2GCJA

Crystal structure of the pob3 middle domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
237
structure length
229
Chain Sequence
AGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHLLVLAIEPPLRKGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the yFACT Pob3-M Domain, Its Interaction with the DNA Replication Factor RPA, and a Potential Role in Nucleosome Deposition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
total genus 50
structure length 229
sequence length 237
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gcjA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 2gcjA01
3T06A 1U27A 5HE2A 1X1FA 2N23A 1W1HA 4NSWA 5D3WA 2QKMA 4EKUA 2G35A 5EFXA 2OQBA 2Y7BA 4TKNA 2DLWA 2EJ8A 1NTYA 3SO6A 1WVHA 5CLLB 2H7DA 2D2QA 1H4RA 1V89A 2YS5A 4B6HA 5D3VA 5LOPB 1V5MA 1DBHA 5KQ4A 2Y8GA 4WJ7A 2YS3A 1N3HA 4MK0A 5CLQB 1MIZB 2K00A 5DHAB 1DROA 2CAYA 3BJIA 2AEHA 1H10A 4XWXA 1IRSA 2M38A 4DBBA 4YONA 3PG7A 4HAWB 3GYPA 1UNRA 4KHOA 2PZ1A 3SNHA 1GC7A 2I5CA 1FB8A 3P6AA 2ELBA 3TFMA 4EMOA 3WYFB 4CHMA 1UNQA 1X86A 2COFA 1UEFA 2VKIA 3CIKA 2D9ZA 3PSCA 5LONB 1XD4A 4HAUB 4F7HA 4PNKA 4MT7A 2D9WA 2Z0OA 3LJUX 5HE0A 2GCLA 1ZC3B 4BBKA 2LOXA 3VOQA 4A6HA 5FI0A 2VSZA 3MPXA 4HAZB 1U5FA 1BTNA 2QKLA 3HW2B 2YRYA 1PLSA 2UVMA 4HB2B 4CYEA 1V5PA 1WJMA 3D8EA 2N0YA 3ML4A 1DDVA 3RCPA 1LB1A 1TJ6A 1BTKA 1V61A 4HB0B 4HDQA 3VIAA 5HE3A 3ODWA 1RRPB 3ULCA 2RLOA 2DKQA 5C6RA 2IFSA 4GN1A 4HATB 1X1GA 4IAPA 1U5GA 2I5FA 4GMXB 4WSFA 2CRFA 3SV1A 4KHAA 4KVGB 3O96A 3TCAA 2MKRA 2RGNB 1W1GA 3AU4A 2M14A 2P8VA 4KAXB 1U29A 5KCVA 3F0WA 1UPQA 3G9WA 4A6FB 1ZVRA 5D3XA 3TVVA 5JHGA 1AWEA 3MDBC 4HDOA 1SHCA 3QBVB 1V88A 2YT1A 4Z2NA 1M7EA 3KSYA 2P0DA 1EVHA 3HQCA 4WVFB 1NTVA 2MWNB 5J3QA 2YS1A 4A6FA 4PQ0A 1V5UA 2OTXA 3D8DA 1FGYA 2AL6A 2LOZA 2EMTA 1XX0A 5C79A 1KZGA 4HAXB 3SUZA 2CODA 2HE7A 1FHXA 1EAZA 2R0DA 1K5DB 1XKEA 2V76A 4Z2MB 1BAKA 3P7ZA 1EF1A 1I2HA 1P6SA 2YT0A 5DI9B 3DXDA 2GCJA 1WJ1A 1WI1A 3ODXA 3PVUA 1PMSA 2JP2A 2L2IA 2DYNA 2H7EA 3SYXA 1WGUA 2UZSA 1MAIA 4ZRKA 5C5BA 2XQNM 1DYNA 1LW3A 1KZ7A 3ZDTA 3A8QA 3M1IB 1FOEA 1ISNA 5JP4A 5C5BB 1XR0B 3ZVRA 2D9VA 1U5DA 2X18A 4DXAB 1PFJA 2W2XD 5L81A 1Y5OA 1FAOA 1EGXA 2UZRA 3NSUA 3ULBA 2D11A 3A8PA 1X05A 4YL8A 3IVFA 1TQZA 5KQ1A 2Z0PA 2DX5A 1BWNA 3TO1A 2E2XA 3PVWA 2DHKA 3A98B 2ZPYA 4ZRIA 3PEGA 4C0AA 2LULA 1UNPA 2CY5A 2KUPA 2RUKB 4GXBA 2MDXA 1MIXA 3U7DA 4NY0A 4GPTB 2HTHB 2VRWB 5JLJB 3N7CA 2ELAA 1MKEA 5D3YA 3V5WA 1Z87A 2YVCA 4GMVA 3ODOA 2LG1A 1MK9B 1E5WA 2I1JA 2Q13A 1SGHA 4HHVA 4MY6A 2ROZB 1ZSQA 1MK7B 4HAVB 1OQNA 1U5EA 1GC6A 2MFQA 4CHJA 4EJNA 2RVBB 2COCA 2DX1A 1AQCA 4TYZA 4ZRJA 4K2OA 3AJ4A 2J0MA 5J3TA 3PVLA 1OY2A 2DHIA 2J59M 5JHHA 4DX8A 1NU2A 4Y94A 1I7AA 4HB4B 4F7UP 5DH9B 4L6EA 1W1DA 1KI1B 2DHJA 2COAA 2J0JA 1Y19B 2KGXB 3QWMA 4KHBB 5GOWB 2P0HA 2EMSA 1QQGA 4IOYX 3KRXA 2ADZA 2LKOA 3WA0A 4A5KA 1MPHA 3FEHA 2J0KA 3U8ZA 5DIFB 3F5RA 1U2BA 1FGZA 1WG7A 2R09A 3BINA 4K81A 2D10A 1TXDA 2DTCA 1WGQA 5DHFB 1P3RA 4H8SA 5C16A 2RSGA 4HAYB 5D27A 2D9YA 2ROVA 5HE1A 2DN6A 1RJ2A 