2GCJA

Crystal structure of the pob3 middle domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
237
structure length
229
Chain Sequence
AGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHLLVLAIEPPLRKGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
publication title The Structure of the yFACT Pob3-M Domain, Its Interaction with the DNA Replication Factor RPA, and a Potential Role in Nucleosome Deposition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 50
structure length 229
sequence length 237
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gcjA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 2gcjA01
1XR0B 3T06A 2AEHA 2X18A 3PZDA 3TCAA 1DDMA 1WJ1A 1AQCA 3A8PA 1DBHA 3CXBB 4XWXA 2P0FA 1UPQA 1DYNA 1GC6A 2COAA 3DXCA 4HAZB 1FOEA 4A6KA 1EGXA 2YS5A 1BAKA 2EMSA 2EJ8A 1MIZB 2DHIA 3GYPA 1J19A 4F7UP 2CY4A 2OQBA 1WGQA 2Y8GA 4K2PA 1FHXA 2KGXB 1U5FA 1MK9B 4DX90 2D9VA 4F7GA 1FGZA 2DKQA 4HAUB 2QKMA 5JP4A 2LG1A 4KVGB 1OMWA 4BBKA 1H10A 3PVUA 4WVFB 1FGYA 3ML4A 3P7ZA 5LOPB 5C5BA 1WG7A 3PG7A 4HAVB 3DXDA 1X05A 1MPHA 4GPTB 3PP2A 2D9XA 1X1FA 3QWMA 2N0YA 5CLQB 1DDWA 1WI1A 1TQZA 1OQNA 1WJMA 2LULA 1W1GA 2G35A 1U5DA 2DX5A 3OANA 5D3VA 1KI1B 2CODA 2DKPA 2GCLA 2RNRB 1ISNA 2Z0QA 3KY9A 4A6FB 4HAYB 2QKLA 1FB8A 3ULBA 1NTYA 4HATB 4KHAA 1U5EA 4H8SA 2D10A 2H7EA 2JP2A 2IFSA 4NY0A 5KQ4A 1TJ6A 2DX1A 5JLJB 5C6RA 4HAXB 1V5UA 2MFQA 3PEGA 3GYOA 1U29A 2H7DA 5FI0A 2CY5A 2LOZA 3WA0A 3A8QA 2ZPYA 1X1GA 3TFMA 1N3HA 2YS1A 5J3TA 2DLWA 3M1IB 4PQ0A 2FJLA 3D8EA 1DROA 2I5CA 3TW1A 2M14A 3CIKA 3WYFB 4PNKA 2D2QA 1P3RA 4A6HA 4GZUA 2VRWB 5J3QA 2YT1A 1TXDA 4C0AA 1UPRA 2YSZA 1GC7A 4MK0A 1V88A 2D11A 1W1DA 2K2JA 2D9WA 4CYEA 2DHJA 1LB1A 2MDXA 2ELBA 3HK0A 4GXBA 5D3XA 1K5GB 5DHAB 2NZ8B 3D8DA 3MPXA 2MWNB 3IVFA 5DI9B 4KHOA 1EVHA 2K00A 1SGHA 1Y19B 4YONA 4ZRKA 1Y5OA 5KCVA 3SV1A 4Y94A 4IOYX 3MDBC 1U5GA 4HHVA 2HE7A 1XD4A 5HE0A 4DX8A 2CAYA 3D8FA 1X11A 3PVWA 2D9ZA 3AU5A 2ELAA 2VKIA 3LJUX 4ZRIA 5FI1A 3FSSA 2AL6A 3SO6A 4HB4B 2OTXA 1LW3A 1QC6A 2HTHB 1PMSA 1MIXA 4D0NB 2L1CA 2LOXA 5DH9B 1BWNA 4A5KA 3KZ1A 5LONB 2J0KA 1RJ2A 2LYDA 3DXEA 4DBBA 4A6FA 3VIAA 1ZC4B 4L6EA 4WJ7A 3PSCA 3QIJA 4P7IA 5J3YA 3ODWA 4TYZA 1H4RA 2XQNM 3F5RA 4HDQA 5JHHA 1K5DB 4K17A 1MAIA 4CHJA 5JHGA 4B6HA 1Q67A 4KHBB 1WGUA 1FHOA 4KAXB 4TKNA 3ODXA 5EFXA 2UZSA 3KRWA 4ZRJA 5DIFB 2J59M 3ZVRA 2Z0PA 5D3WA 1B55A 2GS0A 1UNPA 3KSYA 2K2UA 2DN6A 2W2XD 3X23A 1NI2A 1XKEA 5DHFB 4IAPA 2Z0OA 5C16A 5D27A 2YS3A 3SYXA 2UVMA 4YL8A 3P6AA 4Z2MB 1U27A 4GMVA 1DDVA 1NU2A 1ZVRA 4F7HA 2RVBB 2R09A 2UZRA 2YT0A 3ZDTA 1XCGA 4HDOA 5KQ1A 4HB3B 2Y7BA 4NSWA 3U7DA 3ODOA 2PZ1A 1V5MA 3O96A 1V61A 4IFSA 2RGNB 2IYBA 4EKUA 2ROVA 1E5WA 1KZGA 4HAWB 2VSZA 1PLSA 2I1KA 3BJIA 2J0JA 2RLOA 1I2HA 2V76A 1Z87A 2J0MA 2GJYA 3TO1A 1QQGA 1P5TA 2YVCA 1W1HA 2D9YA 2E2XA 2KUPA 1V5PA 1SHCA 1KZ7A 2L2IA 5GOWB 3FM8C 1UEFA 2DHKA 5C5BB 1UNRA 2NMBA 2Q13A 2EMTA 2P0HA 2DYNA 2KCJA 2P0DA 1ZSQA 4HB0B 2DTCA 2GCJA 1MKEA 3UZTA 1M7RA 3N7CA 2M38A 1FAOA 1XX0A 2I5FA 4DXAB 2ROZB 1EAZA 1WVHA 2W2XC 