2GCPA

Crystal structure of the human rhoc-gsp complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
177
Chain Sequence
b'IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoC
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 177
sequence length 178
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcpA00
2DYKA 4H1VA 3KKPA 3TRFA 4QGGA 1XTSA 3AH8A 3B8HA 1JQJC 2WKQA 3QVUA 1U81A 4HLUC 3QKRB 1RKBA 3UG6A 5P21A 3W5JA 5JHGB 5LB4A 1GAJA 2VSOA 3BS4A 4LYHA 1CLUA 3CR7A 1QG4A 3ZS9A 1ZUNB 2QSYA 3K0AA 1VMAA 3VR3A 2ANCA 4B35A 5C4MA 2BKEA 3U3JA 2R6AA 3VFDA 4B2LA 4DB4A 1GZSA 1WBBA 1XFAA 2LKDA 2XTNA 2VP0A 1RIFA 2PJZA 3WHKA 5K8UA 3QKSA 2OZEA 3ADBA 1KMQA 5J47A 2CLSA 1ZW6A 2CLDX 2QZ4A 3SYKA 1AJEA 1KY3A 1VKJA 4TQUS 4ESHA 1E9BA 2YNMA 5KNDA 4FWIB 3BXZA 1ESNA 2B8TA 3PUZA 2VP5A 3FKSA 2WV9A 3BJIC 3O8BA 2Z4RA 4PANA 1E9CA 3I4LA 4UJ3A 4DBLC 1NMXA 3B60A 3TVDA 1GVNB 2IUTA 2MSDB 1KDTA 1ZU4A 3GLHE 1FX0B 1P72A 4JVLA 4KVGA 4RSGA 1YZNA 2FGJA 4KHZA 3THOA 1ZU5A 1LVGA 3FDIA 1BKDR 1GIAA 4PAQA 3T1VA 3PUWA 3NEJA 1RVDA 2FH5B 5G3YA 3Q72A 4ZCLA 4HZIA 5JWHA 2IXFA 1ZJ6A 2BEJA 4GT1A 3N70A 4F4JA 4DDVA 2ZRFA 1W4AA 2AD1A 1II8A 3T35A 3A36A 2OXCA 1YVDA 2NTYC 1PZNA 4X8OA 5GJBA 1JI0A 3WHLA 2YWHA 5LDDC 2IUUA 2OCYC 5JJKA 5JEDA 2YJTD 4I1SA 2FG5A 3HJNA 4B3FX 3DO6A 3K9GA 4Q9JA 3L8ZA 1AN0A 1E1RA 1VCNA 1LF5A 3DOFA 1YR8A 3I92A 5FOSA 3AUYA 2J45A 2W0SA 2RHDA 1GILA 3MWJA 2RHMA 1XEXB 1G3RA 2BVNA 3VU9A 3SN6A 5JCZA 3TR0A 2ATXA 1VIYA 1VYUA 1Z6GA 5KDDA 5G41A 2ZS9A 4IFBA 3VKHA 3QY0A 1NY5A 3U5ZB 2IK8A 4KI0A 1S96A 1KK2A 3AKCA 2BCGY 1HYQA 3NVAA 1RRPA 1UKVY 1NKTA 4TL8A 5EUMA 3RYTC 4EIWA 1CJMA 5CM8B 1N6PA 2WPDA 4FINA 4OQNA 1X86B 4JVMA 5FBRB 1UEJA 2HCBA 2F55A 1AQUA 3W9YA 3KKOA 4P33A 4K8OA 1F3OA 3SU8A 1E99A 2H8KA 4Q48A 4ZO4A 5EXPA 3X1WA 3AVWA 3BFXA 3EA5A 5CJ2A 1SULA 2OBMA 3IKJA 4US2R 1YU9A 3QPUA 2JIZA 3PUVA 5TARA 3F0TA 3VHXA 1GNRA 3ONWA 3U44A 1N5LA 4P4TA 3CNNA 1YQTA 2ODWA 3HU3A 4FMDF 4DVGA 1N6IA 2EFEB 2R2AA 2HCJB 3QIAA 4BFVA 2YOFA 4TSFA 2QENA 4IKEA 1N6KA 3ZIAD 4XVQA 3QXHA 2O0JA 3AKEA 1DOAA 3LY5A 3NG1A 1J90A 3ASZA 2IT1A 5FTKA 4W7SA 2BEKA 3B82A 1KSGA 2ZRLA 4WVFA 1NBMD 1NL3A 3GQBA 4PPNA 1XCMA 2W6JD 1TX4B 2ZI4A 3OEHA 1NIPA 4BFTA 3N2EA 1SHKA 2O0HA 4JLJA 2ZRJA 5FBQB 4E09A 1FTSA 1GL6A 1E1QD 1NRJB 1ZD1A 1G291 4NDZA 2QSZA 1OH8A 4PHFA 1OB2A 2WJJA 4NCHA 3SJZA 1YRBA 2N46A 3TGPA 3BH7A 121PA 4LPKA 4BLQA 5JFGA 1R7RA 2JLQA 4DIDA 5IF9A 3EW9A 4I4LA 4C2UA 3IEVA 1I2MA 3WXMA 2C98A 2GXSA 1F2UA 3LBHA 3RRZA 4MKFA 4RFVA 4HZUB 4P32A 4DCVA 1XWIA 5B58C 4FWTA 4IRUB 3UANA 3CRVA 3CF6R 4M1OA 1FMJA 3OIWA 5FI0B 2CJWA 3SZRA 2FSIA 2RGNA 3CX8A 4AK9A 4KCGA 2NIPA 3MD0A 4DLYA 4XVUA 5AR1A 1D9ZA 2BJWA 2EW1A 2XSZA 3I8XA 4PSKA 1D2NA 3T1TA 1SXJC 3SBEA 4PC7A 4EPXA 3CH4B 1XMVA 1JNYA 3ZQ6A 4DLXA 1S2MA 1L4UA 2Y8EA 2JJ2A 3MWKA 4CVNA 1FX0A 2D7DA 1A82A 1NSTA 3RS7A 4GOJA 4DHEA 2DPXA 1H8ED 2WHXA 2DWOA 3FTQA 4WW0A 1PLJA 2IYVA 3UMRA 3DVLA 1M8PA 1PLKA 1SKYB 5JI2E 2AD5A 3B13B 1AQYA 2GA8A 4A6PA 1Q22A 5A5GA 3LH5A 2WIBA 4LOAA 2JASA 2QU8A 1AZTA 1XZQA 3I3SR 4HUQB 2QEQA 2WWWA 2X19A 3ZS8A 4BLTA 4CT5A 3MMPA 2AN9A 1HQCA 4M9ZA 1TAGA 1P9WA 2ZI7A 3ADKA 1E2QA 2ZETA 4LYAA 2AWNA 3AP3A 4OL0A 3EZFA 3R9XA 4AI6A 2JATA 2PEZA 5GVSA 3GLIB 3PQCA 1YRAA 4TTQA 4D4KA 1I4TD 2GWHA 3T15A 3W34A 1FFHA 4YDHB 3AVVA 3C8UA 4JLAA 2C99A 1XEXA 1TU4A 5JZVA 1ZUIA 2P6NA 2W0MA 2J7PA 1ZCAA 4M1WA 4E03A 5J4KA 5KPDA 3PR1A 1XD8A 2OFOA 4OI4A 1X8JA 3SS8A 4LHZA 3E1SA 1SVIA 4Z54A 1COWA 2ORWA 2PLFA 2OLKA 2ZE5A 5FTMA 2JLZA 1OIVA 1KMHA 1TL7C 4B71A 4Q1EA 2RGBA 3DPUA 2ZUBA 2WWXA 4XOIA 3AP1A 3QPVA 4TLBA 3I61A 3RAPR 1OFUX 4C0QC 2C9OA 4Q4LA 1G8FA 4HAUA 5CLQA 4LDJA 3MCAA 1BS1A 4LBWA 3QSYA 2YINC 1XTQA 1E0JA 2P2LA 3L0SA 3B78A 2WOOA 1XTKA 4MDEA 1QF9A 4O2LA 2IYUA 1EESA 4D2IA 3EZ7A 1W48A 2ZRAA 1G8GA 1NMZA 1TF7A 3L0OA 1E9EA 1W0JA 1Z5ZA 3ZGXA 3RS3A 2N1BA 2V6JA 4YLGA 2MSEB 1IHUA 5FBLB 1HT1E 2OXRA 2W6ID 1YZTA 4GBMA 4UNPA 4F4CA 2O8EB 1OH5A 2QAJA 1EXMA 1VTKA 1W7AA 1XCGB 2JA1A 3I72A 4KYUA 4MGKR 5IT5A 2IWRA 4Q4AB 3OIVA 2GEVA 5TV2A 4BPBA 4XSGA 4HDOB 1M6NA 2WWGA 3K70D 3R7WB 3EXAA 4XD7A 4KBFA 4DB2A 4GPTA 2GEDA 3W90A 2CBZA 2ZREA 2F1HA 3WNCA 2VIIA 2BMJA 1T0JB 4R98A 1V43A 2FWRA 1S3GA 3CRRA 1JR6A 1NMYA 3EIHA 2JCSA 3CPHA 1CR4A 4OHVA 4TT3A 4JSTA 4KO8A 2NPFA 4H1UA 2GK7A 1AA9A 2XEXA 1GSIA 3R9IA 3IIMA 4A4DA 1KKLA 2YOGA 3B1WA 3UKDA 3K0CA 2FFAA 2OAQ1 2JLYA 3M6AA 1G7CA 1KJWA 4G5OA 1ZIPA 3U2QA 1TF2A 3TUIC 4HI0E 5EE5B 2F1JA 1VCMA 3DHWC 3GLHA 3QVVA 3BK7A 3R8FA 1N6RA 2VHTA 2CVHA 1JALA 1GKIA 2PMDA 3A1UA 1WDTA 3K09C 3M4YA 4L16A 4TMKA 3TAUA 1B23P 1OFTA 4MYHA 2O0KA 1EK0A 1Z63A 2EQBA 2RGAA 1DO2A 2ZR7A 1KI7A 4OBEA 3UWOA 4WAUA 2D3WA 4OJKA 3K0SA 4MRRA 1RJ9A 3DKVA 3AQ4A 3ECCA 1Z28A 4MQBA 3K53A 2QP9X 3F5FA 5G3ZA 5FPKA 5ELXA 3AVXA 2WJVA 1ZMXA 3LBNA 3WP0A 2J0UB 3BFVA 4IHQA 3GMTA 5JI3E 1E94E 3LD9A 3K70C 3SHFA 1L2TA 3PCRB 4UQOA 2RH5A 3B1ZA 2BCJQ 2PZEA 5F2EA 3EZ2A 2DFLA 3BC1A 3TVTA 4EJSC 1YR9A 2QQEA 1KJYA 4MRVA 5FPHA 3RANA 4EAQA 2I3BA 2BHRA 1T91A 1W2GA 1X1SA 3Q85A 1N3BA 3QBTA 2CCKA 2HV8A 1JAIA 4CYMA 5IRCD 2H5EA 3PIRA 4GFDA 1CJUC 