2GCPA

Crystal structure of the human rhoc-gsp complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
molecule keywords Rho-related GTP-binding protein RhoC
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 177
sequence length 178
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcpA00
3OAAD 4GP7A 3EASA 4EPXA 1E79A 2VO1A 2H57A 3BOSA 3DL0A 3W8RA 1VYUA 2VBCA 2Q0HA 8OHMA 5CIQA 3VAAA 3SU8A 4MGIR 4AYWA 3OEEA 1F2TB 5K8LA 1P3JA 2QUZA 1FW6A 4BFVA 2GETA 3PUXA 4IOLA 4KYIB 2WJVA 2X19A 1IXRC 2G83A 4OQNA 4DDUA 3KQNA 3QXJA 3TUJC 2NZ8A 1X1RA 3SBDA 3DDCA 2GZAA 3M1IA 4HAVA 4DKXA 3CNNA 4QGFA 3X1WA 4AKHA 4DLRA 4TMTA 3R8FA 3GLFA 4DRZA 5FBWB 1HQYE 3BFXA 3GMTA 1JAHA 1NVUQ 4Z1MD 1KOFA 4IKEA 4PHHA 1TNDA 2XZLA 2GVDC 1IM2A 4C0KA 5EE9A 1E0AA 4PHGA 2FA9A 2ATVA 4FD2A 4NE2A 5FI0B 3K0SA 2YWEA 3QXHA 2QRNA 5TB5A 1NG9A 1G6OA 4D81A 1JEEA 3H84A 4A92A 1E69A 3OAAA 5D3MB 3SJZA 2XXAB 2ZI4A 4OL0A 3NC1C 5TVKA 2Z5FA 2ZS7A 3TW4A 3FB4A 1X1SA 3RS3A 3SOPA 2F55A 4US0R 1QVAA 5DYIA 5GJWC 1KDTA 1I2DA 5IDVA 4JMPA 3EA5A 5KOYA 2Z83A 1JPJA 4R71A 2VP0A 1RYHA 4LDJA 3U5ZB 3PENA 1G6HA 1NMXA 2ZANA 1U98A 1XEXB 2UVQA 2WJYA 4ARZA 1TEXA 3ICEA 3QF4B 1H65A 1ZBDA 1YR8A 4FMBB 2IS1A 4RFVA 1VHTA 5GJBA 2J0VA 4RKEA 4DCVA 4L15A 3A4LA 5D3QA 5JI2E 3DMNA 1PJRA 1NL3A 4RSGA 3CPEA 1V5WA 5CYOA 3NBFA 1MO3A 2ZUCA 1Q1ZA 3RLFA 4YLGA 5EXPA 2O0HA 3BORA 4DB2A 1GL6A 3RAPR 4DSOA 3BE4A 4GPTA 2JLYA 4RD2A 1DAKA 1UKVY 3W8NA 2WOOA 3QBVA 1M2OB 3KQHA 1ETUA 2QSYA 3BK7A 3CBQA 4BQSA 3AVYA 2V3CC 3UMFA 2DFNA 3I92A 2J1LA 3Q8XB 1TU4A 4CVNA 2J59A 3QEJA 1E9AA 1N6IA 4IVPA 5F9HA 4YXWD 4R98A 2RHMA 2OSBA 1W0JA 3QVUA 1GP2A 5EZ6B 3WRXC 1OYWA 3IPYA 1X8LA 1ZINA 1CJMA 1SVWA 1DO2A 4NONA 1G4UR 1HQCA 3UK6A 5FPHA 2IYLD 4Q03A 2V6JA 2ZSAA 5FTMA 421PA 2QMOA 5L3QA 3QSYA 4BEBA 3TAUA 5FUYA 2WMNB 3SYKA 2WSMA 1W5TA 2CHQA 1KSJA 2EVWX 5BQ5A 1G8FA 5KHOC 3ZVMA 2PT5A 2ZRDA 1OT3A 4G0NA 2E9SA 2HF9A 2FX3A 4RZXA 5CIWA 5TV2A 3K9HA 1E0SA 2GBLC 4XTCS 4M1OA 3VR3A 1E2FA 4UKDA 1P2TA 1KK1A 2BVNA 1ZD8A 1NJGA 2OCBA 3QKSA 4QHSA 4C0JA 1KSGA 5FR2A 4A1FA 2Q9BA 3ZLJA 2REOA 2IYWA 2WOJA 1XTKA 4PPFA 3IQWA 2NG1A 2Z43A 4D4MA 3AVTA 1R8QA 2ZI9A 3F8TA 1N6LA 5FTNA 4IDQA 4LHXA 4AC9A 3TGPA 1VDZA 1ZP6A 3WNCA 2GJ8A 4URXR 5J4KA 2GXAA 2UZIR 3QKTA 4NKRA 4G3XA 3EIEA 3EC1A 1DADA 4BLSA 4QJ3A 3X1YA 1FFHA 4ZV4A 3KJHA 2MSEB 4NYJQ 4KODA 1CKEA 3A58B 1D5CA 4ITRC 4M1WA 1XEWY 2YJTD 4N1AA 5CLQA 4ARZB 4CT5A 2ERXA 4TT3A 2QMHA 4QNMA 3GJXC 3K9NA 1XP8A 3KKOA 4GI7A 3B60A 2QAGC 4M53A 1FMJA 3NIBA 4YMVA 1A7JA 1DAGA 2IW3A 1NLZA 4EFMA 2XJ9A 1TQDA 4ZI3A 4PQYA 1XWIA 3I3SR 3T06B 4AG5A 5KNCA 2PZFA 1XEWX 4S35A 2FPKA 4JIMA 4Q02A 1L4UA 4M1MA 3Q3JB 4RKFA 4OI0A 4NHOA 3B78A 2JLSA 5TDHA 4C30A 2LKCA 1IHUA 1YZTA 1XX6A 3KXLA 3AVPA 4M1TA 4NP6A 2H8KA 3GFOA 2NO0A 2NTYC 2PCJA 3RS5A 1OPXA 2DR3A 4W7SA 4EPWA 2VHCA 2GTPA 5FPSA 4CEJA 4PHFA 3CRRA 4IDHA 1RRGA 2N46A 1CRPA 3QY0A 3A6PC 4GT1A 3I61A 721PA 4AURA 1A1VA 4BLRA 4GOKA 3AF4A 4Q00A 4BFWA 2WIAA 5DYGA 3DZDA 4PANA 3S1AA 3NEYA 4KV9A 5GJVC 4JLPA 3GEHA 3TUIC 2CEAA 5L3QB 3LRPA 4KFTA 2ZE7A 2IT1A 2Q21A 2WV9A 3ZGXA 3UANA 3O8BA 2FWRA 3ICQB 2R2AA 1OXTA 4ZDIA 1NLFA 4X8LA 3VHXA 4LJ7A 5DHAA 3ZZUA 1NMYA 1VG1A 3IBYA 3NH6A 1WCV1 4EQ6A 2OE2A 2QQ0A 4ESHA 2AWNA 1U0JA 1YR7A 4ESVA 1A2KC 2X1VA 3T5DA 2BV3A 5LB2A 1G19A 2ZJYA 2W2TA 1GUAA 1EFRD 1Y3AA 3GLHA 2GEUA 4QGAA 2G1KA 4M9QA 3W6OA 1EFCA 5JBQA 3NVAA 1VCNA 3QKSB 5J40A 5L3RA 1OH5A 1PZNA 4ASUD 2W2XA 3P26A 1Q1QA 1KNXA 1GKUB 4KJZA 2W83A 1MABB 4OK3A 2VPPA 1JB1A 1J70A 5IRCD 4HZUA 5JEEA 2F6RA 2OXRA 5CB8A 2KB0A 2ZITA 4JLMA 2ZUDA 3GLFE 1T8UA 1TEVA 3L2OB 2A5GA 2ZRIA 3ZYCA 4B32A 2UKDA 4QGGA 5TMPA 4TYPA 4JJZA 3KJEA 2FGJA 2Y8EA 5AJXA 2WPDA 2HJVA 3FGNA 1HA3A 3P1JA 5EUMA 1G41A 1KNQA 1XTSA 2A3RA 3A1VA 1W48A 4KO8A 2AD5A 2ZROA 3T1VA 5JEDA 1OB5A 3AQ4A 1NBMA 3A8TA 4LJAA 5FPYA 3LW7A 4IXNA 4V0OA 5GADl 1MKYA 1ZC3A 1R10A 5CLLA 4B76A 4LWZA 4KHZA 4WBSA 2QMUA 1NP6A 3CZPA 5FOXA 2FNAA 4IDOA 4ASUA 3B1VA 1NKTA 2J41A 2CLCX 5JCZA 4V0NA 2GDJA 2QMEA 4EKDA 4I1VA 2Q9AA 4JLDA 1LY1A 1Q57A 3GJ3A 2JDIA 2Z0MA 2QAJA 4XJXA 3SI7A 5H8WA 2KBFA 2QORA 2ZRBA 1OKKA 2AHOA 1GAJA 2WZQA 1Z63A 2BHRA 1G9XA 2HF8A 3CO5A 4Q4AA 1G5PA 1P61B 5KSPA 4OI4A 4MYTA 4Q7KA 5J47A 2KBEA 5FL7A 1UEIA 4PC2A 5E7IA 1IJFA 1ESMA 4TLEA 4CEJB 1XZPA 1FUUA 2DPXA 3TBKA 4CF7A 3CF0A 2YVUA 4FWIB 1GRRA 1HE8B 2P6UA 3J81k 2ORWA 4DXAA 3NBZC 5HTKA 3L8ZA 3SFVA 2QTFA 2J9RA 2G88A 1S4QA 1LNZA 1OH8A 3S1AB 4IEEA 3SN6A 1F60A 5JLJA 2P67A 1E32A 2QSZA 1VG9B 3TW8B 1ZM4A 4YMUA 4ZDKA 1P7CA 3TMKA 2GILA 2RCNA 3LA6A 4JVSB 3EC2A 2GXQA 2A2ZA 4FCTA 4B6EA 1CRQA 1P4SA 1T6NA 2AFHE 4TWZA 4RZ2A 1GNRA 1K6MA 3GJ4A 2V54A 4KXFB 4LV6A 2V4ZA 3PEUA 1ELOA 3GLHB 4AKEA 1KO5A 1C1YA 1KJYA 1DG1G 3FKSA 3LBHA 4AG6A 5DHFA 1MO5A 3NTUA 1NKSA 3TIFA 1WMSA 2ZU6A 4QRHA 5EE3A 3RRNA 2DFTA 4JT4A 1K5GA 2CNWD 4UNRA 1MO4A 1US8A 2L0XA 1JI0A 4LZZA 4US1R 3UATA 3VNUA 2A5FA 2QN6A 2XSZD 4Q9KA 1W0KA 3WP0A 1XDBA 5DE3A 3PEYA 1IOZA 2ANCA 1SULA 2WSSA 3KFVA 1FUKA 4ZDWA 3WYAA 1IY2A 2JLUA 4BWYA 3EZ2A 5FOSA 2BMEA 1LW7A 4JL5A 3SDZA 2FH5B 2ZR7A 2J0QA 4HLCA 3D7MA 3SQWA 4OQMA 2QM8A 