2GCPA

Crystal structure of the human rhoc-gsp complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho-related GTP-binding protein RhoC
total genus 59
structure length 177
sequence length 178
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcpA00
3T5GA 3VQTA 3K70C 4EPTA 4B35A 3QXHA 4BZXA 1D9XA 2X77A 2WKQA 3AKYA 1KKLA 2ODWA 4WBSA 5SZKB 3LLMA 4U5XA 4Q9KA 5EE0A 2REOA 3SBDA 5KSOA 2OFWA 1JPNA 2Z6VA 3U3OA 3K53A 1UAAA 3CRQA 1J70A 3TQFA 4AWXA 1ZM9A 4TWZA 1QHIA 3Q72A 5JEEA 4A9AA 2BJVA 2A78A 1W7AA 3IKJA 1M7BA 1BYIA 1RPZA 1VG1A 1VYUA 1Z0DA 2OLJA 4V0LA 3U3KA 3P32A 1AKYA 4BPBA 2GZDA 2NO0A 5TXGA 2FU5C 4V03A 3GJXC 4RFSA 2QBYB 4Q1FA 1UJ2A 3RNLA 1EESA 1ZUIA 1R10A 2BHRA 2VSFA 4IEIA 5FPKA 2NG1A 4J0QA 2O5VA 3HU1A 2Q21A 2YHSA 3C5HA 2O8CB 2JJ2D 3OIYA 1LNZA 4JJZA 5GVSA 2B6HA 2DWQA 2XAUA 4WOPA 3LW7A 1CJUC 1W1WA 2H92A 2OILA 3GJ5A 5CJPA 4FMCF 2MSCB 1G3RA 1NBMA 2HT1A 1T3HA 1E1RD 3VFDA 5EUQB 1Z6XA 5J4HA 4PPGA 4O2RA 4PSAA 4B71A 1LY1A 1EX7A 3BB1A 3LX8A 5HZHA 3VTKA 3IIKA 1YJ5A 4KFSA 3SJZA 4DRZA 1E0JA 4M8NE 4HUTA 1RFLA 2GBLC 4GDFA 1Y63A 3NEJA 2CCKA 4TYWA 3BB3A 4O0MA 2J7KA 5FOUA 4KO8A 1XCPA 1UBGA 2F1RA 2FGKA 1G7TA 2B8WA 4A0FA 1P2VA 2OE2A 1FOEB 2WOOA 5HE8A 1KIMA 1HYQA 3LQRA 4OI2A 3GLGB 5FTMA 2P3SA 3R7WB 2ZRLA 1YQTA 3A4LA 5HTKA 2QT1A 3EXAA 2OO7A 2QNRA 1E9AA 1Y3AA 3AVPA 3VKHA 1IM2A 4GZMA 1W4RA 3CX8A 3FE2A 2ONKA 5EXSA 3QBVA 1BMFD 4ZDIA 3REGA 2Q9BA 2C9OA 3DDCA 3CNNA 1I2MA 4ARZB 2CK3D 3CPJB 4A8JC 3B1WA 221PA 2EFDB 4LGMA 5FL3A 2GZHA 2RGXA 2IYVA 4NKRA 1KTVA 4UXHA 3I61A 2VLIA 4PANA 1XXHE 3U7FB 1H8EA 4MKHA 2IA5A 2C99A 2RCNA 1VIAA 4EPYA 2IYQA 1JECA 5EXXA 2PJZA 3MAAC 1DS6A 3SJAA 3TSOA 3GPLA 5L3VA 1CJKC 1DTSA 1KK3A 4Q4HA 2BWJA 2HJGA 4WIAA 4RD0A 2SHKA 4KV9A 2IYZA 4PAOA 1BMFA 1DAEA 4Q7LA 4AC9A 1FPMA 4TSFD 4DT1B 1Z47A 2GEUA 2FSFA 3E2IA 5J40A 1J2JA 1MV5A 4RKFA 1Z6YA 4LDJA 5E7MA 5KNBA 1W4AA 4A2PA 2RHMA 2LWIA 5GJWC 1OXSC 4B2LA 5LDDC 1XCMA 2H17A 3MD0A 