1CJKC 3U3MA 4A8JA 2OSBA 1XB2A 4URUR 5BYJA 5BN5A 3QEJA 1JAHA 5IK2D 1QVRA 4XIGS 3NWJA 4YMWA 1G5RA 4KLNA 4TLAA 4V03A 3ZZ0A 5KHOC 1CS4C 4LHVA 3L43A 3T61A 2RB4A 4DRZA 4UJ5A 2AKYA 2V9PA 4IOJA 3FWYA 5JS7A 1I4DD 4TMZA 1IXRC 3PENA 1Y3AA 5FOWA 4CEHA 1GKUB 2WMNB 3A8TA 4LI0A 1OE0A 3RVBA 3U61B 3QE0A 4BFUA 5DHAA 2JLXA 1EX6A 1S8FA 3QBVA 1K6MA 3THWB 2GBLA 1DAGA 1R5OA 3C15C 4CF7A 1EGAA 1KO8A 1SHZA 1GRNA 1U94A 5DYIA 3WYAA 2JDID 3C7KA 3LLUA 5AUNB 1T3HA 3RRYA 3U4QA 1CR1A 4ABYA 1NG1A 4LYJA 1X8LA 1W36B 2FSHA 4M1MA 2Q3MA 4PAMA 2OT3B 4B32A 5JCPA 1SVWA 5L8VA 1OIXA 4JVSB 5C46F 1AGPA 1Q44A 3EPJA 1EFUA 3LRPA 4HB3A 4WBSA 5AWFC 4AYWA 1U2RA 3U7FB 4JS0A 2VP2A 1H8HA 2YKGA 3SHWA 5CM9C 2ERYA 2ZI6A 1XF9A 4B3CA 2G9NA 4AKIA 4B48A 3RS0A 1KSFX 4GNKA 4DUGD 2NO9A 2OCPA 2NPIA 4PR0A 5CB8A 2YV5A 2ZRNA 2X2EA 4AG5A 621PA 1VYVA 4ZKDA 4DDWA 4Y0VA 2QTVB 3QQ5A 1E9AA 1R10A 3B6EA 3MJRA 2H17A 3VQTA 4D4JA 2R6GA 5SZIA 4LV6A 3AF4A 2ZRBA 4MYUA 3T1QA 5HZKA 2YC2C 2CCJA 2O8EA 1Q1ZA 3GLGE 4JYBA 5GADl 1GM5A 1ZVQA 2G6BA 1H65A 4O0MA 4JLOA 1C1YA 2UVQA 4Q4AA 4A82A 1NG9A 1SQ5A 1R2QA 1KYIA 5KU1A 1GRRA 4M9XA 3R7WA 4RD0A 4M21A 4LHYA 2VSFA 2QGZA 1QDEA 1ZM9A 1XPRA 3RDPA 1AM4D 4Q01A 1Z6YA 1TNDA 2XNDA 3T1OA 2WJIA 3DKPA 2ZRKA 1ZINA 3GJ5A 1T4GA 4KITB 2O8DB 2PLRA 4E22A 4G5GA 1QHHB 5EZ5A 5AJVB 2GTPA 2GXAA 2XZPA 1K5DA 2YWEA 4W5WA 1VCIA 3VX3A 2WICA 4BLSA 2WTUA 4M53A 2ZRDA 2C5LA 2IYQA 1GDDA 2RGDA 4TMWA 4BRUA 1G18A 2ZROA 3KJHA 3ZD6A 3NHAA 1M7HA 4LUCA 1BMFA 4PC6A 3THXB 3IEUA 5FOVA 8OHMA 3IHWA 1YKSA 3G82C 2WKRA 1E2KA 2HYDA 2QPAA 3RSLA 2F6RA 1KO5A 4C0LA 3CO5A 3W3ZB 1Q1EA 4M9SA 4DSOA 2ZYTX 3AVQA 5LBIA 2GVDC 4DLVA 1MRNA 4MKHA 4A2WA 1IQPA 1NLFA 1XD9A 2ORVA 3FHOA 4A0FA 1MT0A 3UXMA 2GK6A 2SHKA 4DZZA 4RFSB 5BN3A 1ZNXA 2AKAB 2BJVA 5E7JA 3TKLA 4JT2A 3RS4A 5FFMA 1KJZA 1KI6B 3PXGA 1E2MA 2F9LA 4L15A 4R2IA 2J3EA 4PSAA 3LXXA 4TMXA 2F43B 2PCJA 1G5PA 3DEFA 2PCLA 3GJ4A 5H1YA 3FOZA 4PHGA 2REXB 4Q9KA 5L3QB 1PVOA 2H1LA 1EWRA 1E9RA 4IEIA 4DSUA 5M04A 1IY0A 4Q7JB 1ZC3A 1CKEA 4QXAA 3TNFA 4X8HA 2BC9A 2ZJOA 4YONB 1OF1A 3V4FA 3KQKA 1OT3A 4ASUD 5EZ6B 3BERA 4HSEA 1XTRA 1P3JA 4MYTA 2AK2A 2VRWA 1W44A 4YXWA 1RFLA 5SZKB 3MJHA 4ACBA 2QI9C 1HEIA 2ZRIA 1KOFA 3NH6A 4JLNA 2VP6A 2ODNA 3VR5A 3VR4A 1Q3TA 4EFLA 2RGNC 4KAXA 3UG7A 3BB3A 1T3SA 3HDTA 4M1TA 3THWA 4KU4A 4O3MA 4TYYA 1Z0KA 1E2NA 3LVQE 2ZSEA 1WA5A 3B9QA 3MUFA 1HURA 2YYZA 4I99A 2GCNA 5AJZA 1GP2A 4YMUA 1I4LD 2D74A 1II9A 3FFAA 4PFSA 3HPRA 3IBYA 3GLGB 1UKZA 2NZJA 4Z1MA 4JVNA 2DBYA 2BM0A 4GRAA 4QJ4A 4B74A 1KDPA 2QM8A 2ZIAA 2IS6A 5D3MB 2P3SA 2CXXA 1IN5A 1P9NA 5CDFA 1XXHE 1GKYA 2IF0A 1Z6TA 5EP2A 5CYOA 1E96A 5F9FA 3AVTA 2GJKA 2XOKD 3FHCB 2O8FB 2QMEA 4TMVA 4GDFA 1GNPA 2NO1A 1A1VA 1FQJA 1TU3A 2OG2A 2QT1A 4LHWA 2FU5C 3ND8A 2V55B 5CYPA 4A2PA 2BBOA 4ARZB 1QHSA 2GEUA 3TH5A 3ZVRA 1UBEA 1NNEA 3CF0A 2C9CA 5KDLA 3WBJA 1W49A 2G83A 4LBZA 721PA 5HE9A 1BIFA 1TADA 4Q4JB 4P0TA 2ZANA 2RGEA 3C5HA 1T6NA 5DGXA 4GZLA 5FL7A 3U7HB 1G3UA 3OE7A 1E2GA 2CNWA 4QJ3A 3F8TA 2GILA 1TQ4A 2WOJA 3NHBA 5GJCA 1N5KA 4JLKA 1IY2A 5ANRB 1KAOA 1WMSA 4X8MA 1OSNA 4Q7LA 5HR5A 2IA5A 3EZ6A 1VG9B 4Q02A 4Q9LA 4AKEA 5E3HA 5B64A 1JBKA 5C18A 2IYTA 4BEBA 3E70C 1J7KA 3UATA 4P4SB 1P5ZB 3KZ1E 4ZCIA 3FGNA 2XITA 4MA4A 4HLCA 4BZPA 1E69A 2ZI5A 2V7QA 4JLVA 4HLDA 4D4MA 3P4YA 5DI9A 4TL9A 5E7IA 2QE7A 1R5NA 1N5IA 4PZYA 3IDQA 1FW6A 3BH6A 2O8DA 2IYYA 4NYMQ 4UNQA 4IDHA 1D2EA 1N6OA 3EC1A 3VR2A 2AXPA 2CVFA 4TZ0A 3KXIA 4Q18A 4BRWA 4E5UA 1NN5A 2OLJA 3OESA 2EFGA 1N2CE 1KK0A 2ZRCA 2R9VA 3TUJC 2IWHA 1Q21A 2IC5A 2I4IA 3MFYA 3TBKA 1JB1A 4FMBB 2VEDA 1K5GA 4L4UA 2AL7A 2CL7X 4CEIB 4DJTA 1X1RA 1HT2E 3BWDD 3GJ8A 3EG5A 5A4JA 4CEJB 2XGJA 3GJ6A 4LJ5A 2WSSD 2WVJA 3THXA 5FOUA 2DWPA 4BFSA 4EPVA 2H7VA 4YMSA 3NIBA 1JPJA 2D4HA 3VKWA 3A6PC 4NL4H 1JECA 1D8TA 3OEEA 4FMCF 5LD2B 3KFVA 1P60A 4PC3A 5DN6A 1AK2A 3ADCA 1Z83A 1G7SA 3UIEA 4NBSA 2ZQ5A 3R8CA 3REFA 2XNSA 4XH9B 4M9QA 2G3YA 2E9SA 1YR6A 1N0VC 4NHOA 4LX0A 2X2FA 5FPYA 4I1OA 4ZPXA 1E4VA 1FUKA 4QRHA 1KI6A 3AM1A 1T5IA 4LV8B 2P65A 4BFZA 1T8UA 5KSOA 4JLMA 2GHIA 2OV2A 4JJZA 3K0CC 3O47A 3I73A 2QBYA 4LZZA 4DT1B 2OFXA 4LBVA 2RCNA 4DEXA 4URVR 5L3QA 4C4PA 2CK3A 2OILA 1QBKC 1TTTA 2R44A 1SKYE 4G5RA 5JBQA 1ZBDA 3X2SA 1AIPA 1ODFA 5JECA 1S9HA 2GVZC 1DELA 1XXHB 3QOFA 1G5TA 4LWZA 2FDCA 3Q8XB 3LX5A 1EWQA 3MWLA 5FOTA 1NLZA 1VG0B 3CH5A 3FMPB 2NZ8A 4G01B 3GLIE 4YMVA 1E0SA 1OXSC 1UJ2A 2ZSAA 4LJ9A 3KKNA 4PZZA 4Q00A 2JJ1D 1M7BA 3BB1A 4NYJQ 3H86A 1FZQA 1U99A 4FN5A 4EPRA 4NMMA 4OK3A 3D3QA 3R9WA 5TXGA 1W47A 2W58A 5HTKA 3K0FB 2ZUCA 3LA6A 3VKGA 3L0IB 4NYIQ 2OCBA 5CIWA 2A9KA 2DWQA 4KFUA 4IVRA 3IIJA 3CZQA 3C5CA 5FBVB 2XXAA 3GLGA 1G3IA 2OM2A 4Q1FA 4A8JC 1XZPA 1ZIOA 2KJQA 4M8NE 4EDHA 1OJLA 2H18A 821PA 2VO1A 5JWOA 3AKYA 5D3MA 4GOKA 3JZMA 3Q7PA 3Q3JB 2PBRA 3AP2A 3K9LA 4TWZA 1SXJD 2QM7A 1YJ5A 2QTHA 2O8FA 3SQWA 2J59A 2AFIE 5DE3A 2P6UA 4ZV4A 3L82B 4TYWA 1W2HA 5FI1B 1G21E 4ARZA 2JLWA 4UXIA 3SJAA 1U0JA 3B1XA 3THYB 4LPSA 4Q4JA 4F92B 2HLDD 1Q1QA 2ZJBA 2GBLC 1R0ZA 5CK5A 1KO7A 3QKRA 5BW8A 1I2DA 2IYLD 3TE6A 3D7MA 4LCBA 3EPKA 2WJHA 1Z8FA 3FMIA 3E2IA 4BGDA 3OHMA 1S1CA 