2GCPA

Crystal structure of the human rhoc-gsp complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho-related GTP-binding protein RhoC
total genus 59
structure length 177
sequence length 178
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcpA00
5JFGA 2J45A 1G7RA 1R0WA 2DB3A 1QHGA 1NMZA 2CNWD 4DSTA 5JI2E 2O8DB 1U0HC 5HTKA 1KMHB 1NIJA 2GCPA 1DELA 4CYMA 2B6HA 2GEVA 4YXWA 4C2UA 1X1SA 3E1SA 4UNRA 1SULA 4JLJA 2FPMA 2BMFA 1SXJD 2VO1A 1J2JA 2XOKD 3TMKA 4YLGA 1ZJ6A 3E70C 1ZM9A 1FW6A 2J5XA 2W0MA 1HY3A 1GIAA 2J0UB 4V03A 4GNKA 4YQFA 2PJZA 5FTJA 5DI3B 4JL5A 2EW1A 1RZ3A 3N2IA 2FOLA 2RKOA 1YHNA 4B3BA 3U2QA 3DVLA 4JLDA 3U61B 2WM9B 3BE4A 1E9EA 2FWRA 4D81A 4KLNA 1G3IA 1YR7A 3A1WA 1BYIA 2QROA 1VTKA 4BLSA 3WP0A 3NG1A 1KO8A 2OBNA 2F1HA 2QAGB 4ON9A 2ZRCA 1E2HA 4CEJA 1YZKA 1XCMA 4ZDWA 1BO6A 2JLUA 2MSCB 4IDNA 2WZQA 4MKGA 4PHTA 4URYR 3IDQA 4QXAA 4OI4A 4AG5A 3T61A 1RC8A 4GP7A 2A78A 5CJPA 3FTQA 4NCNA 4C0KA 1X1RA 2OM2A 5J4YA 3ICEA 2HXYA 2XEXA 4DUGA 4V0ME 4IEIA 5LB4A 3M4YA 4PQRA 2NO7A 2JGNA 3SE0A 3Q9LA 2FGKA 2V4ZA 3BB1A 4DEXA 4XD7A 2NPFA 2ZXUA 1X8LA 2A30A 1XTJA 5FBRB 3DM5A 5GVRA 2BBOA 4Q4JA 1AA9A 1EFHA 2VHUA 3Q5EA 4LJ4A 3HWSA 5FH9A 4QBFA 2G1KA 3NC0C 3PEWA 5JSZA 3QPWA 4TZ0A 2WWHA 1G7TA 1XDBA 4US1R 3P27A 1JR3A 4HUTA 2AK2A 1PVOA 2FU5C 2ZE6A 4TL6A 2RH5A 3NIBA 3NHBA 5BN3A 1G64A 1QG2A 4PZZA 2OE2A 1Z0IA 5B57C 1AKEA 4N0EA 2QQ0A 4EKDA 2IUSA 4PQYA 5B58C 3CONA 3PUYA 4QRHA 3PUVA 4M1YA 1NG1A 1GSIA 2IT1A 3I4LA 1IHUA 3AKYA 1VIYA 1EFUA 3FMIA 4IDPA 2GJSA 4M8NE 1FOEB 3WYAA 3X1ZA 1E9SA 2P6NA 2IEZA 2UZ3A 3FHOA 2G9NA 3T15A 4GL2A 1GOTA 3CB4A 4OHZA 1R8QA 4B6EA 3HDTA 3TK1A 4MQBA 1XU4A 4B2PA 3CZPA 1IN7A 1A1VA 1KSGA 3WYGA 3S1AA 2GXQA 3TE6A 3QQ5A 1CLUA 2J9RA 4KV9A 1RRFA 2QT1A 5KU1A 3Q72A 5FUYA 3CM0A 4Q00A 1JPJA 2RGXA 4GMXA 1RIFA 1CRQA 3OEHA 3AGPA 4JBWA 2FV8A 2WIAA 4P4UA 3BB3A 1N25A 1E9BA 1SQ5A 2QP9X 3IHLA 1RFLA 1OH5A 3QOFA 3ZLJA 2ONJA 2SHKA 2WV9A 1N6RA 4HZIA 721PA 3GPLA 2DFTA 3D7MA 3FB4A 1E1QA 4I99A 1EGAA 1SKYB 2GK7A 2GBLC 4MITA 2OFOA 1GITA 3VHXA 2GILA 2Q3FA 2BM1A 2XTMA 5EZ5A 4QHTA 1K6MA 1E2QA 2OFWA 1JEEA 2W2XA 3WXMA 3K0SA 4DC9A 1HA3A 1CIPA 1P4SA 2J1LA 2QSYA 2Z0MA 2JLRA 1J70A 3R9WA 2VPPA 1Y63A 4LPSA 1ZMXA 4MRVA 1SXJB 1AM4D 4HUQA 4E03A 3L0PA 4D4LA 2Q6TA 2YC2C 4A0RA 3DO6A 5BN4A 2WIBA 4WZAE 3U7FB 1QHHB 1YRBA 1G6HA 3DMNA 1SKQA 5DI9A 5TXGA 4YMVA 2QRZA 2R65A 1ZM3A 1E1RD 2WJHA 1JQLB 2ERYA 4M4SA 4LGMA 5DIFA 4QNRA 3MWKA 4B44A 2OXCA 2QMUA 4NONA 3SN6A 2FDCA 4PC1A 1DAGA 3TW8B 3WNCA 3CX7A 4IDQA 3SJAA 4Z1MD 3V4RA 4A6PA 1KYIA 4ACAA 5FBVB 2JLSA 4H1UA 4DDWA 1Q1ZA 3W8RA 1OXUA 3SHFA 3UG6A 5AJYA 1DEKA 2BCJQ 3T5GA 5JCPA 3SBEA 4HZUB 3GJ3A 1K5GA 4O3MA 3ZZTA 1YR8A 4QBHA 2QORA 2F9MA 2IYQA 1KAGA 4WBSA 1SXJE 5KNCA 2ZI6A 3QXXA 2GRJA 3CRQA 2CHQA 1W46A 2AFIE 1XP8A 3ZIAD 1J90A 5HCIA 1VCMA 4YMWA 1L4YA 1W4BA 1FMJA 1GDDA 1XCPA 3VX4A 1EFRA 4LC0A 1XEXA 3MAAC 3RS0A 1G3UA 4P32A 3EXAA 2GJ8A 2ZRLA 4RFVA 5CDFA 2A2ZA 4DLVA 2P5SA 2O5VA 4PPQA 3U7HB 3MWJA 4CZ2A 4RSGA 1VG8A 5IF9A 3C7KA 1R0ZA 3ZS9A 3QF4A 3FDIA 2VHTA 4DLZA 2EFHB 1G18A 2JASA 2O8BB 2YYZA 1AGRA 5TARA 2I3BA 2CCJA 4AYWA 3AVQA 3D8BA 1FFHA 2R6AA 4GT1A 4XTRA 2IS4A 1GWNA 3DZDA 1XD9A 1FX0A 4D0GA 1HURA 1SVMA 2VTKA 4M1KA 4JL8A 1SXJA 3QKTA 4ESVA 5JCZA 2WICA 2EWVA 1W48A 4B33A 2XTNA 2ZJZA 3CX8A 4NP6A 3RYTC 5EE1A 4M22A 4D25A 1YZUA 2GJKA 4US2R 2HJVA 2CVFA 2QA5A 4DLRA 4NYMQ 1FUKA 4KFRA 3KKMA 2XTZA 3OIVA 4PC3A 1XEWY 2RCNA 2ORVA 4PX9A 4NYMR 1QF9A 4GP6A 2HCJB 4F91B 4UKDA 2Z4SA 2QBYA 3CIOA 3QG5A 4PSVA 4OBEA 4QOSA 4JLMA 1G7CA 3BB4A 1UBCA 4PZLA 1UJ2A 5KUTA 3EG5A 4B71A 2H18A 2VP4A 4B35A 3GCGA 2FA9A 3GLHB 1OE0A 4L15A 3V9PA 2QM7A 2VA8A 1Z3IX 3OE7A 5CB6A 4HLUA 5TMPA 5LD2B 1NIPA 3GLIB 1SVSA 1ZP6A 4PFSA 2GXAA 5GJWC 4HATA 3ND8A 1CJKC 3B9QA 3VMFA 2AHOA 2PMDA 4TN1A 1QG4A 3VKWA 2FNAA 4MGZR 3K9LA 2R6FA 1XBTA 1GKUB 1Z5ZA 2W0SA 4RFSB 5HE9A 2FF7A 3L82B 1U9IC 1CJUC 1ZC3A 4RD2A 1AS3A 3A1TA 1ZM2A 1Z6GA 4HB2A 1P61B 3THYB 4IOLA 1KI2A 1GNQA 4BEBA 1P72A 4GOJA 1M1YE 3THWB 1XWIA 3BC1A 4JSTA 3WRXC 1NJFA 3CNNA 2BVNA 1I2DA 1UKYA 4O0MA 4TL8A 2IXGA 4WXPA 2XXAB 2QTHA 2W2TA 1GL9B 3BOSA 2EQBA 2JLZA 4TTQA 4IJMA 5AUQA 2PLRA 3AH8A 4QG7A 1B23P 1R5BA 1Y3AA 2DR3A 1G4AE 2WMNB 4BWYA 1R6BX 4A2WA 2XNSA 1T8UA 1TX4B 2WJYA 1P7CA 3IQWA 3SFVA 5JRJA 4OQMA 4BFTA 1OIXA 2FH5B 2P3SA 4PPFA 3SJCA 5EP2A 4CRWB 1AN0A 4LJ5A 4BLTA 4NTZA 3P32A 3I72A 3KKPA 2V54A 5B30A 3D31A 3FHTA 3PENA 1XFAA 4FWIB 4L8GA 2ZRHA 3LX5A 4FN5A 2YOHA 3OF5A 4G0NA 5P21A 1GNRA 2F3RA 1W0KA 1E0JA 2HV8A 1KTVA 2GXSA 4NCKA 1TU4A 2C77A 4BGDA 3LBNA 4LZZA 1RPZA 1M34E 2GEUA 4TMKA 1PUJA 2EYUA 1IJFA 1FPMA 4LBVA 4IKEA 2GTPA 1X8JA 1G16A 4AURA 3RLFA 2RGAA 3AKCA 5DN6D 2JLYA 4C0SA 3QKRB 2BBTA 3NBYC 1Q20A 3QSYA 2QTFA 1IM2A 4HYYA 1XXHE 3CNOA 2OAQ1 5TB5A 3U3RA 1Z8FA 3T1OA 4KLZA 4BQSA 3I73A 2I1QA 2DFLA 2R8RA 2R44A 3IHWA 4BLRA 2OBLA 3IBGA 3MJRA 1N6NA 3TNFA 3AF0A 2CEAA 2ZRNA 4TWZA 3QVVA 3SYKA 2H57A 2VP0A 2DWPA 4MKFA 2HUPA 3C16C 1A4RA 3HYTA 5BXQC 4A8JC 2AK3A 5AUPB 1JXOA 1XMIA 3AP1A 5K8LA 5KOYA 1EX7A 2VSOA 1G8GA 3TSWA 1FZQA 2IYXA 5JRZA 5C2JB 3QXSA 1JR6A 