4O2RA 2D3WA 2FE4A 4NYIR 4K81B 4FMDB 3RABA 3VR5A 3EAQA 3GLIA 1RKBA 4FINA 1W36D 1GDDA 4RD4A 4P4UA 4MKGA 1YRAA 1DS6A 2MMCA 1IN5A 4DHEA 1XJQA 4EAQA 3W90A 2A5JA 2FFAA 2XB4A 3IIKA 3R9IA 3SR0A 4F4IA 2RB4A 3TVTA 3C14C 1N0UA 4L16A 1T3SA 2FG5A 3TSWA 4URZR 1M6NA 4BGDA 3VX4A 3FVQA 3RANA 3ZZTA 3SS8A 1W36C 1HH4A 2HV8A 4IFEA 2RGNC 2JGNA 1LB1B 4HAYA 3RRMA 1Z06A 3CH5A 3ZVRA 4A15A 3VHLB 1KO8A 1YE8A 4DLWA 1QG2A 4JL8A 5JWHA 1TUIA 2C9OA 1G7RA 4Q48A 4F4JA 1COWD 1B0UA 4PO1A 4LJ9A 3U2QA 4ZCMA 5DO9A 4WOPA 4OHWA 2WWIA 3KKQA 1ZM2A 5SZIA 5JWRA 4I99A 3ZVLA 4MGZR 3CRMA 4G01B 4YC7A 1KZGB 5E3HA 3ZVNA 3NWJA 3B13B 3IKJA 2P2LA 2QT1A 3ONWA 3SBEA 1SXJA 3EPLA 2J3EA 1HUQA 4OHZA 2ORVA 1TF2A 1L7VC 5EP1A 3R7WA 1VYTA 4NPHA 5JRZA 4WW0A 3BAFA 3U3RA 3P27A 3UG6A 2C77A 3K0CA 2VHJA 2C2HA 4C0LA 1NVWQ 1QHXA 3BIFA 3RHFA 4EPTA 4EJSA 3NG1A 5C46F 5L3SA 1P73A 3PJRA 4JKIA 1J90A 2OHFA 1COWA 2IYUA 3MG9A 2A9KA 3GLHE 4NL4H 1OIVA 3ZQJA 3L82B 5DI3A 3A1TA 2YZ2A 4PO8A 1YZUA 1ZCBA 4F93B 1IN6A 1US8B 1YQTA 1UF9A 4IVQA 121PA 4PC6A 3T34A 1D9XA 2EFCB 3MFYA 4CEIA 4B71A 3THWA 4MYUA 2CK3D 1E98A 2A30A 4FIDA 4NCIA 3W5IA 3LWNA 5KSYA 2ZYTX 4LYHA 3B5JA 3HYTA 2ZRMA 4HEJA 2P5TB 1N2CE 4U5XA 3D6TB 2R44A 3C16C 3DOFA 2CHGA 1PLLA 5CM9C 5EP3A 1EXMA 4PFSA 4TZ0A 4KVAA 3GLIB 1Z29A 1NBME 1Z22A 4P4SA 1JR3A 3HWSA 4V0KA 3V4FA 3CF2A 1S9DA 2H7VA 2HLDD 3LVRE 1E1RA 2ZSBA 1PLJA 2GHIA 3DZ8A 4GZLA 6Q21A 2GZHA 2W6IA 4PQRA 2XZOA 1UKEA 2ZS8A 4O0MA 2GF0A 4Q4JA 4A82A 3OIVA 2REBA 4M1SA 3A4MA 2CJWB 1AZTA 4BZQA 4PSKA 2EFEB 2HYIC 4ZCIA 3RS7A 3EPHA 3FPAA 2BCGY 3DM5A 3ZJYA 2DHRA 1G21E 1U9IC 2GAAA 5FOUA 3IIJA 1TQ2A 2QQEA 2QPOA 4TYWA 1OYYA 2RH5A 3K9GA 4G5OA 4QXAA 4YMWA 2Z4RA 2AXNA 1KYIA 4EPYA 1X8KA 2E87A 4XH9B 4XVUA 2YOFA 2WTUA 1GZSA 3F5FA 2WWHA 1G64A 1CJVC 4ACAA 1OH6A 3AF2A 1CS4C 2FU5C 1LV7A 3FWYA 1SXJB 1E79D 3TQFA 5KNDA 2PZGA 1ZNYA 2HEIA 1VIAA 1XFAA 3ECCA 3QEOA 1VCMA 1ZD1A 4Q1CA 1Z6TA 3UMSA 1NRJB 3OEED 4X8HA 1KJZA 2GEVA 3K09A 1CR2A 2P3SA 5A5GA 3AF3A 3FHCB 3OIUA 1HT1E 1ONBA 1WQ1R 3WY9A 1T91A 4MGYR 2F1RA 4EJSB 4IOJA 1P9WA 2XOKD 3ZIAA 5L3SB 4LJ5A 1NG1A 4N0EA 3T1OA 1D9ZA 3B7GA 5AUPB 2OV2A 4AYTA 3BXZA 4NYJR 1YKSA 1ZUNB 4TLAA 4XSGA 1JAIA 2WKQA 2NO7A 3EWSA 4LHWA 1Z0FA 2BMFA 1XTIA 1JBKA 1R0WA 1ZJ6A 2CE7A 2ZJ8A 4Q4HA 5DI3B 2IHYA 3RSOA 1IAQA 1AZSC 2ANBA 4QJ4A 3LFUA 3R9XA 3OEHA 3KQLA 2V7QA 3SEAA 5IK2A 4CEIB 5JHGB 3GFTA 4U00A 3LH5A 3THWB 2ZU0C 2WICA 4IW3B 4DLZA 1CJKC 3KFXA 2RAPA 1Y63A 1FTNA 4ZKEA 4AY2A 4IXMA 4JLNA 5IF9A 2VP5A 3K0FA 2NPFA 1BYIA 4CDGA 1G7SA 3DHWC 1QVRA 1W47A 1RFLA 4B2IA 4JS0A 3L8YA 4LUCA 4IVRA 2HT1A 1CEEA 4YONB 1IQPA 2XOKA 2ZYUX 2ZQ5A 4LSGA 5FOVA 3MUFA 1YZGA 1LS6A 4UNSA 5FBRB 2YOGA 3TH5A 2QL6A 4MYCA 3GLIE 5AJYA 1QHSA 5LD2B 3RS2A 2CL6X 4V03A 4KI0A 4DSNA 2XGJA 1QDEA 4KLZA 2BEJA 2JATA 4Q4JB 5IHPA 3OE7A 3M4YA 2D2FA 1ZM3A 3AKEA 3QXCA 4DDWA 1JR6A 1J99A 2XEXA 2H92A 1G17A 4QL3A 3LW8A 4OQLA 1E3MA 3BRWD 1F5NA 3WMFA 1M34E 3FHTA 1E1QA 1W4BA 2DFLA 3EZFA 1W5SA 1DVRA 1YZLA 2LWIA 2YC2C 3U3KA 3B85A 1W0JD 2R9VA 3PITA 3AEZA 4HI0E 2J45A 2ZI3A 4OJKA 3NXSA 2D4HA 3TAHA 4ZCLA 5FBQB 4M9SA 3ND9A 3U3JA 2BMDA 4II7A 2VP6A 4DIEA 3A37A 2BBTA 3I8SA 2GEDA 4LBYA 4QBHA 2MSDB 1OJLA 5BXQC 2VHQA 2YKGA 1W7AA 4V0MA 1GNPA 2C04A 1Z8FA 2JJ1A 3BH6A 1LS1A 2H16A 5CYPA 2WHXA 4IJMA 1SXJE 4C7OA 3PQCA 2BC9A 4GZMA 1QF9A 3IILA 3WP1B 3FHOA 1HTWA 1NY5A 4GMDA 3L0OA 3TSZA 1RW4A 2R8RA 3DVLA 4PHTA 2LCFA 3PG5A 2XJ4A 1VTKA 4WXPA 2ZXUA 4Q9LA 2IXFA 2BMJA 5KO2A 4Y0AA 3WNBA 4FN5A 4B3FX 1IXSB 2JA1A 3EPJA 2F43A 4Q4HB 5C1BA 2ZM5A 2UZ3A 2GZDA 1KJWA 2QE7A 2DBYA 3LD9A 3U3MA 4N0DA 2PEZA 1Q20A 3CPJB 4NH0A 2BM0A 3U6KA 1RC8A 3FKQA 3V9PA 2QPAA 5JECA 4I1OA 1W4AA 1KAGA 1PUIA 3CB4A 1RRFA 4FW9A 5B2ZA 4DVGA 1NVVQ 2ZREA 1S2MA 1CLUA 3RWOA 5FFMA 4RFSA 4Z8XA 2AL7A 1T9HA 3K0FB 4I1SA 2XNDA 4Q7JB 2IC5A 1FQKA 2YWHA 1U99A 1YR9A 2ZPTX 3SFZA 3O47A 1YVDA 1EESA 4TL6A 2W6JA 3A1SA 1HEIA 4TT3D 3RRYA 3WBKA 1XCGB 2AX4A 3C41J 1E96A 3FTQA 4MRNA 4G5RA 3VKHA 5HCNA 3EG5A 3TSOA 3ADKA 3FMFA 5J4HA 3TRFA 3GLFB 1UBGA 2ZEJA 2BKUA 3CRVA 2PZEA 5CB6A 4F91B 3T61A 4DCSA 5BYKA 1BKDR 5K8IA 1ZNWA 1JR3E 4XOIA 4A0FA 1AS2A 5J5CA 5K8UA 2EYUA 4OK5A 1QBKC 2ZJAA 3ADCA 2RGCA 5AWFC 2ZVPX 4JLJA 1U90A 4QOSA 3WHLA 3WYFA 2DWQA 3QKRA 4JBXA 1DOAA 4XWKA 1G5TA 1SHKA 3GEEA 1A5TA 1X8JA 1E2PA 2AN9A 4GOXA 3CX7A 4DC9A 5AUNB 1DAHA 3FMIA 3MD0A 1SVSA 5KDDA 3AVWA 1LF0A 1ZNZA 3DMDA 4NCNA 3UXMA 4MUBA 2DCUA 2ODNA 4WAUA 2Q3HA 5CK5A 4C0SA 3N70A 4CYMA 2A5YB 1E2DA 5AUOB 3MSXA 5M04A 3CX6A 2DB3A 2VP9A 2CE2X 4Q1AA 4MH0R 1C4OA 4DLXA 2QTHA 4ERNA 1G3IA 2IWHA 221PA 3B6EA 1FQJA 5JS8A 2OG2A 1D8TA 3KUCA 3LX5A 3L43A 4RCYA 2YHSA 3BBPA 2O8EA 1R0XA 2OCYC 2ZJOA 3ZQ6A 4X8OA 2FMXA 2P65A 2C99A 4PZYA 2ONJA 4TLBA 4C7OB 1LVGA 2QROA 4LK2A 1G5RA 4OQXA 1DARA 4TMKA 1P5ZB 2WJGA 4C0AC 1M74A 4PTLA 4JZKA 3KX2A 2MMGA 4PSAA 4GMXA 3VR4A 4TSFA 4OI1A 3PUVA 2QM7A 1XD9A 4A0GA 1Q21A 4P4TA 1M8PA 1XTQA 3QNUA 3BH7A 4LCBA 3CF6R 5E4FA 5FTLA 1UDWA 2F43B 3B82A 1E6CA 3QQ5A 5HKKA 1KO1A 1WBDA 5JS7A 1P60A 4MUAA 4AIIA 2G6BA 3ZDQA 1NNEA 1JXOA 3T5GA 1XTJA 1S0UA 1KIMA 4QHTA 2G0TA 1M1YE 2NPIA 1G8GA 5UKDA 