 2OQBA 2R0DA 2NZ8B 2N23A 4NY0A 4F7GA 1P6SA 1M7EA 1UEFA 3DXDA 2D9YA 3HK0A 3ULBA 2M14A 4QJ3B 2PZ1A 4IOYX 1FGYA 1DDWA 2MDXA 3A8QA 4B6HA 4ZRKA 4HAXB 3B77A 2LOZA 3A98B 2Z4DA 1V89A 5DIFB 1BTNA 1QC6A 1WGQA 3TFMA 1EGXA 3N7CA 4P7IA 3OANA 2DA0A 3F5RA 1WJMA 4HHVA 4GOUA 2CRFA 5D3WA 3F0WA 1UPRA 2D9ZA 5HE0A 1X05A 4K81A 1W1DA 2D9XA 5D3VA 5M4YB 2HE7A 2K00A 2EMSA 2J0JA 2YVCA 4ZRJA 1BTKA 4A6FB 2Q13A 1FHXA 2YT2A 4HAYB 4K17A 2DX5A 5CLLB 4MY6A 3QBVB 3DXEA 2GS0A 2YF0A 4BBKA 3U12A 3ML4A 2RVBB 3PG7A 4PNKA 1B55A 3HQCA 2LYDA 3T06A 5DH9B 1FHOA 2G35A 3OHMB 2H7DA 1ZC4B 4HATB 3P7ZA 2DKQA 2LG1A 1FB8A 2HTHB 3D8FA 2UVMA 2XQNM 3SV1A 4A6KA 1NTVA 2EMTA 2K49A 4IFSA 1QQGA 4A6FA 1U2BA 4XWXA 3LJUX 2GJYA 1Y5OA 1WI1A 5D3YA 2I5FA 2CODA 5GOWB 2VSZA 1NTYA 2I5CA 3NWAA 3X23A 3BJIA 5KCVA 1J19A 3MDBC 3AU5A 5J3YA 2CAYA 4H8SA 2Z59A 1EVHA 3ULCA 3WA0A 3KY9A 2J59M 1XKEA 2CY5A 2KUPA 4QJ4B 2Y7BA 4CHJA 3BINA 1ZC3B 1SHCA 2BCJA 2W2XD 1V5MA 3TO1A 5D27A 3PVUA 1ZM0A 1U5FA 2RNRB 1Y19B 1I2HA 4GNKB 1EAZA 2Y8GA 2CY4A 3FM8C 4HAWB 3ODXA 3FVCA 1P3RA 2Z13A 5IRSA 4GMVA 2COFA 2LULA 2RLOA 2KCJA 2ELBA 2GUMA 2DHJA 2V76A 1ZVRA 2ROVA 3GYOA 1MIZB 1GG3A 4WSFA 4HAUB 2Z0QA 1MIXA 1AQCA 3U7DA 3MPXA 1XX0A 1IRSA 2VKIA 1W1HA 2COCA 1KZ7A 3KSYA 2Z0PA 2KIEA 2YRYA 2D4QA 1FGZA 4GPTB 3SYXA 5FI1A 5HE3A 4OT1A 2ZPYA 1LB1A 2AL6A 3P6AA 3SO6A 1MK9B 4Z2MB 3AU4A 4L1RA 1SGHA 3U8ZA 3ZDTA 2LKOA 2P0FA 3NSUA 2YSZA 3G9WA 3DCXA 3PSCA 4NSWA 4WJ7A 1MK7B 2OTXA 5LG4B 1V88A 3D8DA 1X11A 2R09A 1M7RA 1V61A 4GXBA 2X18A 3HSAA 3TW1A 4OSNA 1MI1A 4KAXB 2L1CA 1FHWA 5KQ4A 1XCGA 4A6HA 4C0AA 3FSSA 1EF1A 4MT7A 5KQ1A 4KHBB 4HB3B 2MWNB 5HE2A 1DDVA 5C6RA 1WG7A 2GCJA 5CLQB 5D3XA 3QWMA 1I7AA 4DIXA 3O96A 1GC6A 4HAZB 2QKMA 3RCPA 1XODA 2MKRA 1H10A 1U5EA 2YS1A 2I1KA 2D2QA 2RSGA 3IVFA 2QKLA 3D8EA 3QIJA 3NWDA 1TXDA 3CXBB 3WYFB 2H7EA 2DYQA 4K2PA 4KHBA 5J3TA 2ZKMX 2D10A 4QXAB 1DDMA 3HIEA 3PZDA 1Q67A 2DHIA 1DROA 5JP4A 5JHGA 4EMOA 1DBHA 4TKNA 2UZSA 2ELAA 3SNHA 2NBVA 4HSIA 1PFJA 2GCLA 3VIAA 3PVWA 1BWNA 2J0MA 3CIKA 1GC7A 2L2IA 3ZVRA 4D6WA 2KUQA 1OQNA 2DN6A 4GMXB 4EKUA 1UNPA 1MKEA 2RRFA 4HDOA 4D0NB 1U29A 5HE1A 5C16A 4ZRIA 2JP2A 2Y8FA 2ADZA 2DX1A 2FJLA 1ZSQA 4IAPA 5C5BA 5L81A 2W2WA 2DLWA 1LW3A 1J0WA 1Z87A 3ODWA 4K2OA 3TCAA 2D9VA 1WGUA 1U5DA 5LOPB 5DI9B 3HW2B 5JHHA 2DYNA 3DXCA 1WJ1A 2NMBA 2IYBA 1BAKA 5J3QA 2Z0OA 1DYNA 2W2XC 1MPHA 4HAVB 5DHAB 2KR0A 1PLSA 3UZTA 1TQZA 1U5GA 1UNQA 1WVHA 4HB4B 4CHMA 1X86A 1V5UA 1RRPB 1TJ6A 4DXAB 4L6EA 1UPQA 2ROZB 2K2JA 2Z14A 1N3HA 5LONB 4QJ5B 1KI1B 1P5TA 2I1JA 4F7HA 2N0YA 3V5WA 4GN1A 2EC1A 5JLJB 3M1IB 2KGXB 1U27A 2COAA 2DFKA 3AJ4A 5I2SA 2YS5A 4TYZA 1ZYIA 1FAOA 4F7UP 2VRWB 2E2XA 2UZRA 1V5PA 3NWFA 4WVFB 1W1GA 3FEHA 2M38A 2D9WA
