2GCLA

Structure of the pob3 middle domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
238
structure length
230
Chain Sequence
b'VAGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHMMVMAIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
publication title The Structure of the yFACT Pob3-M Domain, Its Interaction with the DNA Replication Factor RPA, and a Potential Role in Nucleosome Deposition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 51
structure length 230
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gclA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 2gclA01
2ELAA 4D0NB 1FHWA 2LG1A 4CHJA 3GYOA 1EF1A 1GC7A 5D3VA 2YT0A 5KQ4A 1RRPB 5EFXA 1MKEA 4A6FA 3BJIA 5LONB 1ISNA 1DBHA 3TW1A 4GN1A 3HW2B 1FHXA 2DYNA 1ZC3B 3PG7A 2JP2A 3OANA 1W1DA 3N7CA 2COAA 1W1GA 2J59M 3U7DA 1V5PA 4A6FB 5CLQB 4HB2B 2D9ZA 1MIXA 2DN6A 2D9XA 4WVFB 3TFMA 3ODOA 4DBBA 2XQNM 2R09A 1UPQA 4Z2MB 2FJLA 4HB4B 3UZTA 2I1JA 4HAXB 4HB3B 1EAZA 3TO1A 4ZRIA 5J3QA 3DXEA 1NTYA 2Z0OA 3DXCA 1ZM0A 2OQBA 3PVUA 4KHOA 5HE2A 1I2HA 5FI0A 2DHKA 4F7UP 2W2WA 1OY2A 2UVMA 2MWNB 1I7AA 1B55A 1ZSQA 1P5TA 4MT7A 4PNKA 2DA0A 4KHBB 4HB0B 3X23A 3AJ4A 4Z2NA 4GZUA 4HATB 1PMSA 2G35A 2DFKA 1SGHA 1X11A 5D3WA 4P7IA 2YVCA 3A8QA 4NSWA 1U29A 2LYDA 3ULBA 1U27A 3BINA 1TXDA 4C0AA 2D4QA 4A5KA 2LULA 1FOEA 2Y8GA 1AWEA 4EKUA 4DXAB 1BTKA 2DHJA 1WGUA 5L81A 2Z0PA 3LJUX 1QC6A 1GC6A 1M7RA 2YSZA 3GYPA 3ZDTA 2GCJA 2BCJA 1V61A 3HQCA 3PP2A 1DDWA 3PSCA 2RLOA 2YRYA 2DX1A 1WVHA 3F0WA 4H8SA 1J0WA 2J0MA 1ZVRA 2NMBA 2I5CA 2YS1A 2UZRA 1NI2A 3PVWA 3QBVB 1K5DB 3CIKA 2EMTA 5LOPB 2LOXA 2X18A 2ADZA 3AU4A 2D9YA 2CODA 4TYZA 3TVVA 1X1FA 1PLSA 2RVBB 3T06A 1X86A 4NY0A 5GOWB 3A8PA 1P3RA 2P0HA 1AQCA 1KI1B 1NTVA 5HE0A 3D8FA 2CRFA 5DH9B 1GG3A 1DYNA 2W2XD 3QIJA 4B6HA 2AEHA 1U5EA 3RCPA 3ODXA 2YF0A 5DI9B 2NZ8B 1U5DA 1XR0B 4WSFA 2KCJA 4YONA 2I5FA 2RGNB 2D9WA 5HE3A 3VOQA 2DKPA 2D11A 5C16A 3SNHA 4KVGB 1SHCA 2P8VA 1UNQA 2J0KA 4GMXB 2RUKB 5J3TA 1MK7B 2MDXA 4HHVA 3KZ1A 4HDQA 4F7GA 1DDVA 4K2PA 1U5FA 3A98B 1H4RA 3VIAA 4Y94A 2HE7A 1UEFA 1EVHA 1FGZA 3ML4A 2CAYA 3CXBB 2IFSA 2ROVA 2N0YA 2VRWB 1V89A 1U2BA 2LKOA 5C79A 2DKQA 2I1KA 1MPHA 1RJ2A 5JHGA 2COCA 3ULCA 3IVFA 1V5UA 1BAKA 2J0JA 3V5WA 2L2IA 2ZPYA 1DROA 1W1HA 2VKIA 2RNRB 3WA0A 5HE1A 5D3XA 4EMOA 3FEHA 4CYEA 1XCGA 2DYQA 1WI1A 1LB1A 1WJMA 1Y5OA 2QKMA 2MKRA 2QKLA 1OQNA 2CY4A 2N23A 4WJ7A 3ODWA 1Z87A 1QQGA 4HAVB 5D3YA 2ROZB 2RSGA 2E2XA 1ZC4B 1WG7A 4GPTB 3P7ZA 3FM8C 1UNPA 2IYBA 2YS5A 5J3YA 5C6RA 5KQ1A 2K2UA 4K17A 5DHAB 3WYFB 2DX5A 4DX8A 1V5MA 1Q67A 1FGYA 1X05A 4A6HA 4ZRKA 1H10A 1KZ7A 2EC1A 3PEGA 3FSSA 5JHHA 2Y7BA 4CHMA 1EGXA 4K81A 2YT1A 3PZDA 4PQ0A 1MAIA 3DXDA 3U8ZA 2KUPA 2GCLA 2K00A 2KGXB 4HAYB 1WJ1A 2D9VA 3PVLA 4KAXB 2VSZA 1XD4A 2L1CA 5CLLB 2Q13A 2YS3A 3KRWA 2GJYA 1FB8A 2AL6A 3KY9A 3SYXA 2DLWA 1XODA 5C5BA 3SV1A 3M1IB 2LOZA 3MDBC 1N3HA 2H7EA 5D27A 5KCVA 2P0FA 3TCAA 2COFA 1FAOA 2P0DA 2Y8FA 2CY5A 3D8DA 1XX0A 5C5BB 2K2JA 4MK0A 3AU5A 4BBKA 1TQZA 3QWMA 2EJ8A 3F5RA 3SO6A 1XKEA 4DX90 