2WPDD 4EPVA 4DZZA 2CLDX 3W3AA 4JLKA 2AKAB 4PX9A 1GIAA 4RFSB 5JJLA 2G0NA 2DFKB 4KSCA 3WHKA 3U7EB 1I4TD 2EQBA 1NBMD 2GCPA 1RE0A 2VF7A 4HATA 1KI7A 2BBWA 1KI9A 1IY0A 3P32A 5G3YA 3Q7PA 2OFXA 4W9MC 2ZRJA 5EE0A 2ZSEA 2V1XA 2OILA 5FUWA 3OF5A 2VH5R 3MWYW 4B34A 4ZDJA 1M7GA 5G3ZA 2RGDA 2FFHA 3B1YA 5LDDC 1JPNA 4TMZA 2JJ2A 5DN6A 1KDRA 2QP9X 4NBSA 4TYYA 2GWHA 2JDID 4DDVA 1FX0A 1G3RA 1Z3IX 4XVRA 1OKKD 1E9CA 2WJJA 4BFUA 1GFIA 2IL1A 3AVQA 4KYUA 4G5GA 2C95A 1GL7A 2F1IA 5JI3E 2JLXA 5FL7D 2BKEA 2IF0A 3U4QA 3NEJA 1UPTA 821PA 1XU4A 4L5BA 4LC1A 3VX3A 1G1MA 1CP2A 2O5VA 3P20A 1ZD9A 2RGGA 5DLQC 2VSFA 4OHVA 3IBGA 3GJ5A 4H1UA 1GM5A 1IONA 2OFOA 3GLGA 1CTQA 4NYMQ 1T0JB 2XTMA 4QBIA 4AKIA 1OW3B 4M21A 2REXB 2QZ4A 3E1SA 3LO5A 1KY3A 3I4LA 4PPQA 4A6XA 5KUTA 2O8EB 2YINC 3VKWA 3B2EA 3CM0A 2ZRPA 4CW7A 4TQ9A 1UFQA 1DPFA 1AGRA 1DBSA 2W00A 2Q9CA 4HAUA 1R5NA 2CCJA 4PZZA 5SZJA 2JLZA 2NMVA 1DG3A 4DLUA 5BN3A 4D26A 4V0ME 1P2SA 3HU1A 2CXXA 4IHQA 3NHBA 4HLUA 4LJ6A 2QG6A 4KCGA 1TL7C 3FKSD 1CJTC 1DAFA 2IUTA 3QVVA 4D4KA 4DLTA 3UKDA 2D06A 4UQOA 4HYYA 1SZPA 4LHZA 5F9FA 1CULC 1DAEA 4IDPA 3W5JA 1GKIA 2AXPA 2PJZA 2VHTA 4JT2A 1F2UA 3EARA 2KSQA 5C4MA 1H8HD 2J46A 1UJ2A 2XB2A 1YU9A 4XVQA 2X8AA 3X2SA 1W0KD 1K8RA 4OI2A 3LY5A 2G77B 3SZRA 1J8YF 2WSSD 1P62B 3BC1A 4QGHA 2B21A 1XJCA 3C15C 1Z5ZA 4AI6A 5G53C 3BB3A 1OV4A 4PXAA 3X1DA 2R6FA 2FV8A 2WVJA 2H18A 1QZXA 2YC4C 4EQ6B 2F7SA 2CL7X 2AD1A 2IF2A 3RS4A 4I81A 2JCSA 4AWXA 4OYHA 1BYUA 1GL9B 1T8TA 1Z0AA 4DBLC 3QJYA 2J7KA 3PCRB 4LJ4A 3U3OA 1T3LA 1DEKA 4B2PA 5L8VA 3OESA 1Z47A 3D3QA 3M6AA 2ZE8A 5HPYB 1R7RA 3DOEA 1RVDA 1AQYA 4KVGA 2DWOA 4WA7A 3CNLA 4LC0A 2IYVA 1CBUA 2IYRA 3K9LA 3U60B 4XD7A 1NSFA 1RZ3A 2FZLA 4EUNA 4A36A 4HZUB 4R2HA 1X86B 2EWVA 2IUSA 5BN5A 4QG7A 4PSVA 1FX0B 2GCOA 2O0JA 1H8HA 4QBGB 1OLOA 4D4JA 4LPSA 1GTVA 4Q18A 3X1XA 1DE0A 1AA9A 3KB1A 1UAAA 5J4LA 4MRSA 4DLYA 5LBIA 4A4DA 4B74A 5H1YA 1KY2A 3SJCA 3I1FA 4A8JA 3U4QB 4S2EA 4Z51A 3SJBA 2NZJA 3C8UA 3R20A 2ZI7A 3KKNA 4MQBA 4C4PA 1H8EA 1LFDB 1QHGA 4URUR 1MOZA 2JLQA 1ZMXA 2NOAA 3SHWA 3UG7A 4DEYA 2IWRA 1E9DA 2OAQ1 1AS0A 1IN4A 2WWGA 1FL9A 5J4VA 1E2EA 3GLGB 1Z0DA 4D0NA 2GK6A 2RMKA 2VRWA 2GK7A 3LLUA 4GBMA 4A2WA 2IS6A 3SJAA 4J0QA 4JVMA 3RWMB 1SXJD 3W34A 3P4XA 4URWR 4PC1A 3ZZ0A 4CZ2A 4QM6A 1OXUA 3I8XA 1Z6GA 2BBOA 4C9BA 1NLYA 1SVMA 1ODFA 3RS0A 3WYGA 3R8CA 3PEWA 1Z08A 1U8ZA 1OFIA 1N6NA 2FFBA 2FSGA 3REGA 4MRPA 4WZAE 2O8FA 3T35A 3AB3A 5EXXA 4Q4AB 4BE7B 3JZMA 5AJZA 4U7DA 1ZNXA 2CDNA 2O52A 3MMPA 3LLMA 1SXJC 3VR2A 1RIFA 4A0HA 5DH9A 5EE1A 3B8HA 4B3XA 5J4YA 4G1UC 3CR8A 5KSOA 4E07A 1AGPA 3FFAA 1HV8A 1G16A 2PX3A 3H86A 3RC3A 5BYJA 5FR1A 4MRRA 5JHHB 2FSIA 3BGWA 4MA4A 3K0CC 3CNOA 3PIRA 1F2UB 5BWMA 1HY3A 5KPJA 4UNNA 4EJSC 3VU9A 3GPLA 3K70B 2R62A 3TQCA 4A6PA 1GNQA 1O3YA 2LKDA 2JIZA 2ZJ5A 3IGFA 4BECA 1EX7A 4UXIA 5E7MA 4F92B 3NC0C 1DELA 4BUJA 5JZVA 1G18A 2NIPA 4CT4B 1E2NA 2BBSA 2CMKA 2QP3A 4LOAA 4OK6A 1S3SA 3V00A 3CWZA 4LBZA 4D6PA 2VA8A 2IXEA 1MR3F 1SHZA 1EG7A 3THOA 3TR5A 3DKVA 4I4LA 1II9A 1RJ9A 4A9AA 2ZS9A 4WZ6A 2QA5A 3CPHA 3GP8A 1JR3D 2BIFA 1S9HA 1DAMA 1DTSA 4Q1FA 3CONA 4BFYA 2VHUA 4M1KA 3PUYA 1E1RD 1IBRA 4B3BA 5EZ5A 3SE0A 4JLBA 1XBTA 2VSOA 2W6ID 3UMRA 5JRJA 2AK2A 2GCOB 3FDIA 1KGDA 2B6HA 2R6CA 1OXXK 2J87A 5H68A 5JFGA 2BJWA 3CRW1 2ZE6A 2FSHA 4ZIRA 3PR1A 3KQKA 3EZ6A 4Q01A 5H70A 3T15A 1TTTA 3JVVA 4RD1A 2D2EA 3SHFA 2TMKA 1JALA 4G5SA 4DUGD 5LD2C 3QG5A 1MO6A 1KK0A 2O8BA 2CBZA 3BD9A 1Z6YA 3BFKA 3LXRA 1XMSA 3ZH9B 5GVRA 2YOHA 5KTYA 2WKPA 1V43A 3QI2A 2HT6A 2ZI6A 5F98A 1XPUA 1U8AA 4X8MA 2IK8A 3MJHA 3RRZA 3MJRA 3NDBB 3W6PA 1NF3A 2WKRA 2IUUA 3QIAA 3JZAA 4A2PA 4M9XA 4LJ8A 3MCAA 2OT3B 3IEUA 3O8DA 2QT0A 3HPQA 3KDSE 5LB4A 5FBLB 2QI9C 1YZQA 2ZRAA 1WXQA 3EX7C 3GLGE 1N6PA 1Q1BA 2R65A 3FE2A 1RYFA 1WE2A 1Q3HA 2HCBA 1EK0A 3A1WA 5JJKA 1CIPA 4OJQA 5TY0A 4TTRA 5KDOA 1ZIPA 2FDCA 3QKUA 1NVVR 3IO5A 3RC8A 5GJCA 2O8FB 2VYFA 1VPLA 1R2QA 1KDOA 5EE5B 4KITB 1XXHA 3VR1A 1KMHA 3DKPA 4DB4A 5JSZA 3WMEA 3ZIAD 5HCIA 2P6RA 1Z6XA 2KJQA 2B92A 3LNCA 4DLVA 4E09A 3E2IA 4PC7A 4DUGA 2OZEA 4V02A 4DDTA 4E5UA 1GRQA 3D8BA 3LBNA 2J0UA 4TZ6A 1D2NA 1II8A 3K09C 1L2TA 1KK3A 3C5CA 521PA 1BOFA 3AUXA 4DSTA 3I62A 2RGAA 3GJ8A 4Q1BA 4R7ZA 1ZVQA 4F4CA 3OEHD 3VU9B 5HZHA 1ZW6A 2V7QD 1Z2AA 3MAAC 4BZXA 3VKGA 2XXAA 2V6IA 2ZR9A 4IEIA 5IK2D 3T1TA 2P6NA 4RD0A 5HE8A 3RVBA 2PLFA 2JASA 1SGWA 4L9WA 1ZAKA 1SVKA 3EZ7A 4TTQA 3R7WB 4B3GA 4BPBA 2PX0A 3RDPA 1VMAA 4DIDA 1I4DD 1NSTA 1XEXA 4DSUA 4PAQA 5CJPA 1Q12A 1B23P 3QENA 4LY6A 4PC3A 3F3YA 2CCKA 4CEHA 3M0EA 4MGKR 4NZYA 3LV8A 2BCJQ 4KFSA 1TF7A 4IDNA 5CJ2A 1AN0A 1BO6A 1TX4B 2SHKA 3IHWA 2R6DA 3FOZA 2XNSA 2PCLA 2ODWA 1EWRA 1G7CA 3OE7D 2A5DA 2VL7A 1YR6A 1AM4D 1ZYUA 5EP2A 4BRUA 4MDFA 1IJEA 4MKIA 3PVSA 3SYLA 3CUEF 4RD6A 4DJTA 4Y0VA 2OO7A 4KFRA 2ZYVX 2OEPA 4ZIRB 1AS3A 1P9NA 3RYTC 3LQRA 4PPNA 4LBWA 2GXUA 2VSXA 5KPDA 2WJIA 1TUEA 3GD7A 1D2EA 3IPXA 4L8GA 2X2EA 4HUQA 4DEXA 1E1QD 1UEJA 2ZSDA 1CR4A 4TYQA 5AJWA 2FJUA 2O8BB 2QNRA 4JVNA 1XD2A 5AJVB 4B3DA 1XMVA 1KI2A 3CWQA 3KTAA 4B44A 2B8WA 1AQUA 1BMFD 3ZD6A 1N5IA 1R8SA 3AV0B 1Z28A 4Q19A 4AYXA 