1M7RA 2W2WA 3KRWA 3HK0A 3PZDA 2L1CA 3TW1A 1DDMA 2FJLA 3DXEA 2YSZA 1ZM0A 4DX90 2K2UA 1FHOA 2DKPA 4HB3B 2NMBA 1B55A 4D0NB 1Q67A 2D4QA 2YF0A 3CXBB 2BCJA 4F7GA 4K17A 1J0WA 2NZ8B 3KZ1A 4P7IA 2Y8FA 4A6KA 4GZUA 1DDWA 2KCJA 1X11A 3X23A 2LYDA 3DXCA 3FM8C 1P5TA 3FSSA 2EC1A 2DA0A 2IYBA 2DFKA 1OMWA 3OANA 1XCGA 1QC6A 2DYQA 3UZTA 5FI1A 2GS0A 3QIJA 1K5GB 3AU5A 2I1KA 3GYOA 3KY9A 4K2PA 4IFSA 1FHWA 1J19A 1ZC4B 5J3YA 1GG3A 1NI2A 2GJYA 2P0FA 2Z0QA 3D8FA 2K2JA 2RNRB 2W2XC 1UPRA 2CY4A 3PP2A 1XODA 2D9XA
chains in the Genus database with same CATH superfamily
3T06A 1U27A 5HE2A 1X1FA 4D6WA 2N23A 1W1HA 4NSWA 5D3WA 2QKMA 2K49A 4EKUA 2G35A 5EFXA 2OQBA 2Y7BA 4TKNA 2DLWA 2EJ8A 1NTYA 3SO6A 1WVHA 5CLLB 2H7DA 2D2QA 1H4RA 1V89A 4QXAB 2YS5A 4B6HA 5D3VA 2Z59A 5LOPB 1V5MA 1DBHA 5KQ4A 2Y8GA 4WJ7A 2YS3A 1N3HA 4MK0A 5CLQB 1MIZB 1ZYIA 2K00A 5DHAB 1DROA 2CAYA 3BJIA 2AEHA 1H10A 4XWXA 1IRSA 2M38A 4DBBA 4YONA 3PG7A 4HAWB 3GYPA 1UNRA 4KHOA 2PZ1A 3SNHA 1GC7A 2I5CA 1FB8A 3P6AA 2ELBA 4GNKB 3TFMA 4QJ5B 4EMOA 3WYFB 4CHMA 1UNQA 1X86A 2COFA 1UEFA 2VKIA 3CIKA 2D9ZA 3PSCA 5LONB 1XD4A 4HAUB 4F7HA 2KIGA 4PNKA 4MT7A 2D9WA 2Z0OA 3LJUX 5HE0A 2GCLA 1ZC3B 4BBKA 2LOXA 3VOQA 4A6HA 5FI0A 2VSZA 3MPXA 4HAZB 1U5FA 1BTNA 2QKLA 4HSIA 3HW2B 2YRYA 1PLSA 2UVMA 4HB2B 4CYEA 1V5PA 1WJMA 3D8EA 3DCXA 2N0YA 3ML4A 1DDVA 3RCPA 1LB1A 1TJ6A 1BTKA 3FVCA 1T77A 1V61A 4HB0B 4HDQA 3VIAA 5HE3A 3ODWA 1RRPB 3ULCA 2RLOA 2DKQA 5C6RA 2IFSA 4GN1A 4HATB 1X1GA 4IAPA 1U5GA 2I5FA 4GMXB 4WSFA 2CRFA 3SV1A 4KHAA 4KVGB 3O96A 3TCAA 2MKRA 2RGNB 2ZKMX 1W1GA 3AU4A 2M14A 2P8VA 4KAXB 1U29A 5KCVA 3F0WA 2KR0A 1UPQA 3A58A 2RRFA 3G9WA 4A6FB 4L1RA 1ZVRA 5D3XA 3TVVA 5JHGA 1AWEA 3MDBC 4HDOA 1SHCA 3QBVB 1V88A 2YT1A 4Z2NA 3B77A 1M7EA 3KSYA 2P0DA 1EVHA 3HQCA 3NWFA 4WVFB 1NTVA 2MWNB 5J3QA 4QJ3B 2YS1A 4A6FA 4PQ0A 1V5UA 2OTXA 4OT1A 3D8DA 1FGYA 2AL6A 2LOZA 2EMTA 1XX0A 2YT2A 2Z13A 5C79A 1KZGA 4HAXB 3SUZA 2CODA 2HE7A 1FHXA 1EAZA 2R0DA 1K5DB 1XKEA 2V76A 4Z2MB 1BAKA 3P7ZA 1EF1A 1I2HA 1P6SA 2YT0A 5DI9B 3DXDA 2GCJA 1WJ1A 1WI1A 3ODXA 3PVUA 1PMSA 2JP2A 2L2IA 2DYNA 2H7EA 3SYXA 1WGUA 2UZSA 1MAIA 4ZRKA 5C5BA 2XQNM 1DYNA 1LW3A 1KZ7A 3ZDTA 3A8QA 3M1IB 1FOEA 1ISNA 2Z14A 5JP4A 5C5BB 1XR0B 4GOUA 2FJUB 3ZVRA 2D9VA 1U5DA 2X18A 4DXAB 1PFJA 1MI1A 2W2XD 5L81A 1Y5OA 1FAOA 1EGXA 2UZRA 3NSUA 3ULBA 2D11A 3A8PA 1X05A 4YL8A 4CSQA 3IVFA 1TQZA 5KQ1A 2Z0PA 2DX5A 1BWNA 3NW8A 3TO1A 2E2XA 3PVWA 2DHKA 2R2YA 3A98B 2ZPYA 4ZRIA 3PEGA 4C0AA 2LULA 1UNPA 2CY5A 2KUPA 2RUKB 4GXBA 4OSNA 2MDXA 1MIXA 3U7DA 4NY0A 4GPTB 5LG4B 2HTHB 2VRWB 5JLJB 3N7CA 2ELAA 2NBVA 1MKEA 5D3YA 3V5WA 1Z87A 2YVCA 4GMVA 3ODOA 2LG1A 1MK9B 1E5WA 2I1JA 2Q13A 1SGHA 4HHVA 4MY6A 2ROZB 1ZSQA 2K8EA 1MK7B 4HAVB 1OQNA 1U5EA 1GC6A 2MFQA 4CHJA 4EJNA 2RVBB 2COCA 2DX1A 1AQCA 4TYZA 4ZRJA 4K2OA 3AJ4A 2J0MA 5J3TA 3PVLA 1OY2A 2DHIA 2J59M 5JHHA 4DX8A 1NU2A 4Y94A 1I7AA 4HB4B 4F7UP 5DH9B 4L6EA 1W1DA 1KI1B 2DHJA 2COAA 2J0JA 1Y19B 2KGXB 3QWMA 4KHBB 5GOWB 2P0HA 2EMSA 2Z4DA 1QQGA 4IOYX 3KRXA 2KIEA 3HSAA 2ADZA 2LKOA 3WA0A 4A5KA 2GUMA 1MPHA 