3P6AA 4HDOA 4IFSA 2GS0A 4TKNA 4F7HA 2W2XC 2H7DA 1J19A 1BWNA 5JP4A 1E5WA 1V88A 1DDMA 4A6KA 1PFJA 3KSYA 4KHAA 1MIZB 3ZVRA 1MK9B 5FI1A 1BTNA 3G9WA 3KRXA 4MY6A 4XWXA 1IRSA 1NU2A 3O96A 1WGQA 4L6EA 3D8EA 4YL8A 3HK0A 2M38A 1KZGA 4IAPA 2D10A 4GXBA 1Y19B 2D2QA 4GMVA 5JLJB 4HAUB 1UPRA 2HTHB 1FHOA 5DHFB 2OTXA 4ZRJA 2Z0QA 2ELBA 4EJNA 2PZ1A 2UZSA 1OMWA 1U5GA 3NSUA 2EMSA 4IOYX 3MPXA 4HAZB 2R0DA 1X1GA 1LW3A 1M7EA 2MFQA 4K2OA 3SUZA 1P6SA 1UNRA 2DTCA 2V76A 2M14A 1K5GB 1TJ6A 5DIFB 2DHIA 4HAWB
chains in the Genus database with same CATH superfamily
2ELAA 4D0NB 1FHWA 2LG1A 4CHJA 3GYOA 1EF1A 1GC7A 5D3VA 2YT0A 5KQ4A 1RRPB 3HSAA 5EFXA 1MKEA 4A6FA 3BJIA 5LONB 1ISNA 1DBHA 3TW1A 4GN1A 3HW2B 1FHXA 2DYNA 1ZC3B 3PG7A 2JP2A 3OANA 1W1DA 3N7CA 2COAA 1W1GA 2J59M 3U7DA 1V5PA 4A6FB 5CLQB 4HB2B 2D9ZA 2KIGA 1MIXA 2DN6A 2D9XA 4WVFB 3TFMA 3ODOA 4DBBA 2XQNM 2R09A 1UPQA 4Z2MB 2FJLA 4HB4B 3UZTA 4KHBA 2I1JA 4HAXB 4HB3B 1EAZA 3TO1A 4ZRIA 5J3QA 3DXEA 1NTYA 2Z0OA 3DXCA 1ZM0A 2OQBA 3PVUA 4KHOA 5HE2A 1I2HA 5FI0A 2DHKA 3A58A 4F7UP 2Z4DA 2W2WA 2FJUB 1OY2A 2KR0A 2UVMA 2MWNB 1I7AA 1B55A 1ZSQA 1P5TA 4MT7A 4PNKA 2DA0A 4CSQA 4KHBB 4HB0B 3X23A 3AJ4A 4Z2NA 4GZUA 4HATB 1PMSA 2G35A 2DFKA 1SGHA 1X11A 5D3WA 4P7IA 2YVCA 3A8QA 4NSWA 1U29A 2LYDA 3ULBA 1U27A 3BINA 1TXDA 4C0AA 2D4QA 4A5KA 4QJ4B 2K49A 2LULA 1FOEA 2Y8GA 1AWEA 4EKUA 4DXAB 1BTKA 2DHJA 1WGUA 5I2SA 5L81A 2Z0PA 3LJUX 1QC6A 1GC6A 1M7RA 2YSZA 3GYPA 3ZDTA 2GCJA 2BCJA 1V61A 2NBVA 3HQCA 3PP2A 1DDWA 3PSCA 2RLOA 2YRYA 2DX1A 1WVHA 3F0WA 4H8SA 1J0WA 2J0MA 1ZVRA 2NMBA 2I5CA 5I2MA 2YS1A 2UZRA 1NI2A 3PVWA 3QBVB 1K5DB 3CIKA 4GNKB 2EMTA 5LOPB 2LOXA 2X18A 2ADZA 3AU4A 2D9YA 2CODA 3NWAA 4TYZA 3B77A 3TVVA 1X1FA 1PLSA 2RVBB 3T06A 1X86A 4NY0A 5GOWB 3A8PA 1P3RA 2P0HA 1AQCA 1KI1B 1NTVA 3U12A 5HE0A 3NWDA 3D8FA 2CRFA 5DH9B 1GG3A 1DYNA 5LG4B 2W2XD 3QIJA 4B6HA 2AEHA 1U5EA 3RCPA 3ODXA 2YF0A 5DI9B 2NZ8B 1U5DA 1XR0B 4WSFA 4OT1A 2KCJA 4YONA 2I5FA 2RGNB 2D9WA 5HE3A 3VOQA 1ZYIA 2DKPA 2D11A 5C16A 3SNHA 2R2YA 4KVGB 1SHCA 2P8VA 1UNQA 2J0KA 4GMXB 2RUKB 5J3TA 1MK7B 2MDXA 4HHVA 3KZ1A 4HDQA 4F7GA 1DDVA 4K2PA 1U5FA 3A98B 1H4RA 3VIAA 2Z59A 4Y94A 2HE7A 1UEFA 4D6WA 1EVHA 1FGZA 3ML4A 2CAYA 3CXBB 2IFSA 2ROVA 2N0YA 2VRWB 1V89A 1U2BA 2LKOA 1T77A 5C79A 2DKQA 2I1KA 1MPHA 1RJ2A 5JHGA 2COCA 3NWFA 3ULCA 3IVFA 1V5UA 1BAKA 2J0JA 3V5WA 2L2IA 2ZPYA 2ZKMX 4QJ3B 1DROA 1W1HA 2VKIA 2RNRB 3WA0A 5HE1A 5D3XA 4EMOA 3FEHA 4CYEA 4QJ5B 1XCGA 2RRFA 2DYQA 1WI1A 1LB1A 3NW8A 1WJMA 3OHMB 1Y5OA 2YT2A 2QKMA 2MKRA 2QKLA 1OQNA 2CY4A 2N23A 4WJ7A 3ODWA 1Z87A 2KIEA 1QQGA 4HAVB 5D3YA 2ROZB 2RSGA 3HIEA 2E2XA 4QXAB 1ZC4B 1WG7A 4GPTB 3P7ZA 3FM8C 1UNPA 2IYBA 2YS5A 5J3YA 5C6RA 5KQ1A 2K2UA 4K17A 5DHAB 3WYFB 2DX5A 4DX8A 2Z14A 1V5MA 2KUQA 1Q67A 1FGYA 1X05A 4A6HA 4ZRKA 1H10A 1KZ7A 2EC1A 4DIXA 3PEGA 3FSSA 5JHHA 2Y7BA 4CHMA 1EGXA 4K81A 2YT1A 3PZDA 4PQ0A 1MAIA 3DXDA 3U8ZA 2KUPA 2GCLA 2K00A 2KGXB 4HAYB 5M4YB 1WJ1A 2D9VA 3PVLA 4KAXB 2VSZA 1XD4A 2L1CA 5CLLB 5IRSA 2Q13A 2YS3A 4HSIA 3KRWA 2GJYA 1FB8A 2AL6A 3KY9A 3SYXA 2DLWA 