chains in the Genus database with same CATH topology
4GZUA 5DHFB 2D11A 4MK0A 2DHKA 2MFQA 4Z2NA 5EFXA 2KIGA 3PEGA 2K2UA 4PQ0A 1FOEA 2K8EA 1XR0B 4YL8A 1XD4A 3TVVA 4EJNA 2RUKB 4A5KA 4KHOA 1NI2A 3ODOA 3KZ1A 3GYPA 2YT1A 1KZGA 2R2YA 1OMWA 4HB0B 1OY2A 3KRWA 4CSQA 1X1FA 1H4RA 2FJUB 4DX8A 3A8PA 4DBBA 2IFSA 2DKPA 5I2MA 2YS3A 5C79A 1K5GB 5C5BB 1ISNA 1UNRA 2LOXA 4YONA 2AEHA 4KVGB 3VOQA 4Y94A 2P0HA 4DX90 2P0DA 2DTCA 1E5WA 4HDQA 3PVLA 1RJ2A 2P8VA 2J0KA 3KRXA 3NW8A 3PP2A 4CYEA 4HB2B 5FI0A 2RGNB 2EJ8A 1K5DB 1PMSA 2YT0A 1AWEA 3A58A 3SUZA 4KHAA 1X1GA 1MAIA 1NU2A 2OQBA 2R0DA 2NZ8B 2N23A 4NY0A 4F7GA 1P6SA 1M7EA 1UEFA 3DXDA 2D9YA 3HK0A 3ULBA 2M14A 4QJ3B 2PZ1A 4IOYX 1FGYA 1DDWA 2MDXA 3A8QA 4B6HA 4ZRKA 4HAXB 2LOZA 3A98B 2Z4DA 1V89A 5DIFB 1BTNA 1QC6A 1WGQA 3TFMA 1EGXA 3N7CA 4P7IA 3OANA 2DA0A 3F5RA 1WJMA 4HHVA 4GOUA 2CRFA 5D3WA 3F0WA 1UPRA 2D9ZA 5HE0A 1X05A 4K81A 1W1DA 2D9XA 5D3VA 5M4YB 2HE7A 2K00A 2EMSA 2J0JA 2YVCA 4ZRJA 1BTKA 4A6FB 2Q13A 1FHXA 4HAYB 2YT2A 4K17A 2DX5A 5CLLB 4MY6A 3QBVB 3DXEA 2GS0A 2YF0A 4BBKA 3U12A 3ML4A 2RVBB 3PG7A 4PNKA 1B55A 3HQCA 2LYDA 3T06A 5DH9B 1FHOA 2G35A 3OHMB 2H7DA 1ZC4B 4HATB 3P7ZA 2DKQA 2LG1A 1FB8A 2HTHB 3D8FA 2UVMA 2XQNM 3SV1A 4A6KA 1NTVA 2EMTA 2K49A 4IFSA 1QQGA 4A6FA 1U2BA 4XWXA 3LJUX 2GJYA 1Y5OA 1WI1A 5D3YA 2I5FA 2CODA 5GOWB 2VSZA 1NTYA 2I5CA 3NWAA 3X23A 3BJIA 5KCVA 1J19A 3MDBC 3AU5A 5J3YA 2CAYA 4H8SA 2Z59A 1EVHA 3ULCA 3WA0A 3KY9A 2J59M 1XKEA 2CY5A 2KUPA 4QJ4B 2Y7BA 4CHJA 3BINA 1ZC3B 1SHCA 2BCJA 2W2XD 1V5MA 3TO1A 5D27A 3PVUA 1ZM0A 1U5FA 2RNRB 1Y19B 1I2HA 4GNKB 1EAZA 2Y8GA 2CY4A 3FM8C 4HAWB 3ODXA 3FVCA 1P3RA 2Z13A 5IRSA 4GMVA 2COFA 2LULA 2RLOA 2KCJA 2ELBA 2GUMA 2DHJA 2V76A 1ZVRA 2ROVA 3GYOA 1MIZB 1GG3A 4WSFA 4HAUB 2Z0QA 1MIXA 1AQCA 3U7DA 3MPXA 1XX0A 1IRSA 2VKIA 1W1HA 2COCA 1KZ7A 3KSYA 2Z0PA 2KIEA 2YRYA 2D4QA 1FGZA 4GPTB 3SYXA 5FI1A 5HE3A 4OT1A 2ZPYA 1LB1A 2AL6A 3P6AA 3SO6A 1MK9B 4Z2MB 3AU4A 4L1RA 1SGHA 3U8ZA 3ZDTA 2LKOA 2P0FA 3NSUA 2YSZA 3G9WA 3PSCA 4NSWA 4WJ7A 1MK7B 2OTXA 5LG4B 1V88A 3D8DA 1X11A 2R09A 1M7RA 1V61A 4GXBA 2X18A 3TW1A 4OSNA 4KAXB 2L1CA 1FHWA 5KQ4A 1XCGA 4A6HA 4C0AA 3FSSA 1EF1A 4MT7A 5KQ1A 4KHBB 4HB3B 2MWNB 5HE2A 1DDVA 5C6RA 1WG7A 2GCJA 5CLQB 5D3XA 3QWMA 1I7AA 4DIXA 3O96A 1GC6A 4HAZB 2QKMA 3RCPA 1XODA 2MKRA 1H10A 1U5EA 2YS1A 2I1KA 2D2QA 2RSGA 3IVFA 2QKLA 3D8EA 