3FEHA 2J0KA 3U8ZA 5DIFB 3F5RA 1U2BA 1FGZA 1WG7A 2R09A 3BINA 3NWAA 4K81A 4QJ4B 2D10A 1TXDA 2DTCA 1WGQA 5DHFB 1P3RA 4H8SA 5C16A 2RSGA 4HAYB 5D27A 2D9YA 2ROVA 5HE1A 2DN6A 1RJ2A 3OHMB 1M7RA 2W2WA 3HK0A 3PZDA 2L1CA 3KRWA 3TW1A 1DDMA 2FJLA 3DXEA 2YSZA 1ZM0A 4DX90 2K2UA 1FHOA 2DKPA 4HB3B 2NMBA 1B55A 4D0NB 1Q67A 5IRSA 2D4QA 2YF0A 3CXBB 3NWDA 2BCJA 4F7GA 4K17A 1J0WA 2NZ8B 3KZ1A 4P7IA 4DIXA 2Y8FA 4A6KA 4GZUA 1DDWA 2KUQA 2KCJA 1X11A 3X23A 2LYDA 3DXCA 3FM8C 1P5TA 3FSSA 2EC1A 2DA0A 2IYBA 2DFKA 1OMWA 3OANA 3HIEA 1XCGA 1QC6A 2DYQA 3UZTA 5I2MA 5FI1A 2GS0A 3QIJA 1K5GB 3AU5A 2I1KA 3GYOA 3KY9A 4K2PA 4IFSA 1FHWA 1J19A 1ZC4B 5J3YA 1GG3A 1NI2A 2GJYA 2P0FA 2Z0QA 3D8FA 2K2JA 2RNRB 5M4YB 2W2XC 1UPRA 2CY4A 3U12A 3PP2A 1XODA 4KHBA 5I2SA 2D9XA
chains in the Genus database with same CATH topology
3T06A 1U27A 5HE2A 1X1FA 4D6WA 2N23A 1W1HA 4NSWA 5D3WA 2QKMA 2K49A 4EKUA 2G35A 5EFXA 2OQBA 2Y7BA 4TKNA 2DLWA 2EJ8A 1NTYA 3SO6A 1WVHA 5CLLB 2H7DA 2D2QA 1H4RA 1V89A 4QXAB 2YS5A 4B6HA 5D3VA 2Z59A 5LOPB 1V5MA 1DBHA 5KQ4A 2Y8GA 4WJ7A 2YS3A 1N3HA 4MK0A 5CLQB 1MIZB 1ZYIA 2K00A 5DHAB 1DROA 2CAYA 3BJIA 2AEHA 1H10A 4XWXA 1IRSA 2M38A 4DBBA 4YONA 3PG7A 4HAWB 3GYPA 1UNRA 4KHOA 2PZ1A 3SNHA 1GC7A 2I5CA 1FB8A 3P6AA 2ELBA 4GNKB 3TFMA 4QJ5B 4EMOA 3WYFB 4CHMA 1UNQA 1X86A 2COFA 1UEFA 2VKIA 3CIKA 2D9ZA 3PSCA 5LONB 1XD4A 4HAUB 4F7HA 2KIGA 4PNKA 4MT7A 2D9WA 2Z0OA 3LJUX 5HE0A 2GCLA 1ZC3B 4BBKA 2LOXA 3VOQA 4A6HA 5FI0A 2VSZA 3MPXA 4HAZB 1U5FA 1BTNA 2QKLA 4HSIA 3HW2B 2YRYA 1PLSA 2UVMA 4HB2B 4CYEA 1V5PA 1WJMA 3D8EA 2N0YA 3ML4A 1DDVA 3RCPA 1LB1A 1TJ6A 1BTKA 3FVCA 1V61A 4HB0B 4HDQA 3VIAA 5HE3A 3ODWA 1RRPB 3ULCA 2RLOA 2DKQA 5C6RA 2IFSA 4GN1A 4HATB 1X1GA 4IAPA 1U5GA 2I5FA 4GMXB 4WSFA 2CRFA 3SV1A 4KHAA 4KVGB 3O96A 3TCAA 2MKRA 2RGNB 2ZKMX 1W1GA 3AU4A 2M14A 2P8VA 4KAXB 1U29A 5KCVA 3F0WA 2KR0A 1UPQA 3A58A 3G9WA 2RRFA 4A6FB 4L1RA 1ZVRA 5D3XA 3TVVA 5JHGA 1AWEA 3MDBC 4HDOA 1SHCA 3QBVB 1V88A 2YT1A 4Z2NA 1M7EA 3KSYA 2P0DA 1EVHA 3HQCA 3NWFA 4WVFB 1NTVA 2MWNB 5J3QA 4QJ3B 2YS1A 4A6FA 4PQ0A 1V5UA 2OTXA 4OT1A 3D8DA 1FGYA 2AL6A 2LOZA 2EMTA 1XX0A 5C79A 2YT2A 2Z13A 1KZGA 4HAXB 3SUZA 2CODA 2HE7A 1FHXA 1EAZA 2R0DA 1K5DB 1XKEA 2V76A 4Z2MB 1BAKA 3P7ZA 1EF1A 1I2HA 1P6SA 2YT0A 5DI9B 3DXDA 2GCJA 1WJ1A 1WI1A 3ODXA 3PVUA 1PMSA 2JP2A 2L2IA 2DYNA 2H7EA 3SYXA 1WGUA 2UZSA 1MAIA 4ZRKA 5C5BA 2XQNM 1DYNA 1LW3A 1KZ7A 3ZDTA 3A8QA 3M1IB 1FOEA 1ISNA 5JP4A 2Z14A 5C5BB 1XR0B 4GOUA 3ZVRA 2FJUB 2D9VA 1U5DA 2X18A 4DXAB 1PFJA 2W2XD 5L81A 1Y5OA 1FAOA 1EGXA 2UZRA 3NSUA 3ULBA 2D11A 3A8PA 1X05A 4YL8A 4CSQA 3IVFA 1TQZA 5KQ1A 2Z0PA 2DX5A 1BWNA 3NW8A 3TO1A 2E2XA 3PVWA 2DHKA 2R2YA 3A98B 2ZPYA 4ZRIA 3PEGA 4C0AA 2LULA 1UNPA 2CY5A 2KUPA 2RUKB 4GXBA 4OSNA 2MDXA 1MIXA 3U7DA 4NY0A 4GPTB 5LG4B 2HTHB 2VRWB 5JLJB 3N7CA 2ELAA 2NBVA 1MKEA 5D3YA 3V5WA 1Z87A 2YVCA 4GMVA 3ODOA 2LG1A 1MK9B 1E5WA 2I1JA 2Q13A 1SGHA 4HHVA 4MY6A 2ROZB 1ZSQA 2K8EA 1MK7B 4HAVB 1OQNA 1U5EA 1GC6A 2MFQA 4CHJA 4EJNA 2RVBB 2COCA 2DX1A 1AQCA 4TYZA 4ZRJA 4K2OA 3AJ4A 2J0MA 5J3TA 3PVLA 1OY2A 2DHIA 