1XODA 5C5BA 3SV1A 3M1IB 2LOZA 3MDBC 1N3HA 2H7EA 5D27A 5KCVA 2P0FA 3TCAA 2COFA 1FAOA 2P0DA 2Y8FA 2CY5A 3D8DA 3FVCA 1XX0A 5C5BB 2K2JA 4MK0A 3AU5A 4BBKA 1TQZA 3QWMA 2EJ8A 3F5RA 2K8EA 3SO6A 1XKEA 4DX90 3P6AA 4HDOA 4IFSA 2GS0A 4TKNA 4F7HA 2W2XC 2GUMA 2H7DA 1MI1A 1J19A 1BWNA 5JP4A 1E5WA 1V88A 1DDMA 4L1RA 4A6KA 1PFJA 3KSYA 4KHAA 1MIZB 3ZVRA 1MK9B 5FI1A 1BTNA 3G9WA 2Z13A 3KRXA 4MY6A 4XWXA 1IRSA 1NU2A 3O96A 4GOUA 1WGQA 4L6EA 3D8EA 4YL8A 3HK0A 2M38A 1KZGA 4IAPA 2D10A 4GXBA 1Y19B 2D2QA 4OSNA 4GMVA 5JLJB 4HAUB 1UPRA 2HTHB 1FHOA 5DHFB 2OTXA 4ZRJA 2Z0QA 2ELBA 4EJNA 2PZ1A 2UZSA 1OMWA 1U5GA 3NSUA 2EMSA 4IOYX 3MPXA 4HAZB 2R0DA 1X1GA 1LW3A 1M7EA 2MFQA 4K2OA 3SUZA 1P6SA 1UNRA 2DTCA 3DCXA 2V76A 2M14A 1K5GB 1TJ6A 5DIFB 2DHIA 4HAWB
chains in the Genus database with same CATH topology
2ELAA 4D0NB 1FHWA 2LG1A 4CHJA 3GYOA 1EF1A 1GC7A 5D3VA 2YT0A 5KQ4A 1RRPB 5EFXA 1MKEA 4A6FA 3BJIA 5LONB 1ISNA 1DBHA 3TW1A 4GN1A 3HW2B 1FHXA 2DYNA 1ZC3B 3PG7A 2JP2A 3OANA 1W1DA 3N7CA 2COAA 1W1GA 2J59M 3U7DA 1V5PA 4A6FB 5CLQB 4HB2B 2D9ZA 2KIGA 1MIXA 2DN6A 2D9XA 4WVFB 3TFMA 3ODOA 4DBBA 2XQNM 2R09A 1UPQA 4Z2MB 2FJLA 4HB4B 3UZTA 4KHBA 2I1JA 4HAXB 4HB3B 1EAZA 3TO1A 4ZRIA 5J3QA 3DXEA 1NTYA 2Z0OA 3DXCA 1ZM0A 2OQBA 3PVUA 4KHOA 5HE2A 1I2HA 5FI0A 2DHKA 4F7UP 3A58A 2Z4DA 2W2WA 2FJUB 1OY2A 2KR0A 2UVMA 2MWNB 1I7AA 1B55A 1ZSQA 1P5TA 4MT7A 4PNKA 2DA0A 4CSQA 4KHBB 4HB0B 3X23A 3AJ4A 4Z2NA 4GZUA 4HATB 1PMSA 2G35A 2DFKA 1SGHA 1X11A 5D3WA 4P7IA 2YVCA 3A8QA 4NSWA 1U29A 2LYDA 3ULBA 1U27A 3BINA 1TXDA 4C0AA 2D4QA 4A5KA 4QJ4B 2K49A 2LULA 1FOEA 2Y8GA 1AWEA 4EKUA 4DXAB 1BTKA 2DHJA 1WGUA 5I2SA 5L81A 2Z0PA 3LJUX 1QC6A 1GC6A 1M7RA 2YSZA 3GYPA 3ZDTA 2GCJA 2BCJA 1V61A 2NBVA 3HQCA 3PP2A 1DDWA 3PSCA 2RLOA 2YRYA 2DX1A 1WVHA 3F0WA 4H8SA 1J0WA 2J0MA 1ZVRA 2NMBA 2I5CA 5I2MA 2YS1A 2UZRA 1NI2A 3PVWA 3QBVB 1K5DB 3CIKA 4GNKB 2EMTA 5LOPB 2LOXA 2X18A 2ADZA 3AU4A 2D9YA 2CODA 3NWAA 4TYZA 3TVVA 1X1FA 1PLSA 2RVBB 3T06A 1X86A 4NY0A 5GOWB 3A8PA 1P3RA 2P0HA 1AQCA 1KI1B 1NTVA 3U12A 5HE0A 3NWDA 3D8FA 2CRFA 5DH9B 1GG3A 1DYNA 5LG4B 2W2XD 3QIJA 4B6HA 2AEHA 1U5EA 3RCPA 3ODXA 2YF0A 5DI9B 2NZ8B 1U5DA 1XR0B 4WSFA 4OT1A 2KCJA 4YONA 2I5FA 2RGNB 2D9WA 5HE3A 3VOQA 1ZYIA 2DKPA 2D11A 5C16A 3SNHA 2R2YA 4KVGB 1SHCA 2P8VA 1UNQA 2J0KA 4GMXB 2RUKB 5J3TA 1MK7B 2MDXA 4HHVA 3KZ1A 4HDQA 4F7GA 1DDVA 4K2PA 1U5FA 3A98B 1H4RA 3VIAA 2Z59A 4Y94A 2HE7A 1UEFA 4D6WA 1EVHA 1FGZA 3ML4A 2CAYA 3CXBB 2IFSA 2ROVA 2N0YA 2VRWB 1V89A 1U2BA 2LKOA 5C79A 2DKQA 2I1KA 1MPHA 1RJ2A 5JHGA 2COCA 3ULCA 3NWFA 3IVFA 1V5UA 1BAKA 2J0JA 3V5WA 2L2IA 2ZPYA 2ZKMX 4QJ3B 1DROA 1W1HA 2VKIA 2RNRB 3WA0A 5HE1A 5D3XA 4EMOA 3FEHA 4CYEA 4QJ5B 1XCGA 2RRFA 2DYQA 1WI1A 1LB1A 3NW8A 1WJMA 3OHMB 1Y5OA 2YT2A 2QKMA 2MKRA 2QKLA 1OQNA 2CY4A 2N23A 4WJ7A 3ODWA 1Z87A 2KIEA 1QQGA 4HAVB 5D3YA 2ROZB 2RSGA 3HIEA 2E2XA 4QXAB 1ZC4B 1WG7A 4GPTB 3P7ZA 3FM8C 1UNPA 2IYBA 2YS5A 5J3YA 5C6RA 5KQ1A 2K2UA 4K17A 5DHAB 3WYFB 2DX5A 4DX8A 2Z14A 1V5MA 2KUQA 1Q67A 1FGYA 1X05A 4A6HA 4ZRKA 1H10A 1KZ7A 2EC1A 4DIXA 3PEGA 3FSSA 