3QIJA 3NWDA 1TXDA 3CXBB 3WYFB 2H7EA 2DYQA 4K2PA 4KHBA 5J3TA 2ZKMX 2D10A 4QXAB 1DDMA 3PZDA 3HIEA 1Q67A 2DHIA 1DROA 5JP4A 5JHGA 4EMOA 1DBHA 4TKNA 2UZSA 2ELAA 3SNHA 2NBVA 4HSIA 1PFJA 2GCLA 3VIAA 3PVWA 1BWNA 2J0MA 3CIKA 1GC7A 2L2IA 3ZVRA 4D6WA 2KUQA 1OQNA 2DN6A 4GMXB 4EKUA 1UNPA 1MKEA 2RRFA 4HDOA 4D0NB 1U29A 5HE1A 5C16A 4ZRIA 2JP2A 2Y8FA 2ADZA 2DX1A 2FJLA 1ZSQA 4IAPA 5C5BA 5L81A 2W2WA 2DLWA 1LW3A 1J0WA 1Z87A 3ODWA 4K2OA 3TCAA 2D9VA 1WGUA 1U5DA 5LOPB 5DI9B 3HW2B 5JHHA 2DYNA 3DXCA 1WJ1A 2NMBA 2IYBA 1BAKA 5J3QA 2Z0OA 1DYNA 2W2XC 1MPHA 4HAVB 5DHAB 2KR0A 1PLSA 3UZTA 1TQZA 1U5GA 1UNQA 1WVHA 4HB4B 4CHMA 1X86A 1V5UA 1RRPB 1TJ6A 4DXAB 4L6EA 1UPQA 2ROZB 2K2JA 2Z14A 1N3HA 5LONB 4QJ5B 1KI1B 1P5TA 2I1JA 4F7HA 2N0YA 3V5WA 4GN1A 2EC1A 5JLJB 3M1IB 2KGXB 1U27A 2COAA 2DFKA 3AJ4A 5I2SA 2YS5A 4TYZA 1ZYIA 1FAOA 4F7UP 2VRWB 2E2XA 2UZRA 1V5PA 3NWFA 4WVFB 1W1GA 3FEHA 2M38A 2D9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZU A;  5DHF B;  2D11 A;  4MK0 A;  2DHK A;  2MFQ A;  4Z2N A;  5EFX A;  3PEG A;  2K2U A;  4PQ0 A;  1FOE A;  1XR0 B;  4YL8 A;  1XD4 A;  3TVV A;  4EJN A;  2RUK B;  4A5K A;  4KHO A;  1NI2 A;  3ODO A;  3KZ1 A;  3GYP A;  2YT1 A;  1KZG A;  1OMW A;  4HB0 B;  1OY2 A;  3KRW A;  1X1F A;  1H4R A;  4DX8 A;  3A8P A;  4DBB A;  2IFS A;  2DKP A;  2YS3 A;  5C79 A;  1K5G B;  5C5B B;  1ISN A;  1UNR A;  2LOX A;  4YON A;  2AEH A;  4KVG B;  3VOQ A;  4Y94 A;  2P0H A;  4DX9 0;  2P0D A;  2DTC A;  1E5W A;  4HDQ A;  3PVL A;  1RJ2 A;  2P8V A;  2J0K A;  3KRX A;  3PP2 A;  4CYE A;  4HB2 B;  5FI0 A;  2RGN B;  2EJ8 A;  1K5D B;  1PMS A;  2YT0 A;  1AWE A;  3SUZ A;  4KHA A;  1X1G A;  1MAI A;  1NU2 A;  2OQB A;  2R0D A;  2NZ8 B;  2N23 A;  4NY0 A;  4F7G A;  1P6S A;  1M7E A;  1UEF A;  3DXD A;  2D9Y A;  3HK0 A;  3ULB A;  2M14 A;  2PZ1 A;  4IOY X;  1FGY A;  1DDW A;  2MDX A;  3A8Q A;  4B6H A;  4ZRK A;  4HAX B;  2LOZ A;  3A98 B;  1V89 A;  5DIF B;  1BTN A;  1QC6 A;  1WGQ A;  3TFM A;  1EGX A;  3N7C A;  4P7I A;  3OAN A;  2DA0 A;  3F5R A;  1WJM A;  4HHV A;  2CRF A;  5D3W A;  3F0W A;  1UPR A;  2D9Z A;  5HE0 A;  1X05 A;  4K81 A;  1W1D A;  2D9X A;  5D3V A;  2HE7 A;  2K00 A;  2EMS A;  2J0J A;  2YVC A;  4ZRJ A;  1BTK A;  4A6F B;  2Q13 A;  1FHX A;  4HAY B;  4K17 A;  2DX5 A;  5CLL B;  4MY6 A;  3QBV B;  3DXE A;  2GS0 A;  2YF0 A;  4BBK A;  3ML4 A;  2RVB B;  3PG7 A;  4PNK A;  1B55 A;  3HQC A;  2LYD A;  3T06 A;  5DH9 B;  1FHO A;  2G35 A;  2H7D A;  1ZC4 B;  4HAT B;  3P7Z A;  2DKQ A;  2LG1 A;  1FB8 A;  2HTH B;  3D8F