2GCLA

Structure of the pob3 middle domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
238
structure length
230
Chain Sequence
VAGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHMMVMAIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the yFACT Pob3-M Domain, Its Interaction with the DNA Replication Factor RPA, and a Potential Role in Nucleosome Deposition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
total genus 51
structure length 230
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gclA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 2gclA01
2PZ1A 1X11A 3SYXA 1LB1A 2D4QA 3VIAA 1ZSQA 3QBVB 2Y8FA 4GN1A 1FOEA 5J3TA 2GJYA 1MPHA 3TO1A 2HE7A 4MY6A 1Q67A 3V5WA 1WJ1A 4HAZB 2Z0QA 1SHCA 3D8EA 1I7AA 4IFSA 3UZTA 4PNKA 1GC6A 1Z87A 2ADZA 2J0MA 1B55A 4ZRKA 1V61A 3FM8C 3KRWA 1XR0B 2VKIA 3BINA 1UPRA 1DYNA 3PZDA 4KVGB 2DKQA 2DFKA 4YL8A 3F5RA 4A6FA 2N23A 3PVUA 2D9VA 2COCA 2YSZA 3P7ZA 3QIJA 5C16A 5LOPB 4WJ7A 5C6RA 4Z2MB 2DN6A 3GYOA 1X1GA 5D3VA 2RLOA 3G9WA 4EMOA 4MT7A 2LYDA 1SGHA 1MK7B 1Y5OA 2H7EA 4WSFA 2D9WA 4CHMA 4KHBB 1W1DA 3VOQA 1TQZA 4HB0B 1EAZA 2DLWA 4IAPA 2YT0A 3DXDA 2P0DA 2V76A 5C5BB 2VRWB 4HAXB 1WI1A 2FJLA 4KHAA 5HE1A 2P0HA 2Z0PA 3KRXA 2W2XD 1MAIA 1FGZA 1OMWA 4PQ0A 2IYBA 2YS3A 1UEFA 2DYQA 3KZ1A 5DHFB 1NTVA 3KSYA 2H7DA 3MPXA 3ULBA 3MDBC 5JHHA 2LOXA 2VSZA 1UPQA 1FHOA 1V89A 3NSUA 1NI2A 2E2XA 1RJ2A 3KY9A 3OANA 1M7EA 5D27A 4Y94A 2Z0OA 4EKUA 2Y7BA 2W2XC 4WVFB 2XQNM 1ZVRA 3HW2B 4A6KA 2GCLA 3PG7A 4TKNA 2J0KA 3U7DA 4Z2NA 2I5CA 2CY5A 1H10A 1W1GA 3FSSA 4DX90 1H4RA 2ROVA 2YF0A 2OQBA 5C5BA 1E5WA 1ISNA 2DKPA 2I1JA 5HE2A 5HE3A 3U8ZA 1U29A 3ODXA 2JP2A 3T06A 1BTKA 2Y8GA 3P6AA 2ELAA 1X1FA 5J3YA 1DROA 4GZUA 5KCVA 2EMSA 2MFQA 4XWXA 2MWNB 2CY4A 4BBKA 3PVWA 1FGYA 2K00A 1I2HA 1KZGA 2EC1A 2LKOA 3PEGA 2W2WA 1ZC3B 3CXBB 4A6FB 3A8QA 1J19A 2COAA 1K5GB 2K2UA 1U5GA 1WG7A 2D10A 4K2OA 1DDVA 1XKEA 3DXCA 4K2PA 4HAYB 4GPTB 1XD4A 4NY0A 5D3XA 1EF1A 2EMTA 5D3YA 1MK9B 2BCJA 1K5DB 5FI0A 2J59M 5DI9B 1U27A 1XODA 5LONB 3TW1A 4CHJA 5DIFB 2DX5A 2HTHB 3FEHA 1X86A 4HDQA 2DHIA 3DXEA 1NU2A 1WGQA 1KI1B 1V5PA 2P8VA 2ROZB 2DHJA 4HAWB 2ZPYA 3CIKA 3WYFB 1DDMA 1X05A 5D3WA 3O96A 4H8SA 4HB4B 3M1IB 2R0DA 2LULA 2D2QA 3AU4A 2D11A 1MIXA 3AJ4A 4HDOA 2L1CA 3D8DA 1RRPB 4DBBA 1IRSA 3ODWA 2COFA 1BTNA 2ELBA 3A98B 1EVHA 4YONA 2AL6A 2LG1A 2D9XA 1TJ6A 2IFSA 2M38A 2QKMA 2I1KA 1MKEA 3N7CA 1P6SA 4B6HA 1DDWA 3SNHA 3ML4A 2KCJA 2YS5A 2YS1A 4ZRJA 5GOWB 2L2IA 3SUZA 1AQCA 4EJNA 1WVHA 2YVCA 3ULCA 2DYNA 5FI1A 2N0YA 1LW3A 2LOZA 3D8FA 2NMBA 5KQ4A 4HAVB 2J0JA 5C79A 4A6HA 5CLQB 3RCPA 4HATB 1GG3A 1BWNA 2RVBB 2MKRA 2I5FA 1J0WA 4A5KA 2CAYA 2M14A 1ZM0A 3PSCA 2DA0A 3A8PA 3TVVA 5JHGA 1U5DA 2KGXB 2QKLA 1UNRA 3SO6A 2DHKA 2EJ8A 3ZDTA 4L6EA 4CYEA 4DX8A 2UZSA 1FHXA 1PLSA 2MDXA 3ZVRA 2RUKB 1KZ7A 5KQ1A 1N3HA 2CODA 4P7IA 3LJUX 4KAXB 1OQNA 2KUPA 4GXBA 4TYZA 1Y19B 2G35A 2YRYA 1U2BA 4F7GA 1FAOA 3HK0A 2DTCA 1QQGA 5DHAB 4MK0A 3TCAA 1V5MA 3F0WA 1ZC4B 2UVMA 5L81A 4HB3B 1FB8A 4GMXB 1AWEA 2RGNB 5EFXA 4K81A 