5JHHA 2Y7BA 4CHMA 1EGXA 4K81A 2YT1A 3PZDA 4PQ0A 1MAIA 3DXDA 3U8ZA 2KUPA 2GCLA 2K00A 2KGXB 4HAYB 5M4YB 1WJ1A 2D9VA 3PVLA 4KAXB 2VSZA 1XD4A 2L1CA 5CLLB 5IRSA 2Q13A 2YS3A 4HSIA 3KRWA 2GJYA 1FB8A 2AL6A 3KY9A 3SYXA 2DLWA 1XODA 5C5BA 3SV1A 3M1IB 2LOZA 3MDBC 1N3HA 2H7EA 5D27A 5KCVA 2P0FA 3TCAA 2COFA 1FAOA 2P0DA 2Y8FA 2CY5A 3D8DA 3FVCA 1XX0A 5C5BB 2K2JA 4MK0A 3AU5A 4BBKA 1TQZA 3QWMA 2EJ8A 3F5RA 2K8EA 3SO6A 1XKEA 4DX90 3P6AA 4HDOA 4IFSA 2GS0A 4TKNA 4F7HA 2W2XC 2GUMA 2H7DA 1J19A 1BWNA 5JP4A 1E5WA 1V88A 1DDMA 4L1RA 4A6KA 1PFJA 3KSYA 4KHAA 1MIZB 3ZVRA 1MK9B 5FI1A 1BTNA 3G9WA 2Z13A 3KRXA 4MY6A 4XWXA 1IRSA 1NU2A 3O96A 4GOUA 1WGQA 4L6EA 3D8EA 4YL8A 3HK0A 2M38A 1KZGA 4IAPA 2D10A 4GXBA 1Y19B 2D2QA 4OSNA 4GMVA 5JLJB 4HAUB 1UPRA 2HTHB 1FHOA 5DHFB 2OTXA 4ZRJA 2Z0QA 2ELBA 4EJNA 2PZ1A 2UZSA 1OMWA 1U5GA 3NSUA 2EMSA 4IOYX 3MPXA 4HAZB 2R0DA 1X1GA 1LW3A 1M7EA 2MFQA 4K2OA 3SUZA 1P6SA 1UNRA 2DTCA 2V76A 2M14A 1K5GB 1TJ6A 5DIFB 2DHIA 4HAWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELA A;  4D0N B;  1FHW A;  2LG1 A;  4CHJ A;  3GYO A;  1EF1 A;  1GC7 A;  5D3V A;  2YT0 A;  5KQ4 A;  1RRP B;  5EFX A;  1MKE A;  4A6F A;  3BJI A;  5LON B;  1ISN A;  1DBH A;  3TW1 A;  4GN1 A;  3HW2 B;  1FHX A;  2DYN A;  1ZC3 B;  3PG7 A;  2JP2 A;  3OAN A;  1W1D A;  3N7C A;  2COA A;  1W1G A;  2J59 M;  3U7D A;  1V5P A;  4A6F B;  5CLQ B;  4HB2 B;  2D9Z A;  1MIX A;  2DN6 A;  2D9X A;  4WVF B;  3TFM A;  3ODO A;  4DBB A;  2XQN M;  2R09 A;  1UPQ A;  4Z2M B;  2FJL A;  4HB4 B;  3UZT A;  2I1J A;  4HAX B;  4HB3 B;  1EAZ A;  3TO1 A;  4ZRI A;  5J3Q A;  3DXE A;  1NTY A;  2Z0O A;  3DXC A;  1ZM0 A;  2OQB A;  3PVU A;  4KHO A;  5HE2 A;  1I2H A;  5FI0 A;  2DHK A;  4F7U P;  2W2W A;  1OY2 A;  2UVM A;  2MWN B;  1I7A A;  1B55 A;  1ZSQ A;  1P5T A;  4MT7 A;  4PNK A;  2DA0 A;  4KHB B;  4HB0 B;  3X23 A;  3AJ4 A;  4Z2N A;  4GZU A;  4HAT B;  1PMS A;  2G35 A;  2DFK A;  1SGH A;  1X11 A;  5D3W A;  4P7I A;  2YVC A;  3A8Q A;  4NSW A;  1U29 A;  2LYD A;  3ULB A;  1U27 A;  3BIN A;  1TXD A;  4C0A A;  2D4Q A;  4A5K A;  2LUL A;  1FOE A;  2Y8G A;  1AWE A;  4EKU A;  4DXA B;  1BTK A;  2DHJ A;  1WGU A;  5L81 A;  2Z0P A;  3LJU X;  1QC6 A;  1GC6 A;  1M7R A;  2YSZ A;  3GYP A;  3ZDT A;  2GCJ A;  2BCJ A;  1V61 A;  3HQC A;  3PP2 A;  1DDW A;  3PSC A;  2RLO A;  2YRY A;  2DX1 A;  1WVH A;  3F0W A;  4H8S A;  1J0W A;  2J0M A;  1ZVR A;  2NMB A;  2I5C A;  2YS1 A;  2UZR A;  1NI2 A;  3PVW A;  3QBV B;  1K5D B;  3CIK A;  2EMT A;  5LOP B;  2LOX A;  2X18 A;  2ADZ A;  3AU4 A;  2D9Y A;  2COD A;  4TYZ A;  3TVV A;  1X1F A;  1PLS A;  2RVB B;  3T06 A;  1X86 A;  4NY0 A;  5GOW B;  3A8P A;  1P3R A;  2P0H A;  1AQC A;  1KI1 B;  1NTV A;  5HE0 A;  3D8F A;  2CRF A;  5DH9 B;  1GG3 A;  1DYN A;  2W2X D;  3QIJ A;  4B6H A;  2AEH A;  1U5E A;  3RCP A;  3ODX A;  2YF0 A;  5DI9 B;  2NZ8 B;  1U5D A;  1XR0 B;  4WSF A;  2KCJ A;  4YON A;  2I5F A;  2RGN B;  2D9W A;  5HE3 A;  3VOQ A;  2DKP A;  2D11 A;  5C16 A;  3SNH A;  4KVG B;  1SHC A;  2P8V A;  1UNQ A;  2J0K A;  4GMX B;  