A;  2UVM A;  2XQN M;  3SV1 A;  4A6K A;  1NTV A;  2EMT A;  4IFS A;  1QQG A;  4A6F A;  1U2B A;  4XWX A;  3LJU X;  2GJY A;  1Y5O A;  1WI1 A;  5D3Y A;  2I5F A;  2COD A;  5GOW B;  2VSZ A;  1NTY A;  2I5C A;  3X23 A;  3BJI A;  5KCV A;  1J19 A;  3MDB C;  3AU5 A;  5J3Y A;  2CAY A;  4H8S A;  1EVH A;  3ULC A;  3WA0 A;  3KY9 A;  2J59 M;  1XKE A;  2CY5 A;  2KUP A;  2Y7B A;  4CHJ A;  3BIN A;  1ZC3 B;  1SHC A;  2BCJ A;  2W2X D;  1V5M A;  3TO1 A;  5D27 A;  3PVU A;  1ZM0 A;  1U5F A;  2RNR B;  1Y19 B;  1I2H A;  1EAZ A;  2Y8G A;  2CY4 A;  3FM8 C;  4HAW B;  3ODX A;  1P3R A;  4GMV A;  2COF A;  2LUL A;  2RLO A;  2KCJ A;  2ELB A;  2DHJ A;  2V76 A;  1ZVR A;  2ROV A;  3GYO A;  1MIZ B;  1GG3 A;  4WSF A;  4HAU B;  2Z0Q A;  1MIX A;  1AQC A;  3U7D A;  3MPX A;  1XX0 A;  1IRS A;  2VKI A;  1W1H A;  2COC A;  1KZ7 A;  3KSY A;  2Z0P A;  2YRY A;  2D4Q A;  1FGZ A;  4GPT B;  3SYX A;  5FI1 A;  5HE3 A;  2ZPY A;  1LB1 A;  2AL6 A;  3P6A A;  3SO6 A;  1MK9 B;  4Z2M B;  3AU4 A;  1SGH A;  3U8Z A;  3ZDT A;  2LKO A;  2P0F A;  3NSU A;  2YSZ A;  3G9W A;  3PSC A;  4NSW A;  4WJ7 A;  1MK7 B;  2OTX A;  1V88 A;  3D8D A;  1X11 A;  2R09 A;  1M7R A;  1V61 A;  4GXB A;  2X18 A;  3TW1 A;  4KAX B;  2L1C A;  1FHW A;  5KQ4 A;  1XCG A;  4A6H A;  4C0A A;  3FSS A;  1EF1 A;  4MT7 A;  5KQ1 A;  4KHB B;  4HB3 B;  2MWN B;  5HE2 A;  1DDV A;  5C6R A;  1WG7 A;  2GCJ A;  5CLQ B;  5D3X A;  3QWM A;  1I7A A;  3O96 A;  1GC6 A;  4HAZ B;  2QKM A;  3RCP A;  1XOD A;  2MKR A;  1H10 A;  1U5E A;  2YS1 A;  2I1K A;  2D2Q A;  2RSG A;  3IVF A;  2QKL A;  3D8E A;  3QIJ A;  1TXD A;  3CXB B;  3WYF B;  2H7E A;  2DYQ A;  4K2P A;  5J3T A;  2D10 A;  1DDM A;  3PZD A;  1Q67 A;  2DHI A;  1DRO A;  5JP4 A;  5JHG A;  4EMO A;  1DBH A;  4TKN A;  2UZS A;  2ELA A;  3SNH A;  1PFJ A;  2GCL A;  3VIA A;  3PVW A;  1BWN A;  2J0M A;  3CIK A;  1GC7 A;  2L2I A;  3ZVR A;  1OQN A;  2DN6 A;  4GMX B;  4EKU A;  1UNP A;  1MKE A;  4HDO A;  4D0N B;  1U29 A;  5HE1 A;  5C16 A;  4ZRI A;  2JP2 A;  2Y8F A;  2ADZ A;  2DX1 A;  2FJL A;  1ZSQ A;  4IAP A;  5C5B A;  5L81 A;  2W2W A;  2DLW A;  1LW3 A;  1J0W A;  1Z87 A;  3ODW A;  4K2O A;  3TCA A;  2D9V A;  1WGU A;  1U5D A;  5LOP B;  5DI9 B;  3HW2 B;  5JHH A;  2DYN A;  3DXC A;  1WJ1 A;  2NMB A;  2IYB A;  1BAK A;  5J3Q A;  2Z0O A;  1DYN A;  2W2X C;  1MPH A;  4HAV B;  5DHA B;  1PLS A;  3UZT A;  1TQZ A;  1U5G A;  1UNQ A;  1WVH A;  4HB4 B;  4CHM A;  1X86 A;  1V5U A;  1RRP B;  1TJ6 A;  4DXA B;  4L6E A;  1UPQ A;  2ROZ B;  2K2J A;  1N3H A;  5LON B;  1KI1 B;  1P5T A;  2I1J A;  4F7H A;  2N0Y A;  3V5W A;  4GN1 A;  2EC1 A;  5JLJ B;  3M1I B;  2KGX B;  1U27 A;  2COA A;  2DFK A;  3AJ4 A;  2YS5 A;  4TYZ A;  1FAO A;  4F7U P;  2VRW B;  2E2X A;  2UZR A;  1V5P A;  4WVF B;  1W1G A;  3FEH A;  2M38 A;  2D9W A; 