4GNKA 1XMIA 2HCJB 3MWJA 2W0SA 1AK2A 2XTNA 4D0LB 5G40A 2XAUA 4F38A 4Z54A 1G4AE 4P4SB 1HT2E 1A82A 3QPVA 1LF5A 1YZNA 4HSEA 4B6FA 2BJVA 4OHYA 2ZJ2A 4FI3C 2O8CA 3IDQA 4UJ3A 4WZBE 1S1CA 2JJ1D 2F9MA 3KKPA 4QC2A 2IHBA 3ADDA 2JJ8A 3H4MA 1XXHB 5G41A 1KMHB 1ZM9A 4MYHA 5JSZB 2W0MA 2IEYA 4M1YA 1NVXQ 5TXGA 2EFHB 3Q5DA 1U2RA 1D6JA 1Q1EA 4A0RA 1OIWA 3REFA 2EFDB 2GNOA 2J7PA 3CLVA 2J0UB 2ZRNA 3IUYA 1II8B 1N25A 4GSYA 2WWYA 2WJHA 1S3GA 1BMFA 1U0HC 2QE7D 2JEOA 1MRSA 1T5LA 3KXIA 4MKHA 1OFUX 1QG4A 2ZSFA 2PH1A 3ND8A 5KDLA 5JWOA 4TL8A 1AKEA 1FP7A 1R0YA 4LHYA 4ZKDA 3EIQA 2N1BA 1KI1A 1IY1A 4D4LA 1CR0A 2QPTA 2IA5A 1MT0A 2C98A 2WWXA 2NO6A 3FMPB 1JECA 4RZUA 3FFBA 2XNDD 1VHLA 2H5EA 1JQLB 3OIWA 2OXCA 1OFHA 2RGEA 5IT5A 5LPNA 2DWPA 2W6JD 4HB3A 2HXYA 4D80A 3PUZA 2F1JA 4BFZA 3LAWA 4Q5IA 3L0SA 5BW8A 1HYQA 3F0TA 4NCJA 1RPZA 4CEHB 4O3MA 4C2TA 2D7CA 1Z2CA 3AP3A 1U94A 4Z1MA 1SKYE 4E03A 1LTQA 1ZM7A 2IYZA 4NYMR 3THYA 1ZUHA 5CK4A 3QUSA 4XSHA 3GEIA 3CRQA 4JYCA 4BLPA 5F2EA 1E9RA 5DI9A 5TARA 2GKSA 2AR7A 1T5IA 4LYFA 1GSIA 2FGKA 3IHLA 4LGMA 3G5UA 1WA5A 2I4IA 4JLAA 1Q0UA 4TTPA 3H0KA 4LV5B 1SVIA 4HUQB 1KHTA 1EX6A 1UADA 2ZE5A 3FMOB 2ZRLA 4GL2A 1R5OA 2HYDA 4U02A 2C9CA 3L0PA 2EWWA 1F6BA 1XD2B 3KTAB 3NBYC 3NBXX 3KJIA 2D7DA 1N0VC 3KL4A 1N6OA 1R0ZA 2MSCB 5E7JA 1ZC4A 4TL7A 1Z83A 5EXTA 4TQUS 2FF7A 3OHMA 1HE1C 3EIHA 3EZ9A 4BFSA 4C2UA 2O8CB 3PUWA 3QE0A 2HUPA 1TQ4A 3HR8A 4TMVA 2ZVQX 1OH7A 2BM1A 2V55B 3ETLA 5A4JA 2I3BA 1AIPA 5KYKA 4GRAA 4B35A 1P72A 4JL6A 3PFIA 1OE0A 4BASA 3DO6A 5FUVA 3B1ZA 3MRSA 4C0QC 5SZKB 2IYQA 4TMXA 1YRBA 4TSFD 3BS4A 1EFUA 4H1VA 4R2IA 4RJLA 2FEMA 1WF3A 1XXHE 2QU8A 3HU3A 4MRVA 2RGBA 1MABA 1M7BA 4YXWA 4RCZA 2KWIA 4CIDA 5HKKD 5JJIA 2ONKA 1N5JA 4Q9HA 3SQXA 1PVOA 4WXRA 2I1QA 1HURA 5FPKA 2GBLA 2R6GA 3CZQA 2NO1A 4Q1EA 4WVFA 4EFLA 4YMTA 1XF9A 1WP9A 1Q3TA 2IYYA 3I32A 4DCTA 2JLWA 4PO9A 1J8MF 4DT1A 2B8TA 5FH9A 1NN1A 3BFVA 3U61B 2CVHA 1P6XA 1UBEA 1EWQA 3HYRA 4JLVA 1E2IA 4JSYA 4Q66C 5HZKA 1ZU4A 2X77A 4JYBA 2GAOA 1KSHA 4KLNA 4D82A 1DO0A 4HZIA 5DGXA 3WMGA 3IQXA 3IO3A 1IXZA 3JVUA 1TMKA 3SC3A 3MGCA 3EWAA 4LRWA 3T1QA 3UWKA 4I1UA 4EIWA 4POAA 2F3TA 3NHAA 2ZRCA 4FMCF 5CDFA 4EDHA 5FI1B 3WBJA 1UBFA 4FXPA 4GOJA 4Q21A 2YWFA 4TQAA 1ZCAA 2JJ2D 3HR7A 1P75A 4IFBA 5DN6D 3THYB 2C03A 3HDTA 4UXJA 1UDXA 5B58C 4RY2A 4LBVA 3AUYA 3C4JA 4DCUA 3BH0A 4Q9JA 1W1WA 1ZUIA 2QEQA 4ON9A 3W9YA 1KAOA 1E9BA 4AK9A 3QG1A 1GWNA 1VCIA 3QBTA 2FPLA 4URVR 1EFTA 2ZAMA 2QAGA 4BFXA 3TKLA 4C0HA 4XTRA 4KFUA 1C9KA 4YQFA 2G9NA 4G5QA 3W3ZB 5B57C 4IRUB 1XPRA 5ANRB 4P32A 1SQ5A 3KJGA 3GJ0A 3NH9A 2IYTA 3MLEA 4QNRA 2WWWA 1KMQA 3X1ZA 3DM9B 1NY6A 2GA8A 4KAXA 2WAXA 5KU1A 5L3VA 1VG8A 2IYSA 1OF1A 1N6KA 1WBBA 3T12A 3AP1A 4HUTA 1WB9A 3ADBA 2H17A 3I72A 5SZHB 2ERYA 2PBRA 3GJ7A 4M0LA 4E22A 1E94E 2QENA 2YNMA 3AGPA 5K8TA 1G8HA 4B2LA 1OXSC 1XD8A 2CVFA 4NDZA 3GCGA 4TLDA 3TNFA 1JNYA 3TJZA 5DIFA 1BS1A 1J7KA 2YWGA 5C18A 2G3YA 1T0HB 4HB2A 1YHNA 2Q6TA 5CM8B 2IS2A 2QTVB 1XRJA 4B48A 1YJ5A 2B7BA 4LYJA 4XWAA 2GXSA 3QKRB 1G8YA 2C78A 5FOWA 4PAOA 1DAIA 2DYKA 4P33A 3AF0A 5E95A 4FCWA 2ZRHA 4HLDA 3ZS9A 2WBLC 1KI4A 3N2IA 2HXSA 4DLSA 2CL0X 1XEFA 4LX0A 4NCHA 1N6HA 1OXVA 3ZS8A 1WDTA 1K5DA 4W5WA 5AUQA 4YMSA 5BN4A 3CH4B 4FMDF 3HPRA 1F48A 2QGNA 3TK1A 3VTKA 2J0SA 1XJ0A 2GF9A 2H1LA 1RRCA 3TR0A 3THXA 3Q7QA 4P3YA 4HLUC 3K70D 3PXGA 3W6NA 4C0BA 2YYZA 4HB0A 4HDOB 1ESNA 1FNNA 2OUKA 1OFTA 1Z0IA 4DT1B 1XB2A 4GFDA 1G8PA 4CRWB 2PT7A 2Z6VA 1FOEB 1W4RA 2WIBA 4HDCA 2EW1A 2IX3A 2VLIA 4CGZA 4D25A 2A7QA 2ATXA 2BWJA 3K70C 2O0KA 2VQSA 1JJ7A 1E2MA 4PPGA 4US2R 3DEFA 1QHIA 1BIFA 1T3HA 4TL9A 1EFRA 4GP6A 5FTJA 2IEZA 3AGQA 3U7HB 2BDTA 3CKLA 621PA 2FFQA 2Q3MA 2VIIA 3BWDD 1OHHD 5FL3A 3ZD7A 4LJYA 3AKDA 2O8DA 2OAP1 5A0FA 3MWLA 4XD7D 1GOTA 3KXKA 1AJEA 1KI6A 4H9GA 2PLRA 1S8FA 4BZPA 4OHXA 3VMFA 3CR7A 3UPUA 1G3UA 1GKYA 3LQQA 1ANKA 3OZXA 1FNMA 3IEVA 5AK0A 2OFWA 4BLTA 2AKYA 1IN8A 4TN1A 1E4VA 1VG0B 1WRBA 2P0EA 3KQUA 1KTVA 3C7KA 2ZAOA 3K0AA 1EFHA 3TLXA 1XCMA 1OSNA 4JBYA 5HE9A 2QAGB 3BB1A 4FMCB 4W5HA 3B1XA 1XTRA 5KNBA 4QFMA 2ODBA 1H8ED 1NIPA 1PLKA 3NKVA 1E9SA 1W46A 1FTSA 2JAQA 2GCNA 2ZRGA 4K46A 2C96A 1EGAA 1I4LD 2ZR0A 2OBLA 2VEDA 3FYHA 3WXMA 2W2VA 2FN4A 4M22A 1VKJA 4UNQA 4A2QA 2IXGA 1NIJA 4A8JC 4W5JA 1OHHA 3K0EA 3V4RA 4AKGA 3EXAA 4HAZA 3VR6A 2IS4A 5B64A 1GVNB 4TMWA 2FPMA 4URYR 2J5XA 4UNPA 5FBVB 1XPOA 1J2JA 3B9PA 2K5UA 3DPUA 4P0TA 4B47A 2YV5A 4MKFA 1JJVA 3UWOA 3VFDA 1PV4A 2OM2A 1VIYA 3U44A 4KU4A 2AFIE 3VQTA 2KI5A 5EQTA 4LHVA 1XCPA 4LI0A 4QHYA 5P21A 1E2GA 2ZRFA 4KBGA 4DWJA 4QKQA 2PMDA 1UM8A 2OCAA 4HB4A 5C4GB 3WNDA 2D62A 1OIXA 2EU8A 2WAYA 2XX3A 1S96A 1VCOA 2QP4A 4YDHB 1SVLA 1BH2A 2VP4A 4QBFA 1CXZA 4BRWA 4HAWA 1CF4A 2GESA 4M8NE 3THXB 1CJUC 1N3BA 2XITA 5EUQB 1W2GA 4M9ZA 4NCKA 2JIZD 4Q4LA 2HJGA 4JSTA 3D31A 2A78A 1TAGA 1RRPA 2ODEA 1II0A 1FMLA 2WWFA 1KSFX 1E2KA 1FPMA 4IOMA 4B75A 4K8OA 4MITA 3AVVA 1QHYA 3TVDA 2GJKA 2OESA 2C5LA 2RKOA 1VYVA 3E5HA 1P2UA 1QHHA 3U6BA 3QPWA 3G82C 3H1TA 1R5BA 1MRNA 4GDFA 4LV8B 3O8RA 1E9EA 3SYNA 3K53A 4R9UC 4L4UA 5FUXA 5ELXA 3MWKA 5CITA 4JLOA 2PL3A 3K8YA 2O8DB 3U7GA 