2JLRA 4LSGA 3LY5A 1XEXA 1P9RA 2Q3MA 1T0HB 1XD2B 2QG6A 2WV9A 1WXQA 2W2TA 3AF3A 2QT0A 1Z22A 3X1WA 2ZROA 3T1QA 1UKEA 1NN1A 3HJNA 3L43A 2QMHA 2QQEA 3LV8A 4URVR 2IUUA 4R71A 2D2EA 2C9CA 4QHTA 4LZZA 3U61B 5D3QA 1KI2A 2GDJA 1OB5A 2J0SA 3HWSA 2HXSA 1T9HA 1NMZA 4EQ6A 3NBFA 1MO6A 2ZAMA 4EIWA 4X8LA 4QBIA 5FUYA 721PA 4TQUS 2JASA 4TYYA 1RRCA 3ND8A 1E32A 2W58A 2WWXA 4D82A 2FPLA 4CIDA 5L3QA 1IN8A 1EG7A 1NVVQ 1R0WA 4HATA 4DEYA 4U7DA 3GLFA 3PENA 1QHXA 2RGAA 3ZS8A 2QTHA 1ZM3A 2CJWB 2QA5A 2GVDC 3QE0A 1I2DA 2C78A 1J7KA 4FIDA 4DCSA 3GLGE 1OFUX 1U99A 4W5JA 3IUYA 3WNCA 4QM7A 3DMNA 1T3SA 4TYNA 4RY2A 2QAGA 3W5IA 1ZU4A 4P33A 1YR7A 2W2XA 2AN9A 1E2KA 4LI0A 5JWRA 2BMEA 3L0PA 4JVMA 4URXR 3LRPA 3MWYW 2AHOA 4IW3B 4D4LA 5BWMA 3VNVA 2HYDA 4JVLA 2VF8A 3LA6A 2ZYWX 2J7PA 1Z8FA 3SDZA 1E69A 3QEJA 4TL7A 3NKVA 1U0JA 3I8SA 2BCGY 3S1AB 2PL3A 4DVGA 2UVQA 4NH0A 4D4KA 5TV2A 5C18A 3TKLA 1XTIA 2IUSA 1XPUA 1XZQA 5G53C 5JFGA 1RYHA 4JSTA 5TARA 1XD9A 4EPRA 1E9CA 1OB2A 2BBSA 1NG1A 3R9XA 4EAQA 2JJ2A 4EKDA 1FNMA 2ZJ2A 2D74A 5DLQC 2BV3A 2CL7X 4WW0A 5DYIA 5FTJA 1Z0IA 5G40A 1CR4A 1IONA 1S0UA 2HUPA 3IILA 4OHXA 3X1XA 4QL3A 5LD2B 3EZFA 1HTWA 3JVUA 3WNDA 3UMRA 5KOYA 4OL0A 4Z51A 2QMOA 1ZC3A 3Q9LA 3NDBB 1U9IC 4NP6A 3CB4A 3B9PA 4H9GA 1GIAA 1ZYUA 2ATVA 4NZYA 2WICA 5EP4A 2HDNB 4MRNA 2CLDX 1ZNZA 4A4DA 2WKPA 3NBXX 3NHBA 2IHYA 2R44A 4JS0A 4MUAA 4Q00A 2Q0HA 1D2EA 2NIPA 4BFSA 3NVAA 5BXQC 5A0FA 4MUBA 4TLCA 3DL0A 4GT1A 3EPJA 4RFVA 4LV8B 3T35A 2IF2A 1GRNA 4JKIA 3VX4A 1SKQA 4FD2A 5EP3A 1G7SA 1TU4A 5CITA 2ZAOA 4RZ3A 5AUNB 3DM5A 5EQTA 1AS0A 4OK3A 3IBGA 1TF2A 1B23P 2QORA 4S2EA 1P72A 4HI0E 4AI6A 1WBBA 2C8VA 2RGEA 2Z0MA 4PQYA 1GTVA 4B47A 2D2FA 1FTNA 3WY9A 2A9KA 1UM8A 5DYGA 5K8IA 4HEJA 2A7QA 1S1MA 4RZUA 2QGNA 2QPOA 3HYRA 2V6JA 3AF1A 3AM1A 1UBFA 4JLMA 4DKXA 1H8ED 4U00A 2VIIA 4FW9A 3EPLA 4QGFA 2I1QA 1DPFA 1E0KA 1NSFA 3L0OA 1N5LA 4N3NA 1CJVC 1W44A 1R8SA 2IXGA 4UNRA 2IF0A 4CT4B 4DEXA 2YVUA 1E1QD 