2RUK B;  5J3T A;  1MK7 B;  2MDX A;  4HHV A;  3KZ1 A;  4HDQ A;  4F7G A;  1DDV A;  4K2P A;  1U5F A;  3A98 B;  1H4R A;  3VIA A;  4Y94 A;  2HE7 A;  1UEF A;  1EVH A;  1FGZ A;  3ML4 A;  2CAY A;  3CXB B;  2IFS A;  2ROV A;  2N0Y A;  2VRW B;  1V89 A;  1U2B A;  2LKO A;  5C79 A;  2DKQ A;  2I1K A;  1MPH A;  1RJ2 A;  5JHG A;  2COC A;  3ULC A;  3IVF A;  1V5U A;  1BAK A;  2J0J A;  3V5W A;  2L2I A;  2ZPY A;  1DRO A;  1W1H A;  2VKI A;  2RNR B;  3WA0 A;  5HE1 A;  5D3X A;  4EMO A;  3FEH A;  4CYE A;  1XCG A;  2DYQ A;  1WI1 A;  1LB1 A;  1WJM A;  1Y5O A;  2QKM A;  2MKR A;  2QKL A;  1OQN A;  2CY4 A;  2N23 A;  4WJ7 A;  3ODW A;  1Z87 A;  1QQG A;  4HAV B;  5D3Y A;  2ROZ B;  2RSG A;  2E2X A;  1ZC4 B;  1WG7 A;  4GPT B;  3P7Z A;  3FM8 C;  1UNP A;  2IYB A;  2YS5 A;  5J3Y A;  5C6R A;  5KQ1 A;  2K2U A;  4K17 A;  5DHA B;  3WYF B;  2DX5 A;  4DX8 A;  1V5M A;  1Q67 A;  1FGY A;  1X05 A;  4A6H A;  4ZRK A;  1H10 A;  1KZ7 A;  2EC1 A;  3PEG A;  3FSS A;  5JHH A;  2Y7B A;  4CHM A;  1EGX A;  4K81 A;  2YT1 A;  3PZD A;  4PQ0 A;  1MAI A;  3DXD A;  3U8Z A;  2KUP A;  2GCL A;  2K00 A;  2KGX B;  4HAY B;  1WJ1 A;  2D9V A;  3PVL A;  4KAX B;  2VSZ A;  1XD4 A;  2L1C A;  5CLL B;  2Q13 A;  2YS3 A;  3KRW A;  2GJY A;  1FB8 A;  2AL6 A;  3KY9 A;  3SYX A;  2DLW A;  1XOD A;  5C5B A;  3SV1 A;  3M1I B;  2LOZ A;  3MDB C;  1N3H A;  2H7E A;  5D27 A;  5KCV A;  2P0F A;  3TCA A;  2COF A;  1FAO A;  2P0D A;  2Y8F A;  2CY5 A;  3D8D A;  1XX0 A;  5C5B B;  2K2J A;  4MK0 A;  3AU5 A;  4BBK A;  1TQZ A;  3QWM A;  2EJ8 A;  3F5R A;  3SO6 A;  1XKE A;  4DX9 0;  3P6A A;  4HDO A;  4IFS A;  2GS0 A;  4TKN A;  4F7H A;  2W2X C;  2H7D A;  1J19 A;  1BWN A;  5JP4 A;  1E5W A;  1V88 A;  1DDM A;  4A6K A;  1PFJ A;  3KSY A;  4KHA A;  1MIZ B;  3ZVR A;  1MK9 B;  5FI1 A;  1BTN A;  3G9W A;  3KRX A;  4MY6 A;  4XWX A;  1IRS A;  1NU2 A;  3O96 A;  1WGQ A;  4L6E A;  3D8E A;  4YL8 A;  3HK0 A;  2M38 A;  1KZG A;  4IAP A;  2D10 A;  4GXB A;  1Y19 B;  2D2Q A;  4GMV A;  5JLJ B;  4HAU B;  1UPR A;  2HTH B;  1FHO A;  5DHF B;  2OTX A;  4ZRJ A;  2Z0Q A;  2ELB A;  4EJN A;  2PZ1 A;  2UZS A;  1OMW A;  1U5G A;  3NSU A;  2EMS A;  4IOY X;  3MPX A;  4HAZ B;  2R0D A;  1X1G A;  1LW3 A;  1M7E A;  2MFQ A;  4K2O A;  3SUZ A;  1P6S A;  1UNR A;  2DTC A;  2V76 A;  2M14 A;  1K5G B;  1TJ6 A;  5DIF B;  2DHI A;  4HAW B; 
#chains in the Genus database with same CATH topology
 2ELA A;  4D0N B;  1FHW A;  2LG1 A;  4CHJ A;  3GYO A;  1EF1 A;  1GC7 A;  5D3V A;  2YT0 A;  5KQ4 A;  1RRP B;  3HSA A;  5EFX A;  1MKE A;  4A6F A;  3BJI A;  5LON B;  1ISN A;  1DBH A;  3TW1 A;  4GN1 A;  3HW2 B;  1FHX A;  2DYN A;  1ZC3 B;  3PG7 A;  2JP2 A;  3OAN A;  1W1D A;  3N7C A;  2COA A;  1W1G A;  2J59 M;  3U7D A;  1V5P A;  4A6F B;  5CLQ B;  4HB2 B;  2D9Z A;  2KIG A;  1MIX A;  2DN6 A;  2D9X A;  4WVF B;  3TFM A;  3ODO A;  4DBB A;  2XQN M;  2R09 A;  1UPQ A;  4Z2M B;  2FJL A;  4HB4 B;  3UZT A;  4KHB A;  2I1J A;  4HAX B;  4HB3 B;  1EAZ A;  3TO1 A;  4ZRI A;  5J3Q A;  3DXE A;  1NTY A;  2Z0O A;  3DXC A;  