2F9LA 4Q4HA 3RRNA 1W36D 4Q9HA 4LDJA 4EJSA 4PAOA 4DT1B 1GM5A 4GI7A 3IILA 4A36A 3AF1A 1WP9A 3DZ8A 2QMOA 4LYJA 4EQ6A 4JLVA 1ZC4A 2P65A 3H84A 3I32A 3KZ1E 2GXUA 3U44B 3N5CA 4L9WA 1MKYA 3LQQA 4YONB 3BFKA 1DVRA 3HR8A 3F8TA 4CEIA 3DL0A 4Q48A 3T1VA 1DBSA 1P62B 3RSLA 1G3MA 2OLJA 3QEOA 1DAHA 2IXEA 2CLSA 1DAMA 4EFNA 1OW3B 1W7AA 2C04A 5EP3A 3I8XA 1KI3A 1P6XA 3UMSA 2IBMA 3A4MA 3T5DA 2OCAA 5FBLB 4HDOB 2R2AA 3EA0A 3QKUA 4FI3C 2D74A 4H9GA 4XVQA 3TBKA 2WWGA 1M7HA 1N6OA 4ZDIA 1CS4C 3A1SA 3GJ7A 3KXIA 4M0LA 1NL3A 4TYPA 4CEHB 1EG7A 3SHWA 2PX3A 5A4JA 2HEIA 4URWR 1XNJA 2J7PD 5D3MB 4A8JB 1MO3A 3TW4A 2PZFA 2QM8A 2ODWA 221PA 1IONA 3A1UA 4R7ZA 4QM7A 1HQCA 2N1BA 4NCJA 4JMPA 1FQJA 1XD2B 1EWQA 5AJVB 1QBKC 4DB4A 2V7QD 2F1RA 3VTKA 1N5IA 1Z0KA 3ZD7A 3THOA 3BAFA 4BFXA 4HDQB 4DIDA 4DLTA 1H8HA 3P20A 2FEMA 2RGCA 4LC1A 2AKYA 3M6AA 4TMTA 4B2IA 3GEHA 1CU1A 1WQ1R 4XIGS 3HP1A 2VH5R 5JWOA 2OSBA 1S3SA 3KQKA 3J81k 2HDNB 2QSZA 4PHFA 1AS2A 1KO5A 2REXB 2GCNA 4Q7KA 1E2NA 2X1VA 3ZVNA 1J8MF 2TMKA 1YQTA 2CBZA 4ZO4A 1TUEA 4OK5A 3MSXA 3T1TA 3KQHA 1NLZA 4PSKA 3SFZA 2IEYA 3OEED 5FR2A 1Q21A 1XMJA 2QE7A 2IYSA 3EZ2A 3SJBA 5L3VA 2G6BA 2KBFA 4BFUA 3TH5A 4EJSB 4D6PA 1L7VC 4US0R 1XTIA 1U94A 4Q1DA 4TYYA 1AKYA 3P1JA 3MWYW 1VIAA 4BFZA 1L8QA 2PX0A 4JKYA 4ILEA 4TT3D 4GOKA 4DLYA 1MO4A 1JAHA 3MRSA 2RGNA 4P31A 1NRJB 5EXSA 4BLQA 4Y0VA 4RD4A 2ZJOA 1HE1C 3QJYA 3OIWA 1RVDA 3BS4A 3CWZA 5FPYA 5JJLA 3TSOA 2C78A 4DSOA 4CEIB 1KAOA 3VKHA 2QT0A 2XSZA 3SQXA 4FCWA 3GLGB 4V0OA 3VR5A 1MABB 2DFKB 4BFSA 2RB4A 1TTTA 3T34A 1E6CA 3R9IA 1AQYA 5FFMA 4IRUB 2CMKA 5FL7D 5EUQB 3FHCB 4KFUA 2GBLA 1UKEA 1UDWA 1ZBDA 2D06A 2ZR9A 3LXXA 2FPKA 2VHJA 4R71A 1MH1A 1QVAA 1Q3HA 1RRGA 3K70C 3K0FA 1XD8A 5IHPA 4MRSA 4I81A 4LSGA 2NQ2C 3TKLA 4KXFB 2ZRGA 2CE7A 1F2TA 4OQXA 3LV8A 1U8ZA 2OCBA 3UPUA 3UATA 3NH6A 2WWXA 3QNUA 1E0AA 1KO1A 4QGFA 2QRNA 4U5XA 2AWOA 2OESA 2B8TA 1Z29A 1ZD9A 3JVVA 2PT5A 1A2KC 5TY0A 5JJIA 2R9VA 1LTQA 1T3HA 4UXIA 4LHXA 5EP1A 3KQLA 1ZCBA 2ZUBA 1ELOA 3EX7C 5EE9A 1Z83A 4DB2A 4IHQA 3ZQ6A 1JPNA 2J7PA 4KSCA 3ZVLA 2QG6A 4NYJQ 1BMFA 2WMOB 3KJEA 2H5EA 2LCFA 3X1XA 2WWYA 1S8FA 1F5NA 3ONWA 3JZAA 2J7KA 3R7WB 4A82A 4FWTA 1ZIPA 4DDVA 4MDFA 2E87A 2Q9AA 1D8TA 4C0AC 2W6JA 2QGNA 3TR0A 3LBHA 1QDEA 2ZAOA 4ZCIA 1KO4A 1E2PA 2ZANA 2ZR0A 1WF3A 1G17A 2W2VA 3PUZA 4D80A 5JS8A 2XJ4A 1U99A 3WNBA 4AKHA 3CRVA 1PLKA 2ZVQX 2QTVB 2NZ8A 3AP2A 1OT3A 1ZUIA 3B13B 4KSBA 3TQCA 3PV0A 3CO5A 5M04A 3O8RA 5SZJA 4P33A 1DAEA 1LS6A 4QL3A 1FTNA 1LB1B 1Z63A 4RVCA 3EPLA 1JJVA 1XTRA 2G83A 4IW3B 1YU9A 3OIUA 3QPUA 5DLQC 2V9PA 5LBIA 4NE2A 3DOFA 4D0NA 2J59A 5AJZA 4F93B 3WYFA 5JS7A 1U0LA 4B76A 5J4KA 2CVHA 4C30A 2D7CA 5KPDA 4L9SA 2LWIA 1ESNA 1F2TB 1R0XA 1KJZA 3HJNA 2XJ9A 3CR7A 4NZYA 1LY1A 1ZRHA 4PAQA 421PA 4NYIQ 3AQ4A 3ZGXA 1Z6XA 5JWHA 1EX6A 2QUZA 1W2HA 3WBKA 4WA7A 1HYQA 4TYNA 3I92A 3L43A 5F9FA 2BMJA 1II8A 2IYLD 2NMVA 4CIDA 1E2LA 2NO1A 1QRAA 5KDDA 2BC9A 3AVYA 2A5YB 4CF7A 4PC7A 5CK4A 4TMXA 3PUWA 1NG9A 2I1VB 4ZV4A 1E32A 5TDHA 2R6GA 4QJ4A 1XXHA 3LQRA 4IFBA 4D4JA 5A0FA 4BZPA 3EZFA 3IPXA 3NXSA 1T0HB 4PHGA 1NF3A 3R7WA 1G5TA 1DAIA 4HLUC 5IRCD 1G291 4MGIR 1N6IA 121PA 3K9GA 1D2EA 2L0XA 3IUYA 5FL3A 3HU2A 4FMDB 2NZJA 1R2QA 2HLDD 4WXRA 3WNDA 4M21A 4WOPA 5DE3A 2GDJA 5KNDA 1KMHA 5FTKA 3B78A 5GVSA 1E1QD 2ZPTX 1Q1QA 2W83A 2QZ4A 4NBSA 3VFDA 3NVAA 1OB2A 3K0CA 2F43B 3B85A 2BJWA 1OF1A 3LRPA 5JBQA 4ITRC 3O8BA 4BFWA 1YVDA 1A82A 3B1VA 2QP4A 4F4IA 3V00A 2NO9A 2PEZA 3P26A 3LVQE 3TR5A 4TYWA 1ZAKA 1OH7A 3A1VA 1GRRA 2BDTA 3U3MA 3NBXX 4JL6A 4OJQA 3KUDA 5J47A 2ZQ5A 4V0NA 5B64A 1TQ4A 3AVVA 1BKDR 3LA6A 2QPAA 3ZJYA 1EK0A 2J87A 3VR2A 5C18A 3EZ6A 2QN6A 3O8DA 1II9A 4B47A 4ZCLA 5DHFA 4JLNA 4Y0AA 2GVDC 3VR3A 4GPTA 4P3YA 2Z43A 4LV6A 1GP2A 4CEJB 1COWD 1SVWA 1WBBA 2V1UA 1OXXK 3AUYA 1T6NA 1J8YF 2ZJAA 3AVOA 3BD9A 2ZEJA 3AF4A 4QBGB 5AJWA 4XJXA 3TIFA 3NHAA 4QKQA 3EC1A 5KSOA 2XGJA 2F1JA 5KSYA 2C96A 1E3MA 1VCNA 1XMSA 2MMGA 1GKIA 4G5SA 1N0UA 1N5LA 1U2RA 4MUAA 4NHOA 4DLWA 2NG1A 3QXJA 1KI4A 2ZS8A 1E96A 4A92A 1LVGA 1DPFA 2R6DA 4WZ6A 3BFXA 1UFQA 2C5LA 2HCBA 1P2TA 1Z28A 5JWRA 2J3EA 1N6PA 3CUEF 3DKPA 1UF9A 1XX6A 5E95A 2Z4RA 4Q4JB 3UWKA 1J7KA 2F3TA 2ZRMA 5EJEA 4JVLA 4JJKA 2IWHA 2FZ4A 5FUWA 5HR5A 5L8VA 1ZNWA 2ZS7A 3MLEA 5FTLA 1XMVA 3FMPB 4ESHA 3QF7A 1CEEA 4LHZA 1YZGA 2ZUCA 3DHWC 4W5WA 5EXTA 5FTMA 3PIRA 1HE8B 4AKEA 4DBLC 3KFXA 1CR2A 1MO6A 1CR0A 4XSHA 3KB2A 5HKKD 3I5YA 2PH1A 4KU4A 5E7JA 2O8BA 4E22A 2CLDX 1IAQA 4Q7JB 5BYKA 1GRQA 5SZKB 5CYPA 1KDRA 2JATA 1I4TD 4M9QA 4N0DA 4B75A 4A6XA 5L3SA 3EIHA 2HF9A 2PMKA 2PCLA 2QNRA 4OYHA 3RS3A 3UMFA 4X8OA 3K0AB 3VU9A 2AXPA 4BE7B 4HI0E 3SZRA 1U8AA 5LB2A 5K8IA 2ZITA 4FCVA 2K5UA 4WW0A 2GZHA 1KHTA 2V55B 5DSZA 4BASA 4EFLA 3B5JA 1TQ2A 1EXMA 4OHXA 2ZYWX 4Q7LA 4XOIA 3RRYA 4MDEA 2X77A 1G4UR 2Z6VA 3AV0B 3P4XA 1R5NA 1SVLA 4JLKA 2YWFA 5DO9A 4JT4A 3ZZUA 2ZS9A 3A4LA 4URXR 4Q02A 1X3SA 1UPTA 1OKKD 1QHSA 2D62A 3GLHA 2HJGA 1G8FA 2O0JA 4S35A 5J4HA 1E69A 4GOXA 1A5TA 3O47A 1G5RA 5L3RA 1X6VA 1KSJA 2ZYTX 1C1YA 3UMRA 2RGEA 4TMZA 4OHVA 3QE0A 4LJ7A 1G21E 4GSYA 5DN6A 2PCJA 3GLIA 3U5ZB 1NBMA 3G82C 