2GCLA

Structure of the pob3 middle domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
238
structure length
230
Chain Sequence
VAGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHMMVMAIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
publication title The Structure of the yFACT Pob3-M Domain, Its Interaction with the DNA Replication Factor RPA, and a Potential Role in Nucleosome Deposition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 51
structure length 230
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gclA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 2gclA01
3DXEA 5CLQB 5JHGA 4HAVB 1WJ1A 1DDWA 2QKLA 4YONA 1I7AA 2ZPYA 3WYFB 1WGUA 4GN1A 1U5FA 1OQNA 5C6RA 2QKMA 3ULCA 4K2PA 1RJ2A 4TYZA 3VOQA 2XQNM 1W1GA 2N0YA 4L6EA 1FHWA 2Q13A 2GCJA 1AWEA 3MPXA 1BWNA 2BCJA 1EF1A 4K2OA 5HE2A 1ZSQA 2RSGA 2DKPA 4KAXB 2FJLA 5J3TA 4IFSA 2I1KA 4HDOA 1V5MA 2DHJA 4HAXB 2LULA 4A5KA 4CHMA 1NTVA 1XX0A 3QIJA 4KHAA 2CY4A 4GPTB 3KSYA 2RGNB 1FOEA 3MDBC 2GS0A 5JLJB 1H10A 2EJ8A 1GC6A 3ODXA 1W1HA 3SNHA 2X18A 1UPQA 2YS5A 4KHBB 1V88A 5DH9B 2PZ1A 2ADZA 1TQZA 3QWMA 1XR0B 4XWXA 4A6FB 4C0AA 1MIXA 2NZ8B 1FHOA 1RRPB 1W1DA 3AU4A 2ELBA 4HB3B 2COAA 2GCLA 3SUZA 4P7IA 4GXBA 4HATB 4GMXB 2LKOA 2E2XA 2KGXB 1XODA 4A6FA 4CHJA 4K17A 1QC6A 4DX90 4DX8A 4EKUA 2D9XA 1U2BA 5DI9B 2Y7BA 1UEFA 2EMSA 3NSUA 2M14A 1GG3A 2VKIA 3WA0A 1XKEA 3D8FA 5EFXA 4EJNA 2L2IA 1UNRA 1WGQA 1XD4A 4NSWA 2K00A 2J0KA 3ML4A 3GYOA 2DX1A 1ZC3B 5KQ1A 3PEGA 2UZSA 2KCJA 3U8ZA 1KI1B 2DLWA 3ODOA 3A8QA 1IRSA 4Z2NA 2M38A 1EAZA 4HAWB 1ZC4B 2IYBA 5HE0A 3N7CA 3QBVB 3V5WA 2UZRA 3PG7A 4MK0A 1E5WA 4PQ0A 1XCGA 1TXDA 3TVVA 1PLSA 5C5BA 4DBBA 3PVWA 2I5FA 3PSCA 4F7HA 3X23A 1NU2A 5D3WA 4HB0B 1P6SA 2RVBB 1U5GA 2W2WA 3GYPA 3KZ1A 3PVLA 1N3HA 3P7ZA 2HE7A 3SO6A 4D0NB 5J3QA 3PVUA 3T06A 2AEHA 3CIKA 3HW2B 3A8PA 3U7DA 1ISNA 2DHIA 4Y94A 2EC1A 2L1CA 3CXBB 4HB4B 1X1GA 4HAUB 5DHAB 4A6HA 2MDXA 2ROVA 4WVFB 2IFSA 2D9VA 3HK0A 5C16A 3TO1A 1DROA 3OANA 2DYNA 2D10A 2LG1A 3PZDA 1BAKA 3ULBA 4HDQA 1MK9B 1K5GB 1I2HA 3VIAA 2RLOA 1UPRA 2JP2A 1DYNA 2P0DA 2YVCA 3TCAA 2D4QA 2R0DA 4H8SA 2J59M 1PMSA 2LYDA 1Y5OA 1J0WA 1TJ6A 4HAZB 4IAPA 2OQBA 5DIFB 2VRWB 2Z0PA 2D11A 3BJIA 3AJ4A 1B55A 5L81A 2MFQA 1V89A 2COCA 1BTNA 1WI1A 1X86A 2MWNB 2KUPA 2YS1A 1OY2A 4IOYX 2Y8FA 2CY5A 2DKQA 1MAIA 1K5DB 2YRYA 2YSZA 3PP2A 2P0HA 3SV1A 2MKRA 2I1JA 1M7EA 1UNQA 3RCPA 1ZM0A 4K81A 2D9ZA 2I5CA 5JHHA 1M7RA 1AQCA 3P6AA 4GMVA 2DN6A 3F5RA 1PFJA 1FAOA 2H7EA 4A6KA 1SHCA 2YS3A 4HB2B 3ODWA 3HQCA 2W2XD 3A98B 4PNKA 1QQGA 3DXDA 1MK7B 2R09A 2Z0QA 4ZRKA 5FI1A 3UZTA 2DHKA 4DXAB 2VSZA 2K2JA 1SGHA 4B6HA 5CLLB 5HE3A 4ZRIA 3FSSA 1Z87A 2CODA 1FGYA 3TW1A 2DA0A 5D3XA 1GC7A 5D3VA 3KRWA 3KY9A 2DTCA 3BINA 3TFMA 1NTYA 1U5EA 1V61A 4HAYB 3F0WA 4NY0A 3KRXA 2DYQA 5J3YA 4GZUA 4KHOA 1DBHA 1V5PA 1U29A 3LJUX 4WSFA 2D2QA 3SYXA 2UVMA 3FEHA 5FI0A 3D8EA 3G9WA 5GOWB 1FHXA 4TKNA 3M1IB 3D8DA 1FGZA 2RUKB 1Y19B 4YL8A 5DHFB 4ZRJA 2YT1A 1H4RA 5LOPB 2Z0OA 2DX5A 1NI2A 5D27A 4KVGB 4MY6A 4CYEA 2LOXA 1DDMA 