2J59M 5JHHA 4DX8A 1NU2A 4Y94A 1I7AA 4HB4B 4F7UP 5DH9B 4L6EA 1W1DA 1KI1B 2DHJA 2COAA 2J0JA 1Y19B 2KGXB 3QWMA 4KHBB 5GOWB 2P0HA 2EMSA 2Z4DA 1QQGA 4IOYX 3KRXA 2KIEA 2ADZA 2LKOA 3WA0A 4A5KA 2GUMA 1MPHA 3FEHA 2J0KA 3U8ZA 5DIFB 3F5RA 1U2BA 1FGZA 1WG7A 2R09A 3BINA 3NWAA 4K81A 4QJ4B 2D10A 1TXDA 2DTCA 1WGQA 5DHFB 1P3RA 4H8SA 5C16A 2RSGA 4HAYB 5D27A 2D9YA 2ROVA 5HE1A 2DN6A 1RJ2A 1M7RA 2W2WA 3KRWA 3HK0A 3PZDA 2L1CA 3TW1A 3OHMB 1DDMA 2FJLA 3DXEA 2YSZA 1ZM0A 4DX90 2K2UA 1FHOA 2DKPA 4HB3B 2NMBA 1B55A 4D0NB 1Q67A 5IRSA 2D4QA 2YF0A 3CXBB 3NWDA 2BCJA 4F7GA 4K17A 1J0WA 2NZ8B 3KZ1A 4P7IA 4DIXA 2Y8FA 4A6KA 4GZUA 1DDWA 2KUQA 2KCJA 1X11A 3X23A 2LYDA 3DXCA 3FM8C 1P5TA 3FSSA 2EC1A 2DA0A 2IYBA 2DFKA 1OMWA 3OANA 3HIEA 1XCGA 1QC6A 2DYQA 3UZTA 5I2MA 5FI1A 2GS0A 3QIJA 1K5GB 3AU5A 2I1KA 3GYOA 3KY9A 4K2PA 4IFSA 1FHWA 1J19A 1ZC4B 5J3YA 1GG3A 1NI2A 2GJYA 2P0FA 2Z0QA 3D8FA 2K2JA 2RNRB 5M4YB 2W2XC 1UPRA 2CY4A 3U12A 3PP2A 1XODA 4KHBA 5I2SA 2D9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T06 A;  1U27 A;  5HE2 A;  1X1F A;  2N23 A;  1W1H A;  4NSW A;  5D3W A;  2QKM A;  4EKU A;  2G35 A;  5EFX A;  2OQB A;  2Y7B A;  4TKN A;  2DLW A;  2EJ8 A;  1NTY A;  3SO6 A;  1WVH A;  5CLL B;  2H7D A;  2D2Q A;  1H4R A;  1V89 A;  2YS5 A;  4B6H A;  5D3V A;  5LOP B;  1V5M A;  1DBH A;  5KQ4 A;  2Y8G A;  4WJ7 A;  2YS3 A;  1N3H A;  4MK0 A;  5CLQ B;  1MIZ B;  2K00 A;  5DHA B;  1DRO A;  2CAY A;  3BJI A;  2AEH A;  1H10 A;  4XWX A;  1IRS A;  2M38 A;  4DBB A;  4YON A;  3PG7 A;  4HAW B;  3GYP A;  1UNR A;  4KHO A;  2PZ1 A;  3SNH A;  1GC7 A;  2I5C A;  1FB8 A;  3P6A A;  2ELB A;  3TFM A;  4EMO A;  3WYF B;  4CHM A;  1UNQ A;  1X86 A;  2COF A;  1UEF A;  2VKI A;  3CIK A;  2D9Z A;  3PSC A;  5LON B;  1XD4 A;  4HAU B;  4F7H A;  4PNK A;  4MT7 A;  2D9W A;  2Z0O A;  3LJU X;  5HE0 A;  2GCL A;  1ZC3 B;  4BBK A;  2LOX A;  3VOQ A;  4A6H A;  5FI0 A;  2VSZ A;  3MPX A;  4HAZ B;  1U5F A;  1BTN A;  2QKL A;  3HW2 B;  2YRY A;  1PLS A;  2UVM A;  4HB2 B;  4CYE A;  1V5P A;  1WJM A;  3D8E A;  2N0Y A;  3ML4 A;  1DDV A;  3RCP A;  1LB1 A;  1TJ6 A;  1BTK A;  1V61 A;  4HB0 B;  4HDQ A;  3VIA A;  5HE3 A;  3ODW A;  1RRP B;  3ULC A;  2RLO A;  2DKQ A;  5C6R A;  2IFS A;  4GN1 A;  4HAT B;  1X1G A;  4IAP A;  1U5G A;  2I5F A;  4GMX B;  4WSF A;  2CRF A;  3SV1 A;  4KHA A;  4KVG B;  3O96 A;  3TCA A;  2MKR A;  2RGN B;  1W1G A;  3AU4 A;  2M14 A;  2P8V A;  4KAX B;  1U29 A;  5KCV A;  3F0W A;  1UPQ A;  3G9W A;  4A6F B;  1ZVR A;  5D3X A;  3TVV A;  5JHG A;  1AWE A;  3MDB C;  4HDO A;  1SHC A;  3QBV B;  1V88 A;  2YT1 A;  4Z2N A;  1M7E A;  3KSY A;  2P0D A;  1EVH A;  3HQC A;  4WVF B;  1NTV A;  2MWN B;  5J3Q A;  2YS1 A;  4A6F A;  4PQ0 A;  1V5U A;  2OTX A;  3D8D A;  1FGY A;  2AL6 A;  2LOZ A;  2EMT A;  1XX0 A;  5C79 A;  1KZG A;  4HAX B;  3SUZ A;  2COD A;  2HE7 A;  1FHX A;  1EAZ A;  2R0D A;  1K5D B;  1XKE A;  2V76 A;  4Z2M B;  1BAK A;  3P7Z A;  1EF1 A;  1I2H A;  1P6S A;  2YT0 A;  5DI9 B;  3DXD A;  2GCJ A;  1WJ1 A;  1WI1 A;  3ODX A;  3PVU A;  1PMS