2AEHA 3X23A 5HE0A 2RSGA 1TXDA 4KHOA 3PVLA 2NZ8B 1M7RA 5JLJB 2RNRB 1U5EA 2YT1A 1XX0A 3TFMA 1QC6A 1UNQA 1BAKA 2CRFA 2D9YA 4F7UP 1V88A 1DBHA 2GS0A 1P5TA 3GYPA 4HB2B 2X18A 1GC7A 2OTXA 2P0FA 2DX1A 4HAUB 4F7HA 2D9ZA 3QWMA 3AU5A 3PP2A 1NTYA 1WGUA 1FHWA 1EGXA 2K2JA 5JP4A 2R09A 1OY2A 2UZRA 4IOYX 4GMVA 1MIZB 3ODOA 4C0AA 1U5FA 4NSWA 5J3QA 1UNPA 5DH9B 4D0NB 1PMSA 1W1HA 4ZRIA 3IVFA 4K17A 4DXAB 1V5UA 3SV1A 1XCGA 3HQCA 4HHVA 2Q13A 5CLLB 3WA0A 1WJMA 1P3RA 2GCJA 1PFJA 3BJIA
chains in the Genus database with same CATH superfamily
2K8EA 2PZ1A 1X11A 3SYXA 1LB1A 2D4QA 3VIAA 1ZSQA 3QBVB 2Y8FA 4GN1A 1FOEA 5J3TA 2GJYA 1MPHA 1MI1A 3TO1A 2HE7A 4MY6A 1Q67A 3V5WA 1WJ1A 4HAZB 2Z0QA 1SHCA 3D8EA 1I7AA 4IFSA 3UZTA 4PNKA 1GC6A 4D6WA 1Z87A 2ADZA 2J0MA 1B55A 2KUQA 4ZRKA 1V61A 3FM8C 3KRWA 1XR0B 2VKIA 3BINA 1UPRA 5I2MA 1DYNA 2Z59A 3PZDA 4KVGB 2DKQA 2DFKA 4YL8A 3F5RA 4A6FA 2N23A 3PVUA 2D9VA 5M4YB 2COCA 2YSZA 3P7ZA 4CSQA 3QIJA 5C16A 5LOPB 4WJ7A 5C6RA 4Z2MB 2DN6A 3GYOA 1X1GA 5D3VA 2RLOA 3G9WA 4EMOA 4MT7A 2LYDA 1SGHA 1MK7B 1Y5OA 2H7EA 4WSFA 2D9WA 2YT2A 4CHMA 4KHBB 1W1DA 3VOQA 1TQZA 4HB0B 1EAZA 2DLWA 4IAPA 2YT0A 3DXDA 2P0DA 2V76A 5C5BB 2VRWB 4HAXB 3U12A 1WI1A 2FJLA 4KHAA 5HE1A 2P0HA 2Z0PA 3KRXA 2W2XD 1MAIA 1FGZA 1OMWA 5I2SA 4PQ0A 2IYBA 2YS3A 1UEFA 2Z4DA 2DYQA 3KZ1A 5DHFB 3DCXA 4L1RA 1NTVA 3KSYA 2H7DA 3MPXA 3ULBA 3MDBC 5JHHA 2LOXA 2VSZA 1UPQA 1FHOA 1V89A 3NSUA 1NI2A 2E2XA 1RJ2A 3KY9A 3OANA 1M7EA 5D27A 4Y94A 2Z0OA 4EKUA 2Y7BA 2W2XC 3NWDA 4WVFB 4OSNA 2XQNM 1ZVRA 3HW2B 4A6KA 2GCLA 3HIEA 3PG7A 4TKNA 2J0KA 3U7DA 4Z2NA 2I5CA 2CY5A 1H10A 1W1GA 3FSSA 4DX90 1H4RA 2ROVA 2YF0A 2OQBA 5C5BA 1E5WA 1ISNA 2DKPA 2I1JA 5HE2A 5HE3A 3U8ZA 1U29A 3ODXA 2JP2A 3T06A 1BTKA 2Y8GA 3P6AA 2ELAA 1X1FA 5J3YA 1DROA 4GZUA 5KCVA 2EMSA 2MFQA 4XWXA 3A58A 2MWNB 2CY4A 4BBKA 3PVWA 1FGYA 2K00A 1I2HA 1KZGA 2EC1A 2LKOA 3PEGA 2W2WA 1ZC3B 3CXBB 4A6FB 3A8QA 1J19A 2COAA 1K5GB 2K2UA 1U5GA 1WG7A 2D10A 4K2OA 1DDVA 1XKEA 1T77A 3DXCA 4K2PA 4HAYB 4GPTB 5IRSA 1XD4A 4NY0A 5D3XA 1EF1A 2EMTA 4QJ3B 5D3YA 1MK9B 2BCJA 4DIXA 1K5DB 5FI0A 2RRFA 2J59M 5DI9B 1U27A 1XODA 5LONB 3TW1A 4CHJA 5DIFB 2DX5A 2HTHB 3FEHA 5LG4B 1X86A 4HSIA 4HDQA 2DHIA 3DXEA 1NU2A 2K49A 1WGQA 1KI1B 1V5PA 2P8VA 2ROZB 2DHJA 4HAWB 2ZPYA 3CIKA 3WYFB 1DDMA 4GNKB 1X05A 5D3WA 3O96A 4H8SA 4HB4B 3M1IB 2R0DA 2LULA 2D2QA 3AU4A 2D11A 1MIXA 3AJ4A 4HDOA 2L1CA 3D8DA 1RRPB 4DBBA 1IRSA 3ODWA 2COFA 1BTNA 2ELBA 3A98B 1EVHA 4YONA 2AL6A 2LG1A 2D9XA 2KR0A 2NBVA 1TJ6A 2IFSA 2M38A 2QKMA 2I1KA 3HSAA 1MKEA 4KHBA 3N7CA 1P6SA 4B6HA 1DDWA 3SNHA 3ML4A 2KCJA 2YS5A 3NWFA 2YS1A 4ZRJA 5GOWB 2L2IA 3SUZA 1AQCA 4EJNA 1WVHA 2YVCA 3ULCA 2DYNA 2Z14A 5FI1A 2N0YA 1LW3A 2LOZA 3NWAA 3D8FA 2NMBA 5KQ4A 4HAVB 2J0JA 5C79A 2GUMA 4A6HA 5CLQB 3RCPA 4HATB 1GG3A 1BWNA 2FJUB 2RVBB 2MKRA 2I5FA 1J0WA 4A5KA 2CAYA 2M14A 1ZM0A 3PSCA 2DA0A 3A8PA 3TVVA 5JHGA 1U5DA 2KGXB 2KIEA 2R2YA 2QKLA 1UNRA 3SO6A 2DHKA 2Z13A 2EJ8A 3ZDTA 4L6EA 4CYEA 4DX8A 2UZSA 1FHXA 1PLSA 2MDXA 3ZVRA 2RUKB 1KZ7A 5KQ1A 1N3HA 2KIGA 2CODA 4P7IA 3LJUX 