3MMPA 1JNYA 1T5IA 2GVZC 2ZYUX 4UNQA 2IA5A 3RHFA 3CH4B 3TGPA 2VRWA 3P4YA 2YWHA 2JJ2D 1DAFA 2CNWA 1IY1A 1TF2A 3AM1A 1Q3TA 2PZGA 3UIEA 3C5CA 1JB1A 4FIDA 2DFNA 2AXNA 3AKDA 1M6NA 4IOMA 2WKQA 3LVRE 1XPOA 3EIQA 4DDTA 1YZLA 3QXCA 2IHYA 4QGAA 2MSEB 1M8PA 4G5RA 5H70A 3RS5A 3FPAA 2AWNA 4HSEA 2QAGA 2IF2A 4HUQB 1CJTC 1ZD8A 4GMDA 3K09A 4UXJA 3UK6A 3NBFA 3TUZC 3I61A 2OXRA 2KSQA 3NC1C 1U0JA 2REOA 3TVTA 2JDID 2QI9C 3GJ6A 5E3HA 3RS2A 4KFTA 3WRYC 3JZMA 2W6JD 4URVR 2RAPA 3LW7A 1N6KA 4TMWA 4Q9JA 4E5UA 1CJVC 3G0HA 2OCPA 3K0AA 2RGNC 2VF7A 1DO2A 3VR1A 4D82A 3NKVA 3BH0A 1FMLA 2BHRA 2PBRA 4M9ZA 3KTAB 5EE5B 1W5TA 5EXPA 1XPRA 1L2TA 1Z6AA 4NCIA 4ZDJA 2W00A 3DM9B 4P0TA 5TV2A 3RAPR 4JIMA 2XITA 4JYCA 2YWEA 4DHEA 1HEIA 3LFUA 1T3SA 1VYUA 1ZUNB 4XD7D 3PVSA 1KI8A 3BXZA 2CHGA 1BH2A 1K5DA 4L5BA 1OV4A 1U8YA 4POAA 1S9DA 4C2TA 1AZTA 3MWLA 3I8SA 1FP7A 1I2MA 4DUGD 4Z8YA 4BLPA 2WHXA 1D9ZA 2EWWA 3VR6A 1G8HA 3QG1A 4HAUA 4TYQA 2MMCA 4ASUD 3IPYA 4V0LA 1KY2A 1PZNA 4XH9B 1KKMA 5BQ5A 1W47A 2IYYA 3CPEA 2XZPA 1SGWA 2JLVA 2OG2A 3R8CA 1U81A 4X8MA 1G41A 3ZIAA 1M7GA 1KI6B 3ASYA 4TTRA 2OHFA 2OBMA 1UBEA 1OFIA 2FSGA 1YRAA 4DLUA 2WWFA 4QBIA 2V8OA 1NSFA 4A1FA 4DT1A 1CKEA 3WP1B 5CIQA 4BFYA 2RHDA 5G53C 2GNOA 5HCNA 3SOPA 3EPKA 4AK9A 4KFSA 4QGHA 2IYWA 2O8CA 1Z07A 4PSAA 2KJQA 1UEIA 2D3WA 4I1SA 1VKJA 4Q4AB 2OT3B 5DHAA 5AUNB 2BBWA 1HT2E 2ZI4A 1QHIA 4IDHA 4LRWA 4B3GA 4G3XA 1UEJA 1VPLA 2V3CC 3B1YA 3SEAA 2PZEA 4CW7A 2AFHE 3BJIC 1E9RA 1XPUA 4PO8A 2ANBA 3HPQA 1N2CE 1Z0AA 4LYHA 1EFTA 5JI3E 2Q9BA 3BRWD 3QY0A 4YXWD 2J0VA 1A7JA 1TUIA 3X1YA 1N0VC 3G5UA 4QNMA 2YC4C 1G5PA 2QBYB 1NKSA 1Z2AA 2C9YA 3QIAA 2X2EA 5FR1A 1KZGB 3PQCA 3CRMA 4OQNA 1NJGA 4PAMA 5L3QA 2GEDA 4ACBA 4CEHA 2YOFA 4LHWA 5B2ZA 4OKSA 4IOKA 5D3MA 4BFVA 2UZIR 3A6PC 3K9HA 4AKGA 1SKYE 1DTSA 1XTSA 2VL7A 2VQSA 2BEKA 3AB3A 4FMCF 4IXMA 4KAXA 5E7IA 5GJVC 5UKDA 2H8KA 4Q03A 4ZDKA 2WPDD 1E2GA 1S1MA 2N46A 2KI5A 3HU1A 5KDLA 1SVIA 3MJHA 1J99A 2ATVA 5KDOA 2ZE5A 2ZRIA 2V7QA 2ODNA 1LF0A 1OIWA 1NN3A 4KODA 3WBJA 1W4RA 2JEOA 3MG9A 3GFOA 4W5JA 3W5JA 2WJGA 3KQNA 3OAAA 1ZNZA 5GJCA 2EYQA 1S1CA 4ZKDA 4PHHA 3U3KA 3W6PA 2XXAA 4JZKA 2V6JA 5CDFE 2DBYA 4LHVA 4M9XA 4G01B 4IXNA 4DWJA 4HLDA 4MKIA 4BZQA 2V6IA 4QHSA 5FBWB 1FP6A 1AIPA 1HQYE 2ATXA 2NO6A 1ZNYA 1E94E 1P2SA 5FOTA 4Q1BA 2OFXA 2CHVA 2F7SA 3PEVA 1GL7A 1VG0B 3OHMA 2ZU0C 2KB0A 5FPHA 4AC9A 2HYDA 3EW9A 2DWQA 2OAP1 4TLEA 2QAJA 2PT7A 4B6FA 3CF2A 3KKQA 1W5SA 2RGBA 3I5XA 4HZUA 1E2JA 2O8EA 2B7BA 3UG7A 3O8CA 4BPBA 2OEPA 4O2LA 3RS4A 2JJ8A 3GJ8A 1S9HA 4RZUA 3WMFA 3AVWA 4QC2A 2H16A 2FFAA 5FOUA 3A4NA 3PUXA 1XCGB 1OHHA 5EP4A 4PZYA 3ASZA 2G3YA 1JAIA 3FYHA 1P75A 1KMQA 1OPXA 4DEYA 1U9IA 5JEDA 4B2LA 3AVUA 3GMTA 1P9RA 4PC6A 4DVGA 2C99A 2GJ9A 3GJ0A 1P73A 2QEQA 1ZCAA 4ZKEA 2EFEB 3H1TA 4Q1AA 2JJ1A 2B7CA 3NWJA 5L3QB 4TLDA 5HKKA 2ZRJA 3K0CC 4Q7MB 4K46A 1W36C 1Z2CA 3Q7PA 3KX2A 4URUR 1ANKA 4MYCA 3B9PA 3DPUA 2PL3A 2AL7A 4X8LA 1ONBA 3SU8A 2BIFA 521PA 4D0LB 3L0IB 4M1WA 3GQBA 4GFDA 3UKDA 3LDAA 5LPNA 1OLOA 3H0KA 4KCGA 1CR4A 2NO0A 2ZJ8A 4C7OB 2VHQA 3A36A 4LBWA 3SS8A 2WPDA 1H65A 4C0JA 4H1VA 4LV8B 3T1QA 5EQTA 4YMTA 2QE7D 3EA5A 4P4SB 2JLQA 1W0JA 1OYWA 5F2EA 2Z83A 3U44A 1ZM7A 2A5DA 4TLCA 3EPJA 3U3JA 3ADDA 1W0JD 3CZQA 3SC3A 5HZHA 4BUJA 1KK0A 1X8KA 1CBUA 3CRW1 3KB1A 1QHXA 2R62A 2P0EA 3AF2A 1E98A 2HLDA 1WXQA 2WJIA 4Q1EA 5ANRB 4G5QA 1KZ7B 4A0FA 4BRUA 1G7SA 2VP9A 4YC7A 1KDTA 3LO5A 3FMOB 4TZ6A 3FKQA 5JZVA 1W36B 4RFSA 3RRMA 4OQLA 4TQ9A 5G3YA 4JS0A 3RSOA 2BCGY 3HR7A 1RJ9A 3THYA 1KO7A 2ONKA 1FTSA 4A8JA 4KBGA 2CL6X 4UNNA 3LLMA 4JT2A 4OQFA 1TAGA 1XD2A 4FMBB 2E1RA 5IK2D 4EJSC 3W6OA 2ZJ2A 3C4JA 4DRZA 1E2FA 1KJYA 2OILA 3CPHA 5AUOB 1KI9A 1US8B 2HF8A 1XEWX 1N5KA 3OEEA 3PXGA 3LW8A 8OHMA 4AY2A 1KSFX 1G6OA 3NH9A 4OJKA 1KY3A 4Q1CA 4URZR 1RKBA 1Z22A 2C95A 1S2MA 2JAQA 2XX3A 4RZ3A 5CYOA 3REFA 2ZETA 2ZYVX 1IJEA 1UDXA 3OFND 1NY5A 4YMUA 1NVVQ 5KSZA 2C9CA 4Q18A 3GEIA 3ZYCA 1OFUX 2O8FB 2IYRA 3QBVA 4OI2A 4C0BA 3F5FA 4BLOA 3RVBA 2A5JA 1TPZA 2IS2A 4LWZA 2A3RA 2G1JA 4FCTA 3SYLA 3TUIC 1DAKA 1CF4A 2D2EA 4DJTA 4C7OA 3LWNA 2JCSA 2YVUA 2PJRA 1ZYUA 3IO3A 5JECA 5F98A 2ZRFA 2ZUDA 3SQWA 2FEOA 1MRSA 2ASEA 3BK7A 3U4QB 4J0QA 5J40A 3VR4A 2V1XA 5G40A 3CW2A 3KDSE 4LV5B 1NMXA 5H68A 1MOZA 2WJVA 4ARZB 4B73A 1IQPA 2OCYC 2KWIA 621PA 5DISB 4BZXA 1ZU4A 5FOWA 2XB4A 1F2UA 1I4DD 3M1IA 4XWKA 5K8TA 1JR3D 1II0A 1JQJC 2QQEA 1LV7A 1YZTA 4Q1FA 3W34A 4IVRA 4WIAA 1R0YA 6Q21A 1D9XA 1NN1A 2ZSBA 1UBGA 5FI0B 2IL1A 4DCNA 1T3LA 5G3ZA 5D3QA 1YR9A 4A2PA 4MH0R 1NN5A 1NVXQ 1XJQA 2UVQA 1R4AA 4TSFA 4RKEA 1E2MA 3MFYA 4NL4H 1HT1E 2WOJA 4WVFA 4JLAA 3RS7A 3AVTA 1XF9A 3HYRA 1RJ9B 5CB8A 4BEJA 4UNSA 1Z08A 3QBTA 1N0WA 2FE4A 2ZRPA 3CNLA 4WAUA 5KYKA 4B3FX 5J5CA 4B3DA 4HAWA 1KSHA 4DCSA 3LXRA 1C9KA 1N6HA 1R7RA 1ZNXA 3CH5A 2DCUA 3REGA 4JJZA 3K09C 3BGWA 2CL0X 3TSZA 4PPGA 5C1BA 2QP3A 4QM6A 5BYJA 2YZ2A 3AKEA 1VMAA 5LDDC 4I1VA 2ZAMA 5FI1B 2GF9A 2DY1A 3NEYA 4LCBA 3L8YA 4Q9LA 2ZJYA 1UADA 3VNVA 3VKGA 5FPSA 1JI0A 1NN0A 3BFVA 3FMFA 3EZ7A 2IUUA 4A9AA 3K9NA 5E7MA 2D7DA 3PEUA 4PR0A 4PTLA 3QXHA 4D4MA 1R5OA 3C8UA 3KXLA 1P2VA 1Q57A 