1PFJA 1V89A 1UNQA 1OY2A 2RUKB 1MK7B 3U8ZA 3SNHA 1GG3A 5D3YA 2DYQA 3F0WA 1AWEA 3BINA 3FEHA 4K2OA 4HB2B 1U2BA 1BTKA 2RSGA 1NTVA 2I1JA 4Z2NA 5C79A 3RCPA 2Y8FA 2W2WA 5HE2A 2DFKA 1J0WA 3V5WA 4MT7A 5HE3A 1ZC3B 1FHWA 4EMOA 3ULCA 3HW2B 2N23A 3AJ4A 1RRPB 3AU4A 1M7EA 3G9WA 4WSFA 4K81A 4MY6A 2R0DA 1IRSA 2P8VA 1P6SA 3NSUA 2ADZA 3A98B 2YF0A 1BTNA 2MKRA 3KRXA 3SUZA 1I7AA 1EF1A 3HQCA 5L81A 1XODA 3QBVB 4GMXB 2COFA 1ZM0A 2COCA 2LKOA 2CRFA 2YRYA 2EC1A 2DA0A 5HE1A 1X86A 3VOQA 3PVLA 4CHMA 2BCJA 2D4QA 3TVVA 4GN1A 4EJNA 5CLLB
chains in the Genus database with same CATH superfamily
1XR0B 3T06A 2AEHA 2X18A 3PZDA 3TCAA 1DDMA 1WJ1A 1AQCA 3FVCA 3A8PA 1DBHA 3CXBB 4XWXA 2P0FA 1UPQA 1DYNA 1GC6A 2COAA 3DXCA 4HAZB 1FOEA 4A6KA 1EGXA 2YS5A 1BAKA 2EMSA 2EJ8A 5LG4B 1MIZB 2DHIA 3GYPA 1J19A 4F7UP 2CY4A 2Z13A 2RRFA 2OQBA 2Y8GA 1WGQA 4K2PA 1FHXA 4QXAB 2KGXB 1U5FA 1MK9B 4DX90 2D9VA 4F7GA 1FGZA 2DKQA 4HAUB 2QKMA 5JP4A 2LG1A 4KVGB 1OMWA 4BBKA 1H10A 3PVUA 4WVFB 1FGYA 3ML4A 3P7ZA 5LOPB 5C5BA 1WG7A 3PG7A 4HAVB 2Z4DA 3DXDA 1X05A 1MPHA 2GUMA 3PP2A 4GPTB 5I2MA 2D9XA 1X1FA 3QWMA 2N0YA 5CLQB 1DDWA 1WI1A 1TQZA 1OQNA 1WJMA 2LULA 1W1GA 3NWFA 2G35A 1U5DA 3NW8A 2DX5A 3OANA 5D3VA 1KI1B 2CODA 2DKPA 2GCLA 2RNRB 1ISNA 2Z0QA 3KY9A 4A6FB 4HAYB 2QKLA 1FB8A 3ULBA 1NTYA 4HATB 4KHAA 1U5EA 4H8SA 4OSNA 2D10A 2H7EA 2JP2A 2IFSA 4NY0A 5KQ4A 1TJ6A 4HSIA 4QJ5B 2KUQA 2DX1A 5JLJB 5C6RA 4HAXB 1V5UA 2MFQA 3PEGA 3GYOA 1U29A 2H7DA 5FI0A 2CY5A 2LOZA 3WA0A 3A8QA 2ZPYA 1X1GA 3TFMA 1N3HA 2YS1A 5J3TA 2DLWA 3M1IB 4PQ0A 2FJLA 2KIGA 3D8EA 1DROA 2I5CA 3TW1A 2M14A 3CIKA 2Z59A 3WYFB 2K49A 4PNKA 2D2QA 1P3RA 2YT2A 4A6HA 3A58A 4GZUA 2VRWB 5J3QA 2YT1A 1TXDA 4C0AA 3HSAA 1UPRA 2YSZA 1GC7A 4MK0A 1V88A 2D11A 1W1DA 2K2JA 2D9WA 4CYEA 2DHJA 1LB1A 2MDXA 2ELBA 3HK0A 4GXBA 5D3XA 1K5GB 5DHAB 2NZ8B 3OHMB 3D8DA 3MPXA 2MWNB 3IVFA 5DI9B 4GOUA 4KHOA 1EVHA 2K00A 1SGHA 1Y19B 1ZYIA 4YONA 1Y5OA 4ZRKA 5KCVA 3SV1A 4Y94A 4IOYX 3MDBC 1U5GA 4HHVA 2HE7A 1XD4A 5HE0A 2K8EA 4DX8A 2CAYA 3D8FA 1X11A 3PVWA 2D9ZA 3AU5A 2ELAA 2VKIA 3LJUX 4ZRIA 5FI1A 3FSSA 2AL6A 3SO6A 4HB4B 2OTXA 1LW3A 1QC6A 2HTHB 1PMSA 1MIXA 4D0NB 4OT1A 2L1CA 2LOXA 5DH9B 1BWNA 4A5KA 3KZ1A 5LONB 2J0KA 1RJ2A 2LYDA 1MI1A 3DXEA 4DBBA 4A6FA 3VIAA 1ZC4B 4L6EA 4WJ7A 3PSCA 3QIJA 4P7IA 5J3YA 3ODWA 4DIXA 4TYZA 1H4RA 3NWAA 2XQNM 3F5RA 4HDQA 5JHHA 1K5DB 4K17A 1MAIA 3DCXA 4QJ4B 4CHJA 5JHGA 4B6HA 1Q67A 4KHBB 1WGUA 1FHOA 4KAXB 4TKNA 3ODXA 5EFXA 2UZSA 3B77A 3KRWA 4ZRJA 5DIFB 2J59M 3ZVRA 2Z0PA 5D3WA 1B55A 2GS0A 1UNPA 3KSYA 2K2UA 2DN6A 2W2XD 3X23A 1NI2A 1XKEA 5DHFB 4IAPA 2Z0OA 5C16A 5D27A 2YS3A 3SYXA 2UVMA 4YL8A 3P6AA 4Z2MB 3TVVA 1U27A 4GMVA 1DDVA 1NU2A 1ZVRA 4F7HA 2RVBB 2R09A 2UZRA 2YT0A 3ZDTA 1XCGA 4HDOA 2FJUB 5KQ1A 4HB3B 2Y7BA 4NSWA 3U7DA 3ODOA 2PZ1A 1V5MA 3O96A 1V61A 4IFSA 2RGNB 2IYBA 4EKUA 2ROVA 1E5WA 1KZGA 4HAWB 2VSZA 1PLSA 2I1KA 3BJIA 2J0JA 2RLOA 1I2HA 2V76A 1Z87A 2J0MA 2GJYA 3TO1A 1QQGA 1P5TA 2YVCA 1W1HA 2D9YA 2E2XA 2NBVA 2KUPA 1V5PA 1SHCA 1KZ7A 2L2IA 5GOWB 3FM8C 1UEFA 2DHKA 5C5BB 1UNRA 2NMBA 2Q13A 