A;  2JP2 A;  2L2I A;  2DYN A;  2H7E A;  3SYX A;  1WGU A;  2UZS A;  1MAI A;  4ZRK A;  5C5B A;  2XQN M;  1DYN A;  1LW3 A;  1KZ7 A;  3ZDT A;  3A8Q A;  3M1I B;  1FOE A;  1ISN A;  5JP4 A;  5C5B B;  1XR0 B;  3ZVR A;  2D9V A;  1U5D A;  2X18 A;  4DXA B;  1PFJ A;  2W2X D;  5L81 A;  1Y5O A;  1FAO A;  1EGX A;  2UZR A;  3NSU A;  3ULB A;  2D11 A;  3A8P A;  1X05 A;  4YL8 A;  3IVF A;  1TQZ A;  5KQ1 A;  2Z0P A;  2DX5 A;  1BWN A;  3TO1 A;  2E2X A;  3PVW A;  2DHK A;  3A98 B;  2ZPY A;  4ZRI A;  3PEG A;  4C0A A;  2LUL A;  1UNP A;  2CY5 A;  2KUP A;  2RUK B;  4GXB A;  2MDX A;  1MIX A;  3U7D A;  4NY0 A;  4GPT B;  2HTH B;  2VRW B;  5JLJ B;  3N7C A;  2ELA A;  1MKE A;  5D3Y A;  3V5W A;  1Z87 A;  2YVC A;  4GMV A;  3ODO A;  2LG1 A;  1MK9 B;  1E5W A;  2I1J A;  2Q13 A;  1SGH A;  4HHV A;  4MY6 A;  2ROZ B;  1ZSQ A;  1MK7 B;  4HAV B;  1OQN A;  1U5E A;  1GC6 A;  2MFQ A;  4CHJ A;  4EJN A;  2RVB B;  2COC A;  2DX1 A;  1AQC A;  4TYZ A;  4ZRJ A;  4K2O A;  3AJ4 A;  2J0M A;  5J3T A;  3PVL A;  1OY2 A;  2DHI A;  2J59 M;  5JHH A;  4DX8 A;  1NU2 A;  4Y94 A;  1I7A A;  4HB4 B;  4F7U P;  5DH9 B;  4L6E A;  1W1D A;  1KI1 B;  2DHJ A;  2COA A;  2J0J A;  1Y19 B;  2KGX B;  3QWM A;  4KHB B;  5GOW B;  2P0H A;  2EMS A;  1QQG A;  4IOY X;  3KRX A;  2ADZ A;  2LKO A;  3WA0 A;  4A5K A;  1MPH A;  3FEH A;  2J0K A;  3U8Z A;  5DIF B;  3F5R A;  1U2B A;  1FGZ A;  1WG7 A;  2R09 A;  3BIN A;  4K81 A;  2D10 A;  1TXD A;  2DTC A;  1WGQ A;  5DHF B;  1P3R A;  4H8S A;  5C16 A;  2RSG A;  4HAY B;  5D27 A;  2D9Y A;  2ROV A;  5HE1 A;  2DN6 A;  1RJ2 A;  1M7R A;  2W2W A;  3KRW A;  3HK0 A;  3PZD A;  2L1C A;  3TW1 A;  1DDM A;  2FJL A;  3DXE A;  2YSZ A;  1ZM0 A;  4DX9 0;  2K2U A;  1FHO A;  2DKP A;  4HB3 B;  2NMB A;  1B55 A;  4D0N B;  1Q67 A;  2D4Q A;  2YF0 A;  3CXB B;  2BCJ A;  4F7G A;  4K17 A;  1J0W A;  2NZ8 B;  3KZ1 A;  4P7I A;  2Y8F A;  4A6K A;  4GZU A;  1DDW A;  2KCJ A;  1X11 A;  3X23 A;  2LYD A;  3DXC A;  3FM8 C;  1P5T A;  3FSS A;  2EC1 A;  2DA0 A;  2IYB A;  2DFK A;  1OMW A;  3OAN A;  1XCG A;  1QC6 A;  2DYQ A;  3UZT A;  5FI1 A;  2GS0 A;  3QIJ A;  1K5G B;  3AU5 A;  2I1K A;  3GYO A;  3KY9 A;  4K2P A;  4IFS A;  1FHW A;  1J19 A;  1ZC4 B;  5J3Y A;  1GG3 A;  1NI2 A;  2GJY A;  2P0F A;  2Z0Q A;  3D8F A;  2K2J A;  2RNR B;  2W2X C;  1UPR A;  2CY4 A;  3PP2 A;  1XOD A;  2D9X A; 
#chains in the Genus database with same CATH topology
 3T06 A;  1U27 A;  5HE2 A;  1X1F A;  4D6W A;  2N23 A;  1W1H A;  4NSW A;  5D3W A;  2QKM A;  2K49 A;  4EKU A;  2G35 A;  5EFX A;  2OQB A;  2Y7B A;  4TKN A;  2DLW A;  2EJ8 A;  1NTY A;  3SO6 A;  1WVH A;  5CLL B;  2H7D A;  2D2Q A;  1H4R A;  1V89 A;  4QXA B;  2YS5 A;  4B6H A;  5D3V A;  2Z59 A;  5LOP B;  1V5M A;  1DBH A;  5KQ4 A;  2Y8G A;  4WJ7 A;  2YS3 A;  1N3H A;  4MK0 A;  5CLQ B;  1MIZ B;  1ZYI A;  2K00 A;  5DHA B;  1DRO A;  2CAY A;  3BJI A;  2AEH A;  1H10 A;  4XWX A;  1IRS A;  2M38 A;  4DBB A;  4YON A;  3PG7 A;  4HAW B;  3GYP A;  1UNR A;  4KHO A;  2PZ1 A;  3SNH A;  1GC7 A;  2I5C A;  1FB8 A;  3P6A