1MIZB 4HHVA 4Z2MB 1KZ7A 2EMTA 2GJYA 1KZGA 2AL6A 1FB8A 5C79A 2G35A 3DXCA 1WVHA 2D9YA 5D3YA 1J19A 3FM8C 1EGXA 4F7UP 4WJ7A 1EVHA 2N23A 1MKEA 1DDVA 5LONB 1MPHA 5JP4A 2K2UA 3ZVRA 2D9WA 2CAYA 2YF0A 1LB1A 1V5UA 1X11A 2DFKA 1X1FA 2J0JA 5KCVA 1U5DA 1ZVRA 4MT7A 1OMWA 5HE1A 4F7GA 1BTKA 2ROZB 1P5TA 3IVFA 2LOZA 4BBKA 1X05A 2Y8GA 2CRFA 3ZDTA 1P3RA 1Q67A 1WJMA 1UNPA 1U27A 2RNRB 2NMBA 2OTXA 2H7DA 2P0FA 2ELAA 2V76A 3O96A 1WG7A 2HTHB 2W2XC 2J0MA 2COFA 4EMOA 1LW3A 2YT0A 5C5BB 2P8VA 5KQ4A 3AU5A
chains in the Genus database with same CATH superfamily
3DXEA 5CLQB 5JHGA 4GNKB 4HAVB 5IRSA 3OHMB 1WJ1A 1DDWA 2QKLA 4YONA 1I7AA 2ZPYA 3WYFB 1WGUA 4GN1A 1U5FA 4QJ5B 1OQNA 3NWDA 5C6RA 2QKMA 3ULCA 4K2PA 1RJ2A 4TYZA 5I2MA 3VOQA 2XQNM 1W1GA 2KR0A 2N0YA 4L6EA 1FHWA 2Q13A 2GCJA 4DIXA 1AWEA 4QJ3B 2Z4DA 3MPXA 1BWNA 2BCJA 1EF1A 4K2OA 5HE2A 1ZSQA 2RSGA 2DKPA 4KAXB 2FJLA 5J3TA 4IFSA 2I1KA 4HDOA 3NWFA 1V5MA 2DHJA 2K49A 4HAXB 2LULA 4A5KA 4CHMA 1NTVA 1XX0A 3QIJA 2Z59A 4KHAA 2CY4A 2Z14A 4GPTB 3KSYA 2RGNB 1FOEA 3MDBC 2GS0A 5JLJB 1H10A 2EJ8A 1GC6A 3ODXA 1W1HA 3SNHA 2X18A 1UPQA 2YS5A 4KHBB 1V88A 5DH9B 2PZ1A 3B77A 2ADZA 1TQZA 3QWMA 1XR0B 4XWXA 4A6FB 4C0AA 4GOUA 1MIXA 5I2SA 2NZ8B 1FHOA 1RRPB 1W1DA 3AU4A 2ELBA 4HB3B 2COAA 2GCLA 3SUZA 4P7IA 4GXBA 4HATB 4GMXB 2LKOA 2E2XA 2KGXB 1XODA 3FVCA 4A6FA 4CHJA 4K17A 1QC6A 4DX90 4DX8A 4EKUA 3U12A 2D9XA 1U2BA 5DI9B 2Y7BA 1UEFA 2EMSA 3NSUA 2M14A 1GG3A 2VKIA 3WA0A 1XKEA 2NBVA 3D8FA 5EFXA 4EJNA 2L2IA 1UNRA 1WGQA 1XD4A 3DCXA 4NSWA 2K00A 2J0KA 3ML4A 3GYOA 2DX1A 1ZC3B 5KQ1A 3PEGA 2UZSA 2KCJA 3U8ZA 1KI1B 2DLWA 3ODOA 3A8QA 1IRSA 4Z2NA 2M38A 1EAZA 4HAWB 1ZC4B 2IYBA 5HE0A 3N7CA 3QBVB 2FJUB 2UZRA 3PG7A 4MK0A 3V5WA 1E5WA 4PQ0A 1XCGA 1TXDA 3TVVA 1PLSA 5C5BA 4DBBA 3PVWA 2I5FA 3PSCA 4F7HA 1ZYIA 3X23A 1NU2A 5D3WA 2GUMA 5M4YB 4HB0B 1P6SA 2RVBB 1U5GA 2W2WA 3GYPA 3KZ1A 3PVLA 1N3HA 3P7ZA 2HE7A 3SO6A 4D0NB 5J3QA 3PVUA 3T06A 2RRFA 2AEHA 3A58A 3CIKA 3HW2B 3A8PA 3NWAA 3U7DA 1ISNA 2DHIA 4Y94A 2EC1A 2L1CA 3CXBB 4HB4B 1X1GA 4HAUB 5DHAB 4A6HA 2MDXA 2ROVA 3HSAA 4WVFB 2IFSA 2D9VA 3HK0A 5C16A 3TO1A 1DROA 3OANA 2DYNA 4CSQA 2D10A 2LG1A 3PZDA 1BAKA 3ULBA 2KUQA 4HDQA 1MK9B 1K5GB 1I2HA 3VIAA 2RLOA 1UPRA 2JP2A 1DYNA 2KIGA 2P0DA 1T77A 2YVCA 3TCAA 2D4QA 2R0DA 4H8SA 2J59M 1PMSA 2LYDA 1Y5OA 1J0WA 1TJ6A 4HAZB 4IAPA 2OQBA 5DIFB 2VRWB 1MI1A 2Z0PA 2D11A 3BJIA 3AJ4A 1B55A 5L81A 2MFQA 1V89A 2COCA 1BTNA 1WI1A 1X86A 2MWNB 4KHBA 2KUPA 2YS1A 1OY2A 4IOYX 2Y8FA 4HSIA 2CY5A 2DKQA 1MAIA 1K5DB 2YRYA 2YSZA 3PP2A 2P0HA 3SV1A 2MKRA 2I1JA 4OT1A 1M7EA 1UNQA 3RCPA 2ZKMX 3HIEA 1ZM0A 4K81A 2D9ZA 2I5CA 5JHHA 1M7RA 1AQCA 3P6AA 4GMVA 2DN6A 3F5RA 1PFJA 1FAOA 2H7EA 4A6KA 1SHCA 2YS3A 4HB2B 3ODWA 3HQCA 2W2XD 3A98B 4PNKA 1QQGA 3DXDA 1MK7B 2R09A 2Z0QA 4ZRKA 5FI1A 3UZTA 2DHKA 4DXAB 2VSZA 2K2JA 2YT2A 1SGHA 4B6HA 5CLLB 5HE3A 4ZRIA 4QJ4B 3FSSA 1Z87A 2CODA 1FGYA 3TW1A 2DA0A 5D3XA 1GC7A 5D3VA 3KRWA 3KY9A 2DTCA 4OSNA 3BINA 3TFMA 1NTYA 1U5EA 1V61A 4HAYB 3F0WA 4NY0A 4D6WA 2K8EA 3KRXA 2DYQA 5J3YA 4GZUA 4KHOA 1DBHA 1V5PA 