4KAXB 1OQNA 2KUPA 4GXBA 4TYZA 1Y19B 2G35A 2YRYA 1U2BA 4F7GA 1FAOA 3HK0A 4GOUA 1ZYIA 4QJ4B 2DTCA 1QQGA 5DHAB 4MK0A 3OHMB 3FVCA 3TCAA 1V5MA 3F0WA 1ZC4B 2UVMA 5L81A 4HB3B 4QXAB 1FB8A 4GMXB 1AWEA 2RGNB 5EFXA 4K81A 2AEHA 3X23A 5HE0A 2RSGA 1TXDA 4QJ5B 4KHOA 3PVLA 2NZ8B 1M7RA 5JLJB 2RNRB 1U5EA 2YT1A 4OT1A 1XX0A 3TFMA 1QC6A 1UNQA 1BAKA 2CRFA 2D9YA 4F7UP 1V88A 1DBHA 2GS0A 3B77A 1P5TA 3GYPA 4HB2B 2X18A 1GC7A 2OTXA 2P0FA 2DX1A 2ZKMX 4HAUB 4F7HA 2D9ZA 3NW8A 3AU5A 3PP2A 3QWMA 1NTYA 1WGUA 1FHWA 1EGXA 2K2JA 5JP4A 2R09A 1OY2A 2UZRA 4IOYX 4GMVA 1MIZB 3ODOA 4C0AA 1U5FA 4NSWA 5J3QA 1UNPA 5DH9B 4D0NB 1PMSA 1W1HA 4ZRIA 3IVFA 4K17A 4DXAB 1V5UA 3SV1A 1XCGA 3HQCA 4HHVA 2Q13A 5CLLB 3WA0A 1WJMA 1P3RA 2GCJA 1PFJA 3BJIA
chains in the Genus database with same CATH topology
2PZ1A 2K8EA 1X11A 3SYXA 1LB1A 2D4QA 3VIAA 1ZSQA 3QBVB 2Y8FA 4GN1A 1FOEA 5J3TA 2GJYA 1MPHA 3TO1A 2HE7A 4MY6A 1Q67A 3V5WA 1WJ1A 4HAZB 2Z0QA 1SHCA 3D8EA 1I7AA 4IFSA 3UZTA 4PNKA 1GC6A 4D6WA 1Z87A 2ADZA 2J0MA 1B55A 2KUQA 4ZRKA 1V61A 3FM8C 3KRWA 1XR0B 2VKIA 3BINA 1UPRA 5I2MA 1DYNA 3PZDA 2Z59A 4KVGB 2DKQA 2DFKA 4YL8A 3F5RA 4A6FA 2N23A 3PVUA 2D9VA 5M4YB 2COCA 2YSZA 3P7ZA 4CSQA 3QIJA 5C16A 5LOPB 4WJ7A 5C6RA 4Z2MB 2DN6A 3GYOA 1X1GA 5D3VA 2RLOA 3G9WA 4EMOA 4MT7A 2LYDA 1SGHA 1MK7B 1Y5OA 2H7EA 4WSFA 2D9WA 2YT2A 4CHMA 4KHBB 1W1DA 3VOQA 1TQZA 4HB0B 1EAZA 2DLWA 4IAPA 2YT0A 3DXDA 2P0DA 2V76A 5C5BB 2VRWB 4HAXB 3U12A 1WI1A 2FJLA 4KHAA 5HE1A 2P0HA 2Z0PA 3KRXA 2W2XD 1MAIA 1FGZA 1OMWA 5I2SA 4PQ0A 2IYBA 2YS3A 1UEFA 2Z4DA 2DYQA 3KZ1A 5DHFB 4L1RA 1NTVA 3KSYA 2H7DA 3MPXA 3ULBA 3MDBC 5JHHA 2LOXA 2VSZA 1UPQA 1FHOA 1V89A 3NSUA 1NI2A 2E2XA 1RJ2A 3KY9A 3OANA 1M7EA 5D27A 4Y94A 2Z0OA 4EKUA 2Y7BA 2W2XC 3NWDA 4WVFB 4OSNA 2XQNM 1ZVRA 3HW2B 4A6KA 2GCLA 3HIEA 3PG7A 4TKNA 2J0KA 3U7DA 4Z2NA 2I5CA 2CY5A 1H10A 1W1GA 3FSSA 4DX90 1H4RA 2ROVA 2YF0A 2OQBA 5C5BA 1E5WA 1ISNA 2DKPA 2I1JA 5HE2A 5HE3A 3U8ZA 1U29A 3ODXA 2JP2A 3T06A 1BTKA 2Y8GA 3P6AA 2ELAA 1X1FA 5J3YA 1DROA 4GZUA 5KCVA 2EMSA 2MFQA 4XWXA 3A58A 2MWNB 2CY4A 4BBKA 3PVWA 1FGYA 2K00A 1I2HA 1KZGA 2EC1A 2LKOA 3PEGA 2W2WA 1ZC3B 3CXBB 4A6FB 3A8QA 1J19A 2COAA 1K5GB 2K2UA 1U5GA 1WG7A 2D10A 4K2OA 1DDVA 1XKEA 3DXCA 4K2PA 4HAYB 4GPTB 5IRSA 1XD4A 4NY0A 5D3XA 1EF1A 2EMTA 4QJ3B 5D3YA 1MK9B 2BCJA 4DIXA 1K5DB 5FI0A 2RRFA 2J59M 5DI9B 1U27A 1XODA 5LONB 3TW1A 4CHJA 5DIFB 2DX5A 2HTHB 3FEHA 5LG4B 1X86A 4HSIA 4HDQA 2DHIA 3DXEA 1NU2A 2K49A 1WGQA 1KI1B 1V5PA 2P8VA 2ROZB 2DHJA 4HAWB 2ZPYA 3CIKA 3WYFB 1DDMA 4GNKB 1X05A 5D3WA 3O96A 4H8SA 4HB4B 3M1IB 2R0DA 2LULA 2D2QA 3AU4A 2D11A 1MIXA 3AJ4A 4HDOA 2L1CA 3D8DA 1RRPB 4DBBA 1IRSA 3ODWA 2COFA 1BTNA 2ELBA 3A98B 1EVHA 4YONA 2AL6A 2LG1A 2D9XA 2KR0A 2NBVA 1TJ6A 2IFSA 2M38A 2QKMA 2I1KA 1MKEA 4KHBA 3N7CA 1P6SA 4B6HA 1DDWA 3SNHA 3ML4A 2KCJA 2YS5A 3NWFA 2YS1A 4ZRJA 5GOWB 2L2IA 3SUZA 1AQCA 4EJNA 1WVHA 2YVCA 3ULCA 2DYNA 2Z14A 5FI1A 2N0YA 1LW3A 2LOZA 3NWAA 3D8FA 2NMBA 5KQ4A 4HAVB 2J0JA 5C79A 2GUMA 4A6HA 5CLQB 3RCPA 4HATB 1GG3A 1BWNA 2FJUB 2RVBB 2MKRA 2I5FA 1J0WA 