2EMTA 2P0HA 2DYNA 2KCJA 2P0DA 1ZSQA 4HB0B 2DTCA 2GCJA 1MKEA 5IRSA 1M7RA 3N7CA 3UZTA 2M38A 1FAOA 1XX0A 2I5FA 4DXAB 2ROZB 1EAZA 1WVHA 2W2XC 1PFJA 1V89A 1UNQA 1OY2A 2RUKB 1MK7B 3NWDA 3U8ZA 3HIEA 3SNHA 2ZKMX 1GG3A 5D3YA 2DYQA 4D6WA 3F0WA 1AWEA 4KHBA 2Z14A 3BINA 3FEHA 4K2OA 4L1RA 4HB2B 1U2BA 1BTKA 2RSGA 1NTVA 2I1JA 4Z2NA 5C79A 2R2YA 3RCPA 2Y8FA 4CSQA 2W2WA 2KR0A 5HE2A 2DFKA 1J0WA 3V5WA 4MT7A 4QJ3B 5HE3A 1ZC3B 1FHWA 5M4YB 5I2SA 4EMOA 3ULCA 4GNKB 3HW2B 2N23A 3AJ4A 1RRPB 3AU4A 1M7EA 3G9WA 4WSFA 4K81A 3U12A 4MY6A 2R0DA 1IRSA 2P8VA 1P6SA 3NSUA 2ADZA 3A98B 2YF0A 1BTNA 2MKRA 2KIEA 3KRXA 3SUZA 1I7AA 1EF1A 3HQCA 5L81A 1XODA 3QBVB 4GMXB 2COFA 1ZM0A 2COCA 2LKOA 2CRFA 2YRYA 2EC1A 2DA0A 5HE1A 1X86A 3VOQA 3PVLA 4CHMA 2BCJA 1T77A 2D4QA 4GN1A 4EJNA 5CLLB
chains in the Genus database with same CATH topology
1XR0B 3T06A 2AEHA 2X18A 3PZDA 3TCAA 1DDMA 1WJ1A 1AQCA 3FVCA 3A8PA 1DBHA 3CXBB 4XWXA 2P0FA 1UPQA 1DYNA 1GC6A 2COAA 3DXCA 4HAZB 1FOEA 4A6KA 1EGXA 2YS5A 1BAKA 2EMSA 2EJ8A 5LG4B 1MIZB 2DHIA 3GYPA 1J19A 4F7UP 2CY4A 2Z13A 2RRFA 2OQBA 1WGQA 2Y8GA 4K2PA 1FHXA 4QXAB 2KGXB 1U5FA 1MK9B 4DX90 2D9VA 4F7GA 1FGZA 2DKQA 4HAUB 2QKMA 5JP4A 2LG1A 4KVGB 1OMWA 4BBKA 1H10A 3PVUA 4WVFB 1FGYA 3ML4A 3P7ZA 5LOPB 5C5BA 1WG7A 3PG7A 4HAVB 2Z4DA 3DXDA 1X05A 1MPHA 4GPTB 3PP2A 2GUMA 5I2MA 2D9XA 1X1FA 3QWMA 2N0YA 5CLQB 1DDWA 1WI1A 1TQZA 1OQNA 1WJMA 2LULA 1W1GA 3NWFA 2G35A 1U5DA 3NW8A 2DX5A 3OANA 5D3VA 1KI1B 2CODA 2DKPA 2GCLA 2RNRB 1ISNA 2Z0QA 3KY9A 4A6FB 4HAYB 2QKLA 1FB8A 3ULBA 1NTYA 4HATB 4KHAA 1U5EA 4H8SA 4OSNA 2D10A 2H7EA 2JP2A 2IFSA 4NY0A 5KQ4A 1TJ6A 4HSIA 4QJ5B 2KUQA 2DX1A 5JLJB 5C6RA 4HAXB 1V5UA 2MFQA 3PEGA 3GYOA 1U29A 2H7DA 5FI0A 2CY5A 2LOZA 3WA0A 3A8QA 2ZPYA 1X1GA 3TFMA 1N3HA 2YS1A 5J3TA 2DLWA 3M1IB 4PQ0A 2FJLA 2KIGA 3D8EA 1DROA 2I5CA 3TW1A 2M14A 3CIKA 2Z59A 3WYFB 4PNKA 2K49A 2D2QA 1P3RA 2YT2A 4A6HA 4GZUA 3A58A 2VRWB 5J3QA 2YT1A 1TXDA 4C0AA 1UPRA 2YSZA 1GC7A 4MK0A 1V88A 2D11A 1W1DA 2K2JA 2D9WA 4CYEA 2DHJA 1LB1A 2MDXA 2ELBA 3HK0A 4GXBA 5D3XA 1K5GB 5DHAB 2NZ8B 3OHMB 3D8DA 3MPXA 2MWNB 3IVFA 5DI9B 4GOUA 4KHOA 1EVHA 2K00A 1SGHA 1Y19B 4YONA 4ZRKA 1Y5OA 5KCVA 1ZYIA 3SV1A 4Y94A 4IOYX 3MDBC 1U5GA 4HHVA 2HE7A 1XD4A 5HE0A 2K8EA 4DX8A 2CAYA 3D8FA 1X11A 3PVWA 2D9ZA 3AU5A 2ELAA 2VKIA 3LJUX 4ZRIA 5FI1A 3FSSA 2AL6A 3SO6A 4HB4B 2OTXA 1LW3A 1QC6A 2HTHB 1PMSA 1MIXA 4D0NB 4OT1A 2L1CA 2LOXA 5DH9B 1BWNA 4A5KA 3KZ1A 5LONB 2J0KA 1RJ2A 2LYDA 3DXEA 4DBBA 4A6FA 3VIAA 1ZC4B 4L6EA 4WJ7A 3PSCA 3QIJA 4P7IA 5J3YA 3ODWA 4DIXA 4TYZA 1H4RA 3NWAA 2XQNM 3F5RA 4HDQA 5JHHA 1K5DB 4K17A 1MAIA 4QJ4B 4CHJA 5JHGA 4B6HA 1Q67A 4KHBB 1WGUA 1FHOA 4KAXB 4TKNA 3ODXA 5EFXA 2UZSA 3KRWA 4ZRJA 5DIFB 2J59M 3ZVRA 2Z0PA 5D3WA 1B55A 2GS0A 1UNPA 3KSYA 2K2UA 2DN6A 2W2XD 3X23A 1NI2A 1XKEA 5DHFB 4IAPA 2Z0OA 5C16A 5D27A 2YS3A 3SYXA 2UVMA 4YL8A 3P6AA 4Z2MB 1U27A 4GMVA 1DDVA 1NU2A 1ZVRA 4F7HA 2RVBB 2R09A 2UZRA 2YT0A 3ZDTA 1XCGA 4HDOA 2FJUB 5KQ1A 4HB3B 2Y7BA 4NSWA 3U7DA 3ODOA 2PZ1A 1V5MA 3O96A 1V61A 4IFSA 2RGNB 2IYBA 4EKUA 2ROVA 1E5WA 1KZGA 