1VYTA 2YHSA 5AK0A 3KQUA 1NSFA 1LF0A 3CWZA 5BN4A 3BIFA 1W0KA 1AZSC 4C30A 3MGCA 1JR3E 1YR7A 2AFHE 2ZRGA 1K8RA 2W83A 3QI2A 4XJXA 2A3RA 3SDZA 1DEKA 1HTWA 2GDJA 2XNDD 4J0QA 1KY2A 2XZLA 1E2IA 3QUSA 1HV8A 221PA 4F93B 3IPYA 4B76A 1OKKA 2HT1A 4L9WA 3OZXA 4EFNA 2ZJ8A 1NJGA 2FJUA 3QEOA 2ZU0C 3LQQA 2EFHB 4AKHA 3GJ3A 4WXRA 1FTNA 2B7BA 2WAXA 4DLRA 4B6FA 1KZ7B 1W4BA 3CX6A 3OAAD 4WZ6A 3U7EB 3U6KA 3UPUA 4QOSA 1CR0A 1TMKA 3CRMA 4FCVA 1CRPA 1SKQA 4AWXA 2GZHA 1UDWA 3ZZUA 1HE1C 2EYUA 2OEPA 3AVOA 4CEJA 3HR8A 1QHGA 4FW9A 3V4RA 4I1VA 4TTPA 3HYTA 2ZI3A 3EPLA 2A2ZA 1DAEA 4RD3A 5HKKD 1TUIA 2BBTA 1C4OA 3KKMA 1CEEA 4KBGA 1G9XA 4RKFA 4PQYA 5GJVC 1TQ6A 1BYUA 5E95A 1ZYUA 4TL6A 4E07A 4BASA 2IW3A 5CJPA 5FL3A 3FFBA 3QKTA 4V0LA 3U7GA 3FMFA 1M1YE 2BWJA 1WQ1R 2CL0X 4NKRA 3CB4A 5HE8A 2Q3HA 3PJRA 2PEYA 1BYIA 1HQYE 1E4YA 3LNCA 1JQLB 2A30A 2CHGA 4TL7A 5EE9A 1XNJA 4CZ2A 2E1RA 2QMOA 3JVUA 1ONBA 1KSHA 3QG5A 4BZQA 5EQTA 4HAYA 4D80A 4ON9A 4IJMA 4JKYA 3WRYC 3EIEA 4CW7A 1YZUA 3AVPA 4DT1A 2QP3A 4LJAA 5KSYA 3OFNA 4I1UA 2HJGA 1EFRA 3MWYW 5FTJA 1UBFA 4CT4B 3M0EA 1IN8A 2FNAA 4L9SA 4FI3C 3TQCA 4UNRA 2PL3A 1YZGA 3U60B 3E5HA 1DVRA 2XB2A 3VNUA 1R0YA 3RRMA 1XXHA 4A1FA 3N5CA 1OFHA 2W2VA 2BM1A 4PO9A 2RGGA 3KL4A 3KKQA 4GMXA 4F4IA 1KI9A 1P73A 1KKMA 3FKQA 4KJZA 1P4SA 5BXQC 1E2HA 2WJGA 3IO3A 2LWIA 4QHSA 3T5GA 4XTRA 1J70A 4LYFA 1E79D 3B1VA 4PAOA 4QC2A 4WIAA 3VMFA 2RGXA 4PO1A 3KQLA 1KK3A 3I5XA 2D7CA 1NVVR 1GL7A 3K0FA 5GJWC 3SNHA 4ILEA 2I1VB 2WWFA 4FCTA 1FUUA 3A4MA 4KODA 2XB4A 4NONA 1SXJB 3U3RA 2O8BB 2IXGA 1ZUHA 2QA5A 2NO6A 3BBPA 4CDGA 1IY1A 4V0KA 4BUJA 1OHHD 3AV0B 5CDFE 4KSCA 4IDOA 1XEWY 2J7KA 5J40A 2HJVA 4OHZA 4OQXA 3PV0A 1GNQA 4CRWB 1MO5A 2KB0A 1Q0UA 3M1IA 2V54A 2DFTA 4A9AA 5BQ5A 3CKLA 2ZE7A 1F48A 5HZHA 1TEXA 2R6CA 3KJGA 1PV4A 4IOLA 1LS1A 4OQMA 3T06B 4YMTA 3HWSA 2IF2A 4M0LA 1ANKA 4G3XA 1XJQA 5KSPA 1XRJA 3THYA 2WSMA 2B92A 2Z4SA 3OE7D 2C96A 3Q5DA 2BMEA 5AJWA 3FB4A 1G3QA 1T5LA 1Z0IA 4MH0R 1CJVC 1R4AA 3NBZC 2G0TA 1F60A 2FZ4A 3DZ8A 4B43A 2RKOA 2IYXA 4JL6A 4D82A 1TF5A 5L3SB 4QGHA 2F9MA 4V02A 1J8YF 3A1WA 4HLQB 3V9PA 4K46A 1W36C 1E6CA 1L8QA 3K1JA 4IXMA 4JT4A 5DI3B 3SFZA 1DG3A 1E2LA 1FNMA 2ZYVX 3NBXX 4Q4HB 1ZM3A 2IL1A 4I81A 4QKQA 4HZUA 2K5UA 4IOMA 4YDSA 5FH9A 5JSZB 1OIWA 3RWOA 2VYFA 2NGRA 5G53C 5CB6A 3P27A 3DDCA 3FKSD 4GP7A 4DSTA 1S3SA 5B2ZA 4OQLA 3HU1A 4DLWA 4EQ6B 3LFUA 1Q12A 2FV8A 2QP4A 3CWQA 3WYGA 4M4SA 1XTJA 3IO5A 4OJQA 4B2PA 4GI7A 2D2EA 5G40A 4N0DA 2FFBA 3AKDA 2KBFA 1CRQA 2OUKA 1XPOA 4C0HA 1OXVA 1QHIA 4BZXA 1MKYA 2BKUA 4HAXA 5EE0A 1P75A 2G1KA 3S1AB 3DMNA 3L0PA 3CM0A 4NZYA 2ZVQX 2QL6A 3P20A 2PJRA 4HAWA 4HUQA 3TW4A 1N0WA 1GG2A 1NIJA 4M1YA 4ZI2A 3RWMB 3K9NA 1GTVA 3CF2A 1RC8A 4NE2A 1W5SA 4LJYA 4CGZA 1XMJA 1WCV1 5AJXA 1E1RD 3KQHA 5BWMA 5C2JB 3GLIA 1ZNZA 5FPTA 2BDTA 1BH2A 2GZDA 1QVAA 2A5FA 2Q9CA 4NTZA 3AUXA 3BOSA 4DSNA 1XDBA 3VTKA 1T8TA 3X1YA 2GCOB 2ONJA 2IS1A 1Z2AA 5EUQB 5B57C 3CNLA 4Q9IA 2DY1A 2IXEA 3LBIA 3MG9A 3B2EA 5FOXA 5JEEA 2HXSA 2ZJAA 3QXCA 2QGNA 2VHUA 5E4FA 5EP1A 2IS2A 5FUWA 4W5HA 1T9HA 3HPQA 3CUEF 5F3WB 2X1VA 2QROA 3PEUA 3A58B 2NO7A 3QF7A 1P2UA 2D2FA 1IJEA 2REBA 2WPDD 3CONA 4Y0AA 4ZIRB 1QHYA 2WIAA 4F91B 4ZCMA 1Z0AA 2GAOA 5EXTA 3I62A 4DIEA 1DAHA 4PPQA 3GLFE 2F1RA 4XTCS 1PLLA 3C4JA 3D6TB 3KUDA 3KX2A 3CR8A 2J0QA 2GXQA 1R8SA 1UEIA 2IEYA 2B7CA 3GP8A 3P1JA 3ICQB 3UMFA 3KB2A 1CXZA 4BFYA 5GVRA 3VR6A 2D06A 2JIZD 3ZVMA 3QENA 3K70B 2FPLA 3SYLA 1SVOA 4XVRA 2E87A 4EJSB 1SVSA 3O8DA 3ZIAA 4B73A 4DCUA 2ZJ2A 5AUOB 1G4AE 2O8BA 4B3XA 1ZM2A 4N1AA 2IS4A 3O8CA 3NC1C 4TSFD 4PPGA 1NBMA 4Z51A 1JR3A 1E2EA 2IUSA 1Z0DA 2W6JA 4V0ME 1U8YA 3WNBA 3KXLA 4JBWA 1E1QA 2WKPA 2ODBA 1TPZA 2KBEA 4IW3B 2UZIR 3OEHD 2ZRPA 5TY0A 3GFOA 1UAAA 3TR5A 4JLPA 4OI2A 2XTZA 1IXZA 4Q1BA 2VLIA 421PA 1XU4A 3QKSB 4URYR 1GL9B 2BBWA 3Q7QA 3WMGA 2JJ8A 4O25A 1J2JA 2G1JA 3A4LA 2NOAA 5L3RA 5JRJA 1ZNYA 5H68A 3U3KA 4D81A 1RW4A 2IHYA 1JXMA 3TW8B 2FPMA 5KNCA 5L3SA 2EU8A 2PX0A 3G0HA 3GJ0A 1G3MA 4BECA 4EUNA 2ANBA 4U02A 1Z07A 1DAKA 4IFEA 2R6FA 2ORIA 4B3GA 4KYIB 1XJCA 1Z0FA 1ZP6A 2J0UA 4NYJR 4EKDA 2XSZD 4FMCB 1OH7A 3LW7A 1A4RA 3P26A 2G0NA 4NYIR 4EQ6A 5EXSA 4OHXA 1H8EA 2ZAOA 1UADA 2IBMA 4A0GA 2JJ2D 2FMXA 4BEJA 4QGFA 1EFTA 4DLZA 1RZ3A 3IQWA 2Q0HA 3QG1A 2AR7A 1P2SA 1LS6A 3D31A 2CHQA 1CTQA 3FVQA 1ZRHA 3H84A 3IGFA 4Q5IA 2AHOA 4POAA 1D2MA 3A1TA 1NY6A 2NG1A 2RGCA 5FUXA 4LK2A 4DCSA 3LLMA 4B75A 4XWKA 4UNNA 3S1AA 2ZITA 3FPAA 4JYCA 1XEFA 4AD8A 2BV3A 4QNMA 4DDTA 1DTSA 1WF3A 4GSYA 1TUEA 3SJCA 4W9MC 2XZOA 4JL8A 4TQAA 2V4ZA 5FTLA 4GL2A 1KNXA 1R8QA 1U90A 2Z83A 4Q47A 3VU9B 3FE2A 4B44A 3QKUA 1WP9A 1D9XA 1XX6A 4RZUA 2VF7A 1MABB 2JEOA 3GLFB 3QJYA 2VF8A 2B8WA 4QBFA 4QFMA 4HAVA 2QUZA 1OYWA 4MRNA 2YZ2A 1WE2A 3VX4A 1MR3F 2GJAA 4HB4A 1L7VC 2J7PD 4WA7A 4C3ZA 2AK3A 3OFND 4PPFA 2H57A 1L4YA 1COWD 4U5XA 1LV7A 3CW2A 1DADA 3Q9LA 1G6HA 3OIYA 4ACAA 4QM6A 3LX8A 4DXAA 5KSZA 4DLTA 1LY1A 2QAGB 2C78A 2WMOB 3SQXA 5KTYA 2YWFA 1Q20A 3TMKA 1FL9A 4WZBE 3GEHA 4ERNA 5HPYB 4PQRA 1CBUA 1Z22A 3RS2A 1CIPA 1T3LA 2GJ9A 2JLUA 2W6IA 2VL7A 3GEIA 1WBDA 2WJYA 4ZDWA 2ZYWX 2ZR0A 1US8B 2HF8A 3RHFA 