1TADA 4EUNA 3E5HA 5J4VA 1Z0DA 2CK3A 4PC2A 1IN6A 1NSTA 1E1RA 3Q7QA 2RGGA 2NTYC 1ZUHA 2N42A 1E9AA 3QPVA 3SDZA 3HPRA 2XOKA 2RMKA 4EPRA 1O3YA 4JBYA 1E2IA 2QY9A 3B1WA 2O8DA 5EE0A 1DS6A 1OH8A 5DI3A 5JEEA 5TVKA 4AKIA 2LKCA 3OIYA 1F3OA 1ZINA 4AG6A 2ZE7A 4HLQB 3K70B 3LLUA 1VYTA 1E0SA 1MR3F 1D2MA 1F2UB 3WMEA 3OESA 4KBFA 4Q9KA 2RHMA 3OAAD 2G0NA 4R98A 5FTNA 3TRFA 5F9HA 2P67A 1NI3A 2IW3A 4JKIA 5JHGB 4RZ2A 2OUKA 4RCZA 1TNDA 1C4OA 2P5TB 2IUTA 1H8HD 5CM9C 2ZR7A 4PPNA 5JLJA 2BWJA 3UXMA 3OFNA 4Q47A 1KGDA 5DGXA 2ZRBA 3VHLB 1YKSA 3FE2A 5KNBA 4HAVA 3UANA 1XJCA 3CWQA 1JECA 2F1IA 2AX4A 1RRPA 2YWGA 4GRAA 3I3SR 1IOZA 5FOXA 1GL6A 1QZXA 1E4YA 1SVKA 3UWOA 1FNNA 4C3ZA 2BJVA 4HB3A 5K8UA 3PJRA 4MGYR 3KQUA 4RJLA 1H8EA 2XNDA 3MD0A 4W5HA 3I62A 1KOFA 1O87A 4RD1A 2HT1A 3C15C 2IS1A 3QKSA 4FMDF 5FPTA 4V0KA 1P5ZB 1D6JA 2ODEA 4ZI3A 3BH6A 2P2LA 1TU3A 5JSZB 2B21A 4Q4LA 3B82A 3GEEA 3RWMB 5BWMA 1XEFA 2BV3A 4M2LA 3U3OA 2ZM5A 1E79A 1ZW6A 4TQAA 3WMGA 1CJMA 2PLFA 1IY0A 3SJZA 1S0UA 1DG3A 3DEFA 3V4FA 4JVNA 4OL0A 5FPKA 5KHOC 4PO9A 4TT3A 2BMEA 5G41A 3JVUA 5AWFC 2EFGA 4RZXA 1L4UA 2IWRA 4F38A 3K0FB 2BKUA 4KVGA 1TF5A 1AJEA 4TMVA 2G0TA 4Q01A 3DKVA 4NPHA 1G8YA 1EFCA 3ADBA 4GDFA 3L0SA 3Q85A 3IEVA 4L4UA 4RD0A 1GKYA 4M1MA 4B48A 3R20A 1NY6A 4D26A 1RYFA 3QF4B 4KJZA 4AWXA 2JIZD 4LX0A 4BRWA 4DCVA 1UAAA 1FQKA 1V43A 2C03A 4MRPA 2YINC 1NBMD 2BMDA 4MYHA 3Q5DA 5ELXA 3EARA 3S1AB 4AYTA 3KL4A 4DSUA 2FPLA 3ZVMA 1CULC 3VX3A 3MUFA 1KI7A 4O2RA 2J46A 5FUXA 1W49A 5KPJA 1G9XA 2OLKA 4IFEA 2OO7A 2GESA 2FN4A 2IF0A 2AD5A 5IT5A 4NH0A 2DWOA 1BYUA 1JBKA 4A0GA 1HTWA 3D6TB 2WJJA 1IXZA 1DARA 3W3AA 5CJ2A 1P2UA 3X2SA 2ECKA 4XTCS 3K0EA 2XZLA 4N1AA 2P6UA 4LJ6A 4LK2A 2WKRA 4YDSA 2O0HA 1Z47A 3KUCA 3QKSB 2R6CA 1U98A 4MGKR 3E2IA 3ZQJA 2IK8A 2ZE8A 5EUMA 4ZIRA 2FSFA 1E2KA 2EFCB 4B43A 5C4MA 1COWA 3FWYA 4G5OA 1G3RA 1F6BA 4OK3A 1XB2A 1Z6YA 3IKJA 1QHNA 3A58B 4F4JA 2IX3A 2FGJA 3FFBA 2J0UA 3BIFA 2Z5FA 1B0UA 1D5CA 2YOGA 1SHZA 1GNPA 4HAYA 1SVOA 2ZJ5A 4DIEA 4NDZA 1Q12A 4MKHA 4ERNA 2GCOB 2JJ2A 4K81B 1KDPA 1ETUA 1T5LA 5HE8A 4M1TA 1TQDA 3ETLA 5FOVA 3VQTA 3WY9A 3TAHA 3ICQB 4PXAA 3CF6R 5FL7A 1XZPA 4LYFA 4DKXA 3B8HA 1GG2A 3Q3JB 4ZPXA 3W3ZB 1CP2A 1I4LD 2WAXA 3RANA 1Q1BA 2J0SA 5CLLA 4DDUA 2YV5A 1H8ED 2XNDD 1Q1EA 1R8SA 1SXJC 2BM0A 5E4FA 2EU8A 1U90A 3B1ZA 3EPHA 1WE2A 2ANCA 2VLIA 5H1YA 1VYVA 4Z51A 3U7GA 4X8HA 2GAOA 4AD8A 3H4MA 1NVUQ 4M53A 4XVUA 5L3SB 1OXVA 2D2FA 3QUSA 3M0EA 3VU9B 3ZH9B 4NYJR 1TF7A 1KNXA 2GHIA 2J41A 2VP6A 2E9SA 2ZIAA 3GJ5A 1NKTA 1N5JA 1FL9A 2FZLA 2H92A 4IOJA 3GP8A 5BN5A 4QHYA 1Z6TA 1IY2A 5IDVA 3LNCA 4TL9A 3PITA 4JSYA 2VBCA 1T91A 1XEXB 4IEEA 5HPYB 4LI0A 4QFMA 3FGNA 1FNMA 1OH6A 4TL7A 4E09A 3QKRA 4LUCA 4XWOA 1LF5A 3T06B 4LHYA 4Q5IA 1JEDA 1UM8A 1YZNA 1BMFD 5BW8A 3ZVRA 3CPJB 1E9CA 1AS0A 4JYBA 4UJ3A 3PR1A 2FSIA 3KJHA 4TLAA 2HT6A 3T12A 4HLCA 2GF0A 4UXHA 3B2EA 2IHBA 4WZBE 4ZIRB 2CK3D 5FOSA 4W9MC 3R8FA 1FX0B 4XSGA 4W7SA 4RKFA 3ND9A 5CIWA 1BIFA 4NCHA 4P4TA 4FXPA 4I1UA 4CGZA 3SNHA 4F92B 4HB0A 4OI1A 1CRPA 1LNZA 3LAWA 4Q4HB 3NDBB 5JJKA 1NNEA 3CRRA 1D2NA 1UKZA 4KITB 2GCOA 4UQOA 2DHRA 2G77B 1DADA 1WA5A 4MYUA 3GLGE 1LFDB 2WSMA 1T8TA 3IIMA 4Q19A 1IN4A 821PA 4AI6A 3DOEA 4B3XA 2WWWA 4Q9IA 4A2QA 1T9HA 4IVQA 2ODBA 5GADl 3TVDA 2FFBA 3H86A 3TUJC 5DYIA 1ZD1A 2WKPA 3GFTA 3ZD6A 1XZQA 3EIEA 2CCGA 1CTQA 1GRNA 4V02A 2YJTD 2FFHA 2AKAB 3GD7A 4C0QC 1Z06A 3GLFA 1R10A 1LW7A 2ERXA 3B6EA 2O8EB 2IC5A 3K70D 4KYUA 3T35A 4YMSA 5EZ6B 1AK2A 1F60A 2UKDA 1OXTA 1VG9B 3EZ9A 2OV2A 4Q66C 2ZSDA 5HZKA 4LYAA 2A5FA 2D4HA 3CBQA 3C41J 2NPIA 4DLXA 2JLWA 2IYZA 4JLOA 4C4PA 1G20E 1TEXA 3DMDA 1BS1A 1TL7C 2IYTA 5IK2A 4ABYA 1OFHA 2BOVA 1AQUA 3H2YA 2BEJA 4TLBA 2QU8A 5EXXA 1T0JB 1IXRC 1HV8A 1TEVA 2X8AA 1VDZA 3VNUA 4Z1MA 2BBSA 3F0TA 2A9KA 3D3QA 4XWAA 4OK6A 4RY2A 3KJGA 4PO1A 3W5IA 1QHHA 3W8NA 4B32A 1XRJA 2QAGC 3ZZ0A 4ZI2A 2WSSA 1GTVA 3CX6A 4QJ5A 3AF3A 4GZMA 3K8YA 2NGRA 1NP6A 1NBME 3B60A 2B92A 3EAQA 3GLHE 3NBZC 3W6NA 1PLLA 5A5GA 4B34A 4XVRA 2WOOA 3A37A 4B74A 3U7EB 3RWOA 1KI6A 2AN9A 3GLIE 2I4IA 4TSFD 4OHYA 2MSDB 3LBIA 2A7QA 4FMCB 2GAAA 3GFPA 2A5GA 2FX3A 5DNYB 3RC3A 2O8CB 1VHLA 1Q22A 4P4SA 3SBDA 1OB5A 4UJ5A 2FFQA 3IQXA 2B8WA 4LBZA 4IDOA 4L16A 1WMSA 2IXFA 1GFIA 2XB2A 3SR0A 3AP3A 4NMMA 5J4LA 3PG5A 5C46F 2ZI9A 3ADCA 3NDPA 2WTUA 4EIWA 1Z0JA 2GKSA 1KDOA 2Y8EA 3LY5A 3TLXA 1W4AA 3GLGA 2NOAA 1A2BA 1XJ0A 4CT5A 1GAJA 4JVSB 3W9YA 1VCIA 2IYVA 1RYHA 3SI7A 2JA1A 4MRNA 3N2EA 1CXZA 2C98A 3RRZA 4A0HA 3GLFB 4YDHB 3THXA 2ORIA 1HH4A 2VIIA 1DE0A 4HAXA 4U7DA 2GK6A 5F3WB 2DPXA 4U00A 3PEYA 5AJXA 3OEHD 1QHYA 2CE2X 3QI2A 1EFRD 3QVUA 1MO5A 3FFAA 2H1LA 4LJ8A 4DLSA 2XAUA 1NMYA 2J0QA 1Q0UA 1G3QA 4LOAA 2ZRKA 3EWSA 1RW4A 4NYIR 2REBA 1NLFA 4PQFA 1UBFA 3PCRB 2WVJA 3U6BA 4NU0A 4KI0A 2P6RA 4EPWA 1ZU5A 1SHKA 2QMEA 3B1XA 2ZROA 2ZSAA 3LH5A 3OE7D 2CXXA 4MUBA 1Q44A 2ZSFA 1MV5A 4FD2A 3KKOA 4TQUS 2NIPA 1EESA 1FUUA 2YNMA 2W6IA 4B3CA 2F55A 1P9NA 1IN5A 1AGPA 3IEUA 4CVNA 4EPXA 4JLBA 1W4CA 2GETA 3X1DA 1G19A 2VYFA 1VG1A 3GLFE 4KVAA 1EWRA 3WHLA 2ZI5A 3KTAA 3X1WA 1UKVY 1ZVQA 4C0LA 3RABA 1S96A 3QEJA 1VECA 2GJAA 