4HAWB 2VSZA 1PLSA 2I1KA 3BJIA 2J0JA 2RLOA 1I2HA 2V76A 1Z87A 2J0MA 2GJYA 3TO1A 1QQGA 1P5TA 2YVCA 1W1HA 2D9YA 2E2XA 2NBVA 2KUPA 1V5PA 1SHCA 1KZ7A 2L2IA 5GOWB 3FM8C 1UEFA 2DHKA 5C5BB 1UNRA 2NMBA 2Q13A 2EMTA 2P0HA 2DYNA 2KCJA 2P0DA 1ZSQA 4HB0B 2DTCA 2GCJA 1MKEA 3UZTA 1M7RA 3N7CA 5IRSA 2M38A 1FAOA 1XX0A 2I5FA 4DXAB 2ROZB 1EAZA 1WVHA 2W2XC 1PFJA 1V89A 1UNQA 1OY2A 2RUKB 1MK7B 3NWDA 3U8ZA 3HIEA 3SNHA 2ZKMX 1GG3A 5D3YA 2DYQA 4D6WA 3F0WA 1AWEA 4KHBA 3BINA 2Z14A 3FEHA 4K2OA 4L1RA 4HB2B 1U2BA 1BTKA 2RSGA 1NTVA 2I1JA 4Z2NA 5C79A 2R2YA 3RCPA 2Y8FA 4CSQA 2W2WA 2KR0A 5HE2A 2DFKA 1J0WA 3V5WA 4MT7A 4QJ3B 5HE3A 1ZC3B 1FHWA 5M4YB 5I2SA 4EMOA 3ULCA 4GNKB 3HW2B 2N23A 3AJ4A 1RRPB 3AU4A 1M7EA 3G9WA 4WSFA 4K81A 3U12A 4MY6A 2R0DA 1IRSA 2P8VA 1P6SA 3NSUA 2ADZA 3A98B 2YF0A 1BTNA 2MKRA 2KIEA 3KRXA 3SUZA 1I7AA 1EF1A 3HQCA 5L81A 1XODA 3QBVB 4GMXB 2COFA 1ZM0A 2COCA 2LKOA 2CRFA 2YRYA 2EC1A 2DA0A 5HE1A 1X86A 3VOQA 3PVLA 4CHMA 2BCJA 2D4QA 3TVVA 4GN1A 4EJNA 5CLLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XR0 B;  3T06 A;  2AEH A;  2X18 A;  3PZD A;  3TCA A;  1DDM A;  1WJ1 A;  1AQC A;  3A8P A;  1DBH A;  3CXB B;  4XWX A;  2P0F A;  1UPQ A;  1DYN A;  1GC6 A;  2COA A;  3DXC A;  4HAZ B;  1FOE A;  4A6K A;  1EGX A;  2YS5 A;  1BAK A;  2EMS A;  2EJ8 A;  1MIZ B;  2DHI A;  3GYP A;  1J19 A;  4F7U P;  2CY4 A;  2OQB A;  1WGQ A;  2Y8G A;  4K2P A;  1FHX A;  2KGX B;  1U5F A;  1MK9 B;  4DX9 0;  2D9V A;  4F7G A;  1FGZ A;  2DKQ A;  4HAU B;  2QKM A;  5JP4 A;  2LG1 A;  4KVG B;  1OMW A;  4BBK A;  1H10 A;  3PVU A;  4WVF B;  1FGY A;  3ML4 A;  3P7Z A;  5LOP B;  5C5B A;  1WG7 A;  3PG7 A;  4HAV B;  3DXD A;  1X05 A;  1MPH A;  4GPT B;  3PP2 A;  2D9X A;  1X1F A;  3QWM A;  2N0Y A;  5CLQ B;  1DDW A;  1WI1 A;  1TQZ A;  1OQN A;  1WJM A;  2LUL A;  1W1G A;  2G35 A;  1U5D A;  2DX5 A;  3OAN A;  5D3V A;  1KI1 B;  2COD A;  2DKP A;  2GCL A;  2RNR B;  1ISN A;  2Z0Q A;  3KY9 A;  4A6F B;  4HAY B;  2QKL A;  1FB8 A;  3ULB A;  1NTY A;  4HAT B;  4KHA A;  1U5E A;  4H8S A;  2D10 A;  2H7E A;  2JP2 A;  2IFS A;  4NY0 A;  5KQ4 A;  1TJ6 A;  2DX1 A;  5JLJ B;  5C6R A;  4HAX B;  1V5U A;  2MFQ A;  3PEG A;  3GYO A;  1U29 A;  2H7D A;  5FI0 A;  2CY5 A;  2LOZ A;  3WA0 A;  3A8Q A;  2ZPY A;  1X1G A;  3TFM A;  1N3H A;  2YS1 A;  5J3T A;  2DLW A;  3M1I B;  4PQ0 A;  2FJL A;  3D8E A;  1DRO A;  2I5C A;  3TW1 A;  2M14 A;  3CIK A;  3WYF B;  4PNK A;  2D2Q A;  1P3R A;  4A6H A;  4GZU A;  2VRW B;  5J3Q A;  2YT1 A;  1TXD A;  4C0A A;  1UPR A;  2YSZ A;  1GC7 A;  4MK0 A;  1V88 A;  2D11 A;  1W1D A;  2K2J A;  2D9W A;  4CYE A;  2DHJ A;  1LB1 A;  2MDX A;  2ELB A;  3HK0 A;  4GXB A;  5D3X A;  1K5G B;  5DHA B;  2NZ8 B;  3D8D A;  3MPX A;  2MWN B;  3IVF A;  5DI9 B;  4KHO A;  1EVH A;  2K00 A;  1SGH A;  1Y19 B;  4YON A;  4ZRK A;  1Y5O A;  5KCV A;  3SV1 A;  4Y94 A;  4IOY X;  3MDB C;  1U5G A;  4HHV A;  2HE7 A;  1XD4 A;  5HE0 A;  4DX8 A;  2CAY A;  3D8F A;  1X11 A;  3PVW A;  2D9Z A;  3AU5 A;  2ELA A;  2VKI A;  3LJU X;  4ZRI A;  5FI1 A;  3FSS A;  2AL6 A;  