2AX4A 4ZKEA 2J0SA 1W0JD 2KE5A 4C0SA 1EG7A 4JBXA 4LC0A 1KO1A 4RZ3A 1Z06A 1U8ZA 4PC2A 4XWOA 1RPZA 2G88A 4P3YA 2ZPTX 3LAWA 4HYYA 3ZYCA 1U8AA 4PXAA 4YC7A 3ZH9B 4B2IA 1DBSA 4ZDIA 4S35A 2HXYA 1Q3HA 3HR7A 2VP9A 4PX9A 2DCUA 1E3MA 1OFIA 2XTMA 1U9IA 4QHYA 4AKGA 4XD7D 3TSOA 3CX7A 1MH1A 1VECA 2ZI9A 1GOTA 1T0HB 3B9PA 3CRQA 2QG6A 5JJLA 1O3YA 5TB5A 3WMFA 3NEYA 3B7GA 1E9SA 3IIKA 2ASEA 4AYTA 4TT3D 3SE0A 3CRW1 1KNQA 3AF2A 2JAQA 2CE7A 2ZSDA 4US0R 1J99A 1QHHA 2PT7A 1JEDA 1UF9A 2G77B 1CJTC 1E2JA 2TMKA 1F2UB 5K8TA 2HF9A 1MO4A 2QTFA 4DWJA 1FPMA 3SOPA 4D0NA 4DEYA 1R5BA 4B3BA 2VP4A 2VTKA 3GCGA 1W5TA 4A92A 2JGNA 1W46A 5DO9A 3QF4B 2CJWB 2MMGA 4Z8XA 1A7JA 4BLOA 1NN0A 1YZQA 4HEJA 1G7RA 3IPXA 1Z29A 3REGA 1KIMA 2EVWX 2VHCA 3LV8A 2O5VA 1DE0A 1U0LA 2P5TB 1GRQA 4D0LB 1KAGA 1VHLA 2ATVA 2F7SA 3LXRA 4KFRA 4LHXA 4MITA 4BLPA 3U6BA 1BO6A 1P6XA 1VCOA 2ZE8A 3H4MA 1W4RA 3BE4A 5BYKA 3FMOB 3LDAA 3NDBB 5JRZA 4RCZA 4RFSA 1Z3IX 3RC8A 2VPPA 5DLQC 2ZS8A 2FF7A 5IK2A 3RABA 2GXUA 4QM7A 2GKSA 2P67A 4X8LA 3RSOA 3ZVLA 1DG1G 5LPNA 3ZLJA 1GUAA 3EX7C 2GZAA 4WOPA 2F43A 3TUZC 3OIUA 3LWNA 4L5BA 1FMLA 1G17A 2ZJZA 1BOFA 2AWOA 1XPUA 2J5XA 5DHFA 3ND9A 3KQNA 4C7OB 2FSGA 1E9FA 1AS3A 2CE2X 4A0RA 2F1IA 4C0AC 2CL6X 1IJFA 4P31A 2XAUA 4C0BA 4BLRA 3QXJA 4LJ4A 3DL0A 5HCIA 5UKDA 4AYXA 1HUQA 1YZLA 5A0FA 2JDIA 4MKIA 2CEAA 5J4VA 1G41A 1MABA 3EWAA 3GLFA 1O87A 3AF0A 3RC3A 3WBKA 4ZI3A 2ZE6A 1S9DA 1U0HC 3NBYC 1N5JA 4IDPA 1FP7A 1KMHB 2W2XA 3L2OB 4U00A 2V1UA 5KNBA 4AG6A 1NVWQ 1N6NA 4HB2A 3KB1A 4RD2A 1HA3A 4OHYA 4B6EA 2QT0A 2ZYUX 2C95A 4FIDA 4PTLA 1XD2B 3N2IA 5F9HA 2A5JA 3B85A 4Q66C 4N0EA 2IYSA 4DUGA 4QJ5A 3SI7A 1QG2A 5KDOA 2QAGA 1MOZA 1H8HD 3WP1B 3NDPA 4IEEA 1NN3A 1UDXA 2QPOA 2W2TA 3DM5A 6Q21A 4Q7MB 4KV9A 1NLYA 1QHXA 3TSZA 2OBLA 1IOZA 2Q9AA 4V0MA 2RAPA 3IILA 1E0KA 4FXPA 4QGAA 2HEIA 3V00A 4UXHA 4TTRA 1XEWX 2FPKA 3BGWA 4M2LA 4C2TA 1UBGA 2A5DA 1MO6A 2D62A 3T34A 1US8A 1XTIA 2Z43A 5KPJA 3NC0C 3EIQA 2OAP1 3I32A 2WBLC 3BFKA 1YHNA 1AKEA 1E2FA 5EXXA 2ZU6A 2PZFA 5H70A 2V3CC 2FGKA 1SXJE 3EAQA 5DYGA 3IQXA 3BORA 3T5DA 2Q6TA 5TDHA 1OXXK 2GF0A 2IYRA 3ASYA 1WB9A 3SYNA 3TSWA 4LBYA 1KI3A 4MRSA 1NBME 2NMVA 1OYYA 1JR3D 4IDQA 3K9HA 4ESVA 4P4SA 4AURA 1RE0A 2PT5A 2V8OA 2L0XA 3LO5A 4JLDA 2XJ4A 4OYHA 5C4GB 4YQFA 5B30A 3GLHB 1G6OA 2QN6A 5DH9A 2QPTA 5DSZA 3SBDA 3X1ZA 1C9KA 5AJYA 5J5CA 1G1MA 2V6IA 3I1FA 1M2OB 2OFWA 1YZKA 4Q03A 2CMKA 5AUPB 1SVLA 1Y63A 4V0NA 5JHHB 1RJ9B 2HYIC 2X77A 4Q1DA 2PH1A 1AS2A 2IYZA 4S2EA 2QMUA 3WNDA 1BMFD 1S1MA 3WMEA 4OI0A 4C0JA 4CEIA 3CNOA 3QF4A 2GETA 2CLCX 2BMFA 1G64A 1IN7A 2ZTSA 5FUYA 3SFVA 2C2HA 1SVKA 1U98A 1M34E 2PX3A 3JZAA 2FX3A 3H0KA 4QG7A 1IN4A 4R7ZA 3BAFA 4MRPA 4MUBA 2AXNA 1N25A 3ADDA 4NU0A 1G8PA 3K8YA 4A8JB 3ZQJA 4LSGA 1FOEB 1MO3A 4RD1A 5HCNA 3EPHA 2CCGA 4A0HA 3HYRA 1F5NA 3AVUA 3IHLA 1RRGA 2ZRMA 4M22A 3WYFA 2GESA 3W8NA 1G8YA 5DIFA 1FP6A 3UWKA 5EP4A 1II0A 1KSJA 3L8YA 3ZJYA 4DKXA 4DLSA 2RMKA 2IEZA 3J81k 4ASUA 521PA 5K8IA 3NH9A 3Q5EA 5CIQA 3W6PA 1DS6A 2FFQA 2J9RA 4CEHB 3PG5A 3BD9A 4MGYR 1N6LA 4LV5B 4RCYA 4C0KA 4TYNA 2A5YB 3AVYA 1KK1A 4C7OA 3DM9B 4GZMA 5J4YA 3ZDQA 4BWYA 4OK6A 4DCNA 4HLUA 1LNZA 2R65A 1Q1BA 4D4LA 4DCTA 4YXWD 3LVRE 4Q1AA 5CITA 5K8LA 4A15A 3U4QB 1Z47A 1TEVA 4D26A 2R8RA 4PSVA 3X1DA 1R0WA 3EZ9A 2ZSFA 4OQFA 4QBHA 3TQFA 3I5YA 1CU1A 1P7CA 3NBFA 4M1SA 2IHBA 2YOHA 1GITA 4OK5A 4JZKA 1R6BX 2ECKA 1XMIA 3MLEA 4KSBA 4TLEA 2BIFA 2Q3FA 1KI1A 4Z1MD 3MAAC 1W36D 3QNUA 1S4QA 4BFXA 3PUYA 4RKEA 4L8GA 2XOKA 5IDVA 1IN6A 2FOLA 1XD2A 1ZD8A 1FQKA 1NVUQ 2PZGA 4GP6A 4MDFA 5JMTA 3PEWA 2QRNA 4QHTA 4NP6A 3KJIA 1ESMA 1DPFA 1KI2A 1JJ7A 4PC1A 4UKDA 4B47A 1A5TA 3SJBA 3CLVA 2EFDB 4EPWA 3A1SA 4XWAA 5IHPA 1E9DA 4OHWA 3ICEA 2ZM5A 2Z6VA 1MRSA 4BQSA 4MGZR 1MV5A 4IVPA 3OF5A 2R62A 1QRAA 2EWWA 2UZ3A 4O2RA 4CIDA 2GAAA 4NH0A 4HUTA 1S0UA 2F3RA 3PVSA 3D8BA 2DFKB 3AGPA 1Z6XA 2JLSA 3TAHA 4TYQA 4HAZA 2J0VA 1LW7A 2ZEJA 1VG1A 4JL5A 4TMTA 1OLOA 3GEEA 2FN4A 4HB0A 5FL7D 4EPTA 1ZM4A 1VIAA 2Z0MA 1PJRA 3FYHA 1KI8A 2CNWD 1F2TB 3F3YA 3TJZA 2DR3A 4R9UC 1UKEA 4KFTA 5SZHB 3EARA 4MKGA 4BE7B 4AIIA 5CK4A 1UM8A 1VDZA 1ZC4A 4DLUA 1DARA 4D0GA 4IDNA 2WWYA 1NN1A 2ZXUA 3AEZA 3PEVA 4EPYA 1KHTA 2BMDA 2OESA 2V7QD 5KO2A 2QORA 3GFPA 3HP1A 3W8RA 1Z0JA 1ZM7A 3AGQA 3IBGA 2QE7D 4RD6A 3TLXA 2HUPA 2ZS7A 3GD7A 4F7WA 1UPTA 3NTUA 4NCNA 4R2HA 3HU2A 4PQFA 4G1UC 2LCFA 4FCWA 5JLJA 2BBSA 4RZXA 4GMDA 1RYFA 1GFIA 1NF3A 1KDRA 2JLVA 2WSSA 3K0EA 3RRNA 3H1TA 3VHLB 3VAAA 2DB3A 1VG8A 2I1QA 4D6PA 4JJKA 2QRZA 1Q57A 1KI4A 2ONKA 4UNSA 5DNYB 2H16A 1R0XA 4URWR 2ODEA 1AGRA 2ZJ5A 2ZJYA 4P4UA 4A36A 3C14C 1PUIA 4GOXA 2GNOA 3I8SA 3KUCA 3OEED 1U9IC 5DN6D 1DAFA 2ERXA 3PUXA 2GJSA 2VHQA 1VHTA 4Z8YA 3GFTA 3RLFA 5KYKA 1DAMA 1W1WA 2V1XA 4KXFB 1N0UA 1SZPA 1G8HA 2PMKA 4G5QA 4D25A 2J46A 1SVMA 3EA0A 1Z08A 2H92A 3BB4A 2FE4A 4KFSA 4HDCA 4Q7KA 2B21A 2C77A 4TLDA 3AF1A 3MSXA 5FR2A 4BFWA 1P62B 2WWIA 2CK3D 2IYWA 5EE3A 1E32A 4IVQA 5D3QA 5FBWB 2ZUDA 3U3OA 1W4CA 3ZVNA 2BOVA 2ZR9A 3CIOA 3KTAB 2W00A 1IAQA 1A2KC 5J4LA 2NQ2C 2O52A 4JIMA 4OKSA 2XX3A 1UBCA 3W6NA 2MSCB 2WM9B 3LW8A 3RNLA 4NPHA 4TN1A 1VPLA 