1ZM0 A;  2OQB A;  3PVU A;  4KHO A;  5HE2 A;  1I2H A;  5FI0 A;  2DHK A;  3A58 A;  4F7U P;  2Z4D A;  2W2W A;  2FJU B;  1OY2 A;  2KR0 A;  2UVM A;  2MWN B;  1I7A A;  1B55 A;  1ZSQ A;  1P5T A;  4MT7 A;  4PNK A;  2DA0 A;  4CSQ A;  4KHB B;  4HB0 B;  3X23 A;  3AJ4 A;  4Z2N A;  4GZU A;  4HAT B;  1PMS A;  2G35 A;  2DFK A;  1SGH A;  1X11 A;  5D3W A;  4P7I A;  2YVC A;  3A8Q A;  4NSW A;  1U29 A;  2LYD A;  3ULB A;  1U27 A;  3BIN A;  1TXD A;  4C0A A;  2D4Q A;  4A5K A;  4QJ4 B;  2K49 A;  2LUL A;  1FOE A;  2Y8G A;  1AWE A;  4EKU A;  4DXA B;  1BTK A;  2DHJ A;  1WGU A;  5I2S A;  5L81 A;  2Z0P A;  3LJU X;  1QC6 A;  1GC6 A;  1M7R A;  2YSZ A;  3GYP A;  3ZDT A;  2GCJ A;  2BCJ A;  1V61 A;  2NBV A;  3HQC A;  3PP2 A;  1DDW A;  3PSC A;  2RLO A;  2YRY A;  2DX1 A;  1WVH A;  3F0W A;  4H8S A;  1J0W A;  2J0M A;  1ZVR A;  2NMB A;  2I5C A;  5I2M A;  2YS1 A;  2UZR A;  1NI2 A;  3PVW A;  3QBV B;  1K5D B;  3CIK A;  4GNK B;  2EMT A;  5LOP B;  2LOX A;  2X18 A;  2ADZ A;  3AU4 A;  2D9Y A;  2COD A;  3NWA A;  4TYZ A;  3B77 A;  3TVV A;  1X1F A;  1PLS A;  2RVB B;  3T06 A;  1X86 A;  4NY0 A;  5GOW B;  3A8P A;  1P3R A;  2P0H A;  1AQC A;  1KI1 B;  1NTV A;  3U12 A;  5HE0 A;  3NWD A;  3D8F A;  2CRF A;  5DH9 B;  1GG3 A;  1DYN A;  5LG4 B;  2W2X D;  3QIJ A;  4B6H A;  2AEH A;  1U5E A;  3RCP A;  3ODX A;  2YF0 A;  5DI9 B;  2NZ8 B;  1U5D A;  1XR0 B;  4WSF A;  4OT1 A;  2KCJ A;  4YON A;  2I5F A;  2RGN B;  2D9W A;  5HE3 A;  3VOQ A;  1ZYI A;  2DKP A;  2D11 A;  5C16 A;  3SNH A;  2R2Y A;  4KVG B;  1SHC A;  2P8V A;  1UNQ A;  2J0K A;  4GMX B;  2RUK B;  5J3T A;  1MK7 B;  2MDX A;  4HHV A;  3KZ1 A;  4HDQ A;  4F7G A;  1DDV A;  4K2P A;  1U5F A;  3A98 B;  1H4R A;  3VIA A;  2Z59 A;  4Y94 A;  2HE7 A;  1UEF A;  4D6W A;  1EVH A;  1FGZ A;  3ML4 A;  2CAY A;  3CXB B;  2IFS A;  2ROV A;  2N0Y A;  2VRW B;  1V89 A;  1U2B A;  2LKO A;  1T77 A;  5C79 A;  2DKQ A;  2I1K A;  1MPH A;  1RJ2 A;  5JHG A;  2COC A;  3NWF A;  3ULC A;  3IVF A;  1V5U A;  1BAK A;  2J0J A;  3V5W A;  2L2I A;  2ZPY A;  2ZKM X;  4QJ3 B;  1DRO A;  1W1H A;  2VKI A;  2RNR B;  3WA0 A;  5HE1 A;  5D3X A;  4EMO A;  3FEH A;  4CYE A;  4QJ5 B;  1XCG A;  2RRF A;  2DYQ A;  1WI1 A;  1LB1 A;  3NW8 A;  1WJM A;  3OHM B;  1Y5O A;  2YT2 A;  2QKM A;  2MKR A;  2QKL A;  1OQN A;  2CY4 A;  2N23 A;  4WJ7 A;  3ODW A;  1Z87 A;  2KIE A;  1QQG A;  4HAV B;  5D3Y A;  2ROZ B;  2RSG A;  3HIE A;  2E2X A;  4QXA B;  1ZC4 B;  1WG7 A;  4GPT B;  3P7Z A;  3FM8 C;  1UNP A;  2IYB A;  2YS5 A;  5J3Y A;  5C6R A;  5KQ1 A;  2K2U A;  4K17 A;  5DHA B;  3WYF B;  2DX5 A;  4DX8 A;  2Z14 A;  1V5M A;  2KUQ A;  1Q67 A;  1FGY A;  1X05 A;  4A6H A;  4ZRK A;  1H10 A;  1KZ7 A;  2EC1 A;  4DIX A;  3PEG A;  3FSS A;  5JHH A;  2Y7B A;  4CHM A;  1EGX A;  4K81 A;  2YT1 A;  3PZD A;  4PQ0 A;  1MAI A;  3DXD A;  3U8Z A;  2KUP A;  2GCL A;  2K00 A;  2KGX B;  4HAY B;  5M4Y B;  1WJ1 A;  2D9V A;  3PVL A;  4KAX B;  2VSZ A;  1XD4 A;  2L1C A;  5CLL B;  5IRS A;  2Q13 A;  2YS3 A;  4HSI A;  3KRW A;  2GJY A;  1FB8 A;  2AL6 A;  