2ORWA 2Q3MA 4K8OA 2CCKA 1OSNA 4JLPA 1F48A 2HXSA 3U60B 4DCTA 1M7BA 3L8ZA 2WBLC 4R9UC 4EFMA 5JMTA 1OXSC 5GJBA 2CL7X 4G5GA 3CKLA 3ZDQA 4E07A 3L0OA 3CLVA 1ODFA 4G1UC 5DYGA 2Q21A 1E9FA 5SZIA 2FG5A 2GA8A 3THWA 1G1MA 1JALA 4HAZA 3AUXA 4EPYA 2VHCA 1XTQA 2YHSA 4I4LA 4QJ3A 2ZU6A 1MT0A 3RNLA 2EFDB 3K53A 5CM8B 3THXB 4D4KA 3VAAA 3ADKA 5DH9A 3LX8A 4F7WA 4HEJA 1JXMA 1LS1A 3FOZA 1P9WA 1W0KD 3K1JA 2FMXA 3IIJA 4II7A 4LJ9A 2O0KA 2OZEA 3L2OB 2XZOA 4F4CA 3DDCA 4HDCA 1OFTA 2KBEA 4Q4AA 1W1WA 2ZVPX 3FKSD 4PANA 1CR1A 2CDNA 2W58A 2ZJBA 5CK5A 4TTPA 4C0HA 1E0KA 2CJWA 5CITA 4R2HA 1WCV1 3ECCA 2GZAA 2KE5A 1BOFA 2VEDA 3FKSA 2QGZA 3IGFA 4M1OA 5AK0A 4CDGA 1N3BA 4FINA 2XSZD 3NTUA 1MABA 2G88A 4AYXA 1IN8A 1KNQA 1GILA 3KJIA 4ASUA 2WWIA 4LBYA 2ZRDA 1XXHB 1PJRA 1XTKA 1W44A 1JR3E 2LKDA 2JDIA 1ZM4A 2ZREA 1M74A 1K8RA 1PUIA 3B7GA 4AIIA 5CLQA 3TJZA 1N6LA 2CLCX 2QMHA 2X2FA 3BWDD 3IO5A 5LD2C 2WSSD 2H7VA 1WB9A 3AVXA 3BBPA 3NEJA 2O52A 3CR8A 4Q21A 2FJUA 2F6RA 3ZS8A 1NVWQ 4UNPA 4C9BA 2GWHA 1OIVA 1YR6A 4V0MA 2AR7A 2QPTA 2GZDA 2H17A 4GBMA 4KHZA 1DOAA 1P3JA 2ZTSA 4OHWA 4N3NA 1GZSA 4RD3A 3OZXA 5EE3A 3HU3A 4M9SA 2F43A 4I1OA 4OI0A 2X19A 1DO0A 1IXSB 5AR1A 1YZQA 4LY6A 3MCAA 2DYKA 3U6KA 3KFVA 3MGCA 4U02A 1VCOA 3WHKA 4EQ6B 3A8TA 3FVQA 1KK3A 4A4DA 4RD6A 2PEYA 1E9DA 1WDTA 4JBXA 2ZI3A 1HUQA 4RCYA 1E2EA 4NKRA 4D2IA 4KYIB 1US8A 1E99A 2ZRAA 2YKGA 3RDPA 5KTYA 4FW9A 1YJ5A 1KK1A 2VSFA 2C8VA 3N70A 4MRRA 1WBDA 2RGDA 2VF8A 4EDHA 4GZLA 4EPVA 1TQ6A 2Q3HA 4HB4A 1GUAA 5C4GB 3GJ4A 1MRNA 1QVRA 2IYUA 2C2HA 3CF0A 1M2OB 1IBRA 1DG1G 2O8FA 5H8WA 5FBQB 3TQFA 3AEZA 2BKEA 1KI1A 1OHHD 2CJWB 2QL6A 1YE8A 2EVWX 2IS6A 2ZI7A 2C9OA 4R2IA 3I1FA 2Q0HA 1KIMA 1PLJA 3RC8A 1W2GA 1WRBA 3U4QA 4DCUA 4O25A 1S4QA 4QGGA 4DXAA 3EASA 4ARZA 3BORA 1T4GA 5SZHB 1E2DA 1E79D 1NVVR 4LPKA 5FUVA 1E4VA 4ZCMA 3Q8XB 4MYTA 3BERA 3IIKA 1OYYA 3KKNA 5KO2A 4LJAA 4A15A 3KXKA 1ZIOA 3C5HA 1KJWA 1X86B 2QENA 2VSXA 1PV4A 2W6ID 4JVMA 2ZSEA 2VP5A 2WAYA 1Z0FA 2JLXA 1SZPA 4CT4B 4EAQA 1KK2A 2JJ1D 1P60A 2QPOA 4EPTA 1V5WA 4KO8A 3W90A 2VP2A 4Z54A 3C14C 3BH7A 1JJ7A 1VHTA 1GVNB 3GJXC 3F3YA 1TMKA 3EC2A 3LD9A 1II8B 1S3GA 4IVPA 3EWAA 4Z8XA 5JHHB 2FSHA 3SYNA 2AD1A 4LJYA 1OKKA 4BECA 1G8PA 1AZSC 3AVPA 3IBYA 3AGQA 1OJLA 3R9XA 3PFIA 4MA4A 4DZZA 3TAUA 1KKLA 3QENA 5KSPA 2JIZA 4DSNA 4S2EA 1NLYA 1RE0A 2HYIC 1ESMA 2Q9CA 4M1SA 1RRCA
chains in the Genus database with same CATH superfamily
5JQGA 5I45A 2VJPA 4CR8A 4OL9A 4ZCTA 1NMZA 4ZAVA 3TSYA 2IEAA 4C08A 1U0HC 1XL1A 1M0SA 2ZJ6A 3ESYA 4PQGA 1EZ4A 1KMHB 1CQJA 1U7TA 2RI0A 3WB2A 4CYMA 1JLSA 1MVOA 3BRWA 4LVNA 3ZEIA 2JKZA 4UNRA 3GZNB 4ZO9A 3T7CA 4XGQA 1ZRMA 4L3OA 3KJZA 4DR6B 2IZZA 2QYOA 1O2DA 5KBYA 1JXQA 4D9CA 4Q12A 3V1NA 1PZFA 3OLWA 1XZMA 5JMOA 2FPMA 2BMFA 1TK3A 2VO1A 1FUIA 4FSXA 5EEHA 1NFQA 1WLSA 1XQVA 4CN8A 1MZPA 1RZVA 1Y37A 4WKOA 3I09A 5U4QA 3AEQB 1MW9X 3HCFA 2J5XA 2W0MA 3N7TA 4QSHA 3S2SA 4BUCA 1GIAA 3LS2A 4B2YA 1VL0A 3A7EA 3DFZA 4V03A 2JZCA 5FTJA 5LMZA 5LYJB 2WJ6A 4YECA 2H54A 2JNWA 4CMGA 5IMBA 4RV5A 5F52A 1NNLA 2FOLA 3R6GA 2W22A 3EW7A 4JC5A 1L5MA 3M4JA 2W4IA 3QUBA 3LLCA 4P22A 1HNXB 3KT3A 4PXSA 4PVCA 3JQPA 2WM9B 3BE4A 3OOHA 3TOZA 3UT0A 1GZ3A 4XYMA 2R00C 4D81A 3WJ2A 4KLNA 4QUAA 4KDEA 2C0PA 4Q1VA 1T8PA 3WK5A 4OLFA 5E8JA 1MAAA 1VTKA 4XJSA 3DWFA 2GD1O 4BVFA 3SE7A 3EEOA 1GQFA 3NCTA 1U2GA 1O89A 2VR1A 1BU8A 1XLTA 2VDMB 2ZTHA 2Z4TA 3PXBA 5A2QA 5ESXA 2QRMA 2RCYA 1BO6A 3NIDB 4PZCA 4LF6B 3UHAA 2MSCB 4IDNA 5GINE 1JIXA 3IDQA 1KQOA 4AX4A 3O8NA 1EUCB 3DZBA 3CNHA 3HB9A 1NNUA 1T9GS 2VUTA 2XA9A 2Z1MA 2ZVDA 1YQXA 4OI4A 1E62A 2A78A 4ZT7A 5IBQA 4AG5A 5CBPA 2VA9A 2GEFA 3FTQA 4N3BA 2ZIGA 3DE1X 1S7CA 1L8AA 1JKXA 1V45E 3LUFA 2OGTA 3PC6A 4RVFA 4F6CA 2HXYA 2XEXA 1JIVA 2G1PA 1N1GA 1O95A 2C2MA 3HWRA 1K7XB 4ED9A 4FEYA 7AT1A 3L1VA 5LB4A 1U7HA 3M4YA 1HLPA 1KJJA 4HUJA 4GI5A 4KI7A 4PQRA 5DM60 5CEFA 1ATZA 3WLKX 3ZE1B 1V16B 4OY3A 4F8EA 2A30A 4AP9A 2FOXA 3A4VA 4JEIA 3MTBA 1G8SA 3D2CA 1LLFA 2IELA 1AV6A 1PYGA 1FSSA 2QRPA 4KIJA 4LGCA 4LJ4A 3TDMA 1TO1E 4CM7A 2G1KA 5JMWA 3NONA 1HE4A 1VI5A 4TZ0A 2JGKA 3G5MA 2CT8A 1CS0A 1NTRA 1E3QA 1XDBA 2J33A 3NTRA 1Y1KE 2ZYAA 4CMEA 4AY6A 1PVOA 1H6BA 5DNDA 2P77A 4BEVA 4NS1A 5H3CA 1L6IA 2CWDA 1SCQA 3VPCA 3P9RA 4G0YA 1Q14A 4HADA 5CVCA 3IERA 2F00A 2IUSA 3BGOS 1ZUWA 4QRHA 3CKKA 5IFKA 1YRWA 2IPAB 4EMSA 2J30A 2ZBUA 1QG6A 1QF7A 4OHMA 3ZLUA 3MINA 5I9NA 4HEQA 3WDSA 1H4QA 1IG0A 3TXXA 4JIGA 1A88A 4WCVA 1PQWA 3FMIA 2Q8QA 5EINA 4GI3A 1PDVA 4OHUA 4C22A 5JD5A 3CSSA 4M8NE 1JHRA 1P0MA 3DMGA 1E9SA 3OC6A 2P6NA 2IEZA 2UZ3A 1C8BA 1LW6E 2ZUVA 3RK4A 3K0KA 3VR3D 4IIGA 3D0QA 2ZATA 1R8QA 3IR7A 3JWJA 4ISCA 2X3FA 1QFSA 3MWEB 5L51A 4MQBA 2J9YB 3W2TA 5FBKA 1GYRA 3MYRA 1I1OA 3HY6A 1JHMA 2JI7A 2SBTA 4HNTA 3Q8KA 4BN4A 3QQ5A 4D9BA 1E8DA 2H7YA 3RSGA 1SUWA 3HCEA 1JPJA 4W4TA 2RGXA 4WCDA 1RIFA 2LR0A 1H3FA 4CLDA 3AGPA 4JBWA 2FV8A 4EF6A 5CBPB 2CXSA 2WIAA 3F6SA 3BB3A 3EXFA 3HCDA 3A6LA 1EAMA 1L4NA 1RFLA 2M6SA 1MEOA 3HKEA 3QOFA 3KHSA 4HX5A 1SB9A 2Y6UA 2WV9A 3CF4G 2ONJA 2BTOA 2QXTA 6REQB 4LMAA 2ETXA 3DDUA 1DJPA 2KYRA 4RIEA 2GK7A 4ETMA 1RHQA 4A23A 2Z09A 