1O87A 3KB2A 3IIMA 2ZJZA 2VTKA 4Q7MB 1KI6B 2W58A 1N0WA 5CDFE 5JCPA 3CIOA 1KDPA 5EXSA 1QRAA 1L4YA 1Z07A 2CNWA 4ZO4A 1W49A 4KBFA 4Q47A 2CJWA 1KO4A 4JKYA 1P2VA 2WMOB 1NN5A 3KUDA 1NI3A 1GILA 2XSZA 2ZIAA 1W44A 3K0AB 4Q9IA 2PEYA 2Q3FA 1E2QA 1Z0KA 3LBIA 4D2IA 2NGRA 2FSFA 1P9RA 3E70C 3SNHA 1TU3A 2V1UA 2OBMA 4RD3A 3EPKA 2GJ9A 2HDNB 1FZQA 1NN3A 2F9LA 2FOLA 4Z8YA 4EFNA 2PJRA 4MDEA 2BEKA 2NO9A 1E0KA 3PV0A 3GJ6A 3HJNA 4XIGS 4B33A 2ORIA 4BEJA 2AK3A 4KSBA 2F3RA 1TPZA 2V9PA 2PMKA 2RGNA 2JLVA 2OBNA 4OQFA 3Q5EA 3OIYA 1W4CA 1NMZA 2C8VA 4B3CA 1G20E 5FOTA 1E2HA 4PZLA 4L9SA 1G291 1XZQA 2DY1A 4JVLA 1KZ7B 1M7HA 2R6AA 1IN7A 4AD8A 3BJIC 3QXXA 1G7TA 3TE6A 2Z4SA 5EP4A 2P5SA 4UXHA 2X2FA 3GFPA 3AVOA 3Q72A 3U44B 2OLKA 3CW2A 3A1UA 1UBCA 4LPKA 1N5KA 1I2MA 2QY9A 4A8JB 3KZ1E 1X3SA 1Q22A 2VF8A 2ZI5A 1KI3A 2QBYA 3B1WA 2CCGA 1NJFA 1R6BX 1UKYA 3P4YA 3C5HA 5FTKA 1Q44A 4C3ZA 2ZETA 4RVCA 3QPUA 4UJ5A 4M2LA 3AKCA 1JXMA 2FEOA 3I5XA 1G3QA 5GVSA 2F1HA 1KKLA 1KK2A 2XZPA 4P31A 1PUJA 1D2MA 2XTZA 5DSZA 2ECKA 3ASZA 3RNLA 4EPRA 1F3OA 5HR5A 4ZPXA 3AKYA 1QHNA 3AVXA 2GVZC 4PAMA 3U7FB 2ASEA 2QRZA 4NTZA 4JBWA 2ZTSA 3A4NA 1E0JA 1F2TA 4V0LA 1QHHB 1XNJA 1JEDA 4WIAA 2B7CA 1Z0JA 1ZIOA 2CHVA 3A36A 3I73A 3RSLA 4B73A 3WRYC 2AWOA 1NN0A 5AR1A 2KE5A 1Z6AA 5FPTA 1S1MA 1UKZA 1CU1A 5B30A 3G0HA 3BB4A 4BLQA 1R4AA 1ZU5A 4HLQB 4DCNA 3NDPA 2BOVA 1GG2A 1KO7A 1TQ6A 3B9QA 1G3MA 4ZI2A 2OCPA 4B43A 3AVUA 3QXSA 3LXXA 2E1RA 3EW9A 4O25A 1E99A 2GRJA 1ZRHA 1A4RA 2ZYWX 5JMTA 4TYNA 4F7WA 1AKYA 5D3MA 4BLOA 3LDAA 4ABYA 4HDQB 2CK3A 3K1JA 3I5YA 1YZKA 4HAXA 4Q7LA 1SVOA 2GJAA 4TLCA 1KKMA 1MV5A 2IYXA 3LVQE 4RZ3A 1U81A 3OFND 1SKQA 4QM7A 3TUZC 4BFTA 1U0LA 1GITA 1N5LA 5F3WB 1MH1A 4NMMA 3GQBA 3EA0A 3LX8A 4NU0A 1W2HA 2V8OA 5KSZA 1T4GA 5DNYB 3PEVA 2C9YA 1KI8A 4D0GA 3Q85A 2GJSA 1RJ9B 2EFGA 3QF4A 3N5CA 3UIEA 1W36B 1SKYB 4PR0A 1E9FA 1E2JA 1GRNA 2CLSA 2EYQA 2JLRA 1N6RA 3CX8A 1U9IA 3H2YA 4LYAA 2HLDA 1TADA 1L8QA 3AF1A 4XWOA 3ASYA 3N2EA 5EJEA 4OBEA 3AM1A 2FZ4A 4QJ5A 3VNVA 1CR1A 4FCVA 4IOKA 3HP1A 1VECA 1A2BA 2RGXA 2NQ2C 3BERA 2G1JA 1TF5A 5DISB 1U8YA 2OLJA 2IBMA 4FWTA 4YDSA 2WM9B 2ZUBA 3QF7A 4M4SA 2ZRKA 4JJKA 4O2LA 4NYIQ 3O8CA 4N3NA 1OB2A 3L0IB 3OFNA 2QBYB 1JQJC 1E2LA 3KKMA 3QOFA 2J7PD 3Q9LA 3R9WA 1E4YA 5C2JB 2D74A 4PQFA 4OKSA 3AH8A 4ILEA 2N42A 1FP6A 3HU2A 3AP2A 1XMJA 1X6VA 2VP2A 4Q1DA 2I1VB 2QGZA 2RHDA 2ZJBA 4ACBA
chains in the Genus database with same CATH superfamily
1FJ2A 1H6BA 1VGRA 4O5AA 4GP7A 2LNDA 3PFGA 1KQNA 4WLVA 3IBTA 1RADA 1I3KA 4GPD1 4RAOA 3MMZA 4LGYA 4BV8A 2FG7C 3DL0A 3IUEA 4RX1A 3UMYA 2PUFA 2VT3A 2VBCA 1P80A 1L7DA 1XDDA 2V96A 3A6EA 4FGLA 5B53A 8OHMA 4CHGA 2R00C 4MGIR 3RAGA 3OEEA 5K8LA 3G89A 4MWSA 5TMEA 1QVWA 1GA1A 2QU7A 1ZSVA 3ENQA 5F52A 4BFVA 3PUXA 1HDXA 4L8YA 2G1PA 4KUEA 5DCYA 2G83A 4F11A 3I4FA 4XFKA 3QXJA 1HM5A 1LI7A 3L79A 2WNIA 1TGYA 3TUJC 3V7WA 5JAZA 2NZ8A 4XI9A 3ZI7A 2P9JA 3FCSB 3M1IA 4DKXA 2VJDA 2XGSA 4XKJA 3VPAA 4YP7A 4F1KA 5FBWB 1HQYE 2NUPB 2WIKA 1Y1QA 2H29A 2YJ6A 3CUWA 3GMTA 2FUNB 2WF9A 3HVKA 2CLIB 5K0TA 1KOFA 4IKEA 4PHHA 4DR6B 1FDRA 1O57A 1RHRA 1IM2A 1SZJG 2FZEA 2GVDC 1JHPA 2OGSA 3GRVA 3QVXA 3ENKA 1K8YB 3JRNA 3BD7A 4GBED 4QATA 5EE9A 5FI0B 3VUFA 2YWEA 2QYSA 3QXHA 4U2CA 3ZHSA 2AG6A 1BQ4A 1MJNA 3GOHA 2DSTA 4D81A 3BEOA 1E69A 3T0IA 3OAAA 1JE0A 3MA0A 2NZ2A 3SJZA 2ZIVB 3R23A 4BVGA 4FJ1A 4Q3OA 3ZK9A 3HVJA 1P0CA 2OKCA 1KAEA 3OKFA 4MJXA 1DC7A 4MLPA 1X1SA 5GJWC 3E22B 4G0ZA 4KR2A 4FSDA 4MUMA 4ZT5A 2YXLA 2VP0A 3EDRA 2WVHA 3ZU4A 1FLNA 3E3OA 1WF6A 2ZIFA 3GQBB 3TQOA 1F8FA 3IQIX 3ANXA 1YCFA 3LPMA 1XEXB 1VSBA 3LQ4A 2UVQA 1Y33E 2RH8A 4FZJA 1JLKA 2PRJA 3LQKA 3OX2A 1SUEA 4N3AA 4D3XA 1ZBDA 5EI5A 2HCRA 3E03A 5CTJA 5TQ2A 4V1CA 1U3WA 5D3QA 1NBEA 4IWXA 1JBEA 1OLSA 1NZJA 2EJVA 3HUDA 3VPSA 5BMVB 2UDPA 3I28A 1UZLA 1H9BA 4KL8S 5IABA 1DUIA 2ZUCA 3D2LA 4YPFA 4YLGA 4RJ2A 3I5MA 4HN2A 1W94A 4DB2A 2HRZA 3GJRA 2GHRA 4LYYA 1FTWA 3UKJA 4DSOA 1C5KA 2B9VA 2C5SA 1DAKA 4B0PA 4U7FA 1EUDB 5E6RA 1T2NA 2B4QA 1NVGA 4BQSA 2V3CC 1BFDA 2DFNA 4QUGA 3W5HA 4ZZ1A 1TU4A 1QF6A 1E9AA 5DOZA 1QIEA 5F9HA 2G63A 4YXWD 4FUTA 1W0JA 3SS7X 4J7XA 4L4XA 3UK2A 4AS1A 5EZ6B 3NASA 1YQGA 2JAXA 2OCLA 5JSUA 3ANTA 2QZZA 4E15A 7YASA 1DO2A 5IKMA 1G4UR 3UK6A 1BD4A 4PFQA 3SP1A 3L6UA 5FTMA 1NF9A 4R9NA 3QA9A 4H59A 2QMOA 2X0FA 1UJ5A 3D7LA 3TAUA 2C2WA 3E1GA 5K0GA 1S8OA 3N6XA 2WMNB 3SYKA 2W71A 2WSMA 2F62A 2AFHA 3ON5A 3REOA 4ZTBA 1O8BA 1P1CA 5IBQA 3ZVMA 4MUHA 2XBLA 4LSMA 1H2WA 2ZRDA 1OT3A 1P7VA 2EFYA 4IH9A 3UAGA 2Q28A 2E9SA 2X22A 2XAAA 3KO8A 3PHJA 1YQXA 3C45A 4G0NA 4HEA1 1Y6RA 2R8BA 5CIWA 1ZGGA 2WU4A 4GKKB 1E5DA 5IDWA 3B1FA 3L7NA 2GBLC 5L9AA 1RXSA 1V8DA 4KO3S 3KUXA 1CE8B 1R0SA 4JIGA 4M1OA 1TAUA 3KJXA 4OATA 1KK1A 4UKDA 3H8VA 3QNWA 1ZD8A 5ER6A 3NRBA 4CQJA 1OI7A 2OCBA 3DEHA 2YMMA 1KZYC 4MDHA 4C0JA 3S81A 1Z34A 3ZLJA 2KYRA 2REOA 2IYWA 3TDMA 2PANA 3WX0A 2YXNA 3PFBA 3BQMB 4PICA 1KOLA 2Y05A 3AVTA 5JQGF 1TKRA 3F8TA 2FYTA 1XZLA 4IDQA 2I4MA 4TN5A 4CU2A 4EM6A 1VDZA 5ENVA 1E3DA 4ZOBA 1M5RA 4URXR 1R3UA 2R0QC 3ZE8A 1MF7A 3GAMA 4BX2A 4FSXA 1EFVB 3B6IA 4G3XA 2FPSA 4ARCA 3PVCA 2GD0A 4UQLA 