1U29A 3LJUX 4WSFA 2D2QA 3SYXA 2UVMA 3FEHA 5FI0A 3D8EA 3G9WA 5GOWB 1FHXA 4TKNA 3M1IB 3D8DA 1FGZA 2RUKB 1Y19B 4YL8A 5DHFB 4ZRJA 2YT1A 1H4RA 5LOPB 2Z0OA 2DX5A 1NI2A 5D27A 4KVGB 5LG4B 4MY6A 4CYEA 2LOXA 1DDMA 1MIZB 4HHVA 4Z2MB 2R2YA 1KZ7A 2EMTA 2GJYA 1KZGA 2AL6A 1FB8A 5C79A 2G35A 3DXCA 1WVHA 2D9YA 5D3YA 1J19A 3FM8C 1EGXA 4F7UP 4WJ7A 1EVHA 2N23A 1MKEA 1DDVA 5LONB 1MPHA 5JP4A 2K2UA 3ZVRA 2D9WA 2CAYA 2YF0A 1LB1A 2KIEA 1V5UA 4L1RA 1X11A 2DFKA 1X1FA 2J0JA 5KCVA 1U5DA 1ZVRA 4MT7A 1OMWA 5HE1A 4F7GA 1BTKA 2ROZB 1P5TA 3IVFA 2LOZA 4BBKA 1X05A 2Y8GA 2CRFA 3ZDTA 1P3RA 1Q67A 1WJMA 1UNPA 1U27A 2RNRB 2NMBA 2OTXA 2H7DA 2P0FA 3NW8A 2ELAA 2V76A 3O96A 1WG7A 2HTHB 4QXAB 2W2XC 2J0MA 2COFA 4EMOA 1LW3A 2YT0A 2Z13A 5C5BB 2P8VA 5KQ4A 3AU5A
chains in the Genus database with same CATH topology
3DXEA 5CLQB 5JHGA 4GNKB 4HAVB 5IRSA 3OHMB 1WJ1A 1DDWA 2QKLA 4YONA 1I7AA 2ZPYA 3WYFB 1WGUA 4GN1A 1U5FA 4QJ5B 1OQNA 3NWDA 5C6RA 2QKMA 3ULCA 4K2PA 1RJ2A 4TYZA 5I2MA 3VOQA 2XQNM 1W1GA 2KR0A 2N0YA 4L6EA 1FHWA 2Q13A 2GCJA 4DIXA 1AWEA 4QJ3B 2Z4DA 3MPXA 1BWNA 2BCJA 1EF1A 4K2OA 5HE2A 1ZSQA 2RSGA 2DKPA 4KAXB 2FJLA 5J3TA 4IFSA 2I1KA 4HDOA 3NWFA 1V5MA 2DHJA 2K49A 4HAXB 2LULA 4A5KA 4CHMA 1NTVA 1XX0A 3QIJA 2Z59A 4KHAA 2CY4A 4GPTB 2Z14A 3KSYA 2RGNB 1FOEA 3MDBC 2GS0A 5JLJB 1H10A 2EJ8A 1GC6A 3ODXA 1W1HA 3SNHA 2X18A 1UPQA 2YS5A 4KHBB 1V88A 5DH9B 2PZ1A 2ADZA 1TQZA 3QWMA 1XR0B 4XWXA 4A6FB 4C0AA 4GOUA 1MIXA 5I2SA 2NZ8B 1FHOA 1RRPB 1W1DA 3AU4A 2ELBA 4HB3B 2COAA 2GCLA 3SUZA 4P7IA 4GXBA 4HATB 4GMXB 2LKOA 2E2XA 2KGXB 1XODA 3FVCA 4A6FA 4CHJA 4K17A 1QC6A 4DX90 4DX8A 4EKUA 3U12A 2D9XA 1U2BA 5DI9B 2Y7BA 1UEFA 2EMSA 3NSUA 2M14A 1GG3A 2VKIA 3WA0A 1XKEA 3D8FA 5EFXA 4EJNA 2NBVA 2L2IA 1UNRA 1WGQA 1XD4A 4NSWA 2K00A 2J0KA 3ML4A 3GYOA 2DX1A 1ZC3B 5KQ1A 3PEGA 2UZSA 2KCJA 3U8ZA 1KI1B 2DLWA 3ODOA 3A8QA 1IRSA 4Z2NA 2M38A 1EAZA 4HAWB 1ZC4B 2IYBA 5HE0A 3N7CA 3QBVB 3V5WA 2UZRA 3PG7A 4MK0A 2FJUB 1E5WA 4PQ0A 1XCGA 1TXDA 3TVVA 1PLSA 5C5BA 4DBBA 3PVWA 2I5FA 3PSCA 4F7HA 1ZYIA 3X23A 1NU2A 5D3WA 2GUMA 5M4YB 4HB0B 1P6SA 2RVBB 1U5GA 2W2WA 3GYPA 3KZ1A 3PVLA 1N3HA 3P7ZA 2HE7A 3SO6A 4D0NB 5J3QA 3PVUA 3T06A 2RRFA 2AEHA 3A58A 3CIKA 3HW2B 3A8PA 3NWAA 3U7DA 1ISNA 2DHIA 4Y94A 2EC1A 2L1CA 3CXBB 4HB4B 1X1GA 4HAUB 5DHAB 4A6HA 2MDXA 2ROVA 4WVFB 2IFSA 2D9VA 3HK0A 5C16A 3TO1A 1DROA 3OANA 2DYNA 4CSQA 2D10A 2LG1A 3PZDA 1BAKA 3ULBA 4HDQA 2KUQA 1MK9B 1K5GB 1I2HA 3VIAA 2RLOA 1UPRA 2JP2A 1DYNA 2P0DA 2KIGA 2YVCA 3TCAA 2D4QA 2R0DA 4H8SA 2J59M 1PMSA 2LYDA 1Y5OA 1J0WA 1TJ6A 4HAZB 4IAPA 2OQBA 5DIFB 2VRWB 2Z0PA 2D11A 3BJIA 3AJ4A 1B55A 5L81A 2MFQA 1V89A 2COCA 1BTNA 1WI1A 1X86A 2MWNB 4KHBA 2KUPA 2YS1A 1OY2A 4IOYX 2Y8FA 4HSIA 2CY5A 2DKQA 1MAIA 1K5DB 2YRYA 2YSZA 3PP2A 2P0HA 3SV1A 2MKRA 2I1JA 4OT1A 1M7EA 1UNQA 3RCPA 2ZKMX 3HIEA 1ZM0A 4K81A 2D9ZA 2I5CA 5JHHA 1M7RA 1AQCA 3P6AA 4GMVA 2DN6A 3F5RA 1PFJA 1FAOA 2H7EA 4A6KA 1SHCA 2YS3A 4HB2B 3ODWA 3HQCA 2W2XD 3A98B 4PNKA 1QQGA 3DXDA 1MK7B 2R09A 2Z0QA 4ZRKA 5FI1A 3UZTA 2DHKA 4DXAB 2VSZA 2K2JA 2YT2A 1SGHA 4B6HA 