4A5KA 2CAYA 2M14A 1ZM0A 3PSCA 2DA0A 3A8PA 3TVVA 5JHGA 1U5DA 2KGXB 2KIEA 2R2YA 2QKLA 1UNRA 3SO6A 2DHKA 2Z13A 2EJ8A 3ZDTA 4L6EA 4CYEA 4DX8A 2UZSA 1FHXA 1PLSA 2MDXA 3ZVRA 2RUKB 1KZ7A 5KQ1A 1N3HA 2KIGA 2CODA 4P7IA 3LJUX 4KAXB 1OQNA 2KUPA 4GXBA 4TYZA 1Y19B 2G35A 2YRYA 1U2BA 4F7GA 1FAOA 3HK0A 4GOUA 1ZYIA 4QJ4B 2DTCA 1QQGA 5DHAB 4MK0A 3OHMB 3FVCA 3TCAA 1V5MA 3F0WA 1ZC4B 2UVMA 5L81A 4HB3B 4QXAB 1FB8A 4GMXB 1AWEA 2RGNB 5EFXA 4K81A 2AEHA 3X23A 5HE0A 2RSGA 1TXDA 4QJ5B 4KHOA 3PVLA 2NZ8B 1M7RA 5JLJB 2RNRB 1U5EA 2YT1A 4OT1A 1XX0A 3TFMA 1QC6A 1UNQA 1BAKA 2CRFA 2D9YA 4F7UP 1V88A 1DBHA 2GS0A 1P5TA 3GYPA 4HB2B 2X18A 1GC7A 2OTXA 2P0FA 2DX1A 2ZKMX 4HAUB 4F7HA 2D9ZA 3NW8A 3QWMA 3AU5A 3PP2A 1NTYA 1WGUA 1FHWA 1EGXA 2K2JA 5JP4A 2R09A 1OY2A 2UZRA 4IOYX 4GMVA 1MIZB 3ODOA 4C0AA 1U5FA 4NSWA 5J3QA 1UNPA 5DH9B 4D0NB 1PMSA 1W1HA 4ZRIA 3IVFA 4K17A 4DXAB 1V5UA 3SV1A 1XCGA 3HQCA 4HHVA 2Q13A 5CLLB 3WA0A 1WJMA 1P3RA 2GCJA 1PFJA 3BJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  1X11 A;  3SYX A;  1LB1 A;  2D4Q A;  3VIA A;  1ZSQ A;  3QBV B;  2Y8F A;  4GN1 A;  1FOE A;  5J3T A;  2GJY A;  1MPH A;  3TO1 A;  2HE7 A;  4MY6 A;  1Q67 A;  3V5W A;  1WJ1 A;  4HAZ B;  2Z0Q A;  1SHC A;  3D8E A;  1I7A A;  4IFS A;  3UZT A;  4PNK A;  1GC6 A;  1Z87 A;  2ADZ A;  2J0M A;  1B55 A;  4ZRK A;  1V61 A;  3FM8 C;  3KRW A;  1XR0 B;  2VKI A;  3BIN A;  1UPR A;  1DYN A;  3PZD A;  4KVG B;  2DKQ A;  2DFK A;  4YL8 A;  3F5R A;  4A6F A;  2N23 A;  3PVU A;  2D9V A;  2COC A;  2YSZ A;  3P7Z A;  3QIJ A;  5C16 A;  5LOP B;  4WJ7 A;  5C6R A;  4Z2M B;  2DN6 A;  3GYO A;  1X1G A;  5D3V A;  2RLO A;  3G9W A;  4EMO A;  4MT7 A;  2LYD A;  1SGH A;  1MK7 B;  1Y5O A;  2H7E A;  4WSF A;  2D9W A;  4CHM A;  4KHB B;  1W1D A;  3VOQ A;  1TQZ A;  4HB0 B;  1EAZ A;  2DLW A;  4IAP A;  2YT0 A;  3DXD A;  2P0D A;  2V76 A;  5C5B B;  2VRW B;  4HAX B;  1WI1 A;  2FJL A;  4KHA A;  5HE1 A;  2P0H A;  2Z0P A;  3KRX A;  2W2X D;  1MAI A;  1FGZ A;  1OMW A;  4PQ0 A;  2IYB A;  2YS3 A;  1UEF A;  2DYQ A;  3KZ1 A;  5DHF B;  1NTV A;  3KSY A;  2H7D A;  3MPX A;  3ULB A;  3MDB C;  5JHH A;  2LOX A;  2VSZ A;  1UPQ A;  1FHO A;  1V89 A;  3NSU A;  1NI2 A;  2E2X A;  1RJ2 A;  3KY9 A;  3OAN A;  1M7E A;  5D27 A;  4Y94 A;  2Z0O A;  4EKU A;  2Y7B A;  2W2X C;  4WVF B;  2XQN M;  1ZVR A;  3HW2 B;  4A6K A;  2GCL A;  3PG7 A;  4TKN A;  2J0K A;  3U7D A;  4Z2N A;  2I5C A;  2CY5 A;  1H10 A;  1W1G A;  3FSS A;  4DX9 0;  1H4R A;  2ROV A;  2YF0 A;  2OQB A;  5C5B A;  1E5W A;  1ISN A;  2DKP A;  2I1J A;  5HE2 A;  5HE3 A;  3U8Z A;  1U29 A;  3ODX A;  2JP2 A;  3T06 A;  1BTK A;  2Y8G A;  3P6A A;  2ELA A;  1X1F A;  5J3Y A;  1DRO A;  4GZU A;  5KCV A;  2EMS A;  2MFQ A;  4XWX A;  2MWN B;  2CY4 A;  4BBK A;  3PVW A;  1FGY A;  2K00 A;  1I2H A;  1KZG A;  2EC1 A;  2LKO A;  3PEG A;  2W2W A;  1ZC3 B;  3CXB B;  4A6F B;  3A8Q A;  1J19 A;  2COA A;  1K5G B;  2K2U A;  1U5G A;  1WG7 A;  2D10 A;  4K2O A;  1DDV A;  1XKE A;  3DXC A;  4K2P A;  4HAY B;  4GPT B;  1XD4 A;  4NY0 A;  5D3X A;  