1DO8A 1X7XA 3QW4B 4LMAA 4IRMA 2C58A 2H08A 3R3YA 4UCXA 4HYEA 4AQDA 1WJGA 2CLEB 3TI9A 3WZLA 3VPXA 2WFAA 2AG5A 4N0PA 2XMZA 1JHRA 1PL6A 2QMYA 5LP6F 3GZNA 3UNXA 4H60A 3X44A 2QRGA 3PUHA 2R4QA 3TB4A 4K5QA 4KR9A 1CKEA 1PJ3A 2VXBA 3CCBA 4ITRC 2YJTD 4M1WA 5CLQA 3ZH2A 3B51X 2LVBA 4OP1A 1C0PA 2TRSB 4XYGA 1A9XA 1XP8A 4R0MA 4FE7A 4LJLA 5HQ3B 3G2MA 4NR0A 2GSDA 2QAGC 3GB9A 1B16A 1FMJA 1M33A 1DTWB 4RYDA 4UM8B 1NLZA 1QIIA 4UMVA 3RTBA 1TQDA 4ZI3A 1KY5A 1HMPA 1XL0A 1H1DA 2AE2A 2ZZKA 3BJEA 5IC6A 3RLIA 3AEYA 1ARZA 3IPRA 3SHQA 1XEWX 1CWUA 2WT9A 4GEKA 3T9CA 1P1FA 1XA0A 5FWDA 2IVZA 1RKUA 1C3OA 4S1TA 1JMKC 4NHOA 1Z2DA 4INOA 4KDEA 1JDBC 1DLIA 2BRUC 2DLNA 4XX0A 1A2QA 4BBZA 4FCCA 4DLPA 4E7OA 4NFHA 2LKCA 1IHUA 1YD7A 2YNMC 1YZTA 3MCZA 4RLSA 3LO8A 3UT6A 4AJOA 2V74B 3ETEA 4I9GA 2BGJA 5T64A 3WGKA 3AI1A 4M1TA 4ZO8A 2FW9A 3OCUA 2NO0A 4D8UA 4R2WA 2HQBA 1GYQA 2NTYC 2QLNA 3DJFA 2ODPA 4JLSA 4BZZA 4WK0B 3PIIA 5JNWA 1G4HA 3R6DA 3IQEA 3A6PC 3AZOA 5F4ZA 1A9QA 2AYZA 2CL5A 4PN7A 3ZOKA 3JAWA 4AAYA 1A1VA 4AULA 1ZOPA 2MOKA 4BFWA 4X61A 4ISCA 5K3CA 4NNJA 1YDFA 4PANA 2AJDA 4F96A 1T25A 1QM5A 1SCIA 3KXPA 1V9SA 2WMYA 3WAGA 1NKVA 5L3QB 3WSWA 2EKZA 3S44A 3E1KA 3TW8A 2YCBA 5IAKA 3RU7A 3WGJA 3ZGXA 3OZSA 4JBLA 3ICQB 4RYLA 1JG6A 1OXTA 2VBIA 4PPYA 4ZDIA 3VHXA 2RHBA 1V96A 3AW8A 2ONZA 3DAOA 2OE2A 4ESHA 2AWNA 3O3NB 1AKWA 1KYWA 1YHYA 1A2KC 3MTAA 2ABWA 1RI3A 2DFDA 5FLEX 1G19A 1S89A 2W2TA 1GUAA 3DEIA 2GEUA 2G1KA 2V0CA 3IUPA 1ZBQA 4GDMA 1T8SA 5J40A 1OH5A 3AY6A 4ASUD 1FY2A 4TV9F 2QVYX 5MN4A 1Q1QA 1KNXA 1GKUB 1PU2A 2JW5A 4KJZA 4RWEA 4YRPA 1SCNE 2JEZA 4NMHA 4ICIA 1FVOA 4OK3A 2ISQA 2PTGA 3U62A 4B7ZA 4BBJA 3M1LA 3VDNB 5IRCD 5KVCA 2F6RA 1QCCA 4TV8B 2RC6A 3NBQA 4D97A 3H9BA 2GGSA 1T8UA 1U1EA 3L2OB 3TMYA 1KP2A 3V7NA 4C3UA 1B4DA 1FFSA 2L2QA 4ML3A 1J56A 1QV6A 1GLVA 1N2CA 1SG9A 3NBKA 3QRWA 4U6NA 1XN4A 3FRHA 4DMRA 2FGJA 3JVDA 3KT8A 2WPDA 3VO2A 1HA3A 3P1JA 4GKAA 5EUMA 3GRAA 2E5FA 5E0OA 1EXVA 2RONA 1X1BA 3LHFA 1WABA 1OX4A 3ACBA 2A3RA 2D54A 3EGCA 1P2FA 4H15A 4TS3A 1W48A 3RUEA 2H7CA 3SGLA 3QWAA 3T1VA 5JEDA 5KNBD 1GGKA 2PZJA 5FPYA 3HUEA 3O8QB 5ED4A 3LW7A 2C5GA 3V32A 4WK2B 5J2TA 1R10A 4X94A 3EMDA 1KU0A 2HJ9A 3Q3GE 1RQPA 4LWZA 5HFJA 3Q2KA 5DHRA 4WBSA 1ZRNA 5FOXA 3CZPA 5EJFA 1ZCZA 4FEGA 4WJZA 3MSCA 3B1VA 4BCDA 4LG1A 3BWEA 4PEVA 3SBOA 2JAOA 3WB1A 4DMMA 1GGHA 3ZBQA 2Q49A 1BEEA 3M70A 3M4NA 3LBAA 2I7XA 1Q57A 4BNMA 2JDIA 2YWDA 2PX2A 4XJXA 1JQEA 1WUKS 2KBFA 4EHBA 2VHVA 3IVAA 4W1QA 5K0EA 3GH1A 4BNIA 1G55A 1G9XA 2ZLBA 3CO5A 3I2KA 5L45A 4CKBB 4OI4A 3OLWA 3PD7A 4PSCA 4UW9A 3RV4A 1CRWG 1VMDA 2C2BA 5FL7A 1JIVA 2IOFK 1QP0A 3SF8B 1UEIA 4PC2A 1EG2A 1QANA 5IZCA 5JVDB 2FN7A 1PSZA 1TFUA 3DE2X 4S3MA 4IQ0A 5I48A 1FUUA 2DPXA 2H3HA 3UF0A 4CEJB 1BH6A 3CF0A 4FWIB 2XCSB 2IP4A 1QYXA 2P6UA 2ORWA 4Z0TA 3S7TA 2R68A 4EX7A 3TD2A 3J81k 5HTKA 1J8QA 4BWVA 2QL9A 2QTFA 3OJOA 5A5DA 5BNIA 1NVDA 4BMYA 1VPWA 1DT3A 4FYWA 3RFTA 3CEMA 1ORIA 2X9QA 3F6RA 5JLJA 4DGQA 1IZ7A 2QSZA 3PNMA 5AKXA 2ZB2A 4KWHA 1P7CA 4ZYYA 3O0DA 4PLWA 2X1MA 3BXXA 5IM4A 1Q0ZA 3PDIB 2GXQA 2A2ZA 3DWFA 3HVIA 3T1YB 2JK1A 4Q34A 2LE0A 4TWZA 2FN9A 3RVRA 1OD6A 3A1FA 1PTKA 1RCFA 4HQRA 1M2VA 1GNRA 4UM5A 2OZVA 2V54A 5H9WA 5FA6A 4FDUA 2V4ZA 1W9MA 1Y8QB 2EP5A 4XJTA 3E05A 3GLHB 4JWKA 1KO5A 4BN4A 4EI9A 1KJYA 1DG1G 1WR8A 1X1EA 3LBHA 4Y1RB 1XXLA 5FA8A 3KOXA 3FOEC 4GZ3A 2ZIZA 3C87A 4N6OA 4L0CA 4N0QA 3NTUA 3CE9A 3M83A 4L76A 1WMSA 4QRHA 2QUHA 3DBRA 3HCDA 4QTTB 3CEAA 3VTZA 5EWJA 3COJA 4OQDA 5CBKA 1U2QA 1G2OA 4KIGA 2GVNA 3QEKA 2YQ5A 1BXRB 5CYGA 1XLUA 5ALLA 3IPLA 2VJMB 3H9UA 1JI0A 4LZZA 3VNUA 4YUVA 5DV9A 2QN6A 5IVKA 2DWCA 3T7EA 1RSZA 4Q9KA 5K3SA 1T1JA 1W0KA 1F4PA 2PD6A 3L7KA 4H6WA 2XCUA 3ZDAA 3EBOA 2W2KA 3WLAA 3FGZA 1HFJA 2IE0A 3OHSX 4LVCA 4M1ZA 5G1PA 1SULA 3IQFA 4ZDWA 3W8DA 2IY9A 4JX8A 1S2GA 1XELA 3NV7A 4V0QA 3EZ2A 2O50A 1KBOA 2BMEA 3PX7A 4UHBA 2PN1A 4JJ6A 3HK2A 3PNQA 1BMQA 1CQXA 1J5PA 2V0NA 2CNBA 2AIRA 2ZJ1A 1H1LA 2WUEA 4HMQA 4IX1A 3TQTA 4O2RA 1YBVA 3IE2A 4D9KA 2E2WA 3TTWA 5BN1A 5BSMA 3NYRA 4FMDB 1TK2A 1ZD5A 3RABA 3EAQA 3VR5A 4BO0A 3GLIA 5CAEA 2R8XA 5EYPA 4O2BA 5IEJA 1GDDA 3O7WA 2WYWA 2QKYA 4RD4A 5DRTA 2P4SA 1MHPA 4MKGA 5PNTA 5TC4A 4BFLA 1YRAA 1IQRA 4X7PA 3DDNA 5K20A 5D86A 2W70A 3W90A 2NAFA 5TQ0B 1YMQA 4OU4A 2FLVA 4R40A 1E3TA 5AT1A 3R9IA 1SKMA 4N39A 2AXQA 3QU7A 1N0UA 2CFIA 4HBGA 2VKQA 4URZR 1WV0A 4BGDA 1JDSA 2JHGA 4MW6A 2DBQA 2XHZA 3VX4A 4ND6A 4U9UA 2WAOA 3JAKB 4WASA 1I7QB 2HV8A 5AHKA 3OCYA 3CFYA 3U80A 2JGNA 3RRMA 5DHTA 2VPTA 3EEOA 1N8KA 1WG8A 3JYHA 4X1KA 2Y0BA 2XMCA 3D0OA 5LBUA 4A15A 3G2LA 4BPRA 2VUUA 1YQEA 4FFDA 4K05A 4FEAA 4Q48A 5GMOA 4F4JA 1COWD 1YRYE 4ZAZA 4XGRA 4PO1A 2J3JA 4LJ9A 1BDMA 5T4FA 1PHRA 3ZW8A 1NATA 4ZCMA 2WWIA 5CA1B 1YB4A 3LY8A 2GBPA 5JWRA 4I99A 1PT6A 3ZZ1A 2GN0A 4HSGA 2OY0A 4MGZR 5JOQA 1GQOA 3M6LA 3MPUA 1V37A 3JX9A 2WJZB 2HA2A 4X3OA 4JQZA 5A9RA 2XGMA 3ONWA 5LQMA 1YAJA 2QRMA 3R6WA 1EVKA 4GM4A 1GPLA 3ZNNA 1TF2A 4GMGA 2QTTA 4IJ6A 3RAJA 3UV3A 4CDRA 1U6KA 3N07A 4YO7A 1PQ4A 1SHUX 3AUJB 4JDPA 4RANA 4RZIA 3N3AC 3DYBA 3K0CA 3PNKA 3HRKA 3RFFA 1J9GA 4EPTA 3RHFA 4YA6A 3NG1A 