2JJ1A 4M1KA 4F38A 3G5UA 4LJ8A 2VQSA 4NYMR 1D6JA 4MUAA 1FNNA 4AC9A 1ELOA 2YVUA 3LQRA 4PZLA 1OH6A 3C41J 3EASA 4LC1A 4MGIR 5AUQA 4PHTA 3GPLA 3VNVA 1QHNA 5FUVA 2HDNB 2KWIA 2X8AA 1A2BA 1Z6AA 4G0NA 2OE2A 4B34A 5E7MA 2P6RA 2WAYA 1TQ2A 1WXQA 1B0UA 2YC4C 1NJFA 5C1BA 1RRFA 3TK1A 1JXOA 2GF9A 2GRJA 3GJXC 3GJ7A 2IX3A 1EX7A 1X8KA 1IONA 5LB2A 2O8CB 1XMSA 1EFCA 3DOEA 1SXJA 2FZLA 1NI3A 4AY2A 3FHTA 3PEYA 5FPSA 4PO8A 4N3NA 4UXJA 1HE8B 3R20A 4JBYA 5KOYA 1LFDB 4IOKA 1OW3B 4LJ7A 2A5GA 3CBQA 1DAIA 2A7QA 2UKDA 4RZ2A 2HLDA 3EWSA 4XSHA 4EFMA 4HDQB 4RY2A 3AF3A 1XBTA 5JWRA 1XP8A 2C04A 2GJ8A 2CHVA 1D5CA 3K0AB 4OI1A 5JJIA 1KZGB 5JS8A 1ZNWA 1EFHA 4WXPA 1RYHA 5TMPA 4KVAA 4II7A 1X6VA 5SZJA 2EWVA 1F2TA 3A4NA 3P32A 2FEOA 2FSFA 4NCIA 1HY3A 2XJ9A 4IXNA 5EJEA 1W0KD 3PITA 3B5JA 4TYPA 3NKVA 2DHRA 4Q21A 1P2TA 3SC3A 1ETUA 4WZAE 5DI3A 1G16A 2FFHA 3BRWD 2ZRHA 3UK6A 2A78A 1QZXA 2GCPA 2KI5A 4Q4HA 2QAGC 5DISB 4A2QA 5JSZA 3MRSA 5EP3A 1OKKD 3VR1A 1LB1B 3CZPA 1IM2A 3OAAA 3WRXC 3DMDA 2VH5R 5EE1A 1AKYA 5FR1A 4RJLA 1OXTA 4B33A 5KUTA 2J87A 3QXSA 2Z5FA 1IBRA 4HATA 1OXUA 1E0AA 1NVVQ 2WWHA 3H2YA 4FD2A 2QNRA 1II8B 2EYQA 1WRBA 4NCKA 5HKKA 2FA9A 3O8RA 2J1LA 2YWGA 1OPXA 5H8WA 4TLCA 4C9BA 3A37A 4K81B 2VHJA 4V0OA 3ZD7A 1V5WA 3ETLA 2OCAA 1ZCBA 1P9RA 2CDNA 4DDUA 2QMHA 4NCJA 1X3SA 4U7DA 2JLRA 1AS0A 3EC2A 1G4UR 4JLBA 2VA8A 3TIFA 1KGDA 3DZDA 1ZD9A 4LGMA 4US1R 1G7TA 5J4HA 3KFXA 2MMCA 4G5SA 1JJVA 5CLLA 1G20E 2QY9A 3CPEA 2Q21A 4ITRC 2P5SA 1J8MF 1M74A 2C8VA 4QBGB 4RVCA 2QBYB 1YE8A 4Q1CA 1DO0A 2N42A 4URZR 3W5IA 2F3TA 3PFIA 4RD4A 3SR0A 2OBNA 4ZDJA 4JMPA 1HH4A 1UFQA 2OHFA 4TQ9A 4PHHA 2ZSBA 3C16C 4A6XA 2OO7A 3JVVA 3AB3A 3CPJB 2ZVPX 3ZZTA 3RS5A 1GWNA 3QXXA 2GCOA 3B1YA 1OV4A 4KLZA 1G19A 2REOA 1SGWA 3IUYA 2KSQA 3BH0A 2Q9BA 4B3DA 1EFRD 1XJ0A 3W6OA 3KTAA 1RRCA 4W5JA 1NVXQ 1XCPA 2B6HA 3T12A 3P4XA 1LTQA 2LKCA 2EFCB 1TQDA 2R6DA 3SEAA 1KO4A 3UMSA 1N6HA 1E79A 1PUJA 1UKYA 2FEMA 4MYCA 4QBIA 1JPNA 2VSXA 5TVKA 4ZIRA 3K09A 2ZAMA 4H9GA 1NKSA 4R71A 1ZAKA 3X1XA 3WY9A 5L3VA 1P61B 1M7GA 4Q9HA 5LD2C 2XXAB 1CR2A 1CULC 3U44B 4LY6A 1E2PA 4DC9A 3QPWA 3NXSA 5F98A 3KDSE 1CF4A 2VBCA 1IXSB 2QQ0A 4LRWA 1CP2A 2HT6A 1OHHA 1F6BA 2P0EA 3KJEA 3A1VA 4JSYA 2DFNA 4LJ6A 1P2VA 1E98A 4QNRA 4FMDB 4ZDKA 2C9YA 2WZQA 4Q19A 1OB5A 4QL3A 4EJSA 2O8CA 1JEEA 1KDOA 1NP6A 1E2DA 2NO0A 4JKIA 3KXKA 5FTNA 1KTVA 1Z2CA 3W3AA 4TZ6A 2J41A 2C03A 4URXR
chains in the Genus database with same CATH superfamily
2O0LA 4QGGA 4WZAB 3WLMA 1Z88A 3M5CA 3IODA 1XTSA 4EHKA 4MZXA 8ABPA 1AO0A 2IBTA 4WINA 1DQSA 1G8SA 3COZA 2I78A 3VZCA 5K0JA 4HDNB 3I8OA 3UG6A 5KJCA 5P21A 2VTVA 1D1TA 1SUDA 4LZNA 4E32A 4YRBA 1EFAA 1CNEA 3BS4A 1CLUA 4YRIA 4KQIA 1L9KA 1MX1A 1T4MA 1GQ2A 1ZUNB 4PG6A 1BFDA 3OBBA 1VMAA 1FJ2A 5EUCA 4B35A 1KS2A 3QEMA 2R6AA 2Q2QA 2L82A 3MINB 4B2LA 2LKDA 3E3NA 4EGFA 1DC3A 4WOJA 5K8UA 2VP0A 1VLJA 3WHKA 1EU1A 3QKSA 2OZEA 2Q4TA 1P7VA 3MVEA 3DPIA 3DEHA 4H2DA 3U4GA 5HFNA 2IPNA 5AW5A 2JGDB 1U2QA 3D0QA 3DUFA 1Z56C 5K05A 1AJEA 1KY3A 1I5RA 3GOHA 3QBJA 1E9BA 2OXEA 2MIIA 4FWIB 5FLEX 4HEA6 1OX6A 2LCIA 1JIJA 3EOAI 2QE6A 3PUZA 3FKSA 4X60A 3O8BA 4IDCA 1NMXA 3OF3A 4IZHA 5FLKA 4EABA 1QONA 3G2HA 3B12A 2IODA 3NMUF 3TVDA 1HG0A 3ROGA 4X9XA 2NVUB 3V1MA 3G7UA 3L02A 4FHCA 1ZU4A 4LE2A 4FFBB 1FX0B 1P72A 2Z8ZA 2G5CA 4JVLA 4KVGA 1YZNA 1CRLA 1HE4A 5FX2A 1E3WA 2FGJA 4UBIA 2IY8A 5DWVA 1J5EB 2O54A 3Q8WA 1KQGA 3PXEA 1BKDR 3NFYA 5HZMA 1NNSA 3T1VA 1XZJA 4FNAA 4UHDA 1XTUA 3ZE0B 3Q72A 2GD1O 1K8QA 5JCJA 2IXFA 1ZJ6A 1JHPA 2EL9A 4GT1A 2A1UB 4F4JA 1WD7A 3RTDA 1W4AA 1ONNA 3P9IA 2BI8A 4QUEA 4F45A 3O1LA 3NHLA 3T35A 4L5IA 4N5IX 3KLBA 1ETHA 1YVDA 1A4IA 3KV1A 1B74A 4RVDA 4X8OA 3R5KA 3TM4A 4IUDS 3IP8A 4Y1EA 2DZDA 2IUUA 2OCYC 2ZBPA 2ZPAA 3GDOA 5JEDA 2FG5A 1UBTS 4B3FX 4LC9A 2VAPA 2L18A 3K9GA 1AN0A 1R18A 4CI9A 3AZOA 1UR5A 3IS3A 4ZZ2A 5JS6A 4WDRA 1O6GA 5AOVA 3AR3A 5TS2A 1LF5A 4ZVQA 3C3WA 5FOSA 1YR8A 1CY2A 2J45A 4Z53A 2W0SA 3HE3A 3OCZA 1VB5A 1GILA 2W4IA 1LX6A 2H9IA 3MWJA 1T2VA 1J1ZA 4OHCA 2BVNA 4D8XA 1XA0A 5AW3A 3T5PA 3TR0A 1VYUA 1Z6GA 2Q1WA 3AR6A 3LC7O 2ZS9A 1W52X 3NT4A 2CNDA 5IDQA 4OG2A 1F8YA 4HX5A 4OQDA 3AKCA 1VRWA 2BCGY 3GHYA 3INYA 4KDFA 4MUFA 4O2BB 3FYTA 4OSOA 3NVAA 4P81A 3V2UA 5DTIA 4HMOA 4BBZA 3DMGA 1M10A 3K35A 5DWDA 5TQ2A 3RYTC 3ZZMA 1B8OA 3IELA 5KVQA 1SBQA 4KI7A 4NDNE 2P4QA 1GU0A 1OC4A 1N6PA 4FINA 3RJ5A 1TIPA 1X86B 2BFPA 3K4QA 4J16A 2MSWA 5LXTB 2IHKA 4KE9A 3VPXA 1U3CA 5BQOA 1T9GR 1UEJA 5I47A 1GGJA 3NCTA 4J0HA 5JNUA 1AQUA 3NR2A 4YS6A 3KKOA 2OBXA 5DYTA 1GN9A 1TQHA 5LZ9A 1GXSA 4QYMA 5JAHA 3DFUA 1JA0A 1UMBA 3AIMA 4HTFA 4Q48A 1YIOA 2RB5A 3ABRB 4I5DA 2SKCA 2AOXA 4LQ4A 4NBTA 2QYSA 1MRZA 1WXFA 1HT0A 1NRXA 3EA5A 3GFVA 4TKUA 5JG7A 1SULA 1KYWA 4RF4A 4C2AA 2EZTA 3OCJA 1PZHA 1YU9A 1P31A 4LZOA 4TKVB 3QPUA 1F6DA 1DTWB 4GI2A 3SMVA 2YIVX 3PUVA 1E1DA 3F90A 5TARA 3SQOA 5C1PA 3W5VA 3DEJA 3F0TA 4GYYA 4KE8A 5LZ4A 1GNRA 1Q84A 1JSZA 3L1IA 4OFWA 3ONWA 5E4JA 1N57A 5B37A 4WOBA 2YJ6A 3DS8A 3VR6D 1U28C 1CUDA 2ODWA 4FMDF 1NC3A 1SUWA 1R3DA 1SHUX 2GD2A 2R2AA 3JAKA 2HCJB 4IZIA 4QOFA 4BFVA 4DVGA 1Y48E 2GB4A 2BKAA 2B78A 4O4LB 3BYZA 