3KY9 A;  3SYX A;  2DLW A;  1XOD A;  5C5B A;  3SV1 A;  3M1I B;  2LOZ A;  3MDB C;  1N3H A;  2H7E A;  5D27 A;  5KCV A;  2P0F A;  3TCA A;  2COF A;  1FAO A;  2P0D A;  2Y8F A;  2CY5 A;  3D8D A;  3FVC A;  1XX0 A;  5C5B B;  2K2J A;  4MK0 A;  3AU5 A;  4BBK A;  1TQZ A;  3QWM A;  2EJ8 A;  3F5R A;  2K8E A;  3SO6 A;  1XKE A;  4DX9 0;  3P6A A;  4HDO A;  4IFS A;  2GS0 A;  4TKN A;  4F7H A;  2W2X C;  2GUM A;  2H7D A;  1MI1 A;  1J19 A;  1BWN A;  5JP4 A;  1E5W A;  1V88 A;  1DDM A;  4L1R A;  4A6K A;  1PFJ A;  3KSY A;  4KHA A;  1MIZ B;  3ZVR A;  1MK9 B;  5FI1 A;  1BTN A;  3G9W A;  2Z13 A;  3KRX A;  4MY6 A;  4XWX A;  1IRS A;  1NU2 A;  3O96 A;  4GOU A;  1WGQ A;  4L6E A;  3D8E A;  4YL8 A;  3HK0 A;  2M38 A;  1KZG A;  4IAP A;  2D10 A;  4GXB A;  1Y19 B;  2D2Q A;  4OSN A;  4GMV A;  5JLJ B;  4HAU B;  1UPR A;  2HTH B;  1FHO A;  5DHF B;  2OTX A;  4ZRJ A;  2Z0Q A;  2ELB A;  4EJN A;  2PZ1 A;  2UZS A;  1OMW A;  1U5G A;  3NSU A;  2EMS A;  4IOY X;  3MPX A;  4HAZ B;  2R0D A;  1X1G A;  1LW3 A;  1M7E A;  2MFQ A;  4K2O A;  3SUZ A;  1P6S A;  1UNR A;  2DTC A;  3DCX A;  2V76 A;  2M14 A;  1K5G B;  1TJ6 A;  5DIF B;  2DHI A;  4HAW B; 
#chains in the Genus database with same CATH homology
 2ELA A;  4D0N B;  1FHW A;  2LG1 A;  4CHJ A;  3GYO A;  1EF1 A;  1GC7 A;  5D3V A;  2YT0 A;  5KQ4 A;  1RRP B;  5EFX A;  1MKE A;  4A6F A;  3BJI A;  5LON B;  1ISN A;  1DBH A;  3TW1 A;  4GN1 A;  3HW2 B;  1FHX A;  2DYN A;  1ZC3 B;  3PG7 A;  2JP2 A;  3OAN A;  1W1D A;  3N7C A;  2COA A;  1W1G A;  2J59 M;  3U7D A;  1V5P A;  4A6F B;  5CLQ B;  4HB2 B;  2D9Z A;  2KIG A;  1MIX A;  2DN6 A;  2D9X A;  4WVF B;  3TFM A;  3ODO A;  4DBB A;  2XQN M;  2R09 A;  1UPQ A;  4Z2M B;  2FJL A;  4HB4 B;  3UZT A;  4KHB A;  2I1J A;  4HAX B;  4HB3 B;  1EAZ A;  3TO1 A;  4ZRI A;  5J3Q A;  3DXE A;  1NTY A;  2Z0O A;  3DXC A;  1ZM0 A;  2OQB A;  3PVU A;  4KHO A;  5HE2 A;  1I2H A;  5FI0 A;  2DHK A;  4F7U P;  3A58 A;  2Z4D A;  2W2W A;  2FJU B;  1OY2 A;  2KR0 A;  2UVM A;  2MWN B;  1I7A A;  1B55 A;  1ZSQ A;  1P5T A;  4MT7 A;  4PNK A;  2DA0 A;  4CSQ A;  4KHB B;  4HB0 B;  3X23 A;  3AJ4 A;  4Z2N A;  4GZU A;  4HAT B;  1PMS A;  2G35 A;  2DFK A;  1SGH A;  1X11 A;  5D3W A;  4P7I A;  2YVC A;  3A8Q A;  4NSW A;  1U29 A;  2LYD A;  3ULB A;  1U27 A;  3BIN A;  1TXD A;  4C0A A;  2D4Q A;  4A5K A;  4QJ4 B;  2K49 A;  2LUL A;  1FOE A;  2Y8G A;  1AWE A;  4EKU A;  4DXA B;  1BTK A;  2DHJ A;  1WGU A;  5I2S A;  5L81 A;  2Z0P A;  3LJU X;  1QC6 A;  1GC6 A;  1M7R A;  2YSZ A;  3GYP A;  3ZDT A;  2GCJ A;  2BCJ A;  1V61 A;  2NBV A;  3HQC A;  3PP2 A;  1DDW A;  3PSC A;  2RLO A;  2YRY A;  2DX1 A;  1WVH A;  3F0W A;  4H8S A;  1J0W A;  2J0M A;  1ZVR A;  2NMB A;  2I5C A;  5I2M A;  2YS1 A;  2UZR A;  1NI2 A;  3PVW A;  3QBV B;  1K5D B;  3CIK A;  4GNK B;  2EMT A;  5LOP B;  2LOX A;  2X18 A;  2ADZ A;  3AU4 A;  2D9Y A;  2COD A;  3NWA A;  4TYZ A;  3TVV A;  1X1F A;  1PLS A;  2RVB B;  3T06 A;  1X86 A;  4NY0 A;  5GOW B;  3A8P A;  1P3R A;  2P0H A;  1AQC A;  1KI1 B;  1NTV A;  3U12 