5JQWA 2P90A 2DH5A 1GITA 2FZEA 1WW3A 2XTMA 2XWSA 2XGGA 4QHTA 1OLUB 2QX4A 1OXBB 1U4SA 3KT0A 3A1FA 3BUSA 3R3JA 2W11A 3WXMA 1WU8A 2G7ZA 3K0SA 4DC9A 2HBRA 3TCNA 1HA3A 1CIPA 1P4SA 1UM9A 2CXOA 2I2AA 1FQOA 2QSYA 3OZBA 3EUFA 4I5DA 1Q0QA 2VYVA 3ZNPA 3KAJA 4JDPA 3TPCA 3X3HA 3KOMA 2VPPA 1Y63A 5DTQA 1ZMXA 3WV4A 4MRVA 1SXJB 1RJEA 3A6ZA 4TXNA 4E03A 2I8CA 2NU9B 2XGOA 4I19A 2EIHA 4D4LA 4ZTUB 4IJWA 4XFJA 3N0VA 4U2FA 1R64A 1UBUS 5DRYA 2G80A 3Q7RA 4HC4A 4WZAE 1CUVA 1QHHB 3AC0A 1YRBA 1RKXA 1OAKA 2XMRA 2ZWOA 3DMNA 3EVDA 2G82A 5TXGA 1V8FA 2GUWA 2DY0A 2QRZA 2QTNA 1C9DB 4LOHA 3OU6A 4LZOA 2B4RO 3IFSA 4KNWA 3G8YA 2WJHA 1JQLB 4P3NA 4R3UC 5DBFA 2FPOA 2R8BA 1SQ0A 4QNRA 2EBHX 3MWKA 4TXMA 3RT7A 5C8DA 3RG2A 4UMDA 2ZW9A 1Y6RA 3R0JA 1Y4SA 4PC1A 3FSRA 5IZCC 3H5VA 1RYNA 3PC2A 3DDHA 3GLRA 1OROA 1U3TA 4MI3A 3SR3A 1KYIA 5I7OA 1RRMA 1FQWA 3KTOA 3PPYA 1UPUA 1RZRD 1DTEA 1HX7A 1O9HA 2A0YA 5JALA 3W8RA 2ILTA 3SHFA 3E3MA 3UG6A 5BNZA 2XH8A 1DEKA 2BCJQ 3K4HA 3BKXA 3T5GA 3ZDEA 3DDOA 3MCZA 4O3MA 7ABPA 5AVVA 1NXPA 1S8OA 1YR8A 5LUBA 2R1VA 3C8MA 2IYQA 3QXXA 1K7FB 2WHQA 2B8NA 4MQEA 2VOJA 2WYWA 4DC1A 5KAPA 3FBWA 3QKWA 3M3PA 1B7GO 5HCIA 4EZIA 1R6UA 4FLMA 1DFIA 3EMDA 4GEKA 1AC5A 4UM7A 3TNDA 4YMWA 1UJMA 1W4BA 1FMJA 3BYZA 5FWDA 2BLLA 2QL7A 4A6EA 1EFRA 1FSFA 3CLSD 3L6EA 2PZBA 3JX9A 4HN4B 3O26A 2JRCA 4P32A 3EXAA 2IZOA 2YHAA 3HEMA 2P79A 1QV9A 4RFVA 2CFSA 1Y9DA 2A2ZA 5LYYA 1BSVA 2P5SA 5CLJA 3AEUA 3MWJA 3WLPA 3AK4A 1HTTA 5AW0A 1IWOA 1VG8A 2P9QA 1R0ZA 1B6TA 3EF0A 1YRYE 3QF4A 2E3JA 1I7DA 3MIIA 1ZL2A 1OLUA 4BJ3A 2O8BB 4FP9A 4DAOA 4QDUA 4PQEA 1PDOA 2CMDA 2I3BA 3TIIA 4RPCA 3ML1A 3D8BA 2D2IA 4J91A 1EMDA 5JANA 4JP3A 5DNAA 3MHTA 5K7SA 3DZDA 4JHXA 4D0GA 3O90A 1BD3A 4B6RA 4KIFA 4M1KA 4H60A 4J2TA 1CUWA 1SXJA 2NX2A 3VH3A 4MDHA 2XTNA 2ZJZA 5AK6A 4JSRA 5EE1A 1YZUA 4UASA 3W05A 2QA5A 3G85A 4R3WA 4A03A 3BDIA 4BGEA 5JU6A 4NYMQ 1NUAA 2O2IA 4O2BA 2QV7A 3UXHA 4ZOQI 1U0SY 3C39A 5DLEA 3EB9A 2QUHA 4F8JA 4PX9A 3HGQA 4NYMR 3ROXA 2F8LA 5C9ZA 3B3FA 4L5YA 4BAUA 4UKDA 2Z4SA 4WPGA 3CIOA 2QBYA 4PSVA 2QGFA 1MC4A 3DLBA 3Q9UA 1WMFA 1UBCA 4PZLA 3MBOA 1I4WA 3C3KA 1W35A 4B71A 1U4NA 1W30A 5ED4A 4B35A 4MR8A 4QX6A 3ZDZB 1Z33A 4JU8A 1UJNA 3JWEA 4IQGA 4LN1A 2DSTA 2VA8A 3OF2A 3OE7A 5I51A 3I64A 1J2YA 5K45A 4C89A 2XE7A 3GLIB 5AVTA 2WHRA 1Y5IA 5GJWC 4F0JA 3AJAA 2IOHA 2AUTA 5G02A 1WR8A 1FS5A 5I7RA 2ZJ1A 5K01A 2AHOA 2PMDA 4KAFA 1NULA 2FNAA 4MGZR 3K9LA 2R6FA 1E6KA 1ECPA 2QU7A 1Z4IA 2CHUA 3TOXA 3W6ZA 4CMAA 4E30A 4UAJA 3EQ2A 2EKPA 4HNGA 4PLVA 2FF7A 4RD2A 5A7FA 1CJUC 1GD1O 2UYGA 4YTEA 3IEIA 4GX2A 1ZM2A 4OIFA 4HB2A 1L5GB 4CLHA 3THYB 2IHTA 1Z56C 4IOLA 1DCTA 1B0AA 4QO8A 1I10A 3QLVC 3UMVA 1CF9A 2BVNA 5BMVF 3DW1X 2AUMA 4JHLA 2QTHA 1B2LA 2AYZA 3FPFA 3ON5A 4MVWA 4ZQIA 3RT1A 4AJNA 5JAIA 4UE3S 1IMJA 1YUNA 5HTOA 3T94A 2HA4A 4Z3DA 3CLTD 3OD1A 1GPLA 4QG7A 1B23P 3DDZX 1G4AE 4BWYA 4DDHA 3RTDA 1XL0A 3I9KA 3QQPA 3UW3A 4AJ1A 2WJYA 5JS1A 3GBVA 3VH4A 3IQWA 2WUGA 3KV3O 4MW1A 1Q74A 3GJYA 4NBUA 1FJGB 3U4DA 4ZU1X 2D00A 2OPBA 3NHYA 4CRWB 1N2SA 2OHGA 1A9RA 4IVPA 4NTZA 2VT7A 4Y2TA 4HWSA 1SC1A 2A4MA 4ZCPA 4EB6B 2XUPA 3D31A 5ALLA 5KTOA 3LSYA 3CLRC 2WKSA 2EFJA 1HGXA 1JHAA 1WNFA 4G0NA 2YOHA 1JIIA 2PGAA 1OBVA 3IP5A 3OF5A 4PLWA 4TTVA 4UUOA 3SDSA 2F3RA 3VNQA 3K5HA 3RJTA 4JXZA 1KTVA 3CSUA 3PPVA 3LBNA 2YW2A 1CE8A 4F2PA 1N5MA 4MXDA 5DX0A 3LPDA 2NV2B 1ZMTA 2PVPA 1G16A 4AURA 3T9AA 3NC4A 5IC5A 2JLYA 3STVA 1ISSA 4ZQHA 1I0LA 4WXEA 2FX2A 1Q20A 1RM3A 3NNSA 2A9OA 2O50A 3OTGA 5K0NA 1M1ZA 3B1KA 3ORFA 3KR2A 1IM2A 1W6RA 2H11A 3H5WA 3IMEA 4X60A 1EHCA 2WT4A 1U9JA 2BHLA 5LXTF 4DRXA 5CDSA 3LC0A 1E3EA 5M7EA 1Q5PA 4MSUA 3UVEA 4A2CA 2M1ZA 1YL7A 1G1AA 1YK1A 2OZKA 2R44A 2R8RA 3I37X 3FYDA 3CLTC 4Y1EA 1NHGA 3EFBA 3IBGA 3MJRA 3TNFA 3PNKA 3URKA 4X93A 5FTWA 3SYKA 1LU9A 4MKFA 1KP2A 1A4RA 1S4MA 1A5AB 2IYPA 3L4BC 1PK8A 1E4OA 2AK3A 2FUEA 2OBXA 4CL0A 2P8JA 3AP1A 1P77A 3G9QA 4MW9A 4G1MB 1COZA 3CT6A 3WXBA 3ZOKA 1B8PA 1WM1A 3PUJA 4UUAA 5AKYA 5ADWA 5IUJC 4YQEA 3I04A 1U1EA 4JJAA 3F9CA 4IIUA 5AI6A 4BN0A 3QXSA 4KGZA 1WCXA 1XZKA 2F9LA 2ZULA 3DP7A 1ZI9A 1I5OA 3CN7A 2JGMA 4Q9HA 5CB4A 4X97A 3IPCA 4GI7A 5KVSA 3N53A 3CLSC 3QUTA 2BRUC 5FBHA 5TPZD 3AF1A 5EKTA 2HD4A 2O48X 2QMOA 1KR5A 1UJ6A 1QGUB 4KVFA 1OGYA 2P65A 4ZZ1A 3FI0A 4JBNA 3VISA 4ID3A 4DG8A 2GXUA 2JCVA 3MTJA 1WP4A 4XYEA 2J9FA 3G6WA 4WK2B 5ES4B 2IHVA 3HR8A 5ICFA 5C81A 4JYMA 4H31A 1GPH1 4MPPA 1E7WA 2WUVA 2IXEA 3H7IA 3PIIA 4M7RA 4O2AA 4GYKA 4QUIA 4U7WA 3X1JA 4R2JA 1JFRA 4WVLA 1OW3B 4BBJA 3H42B 2DQZA 3A4MA 2FDXA 3R9KA 2OCAA 1AF7A 2W71A 3EA0A 3INTA 3QKUA 4FZRA 3IHTA 1EFAA 1OAOA 1TIKA 2YV3A 1USGA 3O5AA 3GFVA 3PZRA 4OQPA 3B53X 1UJBA 3KXIA 4PRZA 5A4FS 2JFBA 1J1UA 4CG1A 1SD2A 1U02A 1EG7A 4KXMA 1ODTC 2AMFA 4RF3A 1Y42X 4M8IA 3SHWA 4HJXA 2HEIA 4CR7A 2HHHB 4A27A 1MG5A 2OD7A 1MBZA 4AWAA 3LUCA 3DJFA 3TWOA 1CE8B 4D98A 5I48A 3RVJA 3OCWA 2ODWA 4RTOA 1NQ5A 4HJRA 4QM7A 2I4NA 1PT9A 1YC5A 1QE0A 2N1BA 4NCJA 3E27A 1UXGA 2PKQP 3FVRA 3LIPA 1T2CA 4P4TA 4BGUA 1EWQA 1QBKC 4DB4A 1IUNA 3ITNA 1N5IA 1Z0KA 3ZD7A 1AB6A 4UVEA 1GFZA 2J5RA 2UYYA 2VYND 4CLOB 4DMHA 5I9IA 3O7WA 