4BJ6A 1CUEA 2QENA 1N6KA 5KX5A 1EQUA 1SOUA 2DHQA 1IZ7A 3TZLA 3SWWA 1JDSA 1P1RA 2PSHA 1DOAA 1UBHS 2CNBA 4A8PA 1YAJA 1ORVA 3WBFA 3OT4A 2G36A 5JXHA 5JSHA 5FTKA 2UZ0A 3HEAA 3UW1A 5CFRA 2ZRLA 1SXPA 4IFTA 1NBMD 1W94A 2PX8A 3DTTA 4ZT2A 4Z4EA 2W6JD 1BFUA 1AGNA 3FZYA 3AIOA 5AXCA 4HGZA 5HK9A 1GL6A 3NXKA 1YJXA 4ZREA 1TMOA 3FCYA 2J4CA 4MYRA 4BU0A 1JHYA 1OH8A 4PHFA 4UCQA 3W4JA 2ROQA 2QX9A 2WJJA 4FLEA 3CWCA 4B3SB 3TGPA 2PXHA 1GZ5A 3OZVA 1C30A 4BLQA 4QECA 4DIDA 1PR2A 1RYDA 5IF9A 1EUDA 1O9BA 1PIWA 1NV8A 1I2MA 2YY5A 4S12A 2C98A 3W2TA 2H8GA 1XNGA 5IJXA 5LP6F 3I9V1 2AMFA 1RAAA 3TJMA 3EC7A 2DLNA 4HN4B 5ADHA 5AHRA 1ITZA 3RRZA 5PGMA 4CETA 2FKAA 3I04A 3SLGA 2JD2A 2NQTA 3HLTA 1YBVA 3CF6R 2X5JO 3SAJA 3LZDA 4AK9A 2V58A 4OO3A 4KCGA 2HF7A 1CUHA 5C7IO 2NIPA 3MD0A 5KNCD 4ZVOA 1K68A 5H59A 1D9ZA 1EAYA 3CW9A 3EY9A 1D2NA 4YRLA 5HS4A 3E7PA 2IZ0A 2OAEA 3M8KA 3SBEA 2AT1A 4PC7A 3A25A 1JEAA 1VBFA 1VE9A 2WJAA 4RHUA 5BW4A 4NESA 5TJHA 4G0MA 4ND1A 3MBOA 3WL8A 4BLUA 1CE8B 3BICA 4MIEA 4HG2A 1N9KA 3EXHB 3LIIA 3RVMA 4B09A 3T3IA 4BB6A 2WF5A 2DPXA 3R6WA 2WHXA 5J9FA 5GQSA 4FZ3A 3ZLUA 2M98A 4WW0A 4A6DA 2Y2UA 1SPBS 3FWKA 3IULA 3PLRA 4PFJA 4Q3CA 3OZWA 3UMRA 1JSLA 1PLKA 2GH1A 3BF7A 4D9KA 2AD5A 3PDUA 1AQYA 4X1YA 5BVGA 1Q22A 5A5GA 1PJAA 3LH5A 3UENA 1DXOA 4JQCA 1AZTA 4GRIA 2VQEB 2QEQA 3PQ4A 5CEJA 3MMPA 1O9HA 2WE7A 1PFUA 1X1EA 3E35A 5AOAA 3IVCA 3R7LA 1E2QA 3TB4A 3V2HA 1VQ1A 5LQCA 3H6GA 5HMMA 2PKEA 4YRNA 3WGJA 3R9XA 3L7MA 4AI6A 2XBLA 3O8OA 3WYNA 3Q1KA 3PQCA 3O3NB 4Q3OA 1VKRA 3H16A 4MJXA 2GDZA 4WBXC 3DZCA 3JAWB 1HYHA 3NWOA 4OREX 5LVAA 2RAFA 5K3BA 2C31A 2VEOA 4BIMA 4H7HA 2WP8J 1FFHA 3CSSA 5C8VA 3O0DA 4ARBA 3W5DA 1JWLA 4JVOA 3ZVKA 2W0MA 4DYHA 2VT3A 4M1WA 4LMPA 3WDSA 2GR9A 1INLA 3IAS1 4FNOA 5HDBB 4OI4A 3TDMA 3WDLA 5H3LA 4BBAA 4ROTA 4Z54A 4H7FA 4UVEA 4AZTA 2ZE5A 4UM9B 4N6OA 3T7DA 4BDTA 1KMHA 3M6VA 4X1IA 5D00A 1BXGB 4Q1EA 4B71A 2E82A 2C83A 2O57A 2RGBA 3IUMA 5LQNA 2I6FA 3H5RA 1I4WA 1VHJA 1ZD2P 1Q1NA 1KIFA 2NVBA 4F3RA 2DR2A 2YFKA 3IRUA 4ZAGA 3RAPR 1AXGA 4C0QC 3IE1A 2BTQA 4M87A 4HAUA 2A0FA 5CLQA 4ZYZA 3MCAA 1E0JA 2P2LA 4ETMA 2IKSA 3IE0A 3FYCA 4HOYA 5IKMA 4D2IA 1Y37A 2W6NA 3LQYA 5E9JA 3ZWKA 4BWGA 4CR8A 3F5DA 3F1LA 1T1EA 3LX4A 3MJ4A 3L0OA 3O21A 1W0JA 4YQEA 2V6JA 2BP7B 2G9QA 1QH8A 1X7WB 1QCCA 2ZBVA 4JOCA 2OXRA 4KQJA 5A4IS 3ZWNA 1YZTA 2TSYB 4GBMA 1Z73A 4GZ5A 5IKOA 1BXZA 2QAJA 4I3FA 2TMDA 2F3PA 1W7AA 1XCGB 3NTXA 3U1VA 4EKNB 4KYUA 2B4TO 1JAZA 2EP8A 2Y0EA 1L7RA 2JFQA 4Q4AB 3BMQA 4JLUA 4P58A 3E4DA 5IC4A 2D2IA 3HFRA 4XSGA 1KJ8A 2H4JA 4P4GA 1GN8A 3G1WA 4E4TA 4ZI7F 2VDQB 2X13A 1Q17A 1N4AA 2ZREA 1NR7A 2EFYA 4QGBA 2F1HA 4RHCA 2VIIA 1LPAB 2AZDA 1T0JB 3JQGB 4TRJA 4WHMA 3WNCA 1O95C 3WLIA 2F62A 1OFGA 3CRRA 4KH0A 1KL7A 4ZCTA 3O4GA 3S28A 3UJ6A 4OHVA 4JSTA 1RYMA 4KO8A 2NPFA 1IWOA 3BMOA 4BXOA 1YDHA 1T6XA 4H1UA 2YCBA 4QICA 2GK7A 1AA9A 3O8NA 1GSIA 1CUGA 1HE3A 3DR3A 2IW1A 1KKLA 2YOGA 1YKFA 3I5MA 4FR2A 4OXYA 3UKDA 4ECEA 3V8RA 5AVZA 3QLEA 1ONOA 4CLOA 1KH2A 1JJIA 1MJNA 2XLCA 3AK4A 3ONVA 5EQJB 2IHTA 2BGJA 3P0EA 1QG6A 1ZIPA 2I62A 1AKWA 1TF2A 1AGYA 2QL5A 2TMGA 2P90A 3DFMA 4FFWA 4L7QA 3FSRA 3TLAA 3TUIC 1NUAA 2H1IA 2QN8A 1KR5A 3QVLA 4N54A 4W5QA 1PT7A 3R6DA 4ZO6A 4EB3A 4F1KA 5ICGA 1OAAA 5CLGA 5BR1A 4TMKA 2BR5A 3K09C 3M4YA 2A58A 4GPZA 3NNNA 4OHBA 4XDYA 1M2OA 5DGCA 4MYHA 4IP0A 2O0KA 1EK0A 2W90A 4DW8A 3D0KA 1VRCA 4UQPA 2YMPA 2D3WA 3N8DA 1LQTA 2WFLA 2ST1A 4MRRA 4JJGA 4OJKA 4WAUA 4DY4A 4L0DA 5G3ZA 4QYWA 3ECCA 2HA5A 1FF9A 3F5FA 4IGEA 2HLPA 4O2AF 1D3AA 2WJVA 3EH2A 4IQ8A 1ZMXA 4D3XA 1ZR4A 3TNDA 5JI3E 3C6KA 2ICAA 3LD9A 5LOVF 1FUYB 1KFKB 4HP8A 4D3SA 1Y3CE 3R5TA 3RUHA 5HX7A 4EG6A 1UPAA 1FYWA 3PCRB 1IC6A 1RXUA 3B1ZA 3RROA 5AVTA 1YHZA 2MDTA 1YR9A 3RANA 3QVOA 2NU8B 3HLKA 4E13A 4N65A 1OQAA 2BHRA 2ZZNA 1LCIA 3ANMA 3Q85A 1GU7A 4U7WA 3FTEA 1RBZA 1Z4IA 2HV8A 5IRCD 2W2KA 2H5EA 2VHEA 2SKDA 5REQA 1OVMA 3S40A 1CJUC 3FNHA 1C8VB 4I14A 4ZVPA 3W5HA 2NXEA 3M1LA 4A8JA 2JCGA 3KEGA 1LH0A 3LP5A 1JXQA 2FMUA 3QWBA 3GMIA 4HVAA 1JAHA 2NO5A 5EOVA 1FQOA 1SU6A 4GKVA 4HFNA 1KQ3A 2Q8QA 2ZJ6A 3VI3B 5HBGA 4HT3B 4DV5B 2OWDA 2ODAA 3ZZ0A 2Y1FA 3R2JA 5KHOC 3I39X 2BTEA 4L6CA 2PRIA 4LHVA 1HK7A 4UJ5A 3ZD9A 2V9PA 5DDIP 3FWYA 1BMTA 5JS7A 5HF9A 5KC9A 1Y1RA 3G5AA 4XKJA 3ZDYB 4CEHA 1Q0RA 4W8HA 1EGVB 4H6XA 4LF6B 4BFUA 4G2TA 1Y8QB 5J58A 2JLXA 2JD0A 1RQ7A 3FDXA 1WR8A 2YNMC 1H6BA 2ZAGA 4J1TC 5T4EA 4D9EA 2HSZA 1VKNA 4MTLA 2K6GA 1QGUA 3N0VA 3VJKA 5AW0A 4CF7A 1EGAA 4Y6SA 3SSOA 4HF7A 1GRNA 4D9CA 2UXBB 4F5YA 5K3FA 2JDID 2HDHA 3K9WA 3KQMA 1U0SY 4LSZA 5IH7A 2FK7A 3GP3A 3CEJA 4MVJM 3ROEA 4LRYA 1V48A 4ABYA 2V74B 3G2IA 1UP4A 4LRXA 1HLDA 2LR0A 1ZO8A 2FSHA 1GDHA 5JH7A 4M1MA 1AQNA 5B3LA 3IAUA 3GAAA 1GL3A 5JCPA 5L8VA 2H7YA 1OIXA 1L5OA 4KQWA 3DD5A 5C46F 4E2YA 1AGPA 1JNXX 1GA4A 1EFUA 3LRPA 2PGJA 5AWFC 3QBEA 1TT5B 2OGWA 1E60A 2AN1A 3U7FB 4JS0A 4K88A 4HDKB 2HPVA 2V0NA 2ERYA 3SHWA 3ED5A 1EE9A 1XF9A 3OA2A 1S5PA 4MP3A 4WA8A 4WLUA 3PD7A 4GHWA 4U6QA 4GNKA 3OH8A 3PKJA 3UT5B 3ZWPA 1PSDA 4PR0A 3JYPA 2YV5A 2AI2A 2ZRNA 3EUWA 4V39A 4XRRA 3OTWA 5JH7F 2AYXA 3BSFA 2CXNA 4Y0VA 5C0OE 3VVLA 