4HGPA 1RPTA 1P73A 4HGOA 3TQSA 5LQKA 4D41A 4AT1A 3EBPA 1A7UA 2WDZA 2Q0QA 4A3SA 2R85A 4RGYA 1IM8A 2NNWB 1ZH6A 2WIDA 1FP4A 1BA3A 5A9TA 4H6XA 4X92A 4NL4H 3OOWA 3ZQJA 2CJPA 3DMTA 4HPXB 5DI3A 2GKGA 4PO8A 1R6UA 1ZCBA 3V6MA 2FZKA 1VBMA 3DLIA 1G66A 5LOVB 3GFQA 2W22A 1YQTA 2C83A 4IFTA 3AEQA 4IVQA 5G4KA 2AOWA 1AK9A 1NMQA 3CKYA 1VL1A 5CXSA 1D9XA 2QRPA 3ZE1B 4BN5A 1H3EA 4MYUA 3RD5A 1Z18A 4FIDA 4PRLA 3I1JA 3WKEA 3LWNA 5KSYA 2EGGA 3B5JA 5CB0A 2LIVA 2QTAA 2UAGA 1JVNA 4MOWA 3LT4A 1FFAA 1LDGA 4ESOA 4WCFC 5IVPA 2B20A 4A8TA 1NDQA 3GJYA 3ET4A 3UPTA 2CNLA 3HEMA 1Z13A 4BO5A 1CDDA 1OQAA 4I4TF 4YN3A 3GNSA 4LDZA 3VTAA 3IEMA 5E7QA 5JZOA 1EXMA 3M4JA 4ZU1X 2MSNA 5GV8A 3UUFA 3SM9A 4TZ0A 2PKQO 4KVAA 4O63O 1Z29A 2B94A 4DJ5X 2EEZA 3R41A 3G23A 1K2WA 4RSMA 1VE5A 4HH1A 4NJEB 4EL5A 2CVPA 4H16A 1I2ZA 1JR3A 2AVDA 1O0BA 3B6JA 4P3PA 5K3DA 3W5BA 4W5OA 1QWSA 1X1TA 1S9DA 4KIJA 3W9BA 2E5WA 1E1RA 4XUGB 2ZSBA 1LKZA 1TLFA 3PJEA 4NFLA 5GV7A 4D4HA 5F77A 2NACA 4YAEA 4WCFA 2XZOA 1UKEA 1ZKMA 2IYNA 2XTJA 1P1JA 3CLUC 3DAPA 2QJWA 2VP3A 3F6BX 4Q3DA 4A6EA 4A82A 5KYWA 3WADA 3GT0A 2NU9B 1L7EA 1B0AA 3ORRA 3EG9B 3AIIA 4PSKA 3ZV5A 3ADPA 2HYIC 1V11A 4HQOA 4H1WA 3CMMA 3DM5A 5DBHX 5ALUA 1S8NA 3ZJYA 5H82A 5IKXA 4GOND 1G21E 2EWMA 3VKVA 1I3MA 5IAEA 4E5MA 2GAAA 3CNQS 5FOUA 3CZ9A 4PIVA 4DARA 3S70A 2J9GA 1IHXA 4EUFA 1OYYA 3R7NA 4DYDA 3ZHVA 2FR8C 1P6UA 3ECAA 2Z4RA 1DDGA 3NHZA 3CG4A 3LKDA 1LBIA 4E32A 4GG1A 1EVIA 3W05A 4RNCA 4GZ5A 4J7UA 4TLMB 2TS1A 4DBZA 3HXQA 1GU0A 5JS2A 3T95A 1GLNA 1ECBA 5I7AA 2PUDA 3R7BA 1CS4C 4FJ2A 3W5AA 2BTQA 1LV7A 2R87A 3FWYA 1E79D 4MVJH 3TQFA 2QTLA 2EL9A 2XQFA 1F8YA 3QX7A 3MD9A 5CVJA 2PZGA 1ZNYA 2HEIA 3AEXA 4FGZA 4X90A 4NC9A 1HRDA 4Q1CA 4ALNA 1YI8A 1EYZA 1GZHB 1R9NA 1TJ4A 1Z6TA 2XUDA 1NRJB 4MMXB 1KJZA 3JQ9C 3K09A 5AD1A 4PZPA 2ZUVA 3VXKA 3W4IA 1B2LA 5JO0A 3OIUA 2WSIA 5E2IA 5JALA 3ZIAA 3HI4A 1O96A 1INLA 1C7JA 1NG1A 1D9ZA 5AIAA 3T1OA 4MUIA 3VOTA 3CLSD 2DHQA 3E7DA 5D7BA 3J80A 2FJPA 2ZYRA 5EJGA 4M0PA 1YJQA 3G9QA 1BW9A 1R0WA 1ZJ6A 5IN5A 2AN4A 3T0FA 4D1YA 5DWDA 1A9RA 2FQYA 2IHYA 3IESA 1MB9A 3RSOA 2ANBA 4ZVUA 4QUIA 1SOAA 1VFNA 2P7IA 3DDZX 3DAYA 3LFUA 3OZAA 1E7SA 2VQEB 2Q5CA 4R8RA 1IRXA 2JHPA 3GI1A 3X2EA 4DCGA 4LJRA 3P5SA 2E49A 1ZS9A 1MH9A 4MV0A 5CT9A 4C7BA 3THWB 1UDCA 4IW3B 1A8UA 3U49A 3TPFA 4TXHA 4DV6B 4NOLA 2AZTA 1BD3A 3M1AA 4A5SA 4JLNA 5IF9A 3L04A 5I9MA 2FQ1A 3K0FA 1BYIA 2NPFA 4QFCA 2RK3A 1QVRA 4UE3S 5C32A 4IJQA 1EVZA 1HLFA 4N8SA 4YAWA 4B2IA 4BDTA 1IJKA 4JS0A 4D9MA 4DVJA 4AMZA 1CFJA 5ALDA 5AOVA 1E3WA 5L53A 1ZK2A 3H42B 4YONB 4Q37A 2HSJA 1IQPA 1UBRS 1EH5A 4YJ2A 4NF2A 2AOVA 4R5MA 3MQ2A 3G1TA 3MUFA 1JNXX 2JFYA 1BE0A 4YPOA 2XTAA 1NUTA 4UNSA 4INZA 2QL6A 4N9WA 4LFBB 3H9GA 3W8FA 3AKZA 2EHJA 1GU1A 4KI0A 3WDLA 3L3BA 4II2A 3HL4A 2DY0A 2QVZX 3AUSA 5CVVA 1JL3A 4AZ0B 2PLNA 3IJPA 5AVUA 2HCFA 3FVTA 5H81A 4DDWA 2EJBA 4ZMSA 2G67A 3LPDA 1J99A 1TCCA 4Y2TA 1RT9A 5KOIA 1JR6A 4MICA 1C30A 1O4WA 2OK7A 1W6RA 3QNMA 4KIWA 2GASA 2VYND 1G17A 3GA0A 4QL3A 1M34E 2PSDA 4J0EA 1UPFA 1VJGA 1W5SA 2QN2A 4P7KA 3VYSB 1CY4A 4EB6A 3U3KA 3B85A 3PXUA 1T35A 4RMIA 2R9VA 3G68A 4H3SA 4IGKA 1AB5A 2R47A 4RHYA 1Z3CA 4B40A 4BNGA 2ZI3A 3HLKA 4XR4A 2OHOA 4YACA 2NLOA 4K6FA 2D4HA 1L5OA 2TSYB 3HEBA 4DV1B 3TD9A 3IR6A 4IHAA 4MQFA 4D9CA 4KMSA 4X63A 3B70A 3ND9A 2Q3EA 2VP6A 2XW6A 4DIEA 5F5XA 3D8TA 2BBTA 2GEDA 3OKCA 5CB4F 4I50B 3OCZA 1OJLA 4WLNA 5BXQC 3MEQA 3FYDA 4W1SA 5AH0A 2HTEA 2YKGA 2GYUA 1KPIA 2C04A 2BZ0A 2BGTA 3CLHA 4H7JA 4AF8A 1P4JA 5D5QA 5LQDA 1IBLB 1LS1A 4OJMX 3A9VA 5REQA 1SXJE 3C97A 3ZW9A 1HEYA 2P2DA 3E9EA 3U3ZA 2BC9A 1TYEB 1QF9A 3KLOA 4FNMA 3FHOA 4UBOA 3WP1B 4AN0A 2IH2A 3C43A 1JXAA 4OB6A 3VYVA 4GMDA 3VR3D 3L0OA 4K9KA 3TSZA 3WL5A 3ZNOA 2W8BA 5TJHA 3PG5A 4KR7A 2X0IA 1ZO8A 3ESBA 4Q9LA 1XMOB 1VC2A 2DF8A 3JWHA 2GEJA 3CISA 5CFLA 2F1OA 5EWMB 2ZQZA 4LS3A 4B3FX 1IXSB 1RAIA 3FPJA 5DGTA 2F43A 4OHKA 5C1BA 1FJHA 2ZM5A 4D4IA 2HF2A 2WLTA 4A1OA 3HG7A 4J0CA 4N0DA 3S99A 3RAEC 2B2CA 2SCUA 4NDNE 2WHQA 1UQUA 4MVJM 1ZQ1A 3V9PA 1A76A 4I9HA 3I83A 5ITSA 3NTOA 3AFIA 3HJFA 2O5EA 1Y6JA 4FW9A 5J2UF 1O95D 1RRFA 5B2ZA 4DCJA 5CH3A 1FRVA 1ICIA 1NVVQ 4KQ1A 4G9GA 3V1KA 2WKWA 1WSBA 3V4FA 3C3EA 4GC9A 3SX0A 1VPTA 4Q7EA 3RBAA 3RWOA 5FFMA 3CZ5A 4LY3A 3U7RA 3UXYA 3DFMA 3ASVA 4K6OA 3USES 1F3LA 4ZVQA 2YWHA 3DS8A 1ZVMA 3RREA 3UK7A 5K3BA 5SYNA 5KWIA 3JWPA 3LFTA 1MORA 1EX1A 2ZPTX 3F46A 4BLVA 3O47A 4XDZA 4XFJA 3DAFA 2OV4A 1YBHA 2YN4A 3NBAA 2W6JA 4TL6A 1AQ6A 4A10A 2B3TA 5T57A 2JD1A 3GD5A 4HNAB 2IEIA 1MFZA 1V3TA 3VKHA 3E9YA 1PQWA 1W4ZA 5J4HA 2PPLA 4QAJA 4H7DA 1QRUA 3AR2A 4UBKA 1M6VA 2XE6A 5KYXA 1Y7IA 4MV7A 1WAMA 3ZVKA 4DCSA 1XZGA 1RXIA 3C2QA 2WQ6A 5ETJA 5KNCD 4CDMA 4QOFA 1AS2A 4A0FA 5J5CA 1TCUA 2EYUA 5SYAA 2QTVA 4A27A 1SBIA 2QZJA 3ADCA 2RGCA 3ZWYA 3QW2A 4QOSA 3WYFA 2DWQA 2Q07A 2HUNA 2VJKA 2ZXEA 1G5TA 3JCZA 1B76A 1SHKA 1TCAA 1TJ5A 1A5TA 2HK6A 2XMRA 3K8OE 3PLNA 3L7IA 2BFDA 2PFGA 3AHGA 4EVRA 4PG8A 3HP7A 2QIPA 1LPAB 3IMCA 4HNGA 4JKOA 4CWAA 5ARCA 4BIIA 1U2GA 1WS6A 3V8EA 3PHHA 4Y98A 1Z74A 3UXMA 3FIJA 2ZM6B 3DZJA 4UPEA 4GQAA 2C4NA 1AD2A 2ODNA 3F8SA 4C0SA 2BTEA 3N70A 