1H8HA 1X1DA 2FEMA 4MP6A 2AKYA 3M6AA 4B2IA 1CUUA 4EUEA 2OO5C 1IG3A 1V47A 2ZUWA 3Q3HA 4I4TF 4XIGS 2VH5R 2WJAA 2OSBA 3UJBA 1RI4A 4PHFA 4Y1RA 3J81k 1AS2A 4KQMA 2GCNA 3FUCA 1IHXA 3SEQA 4MLDA 1YQTA 2ZYDA 1GAQA 4KQXA 4ZO4A 4XIIA 4GQAA 4DM7A 4QVKA 5H9WA 4WY8A 2GA9A 5FADA 3T1TA 1GYPA 1V4BA 4PSKA 3GNLA 1WW8A 3HUDA 3V7YA 3KQHA 4MQ6A 3JASA 5F35A 3LZ6A 3PYXA 1T6YA 1RVV1 1XMJA 2BGMA 2QLBA 3SJBA 2E4AA 3CVOA 3PC8C 4G26A 2G6BA 2KBFA 5DEOA 3FCCA 1BS2A 1WY7A 3JD1A 2LV8A 1P7PA 3IMCA 1CYDA 1X74A 4KE6A 2RI1A 3R4CA 1GN8A 4JKYA 3SBOA 3FCSB 1QGUA 1RYDA 4TT3D 4BX9A 1JQDA 4DLYA 3EXG2 4YV1A 1IM5A 1JAHA 3MRSA 2NO4A 4Z0TA 1F9EA 3LCVB 3V4PB 4FILA 2H7CA 1GNTA 4FCCA 1JJIA 3TSOA 2C78A 2WUDA 3B8EA 3QEKA 2X9LA 3TFOA 1OCEA 1DIHA 1UINA 2JF0A 2PJUA 4HS4A 2D1SA 2GFHA 3BX1A 5C8YA 2HQRA 3SQXA 3DD1A 5B3KA 1V11A 1HZZC 3AHJA 4UMFA 2YQZA 1PJ2A 1QCCA 3WTCA 4FMPA 2RB4A 1BTOA 2YHIB 3B6ZA 1NRWA 4MWGA 5AOBA 4EW1A 1PZXA 3PZBA 3JAMA 1HG0A 2YYYA 4IRUB 2CMKA 3OFSA 2O05A 4PZ0A 1D1QA 1MX3A 1DIRA 1UKEA 2D06A 2GBLA 3AXTA 5EJGA 4AJ2A 2IPMA 2HWUA 3W5VA 5TQ0A 1JJFA 3T3DA 1GTMA 1Q3HA 3EPPA 2XECA 4P08A 2RGUA 4HFMA 1J97A 3K0FA 5BQOA 1UDAA 4G5XA 4YP6A 4PZPA 2E48A 2X22A 3KLOA 2OMEA 4K86A 4HGQA 1TM4E 4MQ4A 1ONOA 1U3UA 3LV8A 3HDVA 4FYJA 1JMVA 4UEKA 2J85A 2JIMA 4BV9A 2O0LA 2ZGVA 1PSDA 2WWXA 2R7NA 4L5IA 4LDPA 1C7RA 1EINA 4QVGA 4U5XA 3FNFA 3OLQA 3OZ7A 4QQFA 3BIXA 1A3CA 3ICVA 2QK4A 3GQBB 2L19A 1OTXA 3C3BA 3OPMA 1M1YA 4CLOA 4M86A 1GGHA 1DLJA 3OQPA 5BUZA 1A2KC 3TF5A 3VR2D 1LTQA 4C4SA 4YHHB 1EG2A 3IVAA 1ZCBA 3GLSA 4UPVA 5BMOA 3H3XA 5BMVB 3PKZA 4WGFA 3EXHB 1WS6A 3ZY4A 4ALMA 1ZKDA 3MTIA 5CFZA 2M6KA 1W59A 5G4LA 4FOPA 1OWLA 5E2AA 3KPUA 4RTQA 2NUTB 1Y3FE 1TD1A 3D5TA 3ZVLA 2R8OA 1ESEA 1AMUA 1L7NA 5C1OA 3IDZA 3ELYA 1TT5B 3HYCA 3X1XA 2OA0A 4D3SA 3ONWA 3R7WB 2RHLA 4Y2SA 4A82A 1K8QA 1ZIPA 4IZIA 3SJ7A 2E87A 4B83A 4F9TA 3I6MA 4O33A 3TR0A 3LBHA 4DNQA 1QDEA 4G5YA 1CUSA 2EJTA 1KO4A 3IXQA 2BMWA 2ZR0A 1KVUA 1G17A 3PU6A 3RF6A 1S89A 4D80A 5DSTA 1DQZA 1M2OA 1XLVA 3JD3A 2UZAA 1XROA 2FE1A 3TTTA 3UJCA 3EY4A 4BYGA 4I55F 2P4EA 2P1DA 3AP2A 3IVRA 3IR6A 2IH4A 4TPKA 3B13B 1Y4UA 1VIMA 3E5MA 3PV0A 3OM0A 5KYWA 1K6EA 1C7FA 3S7ZA 1WMAA 3BRSA 4IIJB 3V4SA 2HF7A 3WA6A 1DAEA 5INTA 5JFOA 1NPYA 3HM9A 1NP3A 3RM3A 1NJ8A 3HVHA 4JASB 4AXXA 3EPLA 1BCRB 1U7ZA 3D7KA 5HF8A 2G83A 4V2IA 4M9RA 3DFUA 3QVWA 5AT1A 4AZSA 5MF6A 1R9MA 3FPEA 3GMDA 3MC1A 3DOFA 3L02A 4RO0A 4BCCA 5AJZA 1GTRA 4RKQA 2WF6A 1QRUA 3NBAA 1PS0A 1M1XB 1U1CA 1YVUA 2CVHA 1MN6A 1BEUB 3QVJA 3T3GA 3V8BA 2D7CA 2Q3DA 4MV5A 3H1PA 4PCLA 3RROA 1P18A 2YN4A 4GPEA 2W48A 1LLDA 2C42A 3Q5GA 5LNK1 2PUGA 2R1TB 1P1RA 2Q7XA 4E2YA 1O8BA 4GOMD 4PAQA 3ZLVA 1I4EB 1JAXA 3KU1A 5IN5A 3VXKA 2JHAA 3L7CA 1HQKA 1TMGE 4HDMB 1TAUA 3HO1A 3IIIA 3WYEA 3ZGXA 1YFJA 3REQA 4QYXA 3TTVA 1EGMB 1W2HA 1FDRA 2OUIA 4TYNA 1C1HA 4DPKA 1QYVA 3DFIA 4D9MA 5CT5A 1II8A 5F9FA 4H15A 4MI6A 3VRHA 3IQIX 2ZG6A 1E2LA 1QGOA 1B93A 5KDDA 4IL5A 2BC9A 1PL8A 1POXA 2PZMA 2P6MA 3IPLA 3V2GA 2VH1A 1PW5A 3DW3X 3GWGA 1NG9A 3KYDA 3WLEA 2PK3A 2V3WA 2G1UA 2R6GA 3FOEC 1J0AA 4CI9A 4QJ4A 3CKMA 3PHCA 3SIPA 1XXHA 2YY6A 3LQRA 4YRRA 1RQLA 4KTVE 2E37A 2RI6A 5DW0A 4EG7A 4BZPA 2FW8A 2HEGA 3NXSA 5E8RA 4J90A 3T5BA 2H7XA 3R7WA 1K2WA 1G5TA 4RDIA 4ZGWA 2NAPA 5H0IA 1N2HA 3BGSA 3I6ZA 4PWYA 4D8XA 5IRCD 1SZDA 4F96A 1N6IA 121PA 1V35A 2C20A 4DW8A 5GONB 3O4VA 4B8WA 1Q0PA 3HU2A 2EX0A 4FMDB 4U7PB 4WOPA 1L9KA 1TQ8A 1ULAA 1Z13A 2VCHA 4BO8A 4TKLA 1UBMS 5GVSA 1E1QD 3WX0A 4MS4B 4UFPA 3U3DA 2B0JA 2W83A 2P9FA 3PS9A 1Q1AA 4JEUA 4OTZA 2XD9A 1ESCA 2CLFB 2ASVA 4QASA 2A84A 4OIMA 5KYWB 1QIHA 4BMNA 1IZZA 2A9VA 3LRPA 5F1OA 4ZYUA 3ZHXA 4HEHA 1POWA 1A82A 4OP2A 5EKXA 3TXYA 3V00A 1XIVA 3HCRA 4HSGA 3JYPA 3TR5A 1BCRA 3FYSA 5CFMA 5FNVA 1PG5A 3SMQA 3FFXA 1TYCA 4PICA 4ND1A 3WJ1A 4B4UA 1UWVA 3NBXX 4OJQA 5K1ZA 4MVJG 2F8TA 2JFNA 4LGYA 3TQTA 1TQ4A 1JIUA 5EJAA 2G09A 1TM2A 4WJZA 3RQIA 2Q4OA 4I9UA 4RSHA 5L3ZA 4QWWA 1TZJA 2AFIA 1WSBA 4BNNA 2QN6A 1WTAA 3O8DA 4BB9A 1QTQA 3CZAA 4QD3A 4IZHA 2WILA 4Y0AA 2BKLA 3WDKA 4ZJZA 3I45A 3HO8A 4ES6A 1R6XA 5JYDA 1COWD 1OXXK 2CV1A 2B69A 4UARA 1KVRA 1T6NA 4E2ZA 2J8ZA 2Q8NA 4M8SA 4D79A 3H87A 2FHSA 4RLHA 4DUYB 3EC1A 3MELA 2CFTA 4X6UA 4MWSA 1LK7A 1FFWA 3C7AA 1HDCA 4GLFA 3TZ6A 1E3MA 1EQ2A 2BMVA 4OHOA 3ZHZA 1U5BB 4DA6A 1N5LA 3HFRA 4JA0A 4V3CA 2XY4A 4WV3A 2IIQA 2IY7A 4BNDB 2HJHA 4KEAA 3IC5A 3QXJA 2O1XA 1ZK4A 1KI4A 5IAAA 1PP4A 1PJBA 3G5AA 4GHWA 1DPFA 2QB5A 2R6DA 4A92A 1RAGA 2YXPX 3BFXA 3CKYA 5K4GA 5ISMA 4QTUB 3TLJA 2P2GA 3NGMA 3G1WA 3VPDA 2VAMA 3FUTA 1N6PA 4MVJD 1ZUD1 5DNWA 4WERA 4RHXA 4HVAA 1UF9A 1RXVA 5DU2A 2I7TA 2Z4RA 4Q4JB 1BKSB 1G6KA 3ROTA 3C0KA 4WKGA 3RC7A 3D4PA 1EBBA 3HC7A 2IV2X 4JJKA 1VRVA 1PR1A 5L8VA 1L4MA 1P1KA 3LG2A 4C4AA 3PE3A 2EG5A 4WACA 3RUAA 4ESHA 3DKIA 5KVVA 1CEEA 3A10A 2Z2IA 4LHZA 3UM9A 1I6WA 2ZUCA 5K0SA 5EXTA 3CNBA 1C0EA 3VU3A 1NU8A 1GT91 1DEHA 4N0PA 1CR2A 2I8LA 2XE8A 3RC2A 4C06A 4GVLA 1CR0A 4Q34A 5FLYA 4XSHA 3R5XA 1IIBA 3E0QA 4HYQA 3CX4A 1L0BA 4AP6A 3KAKA 3HJGA 3IS3A 4QGSA 4MS3B 1FCJA 1CYEA 3H5RA 1QCYA 4A0SA 1ZVVA 4HDAA 2XCIA 3OF3A 4H7DA 