2QTVB 3TTUA 3QQ5A 1E9AA 1R10A 4N5HX 3AONB 3B6EA 2WHQA 3QW2A 5EWLA 3U4AA 4C4YA 3VQTA 4D4JA 1ND6A 2W2LD 4PXYA 5A1JA 5AKLA 5JQWA 3HYNA 4YH1A 3RIEA 4HVTA 5HOEA 2GSWA 2JFPA 4MYUA 1KJIA 5HZKA 1N1GA 3PFBA 1Q1ZA 3ILYA 3E9QA 4TMYA 1SKUA 3SIRA 1FRFS 1GM5A 4NAUA 3PL5A 1ZVQA 1H65A 1YZHA 3NHUA 4O0MA 1TAQA 2WKSA 3HB7A 4NULA 1SQ5A 1LXCA 4J90A 4B84A 2NQ8A 3H1BA 3SF0A 1U2ZA 5BT9A 5AKGA 3KZKA 4LHYA 2VSFA 2AVDA 2ZULA 3X43A 3UPTA 2ZB2A 2CVPA 5EPOA 3IAFA 3EE6A 3IKMB 4Q05A 1TNDA 4P36A 1K0FA 4HBZA 3A9VA 2WIJA 5HA5A 3VDXA 4WBNF 1Y5IA 1H9AA 2EDAA 4G4IA 4MWGA 3RT9A 5AM3A 5AJUA 2WSIA 5WRFA 4UTOA 4E22A 1QHHB 4ZQGA 5BSFA 3T9EA 3MCWA 4EELA 2GXAA 4CIXA 2XY4A 3B53X 3F6RA 4U2FA 4F6RB 4NC9A 1U7ZA 3G13A 2YWEA 4AN0A 1DAPA 3BL5A 1VCIA 1J33A 3VX3A 3AM5A 3FBTA 4WLOA 4NJMA 2H4YA 2VDMB 2JBWA 4Z3OA 1S89A 4EECA 4AKTA 4FB5A 2NUAB 2XMRA 4MS4A 1AU9A 1G18A 1C41A 1W9HA 3DT9A 4EEZA 5IJWA 3ZD6A 1JQ3A 2XE4A 4PC6A 3U4DA 1IDOA 1VFNA 5FBHA 5FOVA 2IH5A 1HRKA 3FYUB 4GG1A 4S1VA 4H3VA 4NE7A 3HXKA 3N75A 4MUXA 3IPCA 3JV7A 2Y05A 3RSLA 2ZUEA 2VJQA 2Y0CA 3C3CA 1YZVA 3NT2A 3AHFA 3OJOA 4HRYA 3PNOA 4DSOA 5KVCA 1AV7A 1HNWB 4QUJA 3LUHA 3BAZA 4CM3A 1XD9A 2ORVA 1QPZA 3FHOA 4X6YA 1DC6A 3VPGA 1PK7A 3UXMA 3WGNA 2SHKA 2H5IA 4OPMA 5BXYA 1U1GA 4IMRA 1T10A 1ODSA 2XYHA 4HFMA 4Z4IA 1VSQA 2MSNA 3BXFA 4JT2A 3RS4A 1KJZA 3UTCA 1NXTA 2H0RA 2GK3A 3O2QB 3OJLA 1FTWA 4RORA 4TVKA 3L0ZA 3QOWA 4B3HA 4URFA 4F4FA 3PHBE 2PCLA 1CQXA 4KKVA 4PLTA 2C4WA 1FZTA 1KAQA 4PHGA 3LWBA 1EWRA 1E9RA 5M04A 1IY0A 3QE3A 4C01A 4JR1A 4PLYA 2OECA 4YONB 2WLTA 4EATA 4DA8A 3NP7A 1M2EA 3C7TA 4ASUD 3KQKA 1N32B 3ZNNA 1ATIA 4UOZA 3MK31 2AR9A 5KB3A 4KXXA 4HSEA 4LVCA 4RK1A 1XTRA 5ES3A 1UINA 5TVGA 5CFQA 2RGYA 4MGHA 5K5EA 3VC2A 1NE2A 1NXOA 4ZQHA 3EVCA 4NFLA 1I0ZA 1HEIA 4NK4A 4JLNA 2QHXA 4J7XA 4EH1A 2VNKA 3VR4A 2FZ5A 3VR5A 3NGXA 4EFLA 3JQCA 3I6IA 3NOQA 3DSRA 1T3SA 3THWA 1SD2A 4TYYA 4KU4A 1Z0KA 2ON6A 3MUFA 4JYAB 3BCUA 4JJ4A 2ZATA 2ZSIA 2YYZA 1OILA 3SBOA 2JHPA 1YA4A 3GX1A 5JTTA 5LYJF 2UYCA 1MVOA 2HI0A 1I4LD 3E7DA 2VQ3A 3RU9A 1DIOB 1N75A 3RT7A 1NWCA 3OQHA 4PFSA 1N8NA 3IBYA 2Y1WA 3L8FA 2KMLA 2YV4A 4GGPA 3GLGB 3RC9A 4GRAA 2P11A 3HCBA 2OPBA 2X8JB 1XZGA 2IS6A 1PKXA 2P3SA 4BRZA 4ESVA 1UOEA 4J6FA 1EK6A 1P9NA 3U4HA 5CDFA 3EZYA 3RSGA 3VPDA 1AHIA 2C2GA 4TXHA 4ZCRA 1QH1A 2ZUWA 2Y92A 2YDXA 4E5NA 2YYSA 1J9GA 1GNPA 2NO1A 1AQJA 3LQ4A 1PEYA 3ROMA 3ZX5A 1FQJA 2Y93A 3L18A 1QHSA 4G5XA 4FK8A 1RKVA 3SXPA 5CCBA 1W49A 2Q28A 3D5TA 5L95A 1BIFA 4AG3A 3UFXB 2YQ5A 4LF9B 3EG9B 4C03A 3AFHA 3BTSA 3A7DA 4IV5A 3ZGVA 5FA8A 4PYIA 1T6NA 5F5LA 2XTAA 5DM70 4CMIB 3CT4A 3FAKA 4R1TA 1SCJA 1WQ3A 2XXJA 4H60A 4DHEA 1KMIY 3F8TA 1W59A 1X0XA 2GILA 4JI6B 4YX9A 1N5KA 1FC0A 1IY2A 4HWPA 5B53A 3QV1A 2PH5A 1UQUA 5A02A 1UANA 1UMCB 2VI5A 4FBLA 5CLFA 1L8OA 3C48A 2HOQA 4I8XA 2IYFA 2IA5A 3EZ6A 4Z0HO 1Y5LA 3HJRA 3OCXA 4YA6A 3W5SA 3EFHA 2WWVD 1EBFA 2XGSA 1E3LA 4P4SB 4CTMA 1P7ZA 3L79A 2R11A 1F7UA 5LP6B 2XITA 1K1EA 4U7PB 2D0IA 4QUBA 4UUBA 1BDIA 4XD2A 5ALIA 1GLNA 1RXYA 1N92A 1EK1A 1JBEA 1QAMA 4YRQA 1JPVA 2GCGA 1R5NA 3GUHA 3LL4A 4HH3C 5AKJA 3BH6A 3ZJUA 4ARIA 3GUCA 3HJFA 3KKEA 4L78A 3LL7A 1N6OA 2FSUA 3EC1A 4X85A 1ZQ9A 1IMOA 2ATCA 2CVFA 1U2DC 2XNKA 2YV1A 2VDVE 2VK1A 3VOAA 4KPYA 3USZA 3Q3HA 5K0EA 3BD6A 2EFGA 2A0YA 1KK0A 4FT2A 3EMDA 1UBOS 1V16A 2ONYA 2AG1A 2RHWA 3OJXA 1YI8A 2TRSB 3NRCA 2AC4A 4FFPA 3HCWA 1S2OA 1H6CA 4L4UA 4YI3A 3DQPA 4DJTA 1X1RA 1HT2E 1HEYA 3EG5A 3DV2A 2AOUB 2I87A 2CWDA 3W1EA 1DINA 2GPYA 2IV3A 4YCJA 3GJ6A 5A0TA 1W6UA 2WVJA 3FPKA 1NXQA 2YR0A 3L5KA 4W7IA 4Y18A 3W7VA 1GQQA 3WJ7A 1OX4A 4S04A 4ZCSA 4EPVA 3DFIA 2DFVA 1OXBB 3NIBA 1O96A 1LTHR 1J5PA 3ACDA 3GRAA 3WYDA 3VR4H 3VR5H 4YGYA 2FAXA 2WKWA 4DLVA 2HSDA 2XEDA 4LFBB 1AK2A 4HS9A 2COUA 3U19A 2PGDA 1G7SA 2Q49A 3U49A 4GKAA 1Z4PX 3VV3A 5LR6A 4XH9B 4M9QA 4WN3A 5DYWA 5LWHA 3ANNA 2E9SA 2CHUA 2CDCA 4G09A 4NHOA 4PLZA 5DNVA 2O50A 1UK9A 3TLBA 4WMLA 2X7HA 1R4NA 1E4VA 1FUKA 3O7MA 1ODCA 2Q0SA 2P65A 4H0FA 2PKYX 1CUBA 4BFZA 2FX2A 1E92A 1T1JA 3RS8A 4EHBA 3RHZA 1Z4KA 4RK5A 1JHQA 2OFXA 2RCNA 3ZU2A 2BH9A 4C4PA 5B2EA 1QBKC 3OFJA 1TTTA 1C4KA 4KQ2A 4FIZA 5ENVA 1NVAA 3OECA 3M5WA 5JBQA 5CFLA 4PQGA 3NGMA 2PQ0A 4RFLA 4CQMB 6AT1A 3G5TA 2Z8YM 5JECA 2FOXA 5JNRA 2Z6UA 1C8LA 2IXDA 3B51X 1XXHB 4LWZA 4RTNA 2WNSA 2C4TA 3C6MA 4G84A 4OGKA 3WL7A 3C8HA 3KVYA 3PXAA 4RH0A 2DXIA 4XX1A 1XMOB 4RIGA 3RYHA 3B20A 5FOTA 3PPVA 2LUOA 4YMVA 1VSTA 4YTEA 5FQOA 4Q00A 5BNZA 4L6IA 1NVDA 5FAKA 3BB1A 5EJFA 2D1RA 3OFKA 3ZHYA 2I9KA 3QQPA 3OETA 4OP1A 2X14A 4MVJD 4OK3A 4YWJA 1H93A 1G2QA 2G6TA 2W58A 4FX2A 5BUQA 3HKBB 1PF7E 4CL0A 4GSKA 4NYIQ 2FEWB 4LY9A 1PGQA 4PX2A 4UU7A 2RONA 2VTEA 2A9KA 3CEAA 3LOPA 3Q3VA 5JNTA 2DWQA 3P9XA 3IIJA 2XXAA 1NVBA 2ZBQA 4MIKA 1CLEA 3FPGA 5HJ5A 1XCOA 1GA1A 3H04A 5CLIA 3ROQA 3EXHC 4L8FA 5CFNA 1O2DA 1OJLA 3KCNA 5P8WA 2Z6AA 5D3MA 1Y98A 3JZMA 3JRXA 2PBRA 1T2AA 4MYSA 2WW8A 2QW8A 3MGGA 4RY0A 5CPFA 1KZHA 5L40A 1YS9A 4NENA 1XLVA 4WZZA 3Q0TA 3L4KA 2QRLA 1YJ5A 1QLJA 1RLMA 1UJCA 2YFYA 1BJRE 5K4AA 3B6JA 4N3CA 4ZI7B 5INTA 2O8FA 1HR0B 1EP2B 1Q74A 4L8LA 4ZALA 2FWJA 3E0XA 3B3AA 5A4DA 3DEKA 