#chains in the Genus database with same CATH topology
 4GZU A;  5DHF B;  2D11 A;  4MK0 A;  2DHK A;  2MFQ A;  4Z2N A;  5EFX A;  2KIG A;  3PEG A;  2K2U A;  4PQ0 A;  1FOE A;  2K8E A;  1XR0 B;  4YL8 A;  1XD4 A;  3TVV A;  4EJN A;  2RUK B;  1T77 A;  4A5K A;  4KHO A;  1NI2 A;  3ODO A;  3KZ1 A;  3GYP A;  2YT1 A;  1KZG A;  2R2Y A;  1OMW A;  4HB0 B;  1OY2 A;  3KRW A;  4CSQ A;  1X1F A;  1H4R A;  2FJU B;  4DX8 A;  3A8P A;  4DBB A;  2IFS A;  2DKP A;  5I2M A;  2YS3 A;  5C79 A;  1K5G B;  5C5B B;  1ISN A;  1UNR A;  2LOX A;  4YON A;  2AEH A;  4KVG B;  3VOQ A;  4Y94 A;  2P0H A;  4DX9 0;  2P0D A;  2DTC A;  1E5W A;  4HDQ A;  3PVL A;  1RJ2 A;  2P8V A;  2J0K A;  3KRX A;  3NW8 A;  3PP2 A;  4CYE A;  4HB2 B;  5FI0 A;  2RGN B;  2EJ8 A;  1K5D B;  1PMS A;  2YT0 A;  1AWE A;  3A58 A;  3SUZ A;  4KHA A;  1X1G A;  1MAI A;  1NU2 A;  2OQB A;  2R0D A;  2NZ8 B;  2N23 A;  4NY0 A;  4F7G A;  1P6S A;  1M7E A;  1UEF A;  3DXD A;  2D9Y A;  3HK0 A;  3ULB A;  2M14 A;  4QJ3 B;  2PZ1 A;  4IOY X;  1FGY A;  1DDW A;  2MDX A;  3A8Q A;  4B6H A;  4ZRK A;  4HAX B;  3B77 A;  2LOZ A;  3A98 B;  2Z4D A;  1V89 A;  5DIF B;  1BTN A;  1QC6 A;  1WGQ A;  3TFM A;  1EGX A;  3N7C A;  4P7I A;  3OAN A;  2DA0 A;  3F5R A;  1WJM A;  4HHV A;  4GOU A;  2CRF A;  5D3W A;  3F0W A;  1UPR A;  2D9Z A;  5HE0 A;  1X05 A;  4K81 A;  1W1D A;  2D9X A;  5D3V A;  5M4Y B;  2HE7 A;  2K00 A;  2EMS A;  2J0J A;  2YVC A;  4ZRJ A;  1BTK A;  4A6F B;  2Q13 A;  1FHX A;  2YT2 A;  4HAY B;  4K17 A;  2DX5 A;  5CLL B;  4MY6 A;  3QBV B;  3DXE A;  2GS0 A;  2YF0 A;  4BBK A;  3U12 A;  3ML4 A;  2RVB B;  3PG7 A;  4PNK A;  1B55 A;  3HQC A;  2LYD A;  3T06 A;  5DH9 B;  1FHO A;  2G35 A;  3OHM B;  2H7D A;  1ZC4 B;  4HAT B;  3P7Z A;  2DKQ A;  2LG1 A;  1FB8 A;  2HTH B;  3D8F A;  2UVM A;  2XQN M;  3SV1 A;  4A6K A;  1NTV A;  2EMT A;  2K49 A;  4IFS A;  1QQG A;  4A6F A;  1U2B A;  4XWX A;  3LJU X;  2GJY A;  1Y5O A;  1WI1 A;  5D3Y A;  2I5F A;  2COD A;  5GOW B;  2VSZ A;  1NTY A;  2I5C A;  3NWA A;  3X23 A;  3BJI A;  5KCV A;  1J19 A;  3MDB C;  3AU5 A;  5J3Y A;  2CAY A;  4H8S A;  2Z59 A;  1EVH A;  3ULC A;  3WA0 A;  3KY9 A;  2J59 M;  1XKE A;  2CY5 A;  2KUP A;  4QJ4 B;  2Y7B A;  4CHJ A;  3BIN A;  1ZC3 B;  1SHC A;  