3SO6 A;  4HB4 B;  2OTX A;  1LW3 A;  1QC6 A;  2HTH B;  1PMS A;  1MIX A;  4D0N B;  2L1C A;  2LOX A;  5DH9 B;  1BWN A;  4A5K A;  3KZ1 A;  5LON B;  2J0K A;  1RJ2 A;  2LYD A;  3DXE A;  4DBB A;  4A6F A;  3VIA A;  1ZC4 B;  4L6E A;  4WJ7 A;  3PSC A;  3QIJ A;  4P7I A;  5J3Y A;  3ODW A;  4TYZ A;  1H4R A;  2XQN M;  3F5R A;  4HDQ A;  5JHH A;  1K5D B;  4K17 A;  1MAI A;  4CHJ A;  5JHG A;  4B6H A;  1Q67 A;  4KHB B;  1WGU A;  1FHO A;  4KAX B;  4TKN A;  3ODX A;  5EFX A;  2UZS A;  3KRW A;  4ZRJ A;  5DIF B;  2J59 M;  3ZVR A;  2Z0P A;  5D3W A;  1B55 A;  2GS0 A;  1UNP A;  3KSY A;  2K2U A;  2DN6 A;  2W2X D;  3X23 A;  1NI2 A;  1XKE A;  5DHF B;  4IAP A;  2Z0O A;  5C16 A;  5D27 A;  2YS3 A;  3SYX A;  2UVM A;  4YL8 A;  3P6A A;  4Z2M B;  1U27 A;  4GMV A;  1DDV A;  1NU2 A;  1ZVR A;  4F7H A;  2RVB B;  2R09 A;  2UZR A;  2YT0 A;  3ZDT A;  1XCG A;  4HDO A;  5KQ1 A;  4HB3 B;  2Y7B A;  4NSW A;  3U7D A;  3ODO A;  2PZ1 A;  1V5M A;  3O96 A;  1V61 A;  4IFS A;  2RGN B;  2IYB A;  4EKU A;  2ROV A;  1E5W A;  1KZG A;  4HAW B;  2VSZ A;  1PLS A;  2I1K A;  3BJI A;  2J0J A;  2RLO A;  1I2H A;  2V76 A;  1Z87 A;  2J0M A;  2GJY A;  3TO1 A;  1QQG A;  1P5T A;  2YVC A;  1W1H A;  2D9Y A;  2E2X A;  2KUP A;  1V5P A;  1SHC A;  1KZ7 A;  2L2I A;  5GOW B;  3FM8 C;  1UEF A;  2DHK A;  5C5B B;  1UNR A;  2NMB A;  2Q13 A;  2EMT A;  2P0H A;  2DYN A;  2KCJ A;  2P0D A;  1ZSQ A;  4HB0 B;  2DTC A;  2GCJ A;  1MKE A;  3UZT A;  1M7R A;  3N7C A;  2M38 A;  1FAO A;  1XX0 A;  2I5F A;  4DXA B;  2ROZ B;  1EAZ A;  1WVH A;  2W2X C;  1PFJ A;  1V89 A;  1UNQ A;  1OY2 A;  2RUK B;  1MK7 B;  3U8Z A;  3SNH A;  1GG3 A;  5D3Y A;  2DYQ A;  3F0W A;  1AWE A;  3BIN A;  3FEH A;  4K2O A;  4HB2 B;  1U2B A;  1BTK A;  2RSG A;  1NTV A;  2I1J A;  4Z2N A;  5C79 A;  3RCP A;  2Y8F A;  2W2W A;  5HE2 A;  2DFK A;  1J0W A;  3V5W A;  4MT7 A;  5HE3 A;  1ZC3 B;  1FHW A;  4EMO A;  3ULC A;  3HW2 B;  2N23 A;  3AJ4 A;  1RRP B;  3AU4 A;  1M7E A;  3G9W A;  4WSF A;  4K81 A;  4MY6 A;  2R0D A;  1IRS A;  2P8V A;  1P6S A;  3NSU A;  2ADZ A;  3A98 B;  2YF0 A;  1BTN A;  2MKR A;  3KRX A;  3SUZ A;  1I7A A;  1EF1 A;  3HQC A;  5L81 A;  1XOD A;  3QBV B;  4GMX B;  2COF A;  1ZM0 A;  2COC A;  2LKO A;  2CRF A;  2YRY A;  2EC1 A;  2DA0 A;  5HE1 A;  1X86 A;  3VOQ A;  3PVL A;  4CHM A;  2BCJ A;  2D4Q A;  3TVV A;  4GN1 A;  4EJN A;  5CLL B; 
#chains in the Genus database with same CATH topology
 1XR0 B;  3T06 A;  2AEH A;  2X18 A;  3PZD A;  3TCA A;  1DDM A;  1WJ1 A;  1AQC A;  3FVC A;  3A8P A;  1DBH A;  3CXB B;  4XWX A;  2P0F A;  1UPQ A;  1DYN A;  1GC6 A;  2COA A;  3DXC A;  4HAZ B;  1FOE A;  4A6K A;  1EGX A;  2YS5 A;  1BAK A;  2EMS A;  2EJ8 A;  5LG4 B;  1MIZ B;  2DHI A;  3GYP A;  1J19 A;  4F7U P;  2CY4 A;  2Z13 A;  2RRF A;  2OQB A;  2Y8G A;  1WGQ A;  4K2P A;  1FHX A;  4QXA B;  2KGX B;  1U5F A;  1MK9 B;  4DX9 0;  2D9V A;  4F7G A;  1FGZ A;  2DKQ A;  4HAU B;  2QKM A;  5JP4 A;  2LG1 A;  4KVG B;  1OMW A;  4BBK A;  1H10 A;  3PVU A;  4WVF B;  1FGY A;  3ML4 A;  3P7Z A;  5LOP B;  5C5B