1CUZA 1B43A 1KDRA 5HW0A 4L6CA 2WTNA 2ZKLA 1UP7A 3N75A 5L3SA 3EIHA 2CUKA 4XARA 5AVYA 2GN6A 5LXTA 1BROA 1EHYA 2QNRA 2XGSA 1JG3A 4OYHA 3RS3A 4OX9Y 4YJDA 3VU9A 4BE7B 4YJKA 5IULC 5LB2A 5K8IA 1XRLA 3CYFA 2VH2A 4LZLA 4WW0A 1L5OA 1T2EA 2ZZNA 2B4AA 4GMGA 5JVDF 2VJMB 5IDWA 3UQZA 4PV7A 1W75A 1F6DA 1M34B 1UBLS 3E3AA 2W4QA 3K73O 3RYFB 3I6BA 4DJDC 5A06A 3B5JA 3UYKA 1RYMA 1EGVB 1JEOA 4Q7LA 5CA0A 1J49A 4MDEA 5DWDA 1QF6A 1G4UR 1UWCA 3MAGA 3P2EA 5E2IA 2QTTA 3KE9A 1VI2A 3IB6A 5HIIA 4CJXA 1NONA 4IPTA 4LW8A 3A4LA 1DUSA 2QF7A 4Q02A 1NC1A 3ZWQA 1PYOA 2VSYA 3GFRA 3JALB 4Y6GB 2HJGA 3GZNA 4X84A 4LG1A 4GOXA 2D1QA 3WHPA 1QIMA 4WE3A 5L3RA 1XMPA 1KSJA 3WADA 3UMRA 5CEJA 3IKTA 4HPXB 1G21E 4LJ7A 1N8SA 3MMPA 3F7MA 1RTKA 1JNYA 1VPDA 3M9WA 2GVZC 2W6OA 3G2HA 4W1PA 3DB2A 2DLNA 4LJKA 4J0DA 1ADBA 1Y8CA 1KH3A 2ATIA 5E4YA 4EHJA 2P2NA 2HJSA 3H2SA 3QYFA 2PMEA 5ADUS 1QTIA 5AIBA 2N1MA 3ANYB 4H1HA 2UUPA 2PTGA 3UIEA 3C5CA 2NZWA 1JB1A 4KN5A 4FIDA 3C5EA 5AVXA 7GPBA 2J3QA 2OVBA 1QYRA 3VDXA 1PEAA 1UBNA 1Z15A 2HM7A 3LVRE 3Q3VA 3SEFA 3EIQA 3MJCA 3QXCA 4BX8A 5H70A 3MGBA 1H2XA 3EGCA 3FBGA 4HSEA 5HFJA 4MHTA 3A4TA 3JQDA 4GMDA 1ZD8A 4HUQB 4B1FA 2OCXA 4YLYA 2KSQA 4MUXA 2VTDA 3DA8A 1GQQA 3UJ6A 3WC4A 4TWJA 3Q2OA 2CNNA 3K94A 1ILEA 3AR7A 4ZO7A 1EVJA 1RM4A 3JZMA 3WRYC 4F1JA 1M2VB 2B37A 2QQGA 4EARA 3ONEA 3EE6A 5F5XA 2MSKA 3BXXA 2P7IA 2XMSA 3G2PA 2PE5A 5LXTB 1CJVC 1FTGA 1N1EA 1ZXXA 3S2YA 2A67A 1NMQA 5K0GA 2CD7A 2C2XA 5TX7A 2XUKA 4UUPA 1O9BA 2YUIA 2X9QA 3Q7SA 3NKVA 3BH0A 3E3LA 3CUUA 5JDIC 3KTAB 1B1CA 3NOXA 4IDGA 3T3PB 3WLOA 2RHGB 4NCIA 1BOOA 4P0TA 2ESRA 4P38A 1XYGA 2P1ZA 3FNGA 1T0PA 4YRJA 3SKYA 1L4FA 2QTWB 3QOXA 2X6RA 4IQ0A 3FPSA 1DI0A 3LFUA 2PQ2A 2QLNA 5FNZA 5HQJA 4N3CA 1VYUA 3W4IA 3ZCUA 1AHPA 1H9CA 4Y18A 1ZQ9A 1YBMA 4DQXA 3BXZA 3AQIA 2WZBA 2CHGA 1BH2A 1K5DA 5B53A 4ZVPA 3VPXA 2XCQA 4POAA 5EWLB 2W9XA 2XAAA 1AZTA 3E61A 3JALA 2NXNA 3I8SA 4I2VA 4YCJA 3U0VA 4DUGD 4WT7A 4Z8YA 3SLKA 2WWRA 2B30A 1MT3A 2WHXA 3T5TA 2VUIB 3Q3GE 1KVQA 3PQ7A 1WHTB 4HAUA 4EHLA 4GI1A 2N3ZA 3F90A 1TKAA 2Q2NA 4ASUD 4V0LA 1KY2A 4GPBA 1KKMA 4XH9B 1W47A 4AU1A 2I6XA 1SMKA 1NXWA 3PT9A 2OG2A 1A2QA 2XWBF 2QN2A 4X8MA 4IXTA 3BK2A 3ZIAA 1M7GA 2XNHA 1HE3A 4N6NA 3WGUA 2OORC 1RXEA 4G4IA 4CCAA 2OBMA 5FORA 5EMLA 2WWFA 3ET4A 4JJFA 5JPDA 2V8OA 4BNJA 1HDRA 1W94A 1CKEA 3WP1B 3H2HA 2P35A 5CIQA 3B2NA 5G53C 5HCNA 3C1AA 3SOPA 2CMFA 3ASUA 2KJQA 3ABOB 5AUNB 2DQSA 1LSUA 4FT2A 3KFLA 2MU1A 2R6HA 3DMPA 1T5DX 2FF5A 1IEXA 2PWZA 2BBWA 1SHUX 2A7XA 1DBIA 1HT2E 3IJRA 3P9CA 1QHIA 1H5QA 4IDHA 4B3GA 4NJEB 5C7IO 3PD1A 1DJMA 1GO2A 1U28A 2CLKB 3B1YA 4MAAA 1K7CA 1K92A 2PZEA 2R7AA 4G0OA 4PG5A 4Q05A 4QO7A 1XF1A 1E9RA 1WOYA 4NJMA 2VDJA 5JMPA 2CFCA 4CGYA 3FDXA 5F7OA 5K0CA 1Z88A 1UBJS 3PR3A 5AHXA 1FF9A 3VU1A 2Q9BA 4EYEA 2C4NA 3BRWD 3DF7A 3JQAB 4M60A 1TCVA 2YZGA 4QOHA 3RIEA 1TUIA 5F9MA 5AFSA 1J1ZA 3GFSA 1U0BB 1N0VC 3U16A 3VZRA 4RESA 3MZ0A 4JGIA 3RK1A 4BMDA 3O4IA 4XLTA 1Z2AA 4EYKA 1EXDA 1CDDA 1TO2E 5FR1A 1DJQA 1NQOA 3CRMA 3M83A 4BV8A 2QIOA 4PAMA 1X8XA 4Y2VA 4ACBA 4UTZA 3O8OA 5L3QA 1YCDA 3UH1A 1IY8A 2HHAA 3FNIA 3YASA 5D3MA 1KJIA 1E6WA 4HDRA 1SKYE 1JSLA 2H5JA 5DV9A 2QUAA 4NZPA 3T7AA 1X9HA 5UKDA 3S99A 1DCFA 1R66A 4I3HA 2WPDD 4W1SA 2L69A 2HZ7A 2P6OA 2RK6A 4BY9E 1DIAA 2FWAA 1ODJA 1SVIA 1ZPDA 2ATVA 3MJHA 2H2AA 2ZRIA 2PQ0A 2QRKA 3G79A 4KODA 4U63A 7REQA 1NN3A 2NWQA 2JEOA 4W9NC 3GFOA 5G0TA 3T3OA 1RCUA 2RH8A 2WJGA 3MPOA 2AOWA 5F7JA 1YB7A 5GJCA 4ARVA 2EP7A 1PUXA 3I9NA 3JQ7A 3MCUA 3PSHA 2QM3A 3K2IA 4D57A 4ZKDA 5JS6A 4V2UA 3W6PA 3E8XA 1AO0A 5KI6A 4P4NA 5B7GA 1M8JA 1IZ0A 2DBYA 4LHVA 2JGJA 3PDWA 1O6BA 1VMIA 1B15A 1FEZA 1YQUA 2ECPA 2IEDA 2PZ8A 3AWDA 4RL6A 4OQDA 3G9ZA 4ZWNA 3IURA 3PUIA 5TGZA 3GRVA 4RS3A 4W6QA 2ZCUA 3KPYA 4D96A 1Z73A 3HI4A 2GK4A 2P9GA 2R79A 3PEVA 1GL7A 3R77A 2C4WA 3D4LA 4QQKA 2FFJA 3D5QA 2HYDA 4V0SA 3RAJA 1FXUA 2CV2A 1ZWLA 4B87A 2NSLA 2DUNA 2QAJA 3UV3A 3HZRA 3OETA 2ECOA 5JNLA 5CA1A 1FP2A 3N9IA 3I5XA 5AM5A 4NH4A 2O8EA 1F4LA 2B7BA 2B1GA 2QTLA 2WVGA 3VR6D 2OEPA 1QH1B 3TNYA 2B9VA 4OMFG 3O8CA 4NJEA 2Q45A 2X1MA 1K08A 1V2GA 2RC5A 2XCTB 4NK5A 1SOWA 3OM1A 4UAUA 1CVRA 1AKWA 4XQCA 1QK5A 3ROZA 1WTCA 5EP4A 3ESXA 3FWZA 2O59A 1ZD2P 4FN4A 1JAIA 3R3UA 3LZCA 3E1GA 2V45A 3P0RA 1KMQA 1OPXA 5GGYA 5A3VA 3U7JA 1JSXA 3I23A 1VPWA 13PKA 1P1HA 3IVXA 2Q7OE 3GMTA 3AVUA 2IBSA 2Y0EA 2HADA 2JG3A 4DVGA 2C99A 2GJ9A 1LJUA 2IP4A 1P73A 5E9AA 2FZVA 4PSUA 1T34A 3F74A 3BIOA 2P2DA 3BMNA 3KWFA 3HJBA 4X63A 2JJ1A 1YVPA 1E3TA 3NWJA 5L3QB 3L0CA 5HKKA 1QIIA 3T9EA 4RTRA 5K4AA 4GZ3A 3H04A 4Q7MB 4NAHA 1Z5PA 4EZBA 1EVKA 2I54A 1P2BA 2ETVA 3NAZA 3V1UA 3JQ9C 2CSXA 3Q7PA 3TLEA 5I7UA 1ISFA 1XDZA 3IDOA 4CKWB 3GGCA 1SZCA 4KXQA 1VLVA 2HO4A 1ONBA 4PWZA 3SU8A 3EXIB 2BIFA 3IT2A 521PA 5TPWA 4D0LB 4M1WA 2RFLA 4GFDA 1EFLA 5ICMA 5JAQA 1SBTA 4K6CA 1LK0A 3ST7A 2J3IA 3NEAA 1PEKE 1V8OA 3I2YX 3N8KA 4KCGA 7REQB 2WM8A 3W5SA 1P5FA 2ZJ8A 4I4IA 1H42A 2OXEA 4F8YA 1ORTA 2PUDA 5K05A 4H1VA 2HQSA 4EKNB 4YMTA 1DB3A 4TVOA 1QH8B 2KPOA 2E5FA 3W2HA 2UU9B 1Y1SA 3OC0A 1NW9B 3KP1A 4D3XA 5F2EA 2F62A 3RNOA 1H9AA 1TUBA 3LUAA 4IFIA 4EI8A