1EF1 A;  2EMT A;  5D3Y A;  1MK9 B;  2BCJ A;  1K5D B;  5FI0 A;  2J59 M;  5DI9 B;  1U27 A;  1XOD A;  5LON B;  3TW1 A;  4CHJ A;  5DIF B;  2DX5 A;  2HTH B;  3FEH A;  1X86 A;  4HDQ A;  2DHI A;  3DXE A;  1NU2 A;  1WGQ A;  1KI1 B;  1V5P A;  2P8V A;  2ROZ B;  2DHJ A;  4HAW B;  2ZPY A;  3CIK A;  3WYF B;  1DDM A;  1X05 A;  5D3W A;  3O96 A;  4H8S A;  4HB4 B;  3M1I B;  2R0D A;  2LUL A;  2D2Q A;  3AU4 A;  2D11 A;  1MIX A;  3AJ4 A;  4HDO A;  2L1C A;  3D8D A;  1RRP B;  4DBB A;  1IRS A;  3ODW A;  2COF A;  1BTN A;  2ELB A;  3A98 B;  1EVH A;  4YON A;  2AL6 A;  2LG1 A;  2D9X A;  1TJ6 A;  2IFS A;  2M38 A;  2QKM A;  2I1K A;  1MKE A;  3N7C A;  1P6S A;  4B6H A;  1DDW A;  3SNH A;  3ML4 A;  2KCJ A;  2YS5 A;  2YS1 A;  4ZRJ A;  5GOW B;  2L2I A;  3SUZ A;  1AQC A;  4EJN A;  1WVH A;  2YVC A;  3ULC A;  2DYN A;  5FI1 A;  2N0Y A;  1LW3 A;  2LOZ A;  3D8F A;  2NMB A;  5KQ4 A;  4HAV B;  2J0J A;  5C79 A;  4A6H A;  5CLQ B;  3RCP A;  4HAT B;  1GG3 A;  1BWN A;  2RVB B;  2MKR A;  2I5F A;  1J0W A;  4A5K A;  2CAY A;  2M14 A;  1ZM0 A;  3PSC A;  2DA0 A;  3A8P A;  3TVV A;  5JHG A;  1U5D A;  2KGX B;  2QKL A;  1UNR A;  3SO6 A;  2DHK A;  2EJ8 A;  3ZDT A;  4L6E A;  4CYE A;  4DX8 A;  2UZS A;  1FHX A;  1PLS A;  2MDX A;  3ZVR A;  2RUK B;  1KZ7 A;  5KQ1 A;  1N3H A;  2COD A;  4P7I A;  3LJU X;  4KAX B;  1OQN A;  2KUP A;  4GXB A;  4TYZ A;  1Y19 B;  2G35 A;  2YRY A;  1U2B A;  4F7G A;  1FAO A;  3HK0 A;  2DTC A;  1QQG A;  5DHA B;  4MK0 A;  3TCA A;  1V5M A;  3F0W A;  1ZC4 B;  2UVM A;  5L81 A;  4HB3 B;  1FB8 A;  4GMX B;  1AWE A;  2RGN B;  5EFX A;  4K81 A;  2AEH A;  3X23 A;  5HE0 A;  2RSG A;  1TXD A;  4KHO A;  3PVL A;  2NZ8 B;  1M7R A;  5JLJ B;  2RNR B;  1U5E A;  2YT1 A;  1XX0 A;  3TFM A;  1QC6 A;  1UNQ A;  1BAK A;  2CRF A;  2D9Y A;  4F7U P;  1V88 A;  1DBH A;  2GS0 A;  1P5T A;  3GYP A;  4HB2 B;  2X18 A;  1GC7 A;  2OTX A;  2P0F A;  2DX1 A;  4HAU B;  4F7H A;  2D9Z A;  3QWM A;  3AU5 A;  3PP2 A;  1NTY A;  1WGU A;  1FHW A;  1EGX A;  2K2J A;  5JP4 A;  2R09 A;  1OY2 A;  2UZR A;  4IOY X;  4GMV A;  1MIZ B;  3ODO A;  4C0A A;  1U5F A;  4NSW A;  5J3Q A;  1UNP A;  5DH9 B;  4D0N B;  1PMS A;  1W1H A;  4ZRI A;  3IVF A;  4K17 A;  4DXA B;  1V5U A;  3SV1 A;  1XCG A;  3HQC A;  4HHV A;  2Q13 A;  5CLL B;  3WA0 A;  1WJM A;  1P3R A;  2GCJ A;  1PFJ A;  3BJI A; 
#chains in the Genus database with same CATH topology
 2K8E A;  2PZ1 A;  1X11 A;  3SYX A;  1LB1 A;  2D4Q A;  3VIA A;  1ZSQ A;  3QBV B;  2Y8F A;  4GN1 A;  1FOE A;  5J3T A;  2GJY A;  1MPH A;  1MI1 A;  3TO1 A;  2HE7 A;  4MY6 A;  1Q67 A;  3V5W A;  1WJ1 A;  4HAZ B;  2Z0Q A;  1SHC A;  3D8E A;  1I7A A;  4IFS A;  3UZT A;  4PNK A;  1GC6 A;  4D6W A;  1Z87 A;  2ADZ A;  2J0M A;  1B55 A;  2KUQ A;  4ZRK A;  1V61 A;  3FM8 C;  3KRW A;  1XR0 B;  2VKI A;  3BIN A;  1UPR A;  5I2M A;  1DYN A;  2Z59 A;  3PZD A;  4KVG B;  2DKQ A;  2DFK A;  4YL8 A;  3F5R A;  4A6F A;  2N23 A;  3PVU A;  2D9V A;  5M4Y B;  2COC A;  2YSZ A;  3P7Z A;  4CSQ A;  3QIJ A;  5C16 A;  5LOP B;  4WJ7 A;  5C6R