A;  1WG7 A;  3PG7 A;  4HAV B;  2Z4D A;  3DXD A;  1X05 A;  1MPH A;  2GUM A;  3PP2 A;  4GPT B;  5I2M A;  2D9X A;  1X1F A;  3QWM A;  2N0Y A;  5CLQ B;  1DDW A;  1WI1 A;  1TQZ A;  1OQN A;  1WJM A;  2LUL A;  1W1G A;  3NWF A;  2G35 A;  1U5D A;  3NW8 A;  2DX5 A;  3OAN A;  5D3V A;  1KI1 B;  2COD A;  2DKP A;  2GCL A;  2RNR B;  1ISN A;  2Z0Q A;  3KY9 A;  4A6F B;  4HAY B;  2QKL A;  1FB8 A;  3ULB A;  1NTY A;  4HAT B;  4KHA A;  1U5E A;  4H8S A;  4OSN A;  2D10 A;  2H7E A;  2JP2 A;  2IFS A;  4NY0 A;  5KQ4 A;  1TJ6 A;  4HSI A;  4QJ5 B;  2KUQ A;  2DX1 A;  5JLJ B;  5C6R A;  4HAX B;  1V5U A;  2MFQ A;  3PEG A;  3GYO A;  1U29 A;  2H7D A;  5FI0 A;  2CY5 A;  2LOZ A;  3WA0 A;  3A8Q A;  2ZPY A;  1X1G A;  3TFM A;  1N3H A;  2YS1 A;  5J3T A;  2DLW A;  3M1I B;  4PQ0 A;  2FJL A;  2KIG A;  3D8E A;  1DRO A;  2I5C A;  3TW1 A;  2M14 A;  3CIK A;  2Z59 A;  3WYF B;  2K49 A;  4PNK A;  2D2Q A;  1P3R A;  2YT2 A;  4A6H A;  3A58 A;  4GZU A;  2VRW B;  5J3Q A;  2YT1 A;  1TXD A;  4C0A A;  3HSA A;  1UPR A;  2YSZ A;  1GC7 A;  4MK0 A;  1V88 A;  2D11 A;  1W1D A;  2K2J A;  2D9W A;  4CYE A;  2DHJ A;  1LB1 A;  2MDX A;  2ELB A;  3HK0 A;  4GXB A;  5D3X A;  1K5G B;  5DHA B;  2NZ8 B;  3OHM B;  3D8D A;  3MPX A;  2MWN B;  3IVF A;  5DI9 B;  4GOU A;  4KHO A;  1EVH A;  2K00 A;  1SGH A;  1Y19 B;  1ZYI A;  4YON A;  1Y5O A;  4ZRK A;  5KCV A;  3SV1 A;  4Y94 A;  4IOY X;  3MDB C;  1U5G A;  4HHV A;  2HE7 A;  1XD4 A;  5HE0 A;  2K8E A;  4DX8 A;  2CAY A;  3D8F A;  1X11 A;  3PVW A;  2D9Z A;  3AU5 A;  2ELA A;  2VKI A;  3LJU X;  4ZRI A;  5FI1 A;  3FSS A;  2AL6 A;  3SO6 A;  4HB4 B;  2OTX A;  1LW3 A;  1QC6 A;  2HTH B;  1PMS A;  1MIX A;  4D0N B;  4OT1 A;  2L1C A;  2LOX A;  5DH9 B;  1BWN A;  4A5K A;  3KZ1 A;  5LON B;  2J0K A;  1RJ2 A;  2LYD A;  1MI1 A;  3DXE A;  4DBB A;  4A6F A;  3VIA A;  1ZC4 B;  4L6E A;  4WJ7 A;  3PSC A;  3QIJ A;  4P7I A;  5J3Y A;  3ODW A;  4DIX A;  4TYZ A;  1H4R A;  3NWA A;  2XQN M;  3F5R A;  4HDQ A;  5JHH A;  1K5D B;  4K17 A;  1MAI A;  3DCX A;  4QJ4 B;  4CHJ A;  5JHG A;  4B6H A;  1Q67 A;  4KHB B;  1WGU A;  1FHO A;  4KAX B;  4TKN A;  3ODX A;  5EFX A;  2UZS A;  3B77 A;  3KRW A;  4ZRJ A;  5DIF B;  2J59 M;  3ZVR A;  2Z0P A;  5D3W A;  1B55 A;  2GS0 A;  1UNP A;  3KSY A;  2K2U A;  2DN6 A;  2W2X D;  3X23 A;  1NI2 A;  1XKE A;  5DHF B;  4IAP A;  2Z0O A;  5C16 A;  5D27 A;  2YS3 A;  3SYX A;  2UVM A;  4YL8 A;  3P6A A;  4Z2M B;  3TVV A;  1U27 A;  4GMV A;  1DDV A;  1NU2 A;  1ZVR A;  4F7H A;  2RVB B;  2R09 A;  2UZR A;  2YT0 A;  3ZDT A;  1XCG A;  4HDO A;  2FJU B;  5KQ1 A;  4HB3 B;  2Y7B A;  4NSW A;  3U7D A;  3ODO A;  2PZ1 A;  1V5M A;  3O96 A;  1V61 A;  4IFS A;  2RGN B;  2IYB A;  4EKU A;  2ROV A;  1E5W A;  1KZG A;  4HAW B;  2VSZ A;  1PLS A;  2I1K A;  3BJI A;  2J0J A;  2RLO A;  1I2H A;  2V76 A;  1Z87 A;  2J0M A;  2GJY A;  3TO1 A;  1QQG A;  1P5T A;  2YVC A;  1W1H A;  2D9Y A;  2E2X A;  2NBV A;  2KUP A;  1V5P A;  1SHC A;  1KZ7 A;  2L2I A;  5GOW B;  3FM8 C;  1UEF A;  2DHK A;  5C5B B;  1UNR A;  2NMB A;  2Q13 A;  