3GYGA 2A5YB 1UXKA 1O89A 3D8UA 3QPAA 5H7XA 4UC0A 5BQFA 1C0IA 4Q1AA 4DLXA 4H3KB 3IXMA 4M1EA 3O2NA 4ERNA 4AZSA 4R1QA 3DGFC 4E33A 1CY7A 3COVA 1SIUA 1Z62A 2WTAA 5H3LA 1U6IA 2AI2A 2K2WA 5BWNA 2FP3A 1J2RA 3L43A 3RO7A 4I5GA 4JGGA 3GVXA 1R0XA 3IODA 1XWWA 3HYNA 2ETXA 1JQ3A 1L1EA 3NWEA 1IEQA 1U0RA 1YC2A 4KAJA 1UP6A 4RE6A 2XCLA 4YQZA 3USCS 1C9JA 4X8OA 4PZUA 3O75A 3V1LA 3ZG6A 1YIAA 4C7OB 2RSLA 2QROA 2QN3A 1G5RA 3CJRA 4IDBA 2XQVA 4LKOA 4FFWA 1P5ZB 5DHQA 1TM5E 3VYRB 1G42A 3BK1A 2KHZA 1NMSA 3ZDRA 2EJUA 4QREA 5TQVA 4GMXA 1PYOA 3OZIA 2XUFA 4FYXA 1HOTA 3KJZA 2YIMA 4OI1A 1MZPA 5BPFA 2NUTB 1OTXA 1KFCB 1Q21A 2X5KO 4P4TA 1XTQA 4Q39A 4EELA 5EESA 1EP1B 3K96A 2WF8A 4LCBA 3U4MA 3B82A 3KELA 4BRSA 4CETA 4F5DA 1KO1A 2HPZA 3LUKA 4V3BA 1P60A 3SHTA 3GN1A 3TXAA 1ZH8A 3ZDQA 4F5WA 2VTBB 3T5GA 1SCAA 1VFPA 4JK3A 16PKA 1A8PA 2GAJA 2MYPA 3IDSA 1M1YE 3BD8A 3QKWA 4BTEA 2JLCA 1S6YA 4R51A 1PJ4A 4ITVA 2CLDX 5EL0A 4G1BA 5JNVA 4ND4A 2CDBA 2GQ0A 2WHPA 4WKOA 4YAFA 4RFSB 1DIRA 4KUGA 1F14A 1TZ2A 1PNRA 4KSCA 5D1NA 3BUSA 3N86A 1MB2A 3U7EB 1CRZA 1I4TD 2GCPA 1L5VA 3K5PA 2VF7A 1K4KA 1XP5A 3NEPX 4HNVA 2A3NA 3HCAA 5G3YA 1LBHA 4RDCA 4U2GA 2GZMA 2OORC 1VRVA 2YJZA 4BKQA 4O4JB 4Z9XA 1UMDB 2ZRJA 1KBQA 3PWSA 1L4KA 5EE0A 3CRNA 1AUXA 3OF5A 2A1UA 5FUWA 4LX8A 3KRTA 3L84A 3AFHA 3PGA1 2WZCA 3D1LA 4S05A 1FXWF 4JI7B 4XWWA 3QVLA 5HOEA 3OY7A 5DGIA 1ACMA 1CQIA 1Z3IX 3UA3A 1AZWA 4UCWA 4R1OA 3DT6A 1BNCA 2LUOA 1KWKA 4YTEA 1LPPA 1IEXA 3DV0B 1R6TA 3AY7A 2G5TA 2D00A 5KYUB 3A05A 4YAUA 1UC8A 3WFIA 1GL7A 5JI3E 2JLXA 4F6RB 4OIFA 4BNWA 5DF1A 5KJCA 4XEHA 1YVUA 3CR3C 5BV1A 4LC1A 3N0WA 1ODKA 4ND5A 5LMCA 3BMOA 4E5YA 3QVKA 1KETA 2CXUA 6PFKA 4ZAYA 3TZ6A 2IPLA 1NW5A 2UZ1A 5DLQC 3IBGA 3GJ5A 3WL3A 2NVUB 3N0XA 3T9EA 1IONA 2OFOA 4E1AA 1GO2A 3SSNA 2JEYA 1QO7A 2XTMA 3O8OA 5JG7A 2ZSJA 1ORWA 1RJWA 1ULBA 3TKYA 5A1TA 4AKIA 2REXB 2Q41A 2O4UX 2QZ4A 3EJ6A 5KUTA 2O8EB 4WZAB 4MVJA 3J81A 4YFYA 3VKWA 3PC8C 2NT3A 3CM0A 2C2GA 4BVAA 4AP5A 3CEJA 4AUKA 2D0IA 3K1AA 3SX4A 3BA1A 3WIDA 1AGRA 1PJAA 2H48A 4ALJA 5AVKA 1V3QE 1IUKA 2Q9CA 2W00A 1M1UA 2CCJA 3O4VA 2NMVA 1KMIY 2D1YA 2VK1A 4Q3LA 1DG3A 2HRRA 3N9IA 2NUBA 4DLUA 3VZBA 4D26A 3Q7IA 2CXXA 3H2ZA 4E6PA 2CF5A 2FWAA 3VZSA 5E8JA 2LPMA 4HLUA 1TL7C 1CJTC 4XVCA 4YMLA 3IV7A 2I54A 3OQJA 1EIZA 4MB6A 3UKDA 2D06A 4IIEA 4OMUA 2O2ZA 2DC1A 2NYVA 3PI7A 1XHEA 1DAEA 2C3MA 2QJFA 3ED5A 3ZWOA 4J49A 2DECA 1I3LA 3IP6A 2AXPA 1RTTA 2VHTA 3WMWA 3GRRA 1FJXA 2QY6A 2DKFA 3OPVA 5C4MA 2AC4A 1CZNA 4IV0A 1W5FA 3DKKA 3L0YA 2IPAB 4PRYA 1AKQA 2C4KA 4DSZA 2OG1A 3G5MA 1JX6A 1E62A 1UM9A 1YU9A 3C6ZA 3KB8A 4K8RB 4DQVA 5C52B 2DT8A 3GJTA 1OLUA 2KLBA 2PWAA 2WF5A 4MVWA 4OBXA 4ZHQA 2O3SA 4N8EA 1KH1A 1U3GA 1Y1LA 3ZK8A 3FBWA 2G77B 2GMWA 2H2FA 2RHHA 3H97A 3LZ6A 3SZRA 3UUEA 1PEYA 1IFXA 1Z38A 1TO1E 1Z5ZA 1RXWA 4PXAA 4AI6A 4A91A 1UXJA 3AHCA 3K9WA 2DJ5A 3JWJA 1KR5A 3E7FA 2WWTA 2CL7X 1NW8A 3DO8A 2AD1A 5EIOA 4HGZA 3T7IA 3TEMA 1DBRA 4OYHA 5FI5A 1T8TA 1X80B 4J2OA 4DNFA 4ZC8A 3LPNA 4UHEA 2J7KA 3BL6A 2RI1A 3U3OA 4ZI7F 1J00A 4B2PA 5L8VA 3OESA 3BM5A 5AKKA 1TVMA 5HPYB 2CB9A 3Q15C 2AS0A 2WP0A 4KVGA 2DWOA 4BU1A 3ZN2A 4WA7A 1TTHA 1KGSA 4LIPD 4ZAVA 1CBUA 3K9LA 3OZEA 1F51E 1CDEA 1XWFA 4EUNA 1X86B 1D6MA 2EWVA 3M9LA 4IV5A 4QG7A 1FX0B 1HK7A 1QV9A 2O0JA 1BWRA 2OCGA 4AN4A 1H8HA 1GXSB 1BN7A 1E7YA 2IPXA 4UOEA 1IUNA 5I45A 5IH3A 1K27A 1YRLA 2AI3A 3VTFA 3F5SA 1W5EA 2WUFA 3FVWA 1YK0A 2W6OA 4Q18A 4ZRNA 1AA9A 3KB1A 5H3CA 2PQMA 3UJ9A 3WZ2A 3X1XA 4YMIA 4J6FA 1GQSA 1NUAA 1V71A 3C24A 2O54A 3WQBA 2PKCA 3HHPA 2IV7A 3IEKA 4JSRA 4S2EA 1GCOA 2X76A 3WQSB 3BXEA 4BNZA 1VL2A 2C1EA 2DKNA 5K01A 4YALA 5C51B 4X1IA 1UPBA 4C4PA 2O1SA 2Q7XA 4XLLA 3V1TC 1KE2A 4CLDA 2NOAA 5KYTA 3L06A 3MS7A 1E9DA 1AS0A 1OBVA 1J33A 3E3AA 1E2EA 3Q8LA 2F3PA 2Q99A 2YIDA 4A6DA 5DP1A 4NXMB 3IHTA 3WTCA 2VRWA 3LLUA 5KVAA 2IS6A 2P2NA 4J76A 5TPWA 3CHYA 3II6X 4U6SA 2F59A 1YA6A 5BQOA 1DQPA 1Z35A 2WTMA 3C74A 4JASB 4MB0A 1JZQA 4X9XA 1QQ5A 2H2AA 2NSLA 2PNFA 1N0HA 5FCDA 4OAQA 3ZOZA 1FLDA 1IJBA 1UANA 1ESDA 4WNAA 1Z6GA 2Q3DA 5ESRA 4C9BA 1JR2A 1ODFA 2WAAA 3C6QA 4MZXA 3ZDXB 2ECPA 4I3HA 1N6NA 1XYVA 1L3IA 3REGA 4MRPA 4Q0MA 3H16A 3V8MA 4JOQA 2PKXA 2XGOA 3RS8A 3OQIA 3M4ZA 1DMSA 4UDXX 5EXXA 4FBGA 1KMMA 1ZNXA 2O52A 2RJNA 3DBOB 1KJQA 4IICA 2UXCB 4E12A 5JJ5A 3A2KA 3DDSA 1MG5A 3H1EA 2BE7A 4AMVA 2HA3A 3EDQA 1JLRA 1ZMBA 3UJ7A 3EXHB 4DF3A 1F1JA 4E07A 3RC3A 1HV8A 2JF0A 4NZOA 5BYJA 1IIRA 1YS7A 4NWIA 1GT6A 1G5IA 3IBSA 3EK2A 1LTHR 2X23A 3DV2A 1XCBA 4JODA 4R5HA 3CNOA 3X43A 1HLGA 1T6BY 1WSWA 2PO5A 2QM3A 3HCEA 4U3JB 1O54A 3A1NA 5K0ZA 4U2FA 3K70B 2R62A 1DIBA 1H42A 1P9OA 1O3YA 1JAXA 2ZJ5A 2C42A 2CGEA 2EX0A 3MIIA 4UXIA 1SNYA 3R3XA 1JYFA 1XTVA 2N9UA 1ZLYA 4F92B 1IVYA 1WDMA 1SXQA 4JLUA 1G18A 1JG7A 2NIPA 2R3SA 4EZBA 1E2NA 1LLFA 4OK6A 1P0QA 4LOAA 1NP3A 5KNBA 2XYHA 3WV5A 3BTOA 3WGQA 4CNBA 3NNSA 4D6PA 3QEAZ 4Z4HA 4D99A 4M0CA 4CL8A 3AFGA 1MR3F 1SHZA 4AJ1A 4I55A 2NUAB 3STTA 2EDAA 4HG2A 2WFLB 1X7YB 3T7KA 5CD9A 1H85A 1RJ9A 3QSGA 4G0PA 3SR3A 3KEQA 5HX7A 5ISMA 1SQGA 3ZTYA 3CPHA 4WKCA 2Y2UA 2Z98A 3FDZA 1Q7TA 5C8YA 4BB0A 2SECE 4LECA 1KZ1A