A;  4Z2M B;  2DN6 A;  3GYO A;  1X1G A;  5D3V A;  2RLO A;  3G9W A;  4EMO A;  4MT7 A;  2LYD A;  1SGH A;  1MK7 B;  1Y5O A;  2H7E A;  4WSF A;  2D9W A;  2YT2 A;  4CHM A;  4KHB B;  1W1D A;  3VOQ A;  1TQZ A;  4HB0 B;  1EAZ A;  2DLW A;  4IAP A;  2YT0 A;  3DXD A;  2P0D A;  2V76 A;  5C5B B;  2VRW B;  4HAX B;  3U12 A;  1WI1 A;  2FJL A;  4KHA A;  5HE1 A;  2P0H A;  2Z0P A;  3KRX A;  2W2X D;  1MAI A;  1FGZ A;  1OMW A;  5I2S A;  4PQ0 A;  2IYB A;  2YS3 A;  1UEF A;  2Z4D A;  2DYQ A;  3KZ1 A;  5DHF B;  3DCX A;  4L1R A;  1NTV A;  3KSY A;  2H7D A;  3MPX A;  3ULB A;  3MDB C;  5JHH A;  2LOX A;  2VSZ A;  1UPQ A;  1FHO A;  1V89 A;  3NSU A;  1NI2 A;  2E2X A;  1RJ2 A;  3KY9 A;  3OAN A;  1M7E A;  5D27 A;  4Y94 A;  2Z0O A;  4EKU A;  2Y7B A;  2W2X C;  3NWD A;  4WVF B;  4OSN A;  2XQN M;  1ZVR A;  3HW2 B;  4A6K A;  2GCL A;  3HIE A;  3PG7 A;  4TKN A;  2J0K A;  3U7D A;  4Z2N A;  2I5C A;  2CY5 A;  1H10 A;  1W1G A;  3FSS A;  4DX9 0;  1H4R A;  2ROV A;  2YF0 A;  2OQB A;  5C5B A;  1E5W A;  1ISN A;  2DKP A;  2I1J A;  5HE2 A;  5HE3 A;  3U8Z A;  1U29 A;  3ODX A;  2JP2 A;  3T06 A;  1BTK A;  2Y8G A;  3P6A A;  2ELA A;  1X1F A;  5J3Y A;  1DRO A;  4GZU A;  5KCV A;  2EMS A;  2MFQ A;  4XWX A;  3A58 A;  2MWN B;  2CY4 A;  4BBK A;  3PVW A;  1FGY A;  2K00 A;  1I2H A;  1KZG A;  2EC1 A;  2LKO A;  3PEG A;  2W2W A;  1ZC3 B;  3CXB B;  4A6F B;  3A8Q A;  1J19 A;  2COA A;  1K5G B;  2K2U A;  1U5G A;  1WG7 A;  2D10 A;  4K2O A;  1DDV A;  1XKE A;  1T77 A;  3DXC A;  4K2P A;  4HAY B;  4GPT B;  5IRS A;  1XD4 A;  4NY0 A;  5D3X A;  1EF1 A;  2EMT A;  4QJ3 B;  5D3Y A;  1MK9 B;  2BCJ A;  4DIX A;  1K5D B;  5FI0 A;  2RRF A;  2J59 M;  5DI9 B;  1U27 A;  1XOD A;  5LON B;  3TW1 A;  4CHJ A;  5DIF B;  2DX5 A;  2HTH B;  3FEH A;  5LG4 B;  1X86 A;  4HSI A;  4HDQ A;  2DHI A;  3DXE A;  1NU2 A;  2K49 A;  1WGQ A;  1KI1 B;  1V5P A;  2P8V A;  2ROZ B;  2DHJ A;  4HAW B;  2ZPY A;  3CIK A;  3WYF B;  1DDM A;  4GNK B;  1X05 A;  5D3W A;  3O96 A;  4H8S A;  4HB4 B;  3M1I B;  2R0D A;  2LUL A;  2D2Q A;  3AU4 A;  2D11 A;  1MIX A;  3AJ4 A;  4HDO A;  2L1C A;  3D8D A;  1RRP B;  4DBB A;  1IRS A;  3ODW A;  2COF A;  1BTN A;  2ELB A;  3A98 B;  1EVH A;  4YON A;  2AL6 A;  2LG1 A;  2D9X A;  2KR0 A;  2NBV A;  1TJ6 A;  2IFS A;  2M38 A;  2QKM A;  2I1K A;  3HSA A;  1MKE A;  4KHB A;  3N7C A;  1P6S A;  4B6H A;  1DDW A;  3SNH A;  3ML4 A;  2KCJ A;  2YS5 A;  3NWF A;  2YS1 A;  4ZRJ A;  5GOW B;  2L2I A;  3SUZ A;  1AQC A;  4EJN A;  1WVH A;  2YVC A;  3ULC A;  2DYN A;  2Z14 A;  5FI1 A;  2N0Y A;  1LW3 A;  2LOZ A;  3NWA A;  3D8F A;  2NMB A;  5KQ4 A;  4HAV B;  2J0J A;  5C79 A;  2GUM A;  4A6H A;  5CLQ B;  3RCP A;  4HAT B;  1GG3 A;  1BWN A;  2FJU B;  2RVB B;  2MKR A;  2I5F A;  1J0W A;  4A5K A;  2CAY A;  2M14 A;  1ZM0 A;  3PSC A;  2DA0 A;  3A8P A;  3TVV A;  5JHG A;  1U5D A;  2KGX B;  2KIE A;  2R2Y A;  2QKL A;  1UNR A;  3SO6 A;  2DHK A;  2Z13 A;  2EJ8 A;  3ZDT A;  4L6E A;  4CYE A;  4DX8 A;  2UZS A;  1FHX A;  1PLS A;  2MDX A;  3ZVR A;  2RUK B;  1KZ7 