2EMT A;  2P0H A;  2DYN A;  2KCJ A;  2P0D A;  1ZSQ A;  4HB0 B;  2DTC A;  2GCJ A;  1MKE A;  5IRS A;  1M7R A;  3N7C A;  3UZT A;  2M38 A;  1FAO A;  1XX0 A;  2I5F A;  4DXA B;  2ROZ B;  1EAZ A;  1WVH A;  2W2X C;  1PFJ A;  1V89 A;  1UNQ A;  1OY2 A;  2RUK B;  1MK7 B;  3NWD A;  3U8Z A;  3HIE A;  3SNH A;  2ZKM X;  1GG3 A;  5D3Y A;  2DYQ A;  4D6W A;  3F0W A;  1AWE A;  4KHB A;  2Z14 A;  3BIN A;  3FEH A;  4K2O A;  4L1R A;  4HB2 B;  1U2B A;  1BTK A;  2RSG A;  1NTV A;  2I1J A;  4Z2N A;  5C79 A;  2R2Y A;  3RCP A;  2Y8F A;  4CSQ A;  2W2W A;  2KR0 A;  5HE2 A;  2DFK A;  1J0W A;  3V5W A;  4MT7 A;  4QJ3 B;  5HE3 A;  1ZC3 B;  1FHW A;  5M4Y B;  5I2S A;  4EMO A;  3ULC A;  4GNK B;  3HW2 B;  2N23 A;  3AJ4 A;  1RRP B;  3AU4 A;  1M7E A;  3G9W A;  4WSF A;  4K81 A;  3U12 A;  4MY6 A;  2R0D A;  1IRS A;  2P8V A;  1P6S A;  3NSU A;  2ADZ A;  3A98 B;  2YF0 A;  1BTN A;  2MKR A;  2KIE A;  3KRX A;  3SUZ A;  1I7A A;  1EF1 A;  3HQC A;  5L81 A;  1XOD A;  3QBV B;  4GMX B;  2COF A;  1ZM0 A;  2COC A;  2LKO A;  2CRF A;  2YRY A;  2EC1 A;  2DA0 A;  5HE1 A;  1X86 A;  3VOQ A;  3PVL A;  4CHM A;  2BCJ A;  1T77 A;  2D4Q A;  4GN1 A;  4EJN A;  5CLL B; 
#chains in the Genus database with same CATH homology
 1XR0 B;  3T06 A;  2AEH A;  2X18 A;  3PZD A;  3TCA A;  1DDM A;  1WJ1 A;  1AQC A;  3FVC A;  3A8P A;  1DBH A;  3CXB B;  4XWX A;  2P0F A;  1UPQ A;  1DYN A;  1GC6 A;  2COA A;  3DXC A;  4HAZ B;  1FOE A;  4A6K A;  1EGX A;  2YS5 A;  1BAK A;  2EMS A;  2EJ8 A;  5LG4 B;  1MIZ B;  2DHI A;  3GYP A;  1J19 A;  4F7U P;  2CY4 A;  2Z13 A;  2RRF A;  2OQB A;  1WGQ A;  2Y8G A;  4K2P A;  1FHX A;  4QXA B;  2KGX B;  1U5F A;  1MK9 B;  4DX9 0;  2D9V A;  4F7G A;  1FGZ A;  2DKQ A;  4HAU B;  2QKM A;  5JP4 A;  2LG1 A;  4KVG B;  1OMW A;  4BBK A;  1H10 A;  3PVU A;  4WVF B;  1FGY A;  3ML4 A;  3P7Z A;  5LOP B;  5C5B A;  1WG7 A;  3PG7 A;  4HAV B;  2Z4D A;  3DXD A;  1X05 A;  1MPH A;  4GPT B;  3PP2 A;  2GUM A;  5I2M A;  2D9X A;  1X1F A;  3QWM A;  2N0Y A;  5CLQ B;  1DDW A;  1WI1 A;  1TQZ A;  1OQN A;  1WJM A;  2LUL A;  1W1G A;  3NWF A;  2G35 A;  1U5D A;  3NW8 A;  2DX5 A;  3OAN A;  5D3V A;  1KI1 B;  2COD A;  2DKP A;  2GCL A;  2RNR B;  1ISN A;  2Z0Q A;  3KY9 A;  4A6F B;  4HAY B;  2QKL A;  1FB8 A;  3ULB A;  1NTY A;  4HAT B;  4KHA A;  1U5E A;  4H8S A;  4OSN A;  2D10 A;  2H7E A;  2JP2 A;  2IFS A;  4NY0 A;  5KQ4 A;  1TJ6 A;  4HSI A;  4QJ5 B;  2KUQ A;  2DX1 A;  5JLJ B;  5C6R A;  4HAX B;  1V5U A;  2MFQ A;  3PEG A;  3GYO A;  1U29 A;  2H7D A;  5FI0 A;  2CY5 A;  2LOZ A;  3WA0 A;  3A8Q A;  2ZPY A;  1X1G A;  3TFM A;  1N3H A;  2YS1 A;  5J3T A;  2DLW A;  3M1I B;  4PQ0 A;  2FJL A;  2KIG A;  3D8E A;  1DRO A;  2I5C A;  3TW1 A;  2M14 A;  3CIK A;  2Z59 A;  3WYF B;  4PNK A;  2K49 A;  2D2Q A;  1P3R A;  2YT2 A;  4A6H A;  4GZU A;  3A58 A;  2VRW B;  5J3Q A;  2YT1 A;  1TXD A;  4C0A A;  1UPR A;  2YSZ A;  1GC7 A;  4MK0 A;  1V88 A;  2D11 A;  1W1D A;  2K2J A;  2D9W A;  4CYE A;  2DHJ A;  1LB1 A;  2MDX A;  2ELB A;  3HK0 A;  4GXB A;  5D3X A;  1K5G B;  