5CLLB 5HE3A 4ZRIA 4QJ4B 3FSSA 1Z87A 2CODA 1FGYA 3TW1A 2DA0A 5D3XA 1GC7A 5D3VA 3KRWA 3KY9A 2DTCA 4OSNA 3BINA 3TFMA 1NTYA 1U5EA 1V61A 4HAYB 3F0WA 4NY0A 4D6WA 2K8EA 3KRXA 2DYQA 5J3YA 4GZUA 4KHOA 1DBHA 1V5PA 1U29A 3LJUX 4WSFA 2D2QA 3SYXA 2UVMA 3FEHA 5FI0A 3D8EA 3G9WA 5GOWB 1FHXA 4TKNA 3M1IB 3D8DA 1FGZA 2RUKB 1Y19B 4YL8A 5DHFB 4ZRJA 2YT1A 1H4RA 5LOPB 2Z0OA 2DX5A 1NI2A 5D27A 4KVGB 5LG4B 4MY6A 4CYEA 2LOXA 1DDMA 1MIZB 4HHVA 4Z2MB 2R2YA 1KZ7A 2EMTA 2GJYA 1KZGA 2AL6A 1FB8A 5C79A 2G35A 3DXCA 1WVHA 2D9YA 5D3YA 1J19A 3FM8C 1EGXA 4F7UP 4WJ7A 1EVHA 2N23A 1MKEA 1DDVA 5LONB 1MPHA 5JP4A 2K2UA 3ZVRA 2D9WA 2CAYA 2YF0A 1LB1A 2KIEA 1V5UA 4L1RA 1X11A 2DFKA 1X1FA 2J0JA 5KCVA 1U5DA 1ZVRA 4MT7A 1OMWA 5HE1A 4F7GA 1BTKA 2ROZB 1P5TA 3IVFA 2LOZA 4BBKA 1X05A 2Y8GA 2CRFA 3ZDTA 1P3RA 1Q67A 1WJMA 1UNPA 1U27A 2RNRB 2NMBA 2OTXA 2H7DA 2P0FA 3NW8A 2ELAA 2V76A 3O96A 1WG7A 2HTHB 4QXAB 2W2XC 2J0MA 2COFA 4EMOA 1LW3A 2YT0A 2Z13A 5C5BB 2P8VA 5KQ4A 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXE A;  5CLQ B;  5JHG A;  4HAV B;  1WJ1 A;  1DDW A;  2QKL A;  4YON A;  1I7A A;  2ZPY A;  3WYF B;  1WGU A;  4GN1 A;  1U5F A;  1OQN A;  5C6R A;  2QKM A;  3ULC A;  4K2P A;  1RJ2 A;  4TYZ A;  3VOQ A;  2XQN M;  1W1G A;  2N0Y A;  4L6E A;  1FHW A;  2Q13 A;  2GCJ A;  1AWE A;  3MPX A;  1BWN A;  2BCJ A;  1EF1 A;  4K2O A;  5HE2 A;  1ZSQ A;  2RSG A;  2DKP A;  4KAX B;  2FJL A;  5J3T A;  4IFS A;  2I1K A;  4HDO A;  1V5M A;  2DHJ A;  4HAX B;  2LUL A;  4A5K A;  4CHM A;  1NTV A;  1XX0 A;  3QIJ A;  4KHA A;  2CY4 A;  4GPT B;  3KSY A;  2RGN B;  1FOE A;  3MDB C;  2GS0 A;  5JLJ B;  1H10 A;  2EJ8 A;  1GC6 A;  3ODX A;  1W1H A;  3SNH A;  2X18 A;  1UPQ A;  2YS5 A;  4KHB B;  1V88 A;  5DH9 B;  2PZ1 A;  2ADZ A;  1TQZ A;  3QWM A;  1XR0 B;  4XWX A;  4A6F B;  4C0A A;  1MIX A;  2NZ8 B;  1FHO A;  1RRP B;  1W1D A;  3AU4 A;  2ELB A;  4HB3 B;  2COA A;  2GCL A;  3SUZ A;  4P7I A;  4GXB A;  4HAT B;  4GMX B;  2LKO A;  2E2X A;  2KGX B;  1XOD A;  4A6F A;  4CHJ A;  4K17 A;  1QC6 A;  4DX9 0;  4DX8 A;  4EKU A;  2D9X A;  1U2B A;  5DI9 B;  2Y7B A;  1UEF A;  2EMS A;  3NSU A;  2M14 A;  1GG3 A;  2VKI A;  3WA0 A;  1XKE A;  3D8F A;  5EFX A;  4EJN A;  2L2I A;  1UNR A;  1WGQ A;  1XD4 A;  4NSW A;  2K00 A;  2J0K A;  3ML4 A;  3GYO A;  2DX1 A;  1ZC3 B;  5KQ1 A;  3PEG A;  2UZS A;  2KCJ A;  3U8Z A;  1KI1 B;  2DLW A;  3ODO A;  3A8Q A;  1IRS A;  4Z2N A;  2M38 A;  1EAZ A;  4HAW B;  1ZC4 B;  2IYB A;  5HE0 A;  3N7C A;  3QBV B;  3V5W A;  2UZR A;  3PG7 A;  4MK0 A;  1E5W A;  4PQ0 A;  1XCG A;  1TXD A;  3TVV A;  1PLS A;  5C5B A;  4DBB A;  3PVW A;  2I5F A;  3PSC A;  4F7H A;  3X23 A;  1NU2 A;  5D3W A;  4HB0 B;  1P6S A;  2RVB B;  1U5G A;  2W2W A;  3GYP A;  3KZ1 A;  3PVL A;  1N3H A;  3P7Z A;  2HE7 A;  3SO6 A;  4D0N B;  5J3Q A;  3PVU A;  3T06 A;  2AEH A;  3CIK A;  3HW2 B;  3A8P A;  3U7D A;  1ISN A;  2DHI A;  4Y94 A;  2EC1 A;  2L1C A;  3CXB B;  4HB4 B;  1X1G A;  4HAU B;  5DHA B;  4A6H A;  2MDX A;  2ROV A;  4WVF B;  2IFS A;  2D9V A;  3HK0 A;  5C16 A;  