A;  5KQ1 A;  1N3H A;  2KIG A;  2COD A;  4P7I A;  3LJU X;  4KAX B;  1OQN A;  2KUP A;  4GXB A;  4TYZ A;  1Y19 B;  2G35 A;  2YRY A;  1U2B A;  4F7G A;  1FAO A;  3HK0 A;  4GOU A;  1ZYI A;  4QJ4 B;  2DTC A;  1QQG A;  5DHA B;  4MK0 A;  3OHM B;  3FVC A;  3TCA A;  1V5M A;  3F0W A;  1ZC4 B;  2UVM A;  5L81 A;  4HB3 B;  4QXA B;  1FB8 A;  4GMX B;  1AWE A;  2RGN B;  5EFX A;  4K81 A;  2AEH A;  3X23 A;  5HE0 A;  2RSG A;  1TXD A;  4QJ5 B;  4KHO A;  3PVL A;  2NZ8 B;  1M7R A;  5JLJ B;  2RNR B;  1U5E A;  2YT1 A;  4OT1 A;  1XX0 A;  3TFM A;  1QC6 A;  1UNQ A;  1BAK A;  2CRF A;  2D9Y A;  4F7U P;  1V88 A;  1DBH A;  2GS0 A;  3B77 A;  1P5T A;  3GYP A;  4HB2 B;  2X18 A;  1GC7 A;  2OTX A;  2P0F A;  2DX1 A;  2ZKM X;  4HAU B;  4F7H A;  2D9Z A;  3NW8 A;  3AU5 A;  3PP2 A;  3QWM A;  1NTY A;  1WGU A;  1FHW A;  1EGX A;  2K2J A;  5JP4 A;  2R09 A;  1OY2 A;  2UZR A;  4IOY X;  4GMV A;  1MIZ B;  3ODO A;  4C0A A;  1U5F A;  4NSW A;  5J3Q A;  1UNP A;  5DH9 B;  4D0N B;  1PMS A;  1W1H A;  4ZRI A;  3IVF A;  4K17 A;  4DXA B;  1V5U A;  3SV1 A;  1XCG A;  3HQC A;  4HHV A;  2Q13 A;  5CLL B;  3WA0 A;  1WJM A;  1P3R A;  2GCJ A;  1PFJ A;  3BJI A; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  2K8E A;  1X11 A;  3SYX A;  1LB1 A;  2D4Q A;  3VIA A;  1ZSQ A;  3QBV B;  2Y8F A;  4GN1 A;  1FOE A;  5J3T A;  2GJY A;  1MPH A;  3TO1 A;  2HE7 A;  4MY6 A;  1Q67 A;  3V5W A;  1WJ1 A;  4HAZ B;  2Z0Q A;  1SHC A;  3D8E A;  1I7A A;  4IFS A;  3UZT A;  4PNK A;  1GC6 A;  4D6W A;  1Z87 A;  2ADZ A;  2J0M A;  1B55 A;  2KUQ A;  4ZRK A;  1V61 A;  3FM8 C;  3KRW A;  1XR0 B;  2VKI A;  3BIN A;  1UPR A;  5I2M A;  1DYN A;  3PZD A;  2Z59 A;  4KVG B;  2DKQ A;  2DFK A;  4YL8 A;  3F5R A;  4A6F A;  2N23 A;  3PVU A;  2D9V A;  5M4Y B;  2COC A;  2YSZ A;  3P7Z A;  4CSQ A;  3QIJ A;  5C16 A;  5LOP B;  4WJ7 A;  5C6R A;  4Z2M B;  2DN6 A;  3GYO A;  1X1G A;  5D3V A;  2RLO A;  3G9W A;  4EMO A;  4MT7 A;  2LYD A;  1SGH A;  1MK7 B;  1Y5O A;  2H7E A;  4WSF A;  2D9W A;  2YT2 A;  4CHM A;  4KHB B;  1W1D A;  3VOQ A;  1TQZ A;  4HB0 B;  1EAZ A;  2DLW A;  4IAP A;  2YT0 A;  3DXD A;  2P0D A;  2V76 A;  5C5B B;  2VRW B;  4HAX B;  3U12 A;  1WI1 A;  2FJL A;  4KHA A;  5HE1 A;  2P0H A;  2Z0P A;  3KRX A;  2W2X D;  1MAI A;  1FGZ A;  1OMW A;  5I2S A;  4PQ0 A;  2IYB A;  2YS3 A;  1UEF A;  2Z4D A;  2DYQ A;  3KZ1 A;  5DHF B;  4L1R A;  1NTV A;  3KSY A;  2H7D A;  3MPX A;  3ULB A;  3MDB C;  5JHH A;  2LOX A;  2VSZ A;  1UPQ A;  1FHO A;  1V89 A;  3NSU A;  1NI2 A;  2E2X A;  1RJ2 A;  3KY9 A;  3OAN A;  1M7E A;  5D27 A;  4Y94 A;  2Z0O A;  4EKU A;  2Y7B A;  2W2X C;  3NWD A;  4WVF B;  4OSN A;  2XQN M;  1ZVR A;  3HW2 B;  4A6K A;  2GCL A;  3HIE A;  3PG7 A;  4TKN A;  2J0K A;  3U7D A;  4Z2N A;  2I5C A;  2CY5 A;  1H10 A;  1W1G A;  3FSS A;  4DX9 0;  1H4R A;  2ROV A;  2YF0 A;  2OQB A;  5C5B A;  1E5W A;  1ISN A;  2DKP A;  2I1J A;  5HE2 A;  5HE3 A;  3U8Z A;  1U29 A;  3ODX A;  2JP2 A;  3T06 A;  1BTK A;  2Y8G A;  3P6A A;  2ELA A;  1X1F A;  5J3Y A;  1DRO A;  4GZU A;  