A;  2ELB A;  4GNK B;  3TFM A;  4QJ5 B;  4EMO A;  3WYF B;  4CHM A;  1UNQ A;  1X86 A;  2COF A;  1UEF A;  2VKI A;  3CIK A;  2D9Z A;  3PSC A;  5LON B;  1XD4 A;  4HAU B;  4F7H A;  2KIG A;  4PNK A;  4MT7 A;  2D9W A;  2Z0O A;  3LJU X;  5HE0 A;  2GCL A;  1ZC3 B;  4BBK A;  2LOX A;  3VOQ A;  4A6H A;  5FI0 A;  2VSZ A;  3MPX A;  4HAZ B;  1U5F A;  1BTN A;  2QKL A;  4HSI A;  3HW2 B;  2YRY A;  1PLS A;  2UVM A;  4HB2 B;  4CYE A;  1V5P A;  1WJM A;  3D8E A;  3DCX A;  2N0Y A;  3ML4 A;  1DDV A;  3RCP A;  1LB1 A;  1TJ6 A;  1BTK A;  3FVC A;  1T77 A;  1V61 A;  4HB0 B;  4HDQ A;  3VIA A;  5HE3 A;  3ODW A;  1RRP B;  3ULC A;  2RLO A;  2DKQ A;  5C6R A;  2IFS A;  4GN1 A;  4HAT B;  1X1G A;  4IAP A;  1U5G A;  2I5F A;  4GMX B;  4WSF A;  2CRF A;  3SV1 A;  4KHA A;  4KVG B;  3O96 A;  3TCA A;  2MKR A;  2RGN B;  2ZKM X;  1W1G A;  3AU4 A;  2M14 A;  2P8V A;  4KAX B;  1U29 A;  5KCV A;  3F0W A;  2KR0 A;  1UPQ A;  3A58 A;  2RRF A;  3G9W A;  4A6F B;  4L1R A;  1ZVR A;  5D3X A;  3TVV A;  5JHG A;  1AWE A;  3MDB C;  4HDO A;  1SHC A;  3QBV B;  1V88 A;  2YT1 A;  4Z2N A;  3B77 A;  1M7E A;  3KSY A;  2P0D A;  1EVH A;  3HQC A;  3NWF A;  4WVF B;  1NTV A;  2MWN B;  5J3Q A;  4QJ3 B;  2YS1 A;  4A6F A;  4PQ0 A;  1V5U A;  2OTX A;  4OT1 A;  3D8D A;  1FGY A;  2AL6 A;  2LOZ A;  2EMT A;  1XX0 A;  2YT2 A;  2Z13 A;  5C79 A;  1KZG A;  4HAX B;  3SUZ A;  2COD A;  2HE7 A;  1FHX A;  1EAZ A;  2R0D A;  1K5D B;  1XKE A;  2V76 A;  4Z2M B;  1BAK A;  3P7Z A;  1EF1 A;  1I2H A;  1P6S A;  2YT0 A;  5DI9 B;  3DXD A;  2GCJ A;  1WJ1 A;  1WI1 A;  3ODX A;  3PVU A;  1PMS A;  2JP2 A;  2L2I A;  2DYN A;  2H7E A;  3SYX A;  1WGU A;  2UZS A;  1MAI A;  4ZRK A;  5C5B A;  2XQN M;  1DYN A;  1LW3 A;  1KZ7 A;  3ZDT A;  3A8Q A;  3M1I B;  1FOE A;  1ISN A;  2Z14 A;  5JP4 A;  5C5B B;  1XR0 B;  4GOU A;  2FJU B;  3ZVR A;  2D9V A;  1U5D A;  2X18 A;  4DXA B;  1PFJ A;  1MI1 A;  2W2X D;  5L81 A;  1Y5O A;  1FAO A;  1EGX A;  2UZR A;  3NSU A;  3ULB A;  2D11 A;  3A8P A;  1X05 A;  4YL8 A;  4CSQ A;  3IVF A;  1TQZ A;  5KQ1 A;  2Z0P A;  2DX5 A;  1BWN A;  3NW8 A;  3TO1 A;  2E2X A;  3PVW A;  2DHK A;  2R2Y A;  3A98 B;  2ZPY A;  4ZRI A;  3PEG A;  4C0A A;  2LUL A;  1UNP A;  2CY5 A;  2KUP A;  2RUK B;  4GXB A;  4OSN A;  2MDX A;  1MIX A;  3U7D A;  4NY0 A;  4GPT B;  5LG4 B;  2HTH B;  2VRW B;  5JLJ B;  3N7C A;  2ELA A;  2NBV A;  1MKE A;  5D3Y A;  3V5W A;  1Z87 A;  2YVC A;  4GMV A;  3ODO A;  2LG1 A;  1MK9 B;  1E5W A;  2I1J A;  2Q13 A;  1SGH A;  4HHV A;  4MY6 A;  2ROZ B;  1ZSQ A;  2K8E A;  1MK7 B;  4HAV B;  1OQN A;  1U5E A;  1GC6 A;  2MFQ A;  4CHJ A;  4EJN A;  2RVB B;  2COC A;  2DX1 A;  1AQC A;  4TYZ A;  4ZRJ A;  4K2O A;  3AJ4 A;  2J0M A;  5J3T A;  3PVL A;  1OY2 A;  2DHI A;  2J59 M;  5JHH A;  4DX8 A;  1NU2 A;  4Y94 A;  1I7A A;  4HB4 B;  4F7U P;  5DH9 B;  4L6E A;  1W1D A;  1KI1 B;  2DHJ A;  2COA A;  2J0J A;  1Y19 B;  2KGX B;  3QWM A;  4KHB B;  5GOW B;  2P0H A;  2EMS A;  2Z4D A;  1QQG A;  4IOY X;  3KRX A;  2KIE A;  3HSA A;  2ADZ A;  2LKO A;  3WA0 A;  4A5K