2BCJ A;  2W2X D;  1V5M A;  3TO1 A;  5D27 A;  3PVU A;  1ZM0 A;  1U5F A;  2RNR B;  1Y19 B;  1I2H A;  4GNK B;  1EAZ A;  2Y8G A;  2CY4 A;  3FM8 C;  4HAW B;  3ODX A;  3FVC A;  1P3R A;  2Z13 A;  5IRS A;  4GMV A;  2COF A;  2LUL A;  2RLO A;  2KCJ A;  2ELB A;  2GUM A;  2DHJ A;  2V76 A;  1ZVR A;  2ROV A;  3GYO A;  1MIZ B;  1GG3 A;  4WSF A;  4HAU B;  2Z0Q A;  1MIX A;  1AQC A;  3U7D A;  3MPX A;  1XX0 A;  1IRS A;  2VKI A;  1W1H A;  2COC A;  1KZ7 A;  3KSY A;  2Z0P A;  2KIE A;  2YRY A;  2D4Q A;  1FGZ A;  4GPT B;  3SYX A;  5FI1 A;  5HE3 A;  4OT1 A;  2ZPY A;  1LB1 A;  2AL6 A;  3P6A A;  3SO6 A;  1MK9 B;  4Z2M B;  3AU4 A;  4L1R A;  1SGH A;  3U8Z A;  3ZDT A;  2LKO A;  2P0F A;  3NSU A;  2YSZ A;  3G9W A;  3DCX A;  3PSC A;  4NSW A;  4WJ7 A;  1MK7 B;  2OTX A;  5LG4 B;  1V88 A;  3D8D A;  1X11 A;  2R09 A;  1M7R A;  1V61 A;  4GXB A;  2X18 A;  3HSA A;  3TW1 A;  4OSN A;  1MI1 A;  4KAX B;  2L1C A;  1FHW A;  5KQ4 A;  1XCG A;  4A6H A;  4C0A A;  3FSS A;  1EF1 A;  4MT7 A;  5KQ1 A;  4KHB B;  4HB3 B;  2MWN B;  5HE2 A;  1DDV A;  5C6R A;  1WG7 A;  2GCJ A;  5CLQ B;  5D3X A;  3QWM A;  1I7A A;  4DIX A;  3O96 A;  1GC6 A;  4HAZ B;  2QKM A;  3RCP A;  1XOD A;  2MKR A;  1H10 A;  1U5E A;  2YS1 A;  2I1K A;  2D2Q A;  2RSG A;  3IVF A;  2QKL A;  3D8E A;  3QIJ A;  3NWD A;  1TXD A;  3CXB B;  3WYF B;  2H7E A;  2DYQ A;  4K2P A;  4KHB A;  5J3T A;  2ZKM X;  2D10 A;  4QXA B;  1DDM A;  3HIE A;  3PZD A;  1Q67 A;  2DHI A;  1DRO A;  5JP4 A;  5JHG A;  4EMO A;  1DBH A;  4TKN A;  2UZS A;  2ELA A;  3SNH A;  2NBV A;  4HSI A;  1PFJ A;  2GCL A;  3VIA A;  3PVW A;  1BWN A;  2J0M A;  3CIK A;  1GC7 A;  2L2I A;  3ZVR A;  4D6W A;  2KUQ A;  1OQN A;  2DN6 A;  4GMX B;  4EKU A;  1UNP A;  1MKE A;  2RRF A;  4HDO A;  4D0N B;  1U29 A;  5HE1 A;  5C16 A;  4ZRI A;  2JP2 A;  2Y8F A;  2ADZ A;  2DX1 A;  2FJL A;  1ZSQ A;  4IAP A;  5C5B A;  5L81 A;  2W2W A;  2DLW A;  1LW3 A;  1J0W A;  1Z87 A;  3ODW A;  4K2O A;  3TCA A;  2D9V A;  1WGU A;  1U5D A;  5LOP B;  5DI9 B;  3HW2 B;  5JHH A;  2DYN A;  3DXC A;  1WJ1 A;  2NMB A;  2IYB A;  1BAK A;  5J3Q A;  2Z0O A;  1DYN A;  2W2X C;  1MPH A;  4HAV B;  5DHA B;  2KR0 A;  1PLS A;  3UZT A;  1TQZ A;  1U5G A;  1UNQ A;  1WVH A;  4HB4 B;  4CHM A;  1X86 A;  1V5U A;  1RRP B;  1TJ6 A;  4DXA B;  4L6E A;  1UPQ A;  2ROZ B;  2K2J A;  2Z14 A;  1N3H A;  5LON B;  4QJ5 B;  1KI1 B;  1P5T A;  2I1J A;  4F7H A;  2N0Y A;  3V5W A;  4GN1 A;  2EC1 A;  5JLJ B;  3M1I B;  2KGX B;  1U27 A;  2COA A;  2DFK A;  3AJ4 A;  5I2S A;  2YS5 A;  4TYZ A;  1ZYI A;  1FAO A;  4F7U P;  2VRW B;  2E2X A;  2UZR A;  1V5P A;  3NWF A;  4WVF B;  1W1G A;  3FEH A;  2M38 A;  2D9W A; 