A;  5HE0 A;  3NWD A;  3D8F A;  2CRF A;  5DH9 B;  1GG3 A;  1DYN A;  5LG4 B;  2W2X D;  3QIJ A;  4B6H A;  2AEH A;  1U5E A;  3RCP A;  3ODX A;  2YF0 A;  5DI9 B;  2NZ8 B;  1U5D A;  1XR0 B;  4WSF A;  4OT1 A;  2KCJ A;  4YON A;  2I5F A;  2RGN B;  2D9W A;  5HE3 A;  3VOQ A;  1ZYI A;  2DKP A;  2D11 A;  5C16 A;  3SNH A;  2R2Y A;  4KVG B;  1SHC A;  2P8V A;  1UNQ A;  2J0K A;  4GMX B;  2RUK B;  5J3T A;  1MK7 B;  2MDX A;  4HHV A;  3KZ1 A;  4HDQ A;  4F7G A;  1DDV A;  4K2P A;  1U5F A;  3A98 B;  1H4R A;  3VIA A;  2Z59 A;  4Y94 A;  2HE7 A;  1UEF A;  4D6W A;  1EVH A;  1FGZ A;  3ML4 A;  2CAY A;  3CXB B;  2IFS A;  2ROV A;  2N0Y A;  2VRW B;  1V89 A;  1U2B A;  2LKO A;  5C79 A;  2DKQ A;  2I1K A;  1MPH A;  1RJ2 A;  5JHG A;  2COC A;  3ULC A;  3NWF A;  3IVF A;  1V5U A;  1BAK A;  2J0J A;  3V5W A;  2L2I A;  2ZPY A;  2ZKM X;  4QJ3 B;  1DRO A;  1W1H A;  2VKI A;  2RNR B;  3WA0 A;  5HE1 A;  5D3X A;  4EMO A;  3FEH A;  4CYE A;  4QJ5 B;  1XCG A;  2RRF A;  2DYQ A;  1WI1 A;  1LB1 A;  3NW8 A;  1WJM A;  3OHM B;  1Y5O A;  2YT2 A;  2QKM A;  2MKR A;  2QKL A;  1OQN A;  2CY4 A;  2N23 A;  4WJ7 A;  3ODW A;  1Z87 A;  2KIE A;  1QQG A;  4HAV B;  5D3Y A;  2ROZ B;  2RSG A;  3HIE A;  2E2X A;  4QXA B;  1ZC4 B;  1WG7 A;  4GPT B;  3P7Z A;  3FM8 C;  1UNP A;  2IYB A;  2YS5 A;  5J3Y A;  5C6R A;  5KQ1 A;  2K2U A;  4K17 A;  5DHA B;  3WYF B;  2DX5 A;  4DX8 A;  2Z14 A;  1V5M A;  2KUQ A;  1Q67 A;  1FGY A;  1X05 A;  4A6H A;  4ZRK A;  1H10 A;  1KZ7 A;  2EC1 A;  4DIX A;  3PEG A;  3FSS A;  5JHH A;  2Y7B A;  4CHM A;  1EGX A;  4K81 A;  2YT1 A;  3PZD A;  4PQ0 A;  1MAI A;  3DXD A;  3U8Z A;  2KUP A;  2GCL A;  2K00 A;  2KGX B;  4HAY B;  5M4Y B;  1WJ1 A;  2D9V A;  3PVL A;  4KAX B;  2VSZ A;  1XD4 A;  2L1C A;  5CLL B;  5IRS A;  2Q13 A;  2YS3 A;  4HSI A;  3KRW A;  2GJY A;  1FB8 A;  2AL6 A;  3KY9 A;  3SYX A;  2DLW A;  1XOD A;  5C5B A;  3SV1 A;  3M1I B;  2LOZ A;  3MDB C;  1N3H A;  2H7E A;  5D27 A;  5KCV A;  2P0F A;  3TCA A;  2COF A;  1FAO A;  2P0D A;  2Y8F A;  2CY5 A;  3D8D A;  3FVC A;  1XX0 A;  5C5B B;  2K2J A;  4MK0 A;  3AU5 A;  4BBK A;  1TQZ A;  3QWM A;  2EJ8 A;  3F5R A;  2K8E A;  3SO6 A;  1XKE A;  4DX9 0;  3P6A A;  4HDO A;  4IFS A;  2GS0 A;  4TKN A;  4F7H A;  2W2X C;  2GUM A;  2H7D A;  1J19 A;  1BWN A;  5JP4 A;  1E5W A;  1V88 A;  1DDM A;  4L1R A;  4A6K A;  1PFJ A;  3KSY A;  4KHA A;  1MIZ B;  3ZVR A;  1MK9 B;  5FI1 A;  1BTN A;  3G9W A;  2Z13 A;  3KRX A;  4MY6 A;  4XWX A;  1IRS A;  1NU2 A;  3O96 A;  4GOU A;  1WGQ A;  4L6E A;  3D8E A;  4YL8 A;  3HK0 A;  2M38 A;  1KZG A;  4IAP A;  2D10 A;  4GXB A;  1Y19 B;  2D2Q A;  4OSN A;  4GMV A;  5JLJ B;  4HAU B;  1UPR A;  2HTH B;  1FHO A;  5DHF B;  2OTX A;  4ZRJ A;  2Z0Q A;  2ELB A;  4EJN A;  2PZ1 A;  2UZS A;  1OMW A;  1U5G A;  3NSU A;  2EMS A;  4IOY X;  3MPX A;  4HAZ B;  2R0D A;  1X1G A;  1LW3 A;  1M7E A;  2MFQ A;  4K2O A;  3SUZ A;  1P6S A;  1UNR A;  2DTC A;  2V76 A;  2M14 A;  1K5G B;  1TJ6 A;  5DIF B;  2DHI A;  4HAW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...