5DHA B;  2NZ8 B;  3OHM B;  3D8D A;  3MPX A;  2MWN B;  3IVF A;  5DI9 B;  4GOU A;  4KHO A;  1EVH A;  2K00 A;  1SGH A;  1Y19 B;  4YON A;  4ZRK A;  1Y5O A;  5KCV A;  1ZYI A;  3SV1 A;  4Y94 A;  4IOY X;  3MDB C;  1U5G A;  4HHV A;  2HE7 A;  1XD4 A;  5HE0 A;  2K8E A;  4DX8 A;  2CAY A;  3D8F A;  1X11 A;  3PVW A;  2D9Z A;  3AU5 A;  2ELA A;  2VKI A;  3LJU X;  4ZRI A;  5FI1 A;  3FSS A;  2AL6 A;  3SO6 A;  4HB4 B;  2OTX A;  1LW3 A;  1QC6 A;  2HTH B;  1PMS A;  1MIX A;  4D0N B;  4OT1 A;  2L1C A;  2LOX A;  5DH9 B;  1BWN A;  4A5K A;  3KZ1 A;  5LON B;  2J0K A;  1RJ2 A;  2LYD A;  3DXE A;  4DBB A;  4A6F A;  3VIA A;  1ZC4 B;  4L6E A;  4WJ7 A;  3PSC A;  3QIJ A;  4P7I A;  5J3Y A;  3ODW A;  4DIX A;  4TYZ A;  1H4R A;  3NWA A;  2XQN M;  3F5R A;  4HDQ A;  5JHH A;  1K5D B;  4K17 A;  1MAI A;  4QJ4 B;  4CHJ A;  5JHG A;  4B6H A;  1Q67 A;  4KHB B;  1WGU A;  1FHO A;  4KAX B;  4TKN A;  3ODX A;  5EFX A;  2UZS A;  3KRW A;  4ZRJ A;  5DIF B;  2J59 M;  3ZVR A;  2Z0P A;  5D3W A;  1B55 A;  2GS0 A;  1UNP A;  3KSY A;  2K2U A;  2DN6 A;  2W2X D;  3X23 A;  1NI2 A;  1XKE A;  5DHF B;  4IAP A;  2Z0O A;  5C16 A;  5D27 A;  2YS3 A;  3SYX A;  2UVM A;  4YL8 A;  3P6A A;  4Z2M B;  1U27 A;  4GMV A;  1DDV A;  1NU2 A;  1ZVR A;  4F7H A;  2RVB B;  2R09 A;  2UZR A;  2YT0 A;  3ZDT A;  1XCG A;  4HDO A;  2FJU B;  5KQ1 A;  4HB3 B;  2Y7B A;  4NSW A;  3U7D A;  3ODO A;  2PZ1 A;  1V5M A;  3O96 A;  1V61 A;  4IFS A;  2RGN B;  2IYB A;  4EKU A;  2ROV A;  1E5W A;  1KZG A;  4HAW B;  2VSZ A;  1PLS A;  2I1K A;  3BJI A;  2J0J A;  2RLO A;  1I2H A;  2V76 A;  1Z87 A;  2J0M A;  2GJY A;  3TO1 A;  1QQG A;  1P5T A;  2YVC A;  1W1H A;  2D9Y A;  2E2X A;  2NBV A;  2KUP A;  1V5P A;  1SHC A;  1KZ7 A;  2L2I A;  5GOW B;  3FM8 C;  1UEF A;  2DHK A;  5C5B B;  1UNR A;  2NMB A;  2Q13 A;  2EMT A;  2P0H A;  2DYN A;  2KCJ A;  2P0D A;  1ZSQ A;  4HB0 B;  2DTC A;  2GCJ A;  1MKE A;  3UZT A;  1M7R A;  3N7C A;  5IRS A;  2M38 A;  1FAO A;  1XX0 A;  2I5F A;  4DXA B;  2ROZ B;  1EAZ A;  1WVH A;  2W2X C;  1PFJ A;  1V89 A;  1UNQ A;  1OY2 A;  2RUK B;  1MK7 B;  3NWD A;  3U8Z A;  3HIE A;  3SNH A;  2ZKM X;  1GG3 A;  5D3Y A;  2DYQ A;  4D6W A;  3F0W A;  1AWE A;  4KHB A;  3BIN A;  2Z14 A;  3FEH A;  4K2O A;  4L1R A;  4HB2 B;  1U2B A;  1BTK A;  2RSG A;  1NTV A;  2I1J A;  4Z2N A;  5C79 A;  2R2Y A;  3RCP A;  2Y8F A;  4CSQ A;  2W2W A;  2KR0 A;  5HE2 A;  2DFK A;  1J0W A;  3V5W A;  4MT7 A;  4QJ3 B;  5HE3 A;  1ZC3 B;  1FHW A;  5M4Y B;  5I2S A;  4EMO A;  3ULC A;  4GNK B;  3HW2 B;  2N23 A;  3AJ4 A;  1RRP B;  3AU4 A;  1M7E A;  3G9W A;  4WSF A;  4K81 A;  3U12 A;  4MY6 A;  2R0D A;  1IRS A;  2P8V A;  1P6S A;  3NSU A;  2ADZ A;  3A98 B;  2YF0 A;  1BTN A;  2MKR A;  2KIE A;  3KRX A;  3SUZ A;  1I7A A;  1EF1 A;  3HQC A;  5L81 A;  1XOD A;  3QBV B;  4GMX B;  2COF A;  1ZM0 A;  2COC A;  2LKO A;  2CRF A;  2YRY A;  2EC1 A;  2DA0 A;  5HE1 A;  1X86 A;  3VOQ A;  3PVL A;  4CHM A;  2BCJ A;  2D4Q A;  3TVV A;  4GN1 A;  4EJN A;  5CLL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...