A;  2GUM A;  1MPH A;  3FEH A;  2J0K A;  3U8Z A;  5DIF B;  3F5R A;  1U2B A;  1FGZ A;  1WG7 A;  2R09 A;  3BIN A;  3NWA A;  4K81 A;  4QJ4 B;  2D10 A;  1TXD A;  2DTC A;  1WGQ A;  5DHF B;  1P3R A;  4H8S A;  5C16 A;  2RSG A;  4HAY B;  5D27 A;  2D9Y A;  2ROV A;  5HE1 A;  2DN6 A;  1RJ2 A;  3OHM B;  1M7R A;  2W2W A;  3HK0 A;  3PZD A;  2L1C A;  3KRW A;  3TW1 A;  1DDM A;  2FJL A;  3DXE A;  2YSZ A;  1ZM0 A;  4DX9 0;  2K2U A;  1FHO A;  2DKP A;  4HB3 B;  2NMB A;  1B55 A;  4D0N B;  1Q67 A;  5IRS A;  2D4Q A;  2YF0 A;  3CXB B;  3NWD A;  2BCJ A;  4F7G A;  4K17 A;  1J0W A;  2NZ8 B;  3KZ1 A;  4P7I A;  4DIX A;  2Y8F A;  4A6K A;  4GZU A;  1DDW A;  2KUQ A;  2KCJ A;  1X11 A;  3X23 A;  2LYD A;  3DXC A;  3FM8 C;  1P5T A;  3FSS A;  2EC1 A;  2DA0 A;  2IYB A;  2DFK A;  1OMW A;  3OAN A;  3HIE A;  1XCG A;  1QC6 A;  2DYQ A;  3UZT A;  5I2M A;  5FI1 A;  2GS0 A;  3QIJ A;  1K5G B;  3AU5 A;  2I1K A;  3GYO A;  3KY9 A;  4K2P A;  4IFS A;  1FHW A;  1J19 A;  1ZC4 B;  5J3Y A;  1GG3 A;  1NI2 A;  2GJY A;  2P0F A;  2Z0Q A;  3D8F A;  2K2J A;  2RNR B;  5M4Y B;  2W2X C;  1UPR A;  2CY4 A;  3U12 A;  3PP2 A;  1XOD A;  4KHB A;  5I2S A;  2D9X A; 
#chains in the Genus database with same CATH homology
 3T06 A;  1U27 A;  5HE2 A;  1X1F A;  4D6W A;  2N23 A;  1W1H A;  4NSW A;  5D3W A;  2QKM A;  2K49 A;  4EKU A;  2G35 A;  5EFX A;  2OQB A;  2Y7B A;  4TKN A;  2DLW A;  2EJ8 A;  1NTY A;  3SO6 A;  1WVH A;  5CLL B;  2H7D A;  2D2Q A;  1H4R A;  1V89 A;  4QXA B;  2YS5 A;  4B6H A;  5D3V A;  2Z59 A;  5LOP B;  1V5M A;  1DBH A;  5KQ4 A;  2Y8G A;  4WJ7 A;  2YS3 A;  1N3H A;  4MK0 A;  5CLQ B;  1MIZ B;  1ZYI A;  2K00 A;  5DHA B;  1DRO A;  2CAY A;  3BJI A;  2AEH A;  1H10 A;  4XWX A;  1IRS A;  2M38 A;  4DBB A;  4YON A;  3PG7 A;  4HAW B;  3GYP A;  1UNR A;  4KHO A;  2PZ1 A;  3SNH A;  1GC7 A;  2I5C A;  1FB8 A;  3P6A A;  2ELB A;  4GNK B;  3TFM A;  4QJ5 B;  4EMO A;  3WYF B;  4CHM A;  1UNQ A;  1X86 A;  2COF A;  1UEF A;  2VKI A;  3CIK A;  2D9Z A;  3PSC A;  5LON B;  1XD4 A;  4HAU B;  4F7H A;  2KIG A;  4PNK A;  4MT7 A;  2D9W A;  2Z0O A;  3LJU X;  5HE0 A;  2GCL A;  1ZC3 B;  4BBK A;  2LOX A;  3VOQ A;  4A6H A;  5FI0 A;  2VSZ A;  3MPX A;  4HAZ B;  1U5F A;  1BTN A;  2QKL A;  4HSI A;  3HW2 B;  2YRY A;  1PLS A;  2UVM A;  4HB2 B;  4CYE A;  1V5P A;  1WJM A;  3D8E A;  2N0Y A;  3ML4 A;  1DDV A;  3RCP A;  1LB1 A;  1TJ6 A;  1BTK A;  3FVC A;  1V61 A;  4HB0 B;  4HDQ A;  3VIA A;  5HE3 A;  3ODW A;  1RRP B;  3ULC A;  2RLO A;  2DKQ A;  5C6R A;  2IFS A;  4GN1 A;  4HAT B;  1X1G A;  4IAP A;  1U5G A;  2I5F A;  4GMX B;  4WSF A;  2CRF A;  3SV1 A;  4KHA A;  4KVG B;  3O96 A;  3TCA A;  2MKR A;  2RGN B;  2ZKM X;  1W1G A;  3AU4 A;  2M14 A;  2P8V A;  4KAX B;  1U29 A;  5KCV A;  3F0W A;  2KR0 A;  1UPQ A;  3A58 A;  3G9W A;  2RRF A;  4A6F B;  4L1R A;  1ZVR A;  5D3X A;  3TVV A;  5JHG A;  1AWE A;  3MDB C;  4HDO A;  1SHC A;  3QBV B;  1V88 A;  2YT1 A;  4Z2N A;  1M7E A;  3KSY A;  2P0D A;  1EVH A;  3HQC A;  3NWF A;  4WVF B;  1NTV A;  2MWN B;  5J3Q A;  4QJ3 