5KCV A;  2EMS A;  2MFQ A;  4XWX A;  3A58 A;  2MWN B;  2CY4 A;  4BBK A;  3PVW A;  1FGY A;  2K00 A;  1I2H A;  1KZG A;  2EC1 A;  2LKO A;  3PEG A;  2W2W A;  1ZC3 B;  3CXB B;  4A6F B;  3A8Q A;  1J19 A;  2COA A;  1K5G B;  2K2U A;  1U5G A;  1WG7 A;  2D10 A;  4K2O A;  1DDV A;  1XKE A;  3DXC A;  4K2P A;  4HAY B;  4GPT B;  5IRS A;  1XD4 A;  4NY0 A;  5D3X A;  1EF1 A;  2EMT A;  4QJ3 B;  5D3Y A;  1MK9 B;  2BCJ A;  4DIX A;  1K5D B;  5FI0 A;  2RRF A;  2J59 M;  5DI9 B;  1U27 A;  1XOD A;  5LON B;  3TW1 A;  4CHJ A;  5DIF B;  2DX5 A;  2HTH B;  3FEH A;  5LG4 B;  1X86 A;  4HSI A;  4HDQ A;  2DHI A;  3DXE A;  1NU2 A;  2K49 A;  1WGQ A;  1KI1 B;  1V5P A;  2P8V A;  2ROZ B;  2DHJ A;  4HAW B;  2ZPY A;  3CIK A;  3WYF B;  1DDM A;  4GNK B;  1X05 A;  5D3W A;  3O96 A;  4H8S A;  4HB4 B;  3M1I B;  2R0D A;  2LUL A;  2D2Q A;  3AU4 A;  2D11 A;  1MIX A;  3AJ4 A;  4HDO A;  2L1C A;  3D8D A;  1RRP B;  4DBB A;  1IRS A;  3ODW A;  2COF A;  1BTN A;  2ELB A;  3A98 B;  1EVH A;  4YON A;  2AL6 A;  2LG1 A;  2D9X A;  2KR0 A;  2NBV A;  1TJ6 A;  2IFS A;  2M38 A;  2QKM A;  2I1K A;  1MKE A;  4KHB A;  3N7C A;  1P6S A;  4B6H A;  1DDW A;  3SNH A;  3ML4 A;  2KCJ A;  2YS5 A;  3NWF A;  2YS1 A;  4ZRJ A;  5GOW B;  2L2I A;  3SUZ A;  1AQC A;  4EJN A;  1WVH A;  2YVC A;  3ULC A;  2DYN A;  2Z14 A;  5FI1 A;  2N0Y A;  1LW3 A;  2LOZ A;  3NWA A;  3D8F A;  2NMB A;  5KQ4 A;  4HAV B;  2J0J A;  5C79 A;  2GUM A;  4A6H A;  5CLQ B;  3RCP A;  4HAT B;  1GG3 A;  1BWN A;  2FJU B;  2RVB B;  2MKR A;  2I5F A;  1J0W A;  4A5K A;  2CAY A;  2M14 A;  1ZM0 A;  3PSC A;  2DA0 A;  3A8P A;  3TVV A;  5JHG A;  1U5D A;  2KGX B;  2KIE A;  2R2Y A;  2QKL A;  1UNR A;  3SO6 A;  2DHK A;  2Z13 A;  2EJ8 A;  3ZDT A;  4L6E A;  4CYE A;  4DX8 A;  2UZS A;  1FHX A;  1PLS A;  2MDX A;  3ZVR A;  2RUK B;  1KZ7 A;  5KQ1 A;  1N3H A;  2KIG A;  2COD A;  4P7I A;  3LJU X;  4KAX B;  1OQN A;  2KUP A;  4GXB A;  4TYZ A;  1Y19 B;  2G35 A;  2YRY A;  1U2B A;  4F7G A;  1FAO A;  3HK0 A;  4GOU A;  1ZYI A;  4QJ4 B;  2DTC A;  1QQG A;  5DHA B;  4MK0 A;  3OHM B;  3FVC A;  3TCA A;  1V5M A;  3F0W A;  1ZC4 B;  2UVM A;  5L81 A;  4HB3 B;  4QXA B;  1FB8 A;  4GMX B;  1AWE A;  2RGN B;  5EFX A;  4K81 A;  2AEH A;  3X23 A;  5HE0 A;  2RSG A;  1TXD A;  4QJ5 B;  4KHO A;  3PVL A;  2NZ8 B;  1M7R A;  5JLJ B;  2RNR B;  1U5E A;  2YT1 A;  4OT1 A;  1XX0 A;  3TFM A;  1QC6 A;  1UNQ A;  1BAK A;  2CRF A;  2D9Y A;  4F7U P;  1V88 A;  1DBH A;  2GS0 A;  1P5T A;  3GYP A;  4HB2 B;  2X18 A;  1GC7 A;  2OTX A;  2P0F A;  2DX1 A;  2ZKM X;  4HAU B;  4F7H A;  2D9Z A;  3NW8 A;  3QWM A;  3AU5 A;  3PP2 A;  1NTY A;  1WGU A;  1FHW A;  1EGX A;  2K2J A;  5JP4 A;  2R09 A;  1OY2 A;  2UZR A;  4IOY X;  4GMV A;  1MIZ B;  3ODO A;  4C0A A;  1U5F A;  4NSW A;  5J3Q A;  1UNP A;  5DH9 B;  4D0N B;  1PMS A;  1W1H A;  4ZRI A;  3IVF A;  4K17 A;  4DXA B;  1V5U A;  3SV1 A;  1XCG A;  3HQC A;  4HHV A;  2Q13 A;  5CLL B;  3WA0 A;  1WJM A;  1P3R A;  2GCJ A;  1PFJ A;  3BJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...