3TO1 A;  1DRO A;  3OAN A;  2DYN A;  2D10 A;  2LG1 A;  3PZD A;  1BAK A;  3ULB A;  4HDQ A;  1MK9 B;  1K5G B;  1I2H A;  3VIA A;  2RLO A;  1UPR A;  2JP2 A;  1DYN A;  2P0D A;  2YVC A;  3TCA A;  2D4Q A;  2R0D A;  4H8S A;  2J59 M;  1PMS A;  2LYD A;  1Y5O A;  1J0W A;  1TJ6 A;  4HAZ B;  4IAP A;  2OQB A;  5DIF B;  2VRW B;  2Z0P A;  2D11 A;  3BJI A;  3AJ4 A;  1B55 A;  5L81 A;  2MFQ A;  1V89 A;  2COC A;  1BTN A;  1WI1 A;  1X86 A;  2MWN B;  2KUP A;  2YS1 A;  1OY2 A;  4IOY X;  2Y8F A;  2CY5 A;  2DKQ A;  1MAI A;  1K5D B;  2YRY A;  2YSZ A;  3PP2 A;  2P0H A;  3SV1 A;  2MKR A;  2I1J A;  1M7E A;  1UNQ A;  3RCP A;  1ZM0 A;  4K81 A;  2D9Z A;  2I5C A;  5JHH A;  1M7R A;  1AQC A;  3P6A A;  4GMV A;  2DN6 A;  3F5R A;  1PFJ A;  1FAO A;  2H7E A;  4A6K A;  1SHC A;  2YS3 A;  4HB2 B;  3ODW A;  3HQC A;  2W2X D;  3A98 B;  4PNK A;  1QQG A;  3DXD A;  1MK7 B;  2R09 A;  2Z0Q A;  4ZRK A;  5FI1 A;  3UZT A;  2DHK A;  4DXA B;  2VSZ A;  2K2J A;  1SGH A;  4B6H A;  5CLL B;  5HE3 A;  4ZRI A;  3FSS A;  1Z87 A;  2COD A;  1FGY A;  3TW1 A;  2DA0 A;  5D3X A;  1GC7 A;  5D3V A;  3KRW A;  3KY9 A;  2DTC A;  3BIN A;  3TFM A;  1NTY A;  1U5E A;  1V61 A;  4HAY B;  3F0W A;  4NY0 A;  3KRX A;  2DYQ A;  5J3Y A;  4GZU A;  4KHO A;  1DBH A;  1V5P A;  1U29 A;  3LJU X;  4WSF A;  2D2Q A;  3SYX A;  2UVM A;  3FEH A;  5FI0 A;  3D8E A;  3G9W A;  5GOW B;  1FHX A;  4TKN A;  3M1I B;  3D8D A;  1FGZ A;  2RUK B;  1Y19 B;  4YL8 A;  5DHF B;  4ZRJ A;  2YT1 A;  1H4R A;  5LOP B;  2Z0O A;  2DX5 A;  1NI2 A;  5D27 A;  4KVG B;  4MY6 A;  4CYE A;  2LOX A;  1DDM A;  1MIZ B;  4HHV A;  4Z2M B;  1KZ7 A;  2EMT A;  2GJY A;  1KZG A;  2AL6 A;  1FB8 A;  5C79 A;  2G35 A;  3DXC A;  1WVH A;  2D9Y A;  5D3Y A;  1J19 A;  3FM8 C;  1EGX A;  4F7U P;  4WJ7 A;  1EVH A;  2N23 A;  1MKE A;  1DDV A;  5LON B;  1MPH A;  5JP4 A;  2K2U A;  3ZVR A;  2D9W A;  2CAY A;  2YF0 A;  1LB1 A;  1V5U A;  1X11 A;  2DFK A;  1X1F A;  2J0J A;  5KCV A;  1U5D A;  1ZVR A;  4MT7 A;  1OMW A;  5HE1 A;  4F7G A;  1BTK A;  2ROZ B;  1P5T A;  3IVF A;  2LOZ A;  4BBK A;  1X05 A;  2Y8G A;  2CRF A;  3ZDT A;  1P3R A;  1Q67 A;  1WJM A;  1UNP A;  1U27 A;  2RNR B;  2NMB A;  2OTX A;  2H7D A;  2P0F A;  2ELA A;  2V76 A;  3O96 A;  1WG7 A;  2HTH B;  2W2X C;  2J0M A;  2COF A;  4EMO A;  1LW3 A;  2YT0 A;  5C5B B;  2P8V A;  5KQ4 A;  3AU5 A; 
#chains in the Genus database with same CATH topology
 3DXE A;  5CLQ B;  5JHG A;  4GNK B;  4HAV B;  5IRS A;  3OHM B;  1WJ1 A;  1DDW A;  2QKL A;  4YON A;  1I7A A;  2ZPY A;  3WYF B;  1WGU A;  4GN1 A;  1U5F A;  4QJ5 B;  1OQN A;  3NWD A;  5C6R A;  2QKM A;  3ULC A;  4K2P A;  1RJ2 A;  4TYZ A;  5I2M A;  3VOQ A;  2XQN M;  1W1G A;  2KR0 A;  2N0Y A;  4L6E A;  1FHW A;  2Q13 A;  2GCJ A;  4DIX A;  1AWE A;  4QJ3 B;  2Z4D A;  3MPX A;  1BWN A;  2BCJ A;  1EF1 A;  4K2O A;  5HE2 A;  1ZSQ A;  2RSG A;  2DKP A;  4KAX B;  2FJL A;  5J3T A;  4IFS A;  2I1K A;  4HDO A;  3NWF A;  1V5M A;  2DHJ A;  2K49 A;  4HAX B;  2LUL A;  4A5K A;  4CHM A;  1NTV A;  1XX0 A;  3QIJ A;  2Z59 