B;  2YS1 A;  4A6F A;  4PQ0 A;  1V5U A;  2OTX A;  4OT1 A;  3D8D A;  1FGY A;  2AL6 A;  2LOZ A;  2EMT A;  1XX0 A;  5C79 A;  2YT2 A;  2Z13 A;  1KZG A;  4HAX B;  3SUZ A;  2COD A;  2HE7 A;  1FHX A;  1EAZ A;  2R0D A;  1K5D B;  1XKE A;  2V76 A;  4Z2M B;  1BAK A;  3P7Z A;  1EF1 A;  1I2H A;  1P6S A;  2YT0 A;  5DI9 B;  3DXD A;  2GCJ A;  1WJ1 A;  1WI1 A;  3ODX A;  3PVU A;  1PMS A;  2JP2 A;  2L2I A;  2DYN A;  2H7E A;  3SYX A;  1WGU A;  2UZS A;  1MAI A;  4ZRK A;  5C5B A;  2XQN M;  1DYN A;  1LW3 A;  1KZ7 A;  3ZDT A;  3A8Q A;  3M1I B;  1FOE A;  1ISN A;  5JP4 A;  2Z14 A;  5C5B B;  1XR0 B;  4GOU A;  3ZVR A;  2FJU B;  2D9V A;  1U5D A;  2X18 A;  4DXA B;  1PFJ A;  2W2X D;  5L81 A;  1Y5O A;  1FAO A;  1EGX A;  2UZR A;  3NSU A;  3ULB A;  2D11 A;  3A8P A;  1X05 A;  4YL8 A;  4CSQ A;  3IVF A;  1TQZ A;  5KQ1 A;  2Z0P A;  2DX5 A;  1BWN A;  3NW8 A;  3TO1 A;  2E2X A;  3PVW A;  2DHK A;  2R2Y A;  3A98 B;  2ZPY A;  4ZRI A;  3PEG A;  4C0A A;  2LUL A;  1UNP A;  2CY5 A;  2KUP A;  2RUK B;  4GXB A;  4OSN A;  2MDX A;  1MIX A;  3U7D A;  4NY0 A;  4GPT B;  5LG4 B;  2HTH B;  2VRW B;  5JLJ B;  3N7C A;  2ELA A;  2NBV A;  1MKE A;  5D3Y A;  3V5W A;  1Z87 A;  2YVC A;  4GMV A;  3ODO A;  2LG1 A;  1MK9 B;  1E5W A;  2I1J A;  2Q13 A;  1SGH A;  4HHV A;  4MY6 A;  2ROZ B;  1ZSQ A;  2K8E A;  1MK7 B;  4HAV B;  1OQN A;  1U5E A;  1GC6 A;  2MFQ A;  4CHJ A;  4EJN A;  2RVB B;  2COC A;  2DX1 A;  1AQC A;  4TYZ A;  4ZRJ A;  4K2O A;  3AJ4 A;  2J0M A;  5J3T A;  3PVL A;  1OY2 A;  2DHI A;  2J59 M;  5JHH A;  4DX8 A;  1NU2 A;  4Y94 A;  1I7A A;  4HB4 B;  4F7U P;  5DH9 B;  4L6E A;  1W1D A;  1KI1 B;  2DHJ A;  2COA A;  2J0J A;  1Y19 B;  2KGX B;  3QWM A;  4KHB B;  5GOW B;  2P0H A;  2EMS A;  2Z4D A;  1QQG A;  4IOY X;  3KRX A;  2KIE A;  2ADZ A;  2LKO A;  3WA0 A;  4A5K A;  2GUM A;  1MPH A;  3FEH A;  2J0K A;  3U8Z A;  5DIF B;  3F5R A;  1U2B A;  1FGZ A;  1WG7 A;  2R09 A;  3BIN A;  3NWA A;  4K81 A;  4QJ4 B;  2D10 A;  1TXD A;  2DTC A;  1WGQ A;  5DHF B;  1P3R A;  4H8S A;  5C16 A;  2RSG A;  4HAY B;  5D27 A;  2D9Y A;  2ROV A;  5HE1 A;  2DN6 A;  1RJ2 A;  1M7R A;  2W2W A;  3KRW A;  3HK0 A;  3PZD A;  2L1C A;  3TW1 A;  3OHM B;  1DDM A;  2FJL A;  3DXE A;  2YSZ A;  1ZM0 A;  4DX9 0;  2K2U A;  1FHO A;  2DKP A;  4HB3 B;  2NMB A;  1B55 A;  4D0N B;  1Q67 A;  5IRS A;  2D4Q A;  2YF0 A;  3CXB B;  3NWD A;  2BCJ A;  4F7G A;  4K17 A;  1J0W A;  2NZ8 B;  3KZ1 A;  4P7I A;  4DIX A;  2Y8F A;  4A6K A;  4GZU A;  1DDW A;  2KUQ A;  2KCJ A;  1X11 A;  3X23 A;  2LYD A;  3DXC A;  3FM8 C;  1P5T A;  3FSS A;  2EC1 A;  2DA0 A;  2IYB A;  2DFK A;  1OMW A;  3OAN A;  3HIE A;  1XCG A;  1QC6 A;  2DYQ A;  3UZT A;  5I2M A;  5FI1 A;  2GS0 A;  3QIJ A;  1K5G B;  3AU5 A;  2I1K A;  3GYO A;  3KY9 A;  4K2P A;  4IFS A;  1FHW A;  1J19 A;  1ZC4 B;  5J3Y A;  1GG3 A;  1NI2 A;  2GJY A;  2P0F A;  2Z0Q A;  3D8F A;  2K2J A;  2RNR B;  5M4Y B;  2W2X C;  1UPR A;  2CY4 A;  3U12 A;  3PP2 A;  1XOD A;  4KHB A;  5I2S A;  2D9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...