2BKXA 4ARZA 1QG0A 4XYLA 3OMXA 4O1IA 4O6VA 3QX7A 1M6WA 3P9CA 4KGDA 1WW2A 4TTSA 1MMFB 3H2ZA 3GXOA 4FOOA 1MBZA 3BGIA 4YJ2A 8GPBA 1Q1QA 2ZJBA 3N8IA 4G1BA 3NYIA 4H0NA 2PWYA 1J56A 4F9EA 5BW8A 1I2DA 2IYLD 3E23A 2WJHA 3GCZA 4HMPA 4K1XA 2OG1A 1SCDA 2Y4NA 4W7HA 2ZWOA 2ZSKA 3O31A 3O84A 1PL6A 1LF0A 3TOVA 1ATZA 5ILQA 3QJ5A 3ETEA 4FE3A 4F85A 1R64A 3BXEA 2OQIA 1OAOC 1F3LA 1OD6A 1WIWA 4XJXA 4C05A 2QSUA 5GZ1A 5J2UF 4QBKA 3LBYA 1DEKA 2C92A 2WUWE 1HTWA 3ZU6A 2BTOA 1CZKA 4YAWA 1JMYA 4KMMA 4EGSA 1DOZA 5I7OA 3WLHA 3FDFA 4JHXA 5JIBA 1HV8A 4NMWA 2QRHA 4ZMRA 1C14A 1KERA 3IPYA 4B76A 3AERA 2PNJA 5I9SA 4UARA 4D8TA 1A5ZA 1H9CA 1MO2A 5BYBA 3OZXA 3DW3X 1WEKA 2H2WA 3SZLA 1ZONA 5LOVB 5C5CA 1FDUA 4EYSA 1WCXA 2JFWA 3GJ3A 1PEDA 4JI7B 5B1SA 2WAXA 4MDHA 4DV6B 1IVNA 5D5HA 1KZ7B 1JU9A 4WZ6A 4D9HA 4NBRA 4QYIA 5IVKA 3AR5A 2AJCA 3VV2A 2XMDA 4FCVA 4TV9F 2D13A 10MHA 4RHTA 4AWXA 4HNQA 1EFLA 2QVLA 4AJJA 4CL8A 2NYRA 1QHGA 3PXXA 3V4RA 3S81A 1YL7A 3HYTA 4Z0NA 3EPLA 4R40A 1E5LA 3ICPA 4YHBA 4QPZA 2PZ8A 3KKMA 3THRA 4KBGA 1E2BA 1P81A 3P4UA 4PQYA 5GJVC 4A1OA 4YV2A 1BYUA 1Z9BA 3UW3A 2QN1A 2Z9CA 1NOJA 3PNBA 2C3MA 1GQOA 5CJPA 1J6UA 1SC1A 5ALUA 1A7AA 3QKTA 4V0LA 4D79A 3LYLA 3PA8A 3FMFA 3G85A 1PG5A 1TC1A 3CB4A 5SYAA 2FQXA 1XAIA 4UATA 5BV2P 2D4AA 2C9ZA 2R97A 3BZWA 3NUZA 3SYRA 2QLMA 1J9EA 4M1ZA 1BE8A 3HC7A 3J7AC 1Z6PA 1OV6A 1E4YA 2ZK7A 4M0MA 2CHGA 2EP5A 3LIPA 3DLBA 1Z34A 1FNSA 1E7QA 2F48A 4CZ2A 2GPSA 3QG5A 1EA7A 2BSXA 2JI7A 1F51E 2XAAA 3JYQA 5AXBA 3NNDA 4ON9A 4CW7A 4ALJA 3WQRA 3AVPA 1VOTA 1IRXA 2W8BB 4LJAA 4RPIA 5KSYA 3A6GA 1U8TA 1W8DA 2HV9A 3ENZA 1YUBA 3MWYW 4FT4A 5IPFA 4I1PA 2EF0A 3F3MA 5B1YA 3GELA 4Y0NA 4RTOA 4D5EA 3U60B 1DVRA 2XB2A 3VNUA 4MI3A 3M70A 4XDZA 5T3UA 3UA4A 1N77A 2P7IA 1Q11A 4XASA 2XUKA 2W2VA 1I2ZA 3AF6A 3HTXA 5AVOA 3CSUA 3LUCA 4GMXA 1U2GC 3W05A 1DLIA 1KZ1A 2Z3ZA 3E8SA 1K27A 1P4SA 3IEXA 1TCVA 3FPLA 1MAAA 4DHWA 2I55A 4B40A 3DJFA 2OCGA 1AHHA 1J70A 1JG3A 3KXDA 3QU2A 4LYFA 4QT4A 5ERGB 3P97A 4PAOA 5KOJB 4QC2A 1B0ZA 4YJGB 2W6PA 4WIAA 3VMFA 1KRWA 2RGXA 5A7GA 3EZXA 2DQYA 4TYWA 1EWTA 1KK3A 1GPWB 2D7CA 3AW8A 5DGHA 3I5XA 1QQBA 3SXUA 4ILEA 4HNAB 2GZ1A 1B43A 3SNHA 2IJGX 2HF2A 1D0VA 1KVSA 4NONA 3UCXA 5I3ZA 3I4FA 5AD1A 3ZU5A 2R6ZA 2O8BB 4G8CA 3FD8A 3EODA 2C7OA 1QKIA 4GYKA 5IN5A 4V0KA 4BUJA 1LWOA 3AV0B 3THSA 2ECQA 5C32A 4S1NA 3UK2A 1YSCA 4BX3A 1PR5A 3JPWA 4MKRA 3DDWA 4JQSA 3H9EO 1BU5A 4OQXA 3PV0A 1QP0A 1JIKA 1Z5NA 3AYXB 1MO5A 4CRWB 2PUCA 1O5TA 3VKUA 1R0BA 2VF5X 1N78A 2DFTA 2VJDA 4A9AA 1PVVA 2O7SA 4E46A 5BQ5A 3S70A 5U9CA 2DT8A 5JXIA 1BE0A 3BRQA 2XZDA 1U1DA 3R09A 3KJGA 1PV4A 3W3AD 1CS0B 4IOLA 3NIGB 4AECA 2H5LA 4C6RA 2IF2A 2PSEA 5AQEA 1L4FA 1ULZA 2PL1A 4Q16A 1PW7A 3UT6A 2BFDB 3OFSA 2P4SA 3THYA 2B20A 5DM1A 3OCWA 1NW5A 4O4HF 3S55A 4UM7A 3KYCB 1ZIDA 3FNIA 4BNXA 2DTEA 3FB4A 4PN3A 1NXPA 1R4AA 2G0TA 4G89A 2DY0A 1C9MA 4OU5A 5LZ7A 3UY4A 3WIOA 3K2BA 3T5CA 2X4DA 5F21A 1DKRA 1P1CA 1ES9A 2HTFA 5L3SB 1PS0A 4CMBA 1IBKB 2GHTA 4HLQB 4HXYA 2VXOA 4JT4A 1HF3A 1M34B 4K46A 4C7XA 3SFZA 2ZYVX 2W2PA 1M2VB 2IFTA 4QKQA 2IL1A 2QF7A 5JDCA 4HZUA 2O2IA 3RSSA 3UFBA 3Q87B 4E5SA 1SQSA 1WXGA 2F4NA 1J49A 3NBKA 4ARAA 5JSZB 1YBAA 5KNDD 2Z6QA 3L7IA 5CB6A 4PVDA 1AB5A 2QJRA 1ZVMA 1QMPA 2M2IA 5HF6A 5FADA 3QELB 3VA7A 1QXSA 3UHAA 4MPTA 4JJ7A 1Q12A 1ZJ5A 1FFSA 1DB3A 1ZZGA 2FV8A 2QP4A 2V4UA 2KX7A 3NKLA 2WFMA 5FO1A 4BNIA 4NJOA 1C1DA 4HX2A 4OJQA 1HDIA 1P2DA 4P22A 3WKBA 4UU8A 5JAUA 2CNLA 3K70C 3WKDA 4DREA 4JX8A 5FD8A 4A03A 4PNEA 4JI5B 1ENPA 4H1WA 1H4VB 2WPNA 1VMEA 4DYDA 1XO1A 4IHJA 4YEDA 3R4CA 1YJCA 1DIGA 1K88A 4ENPA 1P75A 2WMDA 3C3XA 4CKCA 2QL6A 3H11A 4C04A 1E66A 2VHVA 1GG2A 3Q2OA 2B1JA 1KYVA 2QW0X 1NPTO 1X1TA 4DANA 2RH4A 1NA5A 3OM1A 4J6EA 4TPKA 5AVWA 2HQ1A 5IBCA 2ZJ7A 1MC4A 5AJXA 1LD3A 1BEUB 1ZNZA 4P5DA 3IAHA 3HWWA 2RBKA 2EX0A 3BOSA 4DSNA 4F3TA 3X1YA 5TMEA 4CIWA 1NU8A 1Z2DA 2WZCA 4Y3UA 2IS1A 1REQA 1YRQA 1T8YA 2I8CA 4EMUA 1RI5A 3W7BA 2DY1A 2OZLA 5E2IA 3CG4A 1K92A 1Y7TA 5FOXA 5IF3A 5JEEA 2X7JA 3NBMA 4NOLA 2PGNA 2BT4A 2IS2A 3I45A 3WE7A 3ESAA 2VWGA 2CB0A 2XD4A 4O29A 4HC4A 2AKEA 2VKTA 3N59A 3ZU3A 5IDYA 3KPWA 3CVOA 3MWEB 5ECWA 4B81A 2HJRA 5C52B 3PQ5A 4W5TA 3TIGA 3FPJA 5F3WB 3P52A 2JEYA 2FCAA 1P2UA 3QVGB 3O03A 1VJDA 2C84A 4L0MA 4D4HA 3CH7A 2IHVA 1LZKA 1UK8A 1QHYA 2FVXA 4ZIRB 3U16A 4JYZA 3MT8A 4V2IA 3GYBA 4XUDA 1J8FA 4XPIA 3T1YB 1T5SA 2R1VA 3WLKX 3T7JA 4LRSB 4HQKA 2F1RA 1JHMA 3DHYA 4XTCS 4S2UA 3EIOA 1BMDA 3DHEA 1QZTA 4GPD1 2JIRA 3CR8A 4PQEA 1G21A 2GXQA 1Y6QA 2J0QA 4JXKA 4X3CA 3QYAA 1FMTA 2GFHA 3KYIB 4K3VA 1OASA 2CJPA 2CXSA 3KHTA 1JFLA 4MV1A 5DV9A 3WLPA 3PHJA 3M6XA 5GVRA 2D06A 4ND7A 5LNK1 4UCWA 3VSCA 4CCYB 2P2SA 1RYNA 4DA0A 2E87A 3ZDCA 3O8DA 4B73A 1JSRA 2VWHA 1G4AE 1PJ8A 1QE3A 1OREA 3L6UA 4M7PA 2DQKA 2F00A 1NVMB 4N1AA 4B3XA 1RP7A 4MXDA 3R75A 3HACA 2BJHA 2WYWA 3VZQA 2QN3A 3SFTA 3OPYA 1Z0DA 4FYJA 3FLBA 5F23A 1TGYA 2HLHA 2UZ4A 1NW6A 2QUIA 1VI6A 3WNBA 4K86A 4KXLA 3ZHBA 3P9RA 1E1QA 4AN1A 2WKPA 3BZBA 3HJHA 4O4JA 1K08A 9MHTA 1PX0A 1UWLA 3AJAA 4P2GA 4QFDA 1WOMA 3OEHD 3AHDA 4I9NA 5TY0A 2GWRA 3FOAA 1UFVA 1USWA 5D5PA 3HMQA 2XQJA 1LJ8A