A;  4KHA A;  2CY4 A;  2Z14 A;  4GPT B;  3KSY A;  2RGN B;  1FOE A;  3MDB C;  2GS0 A;  5JLJ B;  1H10 A;  2EJ8 A;  1GC6 A;  3ODX A;  1W1H A;  3SNH A;  2X18 A;  1UPQ A;  2YS5 A;  4KHB B;  1V88 A;  5DH9 B;  2PZ1 A;  3B77 A;  2ADZ A;  1TQZ A;  3QWM A;  1XR0 B;  4XWX A;  4A6F B;  4C0A A;  4GOU A;  1MIX A;  5I2S A;  2NZ8 B;  1FHO A;  1RRP B;  1W1D A;  3AU4 A;  2ELB A;  4HB3 B;  2COA A;  2GCL A;  3SUZ A;  4P7I A;  4GXB A;  4HAT B;  4GMX B;  2LKO A;  2E2X A;  2KGX B;  1XOD A;  3FVC A;  4A6F A;  4CHJ A;  4K17 A;  1QC6 A;  4DX9 0;  4DX8 A;  4EKU A;  3U12 A;  2D9X A;  1U2B A;  5DI9 B;  2Y7B A;  1UEF A;  2EMS A;  3NSU A;  2M14 A;  1GG3 A;  2VKI A;  3WA0 A;  1XKE A;  2NBV A;  3D8F A;  5EFX A;  4EJN A;  2L2I A;  1UNR A;  1WGQ A;  1XD4 A;  3DCX A;  4NSW A;  2K00 A;  2J0K A;  3ML4 A;  3GYO A;  2DX1 A;  1ZC3 B;  5KQ1 A;  3PEG A;  2UZS A;  2KCJ A;  3U8Z A;  1KI1 B;  2DLW A;  3ODO A;  3A8Q A;  1IRS A;  4Z2N A;  2M38 A;  1EAZ A;  4HAW B;  1ZC4 B;  2IYB A;  5HE0 A;  3N7C A;  3QBV B;  2FJU B;  2UZR A;  3PG7 A;  4MK0 A;  3V5W A;  1E5W A;  4PQ0 A;  1XCG A;  1TXD A;  3TVV A;  1PLS A;  5C5B A;  4DBB A;  3PVW A;  2I5F A;  3PSC A;  4F7H A;  1ZYI A;  3X23 A;  1NU2 A;  5D3W A;  2GUM A;  5M4Y B;  4HB0 B;  1P6S A;  2RVB B;  1U5G A;  2W2W A;  3GYP A;  3KZ1 A;  3PVL A;  1N3H A;  3P7Z A;  2HE7 A;  3SO6 A;  4D0N B;  5J3Q A;  3PVU A;  3T06 A;  2RRF A;  2AEH A;  3A58 A;  3CIK A;  3HW2 B;  3A8P A;  3NWA A;  3U7D A;  1ISN A;  2DHI A;  4Y94 A;  2EC1 A;  2L1C A;  3CXB B;  4HB4 B;  1X1G A;  4HAU B;  5DHA B;  4A6H A;  2MDX A;  2ROV A;  3HSA A;  4WVF B;  2IFS A;  2D9V A;  3HK0 A;  5C16 A;  3TO1 A;  1DRO A;  3OAN A;  2DYN A;  4CSQ A;  2D10 A;  2LG1 A;  3PZD A;  1BAK A;  3ULB A;  2KUQ A;  4HDQ A;  1MK9 B;  1K5G B;  1I2H A;  3VIA A;  2RLO A;  1UPR A;  2JP2 A;  1DYN A;  2KIG A;  2P0D A;  1T77 A;  2YVC A;  3TCA A;  2D4Q A;  2R0D A;  4H8S A;  2J59 M;  1PMS A;  2LYD A;  1Y5O A;  1J0W A;  1TJ6 A;  4HAZ B;  4IAP A;  2OQB A;  5DIF B;  2VRW B;  1MI1 A;  2Z0P A;  2D11 A;  3BJI A;  3AJ4 A;  1B55 A;  5L81 A;  2MFQ A;  1V89 A;  2COC A;  1BTN A;  1WI1 A;  1X86 A;  2MWN B;  4KHB A;  2KUP A;  2YS1 A;  1OY2 A;  4IOY X;  2Y8F A;  4HSI A;  2CY5 A;  2DKQ A;  1MAI A;  1K5D B;  2YRY A;  2YSZ A;  3PP2 A;  2P0H A;  3SV1 A;  2MKR A;  2I1J A;  4OT1 A;  1M7E A;  1UNQ A;  3RCP A;  2ZKM X;  3HIE A;  1ZM0 A;  4K81 A;  2D9Z A;  2I5C A;  5JHH A;  1M7R A;  1AQC A;  3P6A A;  4GMV A;  2DN6 A;  3F5R A;  1PFJ A;  1FAO A;  2H7E A;  4A6K A;  1SHC A;  2YS3 A;  4HB2 B;  3ODW A;  3HQC A;  2W2X D;  3A98 B;  4PNK A;  1QQG A;  3DXD A;  1MK7 B;  2R09 A;  2Z0Q A;  4ZRK A;  5FI1 A;  3UZT A;  2DHK A;  4DXA B;  2VSZ A;  2K2J A;  2YT2 A;  1SGH A;  4B6H A;  5CLL B;  5HE3 A;  4ZRI A;  4QJ4 B;  3FSS A;  1Z87 A;  2COD A;  1FGY A;  3TW1 A;  2DA0 A;  5D3X A;  1GC7 A;  5D3V A;  3KRW A;  3KY9 A;  2DTC A;  4OSN A;  3BIN A;  3TFM A;  1NTY A;  1U5E A;  1V61 A;  4HAY B;  3F0W A;  4NY0 A;  4D6W A;  2K8E A;  3KRX A;  2DYQ A;  5J3Y A;  4GZU