#chains in the Genus database with same CATH homology
 4GZU A;  5DHF B;  2D11 A;  4MK0 A;  2DHK A;  2MFQ A;  4Z2N A;  5EFX A;  2KIG A;  3PEG A;  2K2U A;  4PQ0 A;  1FOE A;  2K8E A;  1XR0 B;  4YL8 A;  1XD4 A;  3TVV A;  4EJN A;  2RUK B;  4A5K A;  4KHO A;  1NI2 A;  3ODO A;  3KZ1 A;  3GYP A;  2YT1 A;  1KZG A;  2R2Y A;  1OMW A;  4HB0 B;  1OY2 A;  3KRW A;  4CSQ A;  1X1F A;  1H4R A;  2FJU B;  4DX8 A;  3A8P A;  4DBB A;  2IFS A;  2DKP A;  5I2M A;  2YS3 A;  5C79 A;  1K5G B;  5C5B B;  1ISN A;  1UNR A;  2LOX A;  4YON A;  2AEH A;  4KVG B;  3VOQ A;  4Y94 A;  2P0H A;  4DX9 0;  2P0D A;  2DTC A;  1E5W A;  4HDQ A;  3PVL A;  1RJ2 A;  2P8V A;  2J0K A;  3KRX A;  3NW8 A;  3PP2 A;  4CYE A;  4HB2 B;  5FI0 A;  2RGN B;  2EJ8 A;  1K5D B;  1PMS A;  2YT0 A;  1AWE A;  3A58 A;  3SUZ A;  4KHA A;  1X1G A;  1MAI A;  1NU2 A;  2OQB A;  2R0D A;  2NZ8 B;  2N23 A;  4NY0 A;  4F7G A;  1P6S A;  1M7E A;  1UEF A;  3DXD A;  2D9Y A;  3HK0 A;  3ULB A;  2M14 A;  4QJ3 B;  2PZ1 A;  4IOY X;  1FGY A;  1DDW A;  2MDX A;  3A8Q A;  4B6H A;  4ZRK A;  4HAX B;  2LOZ A;  3A98 B;  2Z4D A;  1V89 A;  5DIF B;  1BTN A;  1QC6 A;  1WGQ A;  3TFM A;  1EGX A;  3N7C A;  4P7I A;  3OAN A;  2DA0 A;  3F5R A;  1WJM A;  4HHV A;  4GOU A;  2CRF A;  5D3W A;  3F0W A;  1UPR A;  2D9Z A;  5HE0 A;  1X05 A;  4K81 A;  1W1D A;  2D9X A;  5D3V A;  5M4Y B;  2HE7 A;  2K00 A;  2EMS A;  2J0J A;  2YVC A;  4ZRJ A;  1BTK A;  4A6F B;  2Q13 A;  1FHX A;  4HAY B;  2YT2 A;  4K17 A;  2DX5 A;  5CLL B;  4MY6 A;  3QBV B;  3DXE A;  2GS0 A;  2YF0 A;  4BBK A;  3U12 A;  3ML4 A;  2RVB B;  3PG7 A;  4PNK A;  1B55 A;  3HQC A;  2LYD A;  3T06 A;  5DH9 B;  1FHO A;  2G35 A;  3OHM B;  2H7D A;  1ZC4 B;  4HAT B;  3P7Z A;  2DKQ A;  2LG1 A;  1FB8 A;  2HTH B;  3D8F A;  2UVM A;  2XQN M;  3SV1 A;  4A6K A;  1NTV A;  2EMT A;  2K49 A;  4IFS A;  1QQG A;  4A6F A;  1U2B A;  4XWX A;  3LJU X;  2GJY A;  1Y5O A;  1WI1 A;  5D3Y A;  2I5F A;  2COD A;  5GOW B;  2VSZ A;  1NTY A;  2I5C A;  3NWA A;  3X23 A;  3BJI A;  5KCV A;  1J19 A;  3MDB C;  3AU5 A;  5J3Y A;  2CAY A;  4H8S A;  2Z59 A;  1EVH A;  3ULC A;  3WA0 A;  3KY9 A;  2J59 M;  1XKE A;  2CY5 A;  2KUP A;  4QJ4 B;  2Y7B A;  4CHJ A;  3BIN A;  1ZC3 B;  1SHC A;  2BCJ A;  2W2X D;  1V5M A;  3TO1 A;  5D27 A;  3PVU A;  1ZM0 A;  1U5F A;  2RNR B;  1Y19 B;  1I2H A;  4GNK B;  1EAZ A;  2Y8G A;  2CY4 A;  3FM8 C;  4HAW B;  