A;  4KHO A;  1DBH A;  1V5P A;  1U29 A;  3LJU X;  4WSF A;  2D2Q A;  3SYX A;  2UVM A;  3FEH A;  5FI0 A;  3D8E A;  3G9W A;  5GOW B;  1FHX A;  4TKN A;  3M1I B;  3D8D A;  1FGZ A;  2RUK B;  1Y19 B;  4YL8 A;  5DHF B;  4ZRJ A;  2YT1 A;  1H4R A;  5LOP B;  2Z0O A;  2DX5 A;  1NI2 A;  5D27 A;  4KVG B;  5LG4 B;  4MY6 A;  4CYE A;  2LOX A;  1DDM A;  1MIZ B;  4HHV A;  4Z2M B;  2R2Y A;  1KZ7 A;  2EMT A;  2GJY A;  1KZG A;  2AL6 A;  1FB8 A;  5C79 A;  2G35 A;  3DXC A;  1WVH A;  2D9Y A;  5D3Y A;  1J19 A;  3FM8 C;  1EGX A;  4F7U P;  4WJ7 A;  1EVH A;  2N23 A;  1MKE A;  1DDV A;  5LON B;  1MPH A;  5JP4 A;  2K2U A;  3ZVR A;  2D9W A;  2CAY A;  2YF0 A;  1LB1 A;  2KIE A;  1V5U A;  4L1R A;  1X11 A;  2DFK A;  1X1F A;  2J0J A;  5KCV A;  1U5D A;  1ZVR A;  4MT7 A;  1OMW A;  5HE1 A;  4F7G A;  1BTK A;  2ROZ B;  1P5T A;  3IVF A;  2LOZ A;  4BBK A;  1X05 A;  2Y8G A;  2CRF A;  3ZDT A;  1P3R A;  1Q67 A;  1WJM A;  1UNP A;  1U27 A;  2RNR B;  2NMB A;  2OTX A;  2H7D A;  2P0F A;  3NW8 A;  2ELA A;  2V76 A;  3O96 A;  1WG7 A;  2HTH B;  4QXA B;  2W2X C;  2J0M A;  2COF A;  4EMO A;  1LW3 A;  2YT0 A;  2Z13 A;  5C5B B;  2P8V A;  5KQ4 A;  3AU5 A; 
#chains in the Genus database with same CATH homology
 3DXE A;  5CLQ B;  5JHG A;  4GNK B;  4HAV B;  5IRS A;  3OHM B;  1WJ1 A;  1DDW A;  2QKL A;  4YON A;  1I7A A;  2ZPY A;  3WYF B;  1WGU A;  4GN1 A;  1U5F A;  4QJ5 B;  1OQN A;  3NWD A;  5C6R A;  2QKM A;  3ULC A;  4K2P A;  1RJ2 A;  4TYZ A;  5I2M A;  3VOQ A;  2XQN M;  1W1G A;  2KR0 A;  2N0Y A;  4L6E A;  1FHW A;  2Q13 A;  2GCJ A;  4DIX A;  1AWE A;  4QJ3 B;  2Z4D A;  3MPX A;  1BWN A;  2BCJ A;  1EF1 A;  4K2O A;  5HE2 A;  1ZSQ A;  2RSG A;  2DKP A;  4KAX B;  2FJL A;  5J3T A;  4IFS A;  2I1K A;  4HDO A;  3NWF A;  1V5M A;  2DHJ A;  2K49 A;  4HAX B;  2LUL A;  4A5K A;  4CHM A;  1NTV A;  1XX0 A;  3QIJ A;  2Z59 A;  4KHA A;  2CY4 A;  4GPT B;  2Z14 A;  3KSY A;  2RGN B;  1FOE A;  3MDB C;  2GS0 A;  5JLJ B;  1H10 A;  2EJ8 A;  1GC6 A;  3ODX A;  1W1H A;  3SNH A;  2X18 A;  1UPQ A;  2YS5 A;  4KHB B;  1V88 A;  5DH9 B;  2PZ1 A;  2ADZ A;  1TQZ A;  3QWM A;  1XR0 B;  4XWX A;  4A6F B;  4C0A A;  4GOU A;  1MIX A;  5I2S A;  2NZ8 B;  1FHO A;  1RRP B;  1W1D A;  3AU4 A;  2ELB A;  4HB3 B;  2COA A;  2GCL A;  3SUZ A;  4P7I A;  4GXB A;  4HAT B;  4GMX B;  2LKO A;  2E2X A;  2KGX B;  1XOD A;  3FVC A;  4A6F A;  4CHJ A;  4K17 A;  1QC6 A;  4DX9 0;  4DX8 A;  4EKU A;  3U12 A;  2D9X A;  1U2B A;  5DI9 B;  2Y7B A;  1UEF A;  2EMS A;  3NSU A;  2M14 A;  1GG3 A;  2VKI A;  3WA0 A;  1XKE A;  3D8F A;  5EFX A;  4EJN A;  2NBV A;  2L2I A;  1UNR A;  1WGQ A;  1XD4 A;  4NSW A;  2K00 A;  2J0K A;  3ML4 A;  3GYO A;  2DX1 A;  1ZC3 B;  5KQ1 A;  3PEG A;  2UZS A;  2KCJ A;  3U8Z A;  1KI1 B;  2DLW A;  3ODO A;  3A8Q A;  1IRS A;  4Z2N A;  2M38 A;  1EAZ A;  4HAW B;  1ZC4 B;  2IYB A;  5HE0 A;  3N7C A;  3QBV B;  3V5W A;  2UZR A;  3PG7 A;  4MK0 A;  2FJU B;  1E5W A;  4PQ0 A;  1XCG A;  1TXD A;  3TVV A;  1PLS A;  5C5B A;  4DBB A;  3PVW A;  2I5F A;  3PSC A;  4F7H A;  1ZYI A;  3X23 A;  1NU2 A;  5D3W A;  2GUM A;  5M4Y B;  4HB0 B;  1P6S A;  2RVB B;  1U5G A;  2W2W A;  3GYP A;  3KZ1 A;  3PVL A;  1N3H A;  3P7Z A;  2HE7 A;  3SO6 A;  4D0N B;  5J3Q A;  3PVU A;  3T06 A;  2RRF A;  2AEH A;  3A58 A;  3CIK A;  3HW2 B;  3A8P A;  3NWA A;  3U7D A;  1ISN A;  2DHI A;  4Y94 A;  2EC1 A;  2L1C A;  3CXB B;  4HB4 B;  1X1G A;  4HAU B;  5DHA B;  4A6H A;  2MDX A;  2ROV A;  4WVF B;  2IFS A;  2D9V A;  3HK0 A;  5C16 A;  3TO1 A;  1DRO A;  3OAN A;  2DYN A;  4CSQ A;  2D10 A;  2LG1 A;  3PZD A;  1BAK A;  3ULB A;  4HDQ A;  2KUQ A;  1MK9 B;  1K5G B;  1I2H A;  3VIA A;  2RLO A;  1UPR A;  2JP2 A;  1DYN A;  2P0D A;  2KIG A;  2YVC A;  3TCA A;  2D4Q A;  2R0D A;  4H8S A;  2J59 M;  1PMS A;  2LYD A;  1Y5O A;  1J0W A;  1TJ6 A;  4HAZ B;  4IAP A;  2OQB A;  5DIF B;  2VRW B;  2Z0P A;  2D11 A;  3BJI A;  3AJ4 A;  1B55 A;  5L81 A;  2MFQ A;  1V89 A;  2COC A;  1BTN A;  1WI1 A;  1X86 A;  2MWN B;  4KHB A;  2KUP A;  2YS1 A;  1OY2 A;  4IOY X;  2Y8F A;  4HSI A;  2CY5 A;  2DKQ A;  1MAI A;  1K5D B;  2YRY A;  2YSZ A;  3PP2 A;  2P0H A;  3SV1 A;  2MKR A;  2I1J A;  4OT1 A;  1M7E A;  1UNQ A;  3RCP A;  2ZKM X;  3HIE A;  1ZM0 A;  4K81 A;  2D9Z A;  2I5C A;  5JHH A;  1M7R A;  1AQC A;  3P6A A;  4GMV A;  2DN6 A;  3F5R A;  1PFJ A;  1FAO A;  2H7E A;  4A6K A;  1SHC A;  2YS3 A;  4HB2 B;  3ODW A;  3HQC A;  2W2X D;  3A98 B;  4PNK A;  1QQG A;  3DXD A;  1MK7 B;  2R09 A;  2Z0Q A;  4ZRK A;  5FI1 A;  3UZT A;  2DHK A;  4DXA B;  2VSZ A;  2K2J A;  2YT2 A;  1SGH A;  4B6H A;  5CLL B;  5HE3 A;  4ZRI A;  4QJ4 B;  3FSS A;  1Z87 A;  2COD A;  1FGY A;  3TW1 A;  2DA0 A;  5D3X A;  1GC7 A;  5D3V A;  3KRW A;  3KY9 A;  2DTC A;  4OSN A;  3BIN A;  3TFM A;  1NTY A;  1U5E A;  1V61 A;  4HAY B;  3F0W A;  4NY0 A;  4D6W A;  2K8E A;  3KRX A;  2DYQ A;  5J3Y A;  4GZU A;  4KHO A;  1DBH A;  1V5P A;  1U29 A;  3LJU X;  4WSF A;  2D2Q A;  3SYX A;  2UVM A;  3FEH A;  5FI0 A;  3D8E A;  3G9W A;  5GOW B;  1FHX A;  4TKN A;  3M1I B;  3D8D A;  1FGZ A;  2RUK B;  1Y19 B;  4YL8 A;  5DHF B;  4ZRJ A;  2YT1 A;  1H4R A;  5LOP B;  2Z0O A;  2DX5 A;  1NI2 A;  5D27 A;  4KVG B;  5LG4 B;  4MY6 A;  4CYE A;  2LOX A;  1DDM A;  1MIZ B;  4HHV A;  4Z2M B;  2R2Y A;  1KZ7 A;  2EMT A;  2GJY A;  1KZG A;  2AL6 A;  1FB8 A;  5C79 A;  2G35 A;  3DXC A;  1WVH A;  2D9Y A;  5D3Y A;  1J19 A;  3FM8 C;  1EGX A;  4F7U P;  4WJ7 A;  1EVH A;  2N23 A;  1MKE A;  1DDV A;  5LON B;  1MPH A;  5JP4 A;  2K2U A;  3ZVR A;  2D9W A;  2CAY A;  2YF0 A;  1LB1 A;  2KIE A;  1V5U A;  4L1R A;  1X11 A;  2DFK A;  1X1F A;  2J0J A;  5KCV A;  1U5D A;  1ZVR A;  4MT7 A;  1OMW A;  5HE1 A;  4F7G A;  1BTK A;  2ROZ B;  1P5T A;  3IVF A;  2LOZ A;  4BBK A;  1X05 A;  2Y8G A;  2CRF A;  3ZDT A;  1P3R A;  1Q67 A;  1WJM A;  1UNP A;  1U27 A;  2RNR B;  2NMB A;  2OTX A;  2H7D A;  2P0F A;  3NW8 A;  2ELA A;  2V76 A;  3O96 A;  1WG7 A;  2HTH B;  4QXA B;  2W2X C;  2J0M A;  2COF A;  4EMO A;  1LW3 A;  2YT0 A;  2Z13 A;  5C5B B;  2P8V A;  5KQ4 A;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...