3ODX A;  3FVC A;  1P3R A;  2Z13 A;  5IRS A;  4GMV A;  2COF A;  2LUL A;  2RLO A;  2KCJ A;  2ELB A;  2GUM A;  2DHJ A;  2V76 A;  1ZVR A;  2ROV A;  3GYO A;  1MIZ B;  1GG3 A;  4WSF A;  4HAU B;  2Z0Q A;  1MIX A;  1AQC A;  3U7D A;  3MPX A;  1XX0 A;  1IRS A;  2VKI A;  1W1H A;  2COC A;  1KZ7 A;  3KSY A;  2Z0P A;  2KIE A;  2YRY A;  2D4Q A;  1FGZ A;  4GPT B;  3SYX A;  5FI1 A;  5HE3 A;  4OT1 A;  2ZPY A;  1LB1 A;  2AL6 A;  3P6A A;  3SO6 A;  1MK9 B;  4Z2M B;  3AU4 A;  4L1R A;  1SGH A;  3U8Z A;  3ZDT A;  2LKO A;  2P0F A;  3NSU A;  2YSZ A;  3G9W A;  3PSC A;  4NSW A;  4WJ7 A;  1MK7 B;  2OTX A;  5LG4 B;  1V88 A;  3D8D A;  1X11 A;  2R09 A;  1M7R A;  1V61 A;  4GXB A;  2X18 A;  3TW1 A;  4OSN A;  4KAX B;  2L1C A;  1FHW A;  5KQ4 A;  1XCG A;  4A6H A;  4C0A A;  3FSS A;  1EF1 A;  4MT7 A;  5KQ1 A;  4KHB B;  4HB3 B;  2MWN B;  5HE2 A;  1DDV A;  5C6R A;  1WG7 A;  2GCJ A;  5CLQ B;  5D3X A;  3QWM A;  1I7A A;  4DIX A;  3O96 A;  1GC6 A;  4HAZ B;  2QKM A;  3RCP A;  1XOD A;  2MKR A;  1H10 A;  1U5E A;  2YS1 A;  2I1K A;  2D2Q A;  2RSG A;  3IVF A;  2QKL A;  3D8E A;  3QIJ A;  3NWD A;  1TXD A;  3CXB B;  3WYF B;  2H7E A;  2DYQ A;  4K2P A;  4KHB A;  5J3T A;  2ZKM X;  2D10 A;  4QXA B;  1DDM A;  3PZD A;  3HIE A;  1Q67 A;  2DHI A;  1DRO A;  5JP4 A;  5JHG A;  4EMO A;  1DBH A;  4TKN A;  2UZS A;  2ELA A;  3SNH A;  2NBV A;  4HSI A;  1PFJ A;  2GCL A;  3VIA A;  3PVW A;  1BWN A;  2J0M A;  3CIK A;  1GC7 A;  2L2I A;  3ZVR A;  4D6W A;  2KUQ A;  1OQN A;  2DN6 A;  4GMX B;  4EKU A;  1UNP A;  1MKE A;  2RRF A;  4HDO A;  4D0N B;  1U29 A;  5HE1 A;  5C16 A;  4ZRI A;  2JP2 A;  2Y8F A;  2ADZ A;  2DX1 A;  2FJL A;  1ZSQ A;  4IAP A;  5C5B A;  5L81 A;  2W2W A;  2DLW A;  1LW3 A;  1J0W A;  1Z87 A;  3ODW A;  4K2O A;  3TCA A;  2D9V A;  1WGU A;  1U5D A;  5LOP B;  5DI9 B;  3HW2 B;  5JHH A;  2DYN A;  3DXC A;  1WJ1 A;  2NMB A;  2IYB A;  1BAK A;  5J3Q A;  2Z0O A;  1DYN A;  2W2X C;  1MPH A;  4HAV B;  5DHA B;  2KR0 A;  1PLS A;  3UZT A;  1TQZ A;  1U5G A;  1UNQ A;  1WVH A;  4HB4 B;  4CHM A;  1X86 A;  1V5U A;  1RRP B;  1TJ6 A;  4DXA B;  4L6E A;  1UPQ A;  2ROZ B;  2K2J A;  2Z14 A;  1N3H A;  5LON B;  4QJ5 B;  1KI1 B;  1P5T A;  2I1J A;  4F7H A;  2N0Y A;  3V5W A;  4GN1 A;  2EC1 A;  5JLJ B;  3M1I B;  2KGX B;  1U27 A;  2COA A;  2DFK A;  3AJ4 A;  5I2S A;  2YS5 A;  4TYZ A;  1ZYI A;  1FAO A;  4F7U P;  2VRW B;  2E2X A;  2UZR A;  1V5P A;  3NWF A;  4WVF B;  1W1G A;  3FEH A;  2M38 A;  2D9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...