4JLNA 1L4YA 4PSKA 2FPMA 1JR3D 2ZU6A 1XJCA 1KDOA 4PO1A 1LVGA 1GNRA 2CK3A 2G1KA 2JDID 1LB1B 3GFTA 3DPUA 2GCPA 4URUR 1NRJB 2NPIA 2R6AA 2W00A 3TVDA 5JEDA 1GG2A 4MQBA 2LKCA 4A36A 2PZEA 1G4UR 5C1BA 2NO6A 1WBDA 3LDAA 4XSGA 2XSZA 3CPHA 1JR3E 2NO7A 5M04A 3BJIC 4BZQA 4GMXA 4ZKEA 1AZTA 2GILA 2K5UA 1OFTA 1G8GA 1JALA 1OFHA 3ND9A 4G5GA 4HLUA 3AVXA 2GVZC 1XEWX 4JLVA 1KOFA 4PPFA 2E1RA 4Q48A 3WRXC 2EFGA 2R2AA 4YDSA 1J8MF 3WP0A 4IXMA 2MMCA 1KO4A 1XU4A 2Z4SA 3B1XA 3B1VA 5DHAA 3UANA 2DR3A 2CVFA 3TE6A 3FMOB 5JWHA 3TMKA 4TQAA 4ZPXA 4XTRA 4CEHA 3BS4A 1U90A 2BBWA 1P62B 2OT3B 121PA 3B7GA 3CONA 3QPUA 4A1FA 4QHSA 4BE7B 2ZE5A 4YC7A 3ZQJA 4GP7A 1F5NA 2EU8A 3L8ZA 1TUIA 5JCZA 1IJEA 1NIPA 3U3MA 2P0EA 1VPLA 3EIEA 3FMIA 4PAQA 1G3IA 1XXHA 3B1YA 2YOHA 3AB3A 2FJUA 1KDRA 3GEHA 4BQSA 3IIJA 4TMZA 2ZI3A 4PHTA 1OHHA 4LHVA 3EZ2A 3KL4A 1K6MA 3C8UA 3VR6A 4DBLC 1SKYE 2XJ9A 1FUKA 4CT5A 4Q1BA 1N6NA 3TGPA 3W8RA 4XD7A 3ZVMA 1G7RA 1HURA 1O87A 2XB2A 3P26A 4TL8A 3GJ4A 4PHHA 2ZSEA 1M8PA 1OIXA 4JL6A 3SFVA 3IO5A 1Q3TA 2ZS7A 3LBIA 3T1OA 4B75A 4PAMA 4A6XA 1YR9A 1IBRA 2D62A 3TNFA 2GHIA 1GUAA 5KSZA 2WKRA 3EPHA 4BGDA 1GSIA 2OXRA 2ZI9A 3W8NA 1W48A 2WWHA 521PA 1HY3A 3OFND 3JVVA 4Q5IA 4CYMA 2PX3A 3ZVRA 2FSHA 2IYLD 1MKYA 5GJVC 3O8BA 3ZZUA 5G41A 1JEDA 4C3ZA 2AFHE 3WRYC 3UIEA 3BORA 1A5TA 3T12A 3W3AA 1ZBDA 2XNSA 3LXXA 1RRGA 4QRHA 4RD1A 4AYTA 2ORVA 3EG5A 5FBRB 4JIMA 3BBPA 3U3RA 5FOXA 4B43A 4F91B 3BB4A 3CZPA 4LYHA 1VYTA 3Q8XB 4DLTA 3BERA 3LO5A 4TLAA 3EZ6A 1HV8A 1WF3A 1YZNA 2H18A 2QN6A 4EFMA 3OFNA 3PEYA 4TLDA 3SJBA 3U4QA 4M1KA 821PA 1W36C 4JYBA 3PITA 4M4SA 2ZR7A 4V0NA 3K09C 1IJFA 4MRRA 2KBFA 1SXJD 2W6IA 4KITB 3CUEF 3OE7D 3ZVNA 1ZM4A 3NBYC 2BDTA 3UXMA 4CEJB 4Z1MD 2LCFA 2MSDB 4KSCA 1XDBA 4IVQA 2VEDA 3BH0A 1R0ZA 1U9IA 2FEMA 4S35A 1CRPA 3K0CC 1D8TA 4Q1CA 4AURA 1JBKA 1Q44A 3AF0A 4UNPA 4DLXA 2DFTA 5KU1A 5KO2A 1Z63A 1HE8B 3ADDA 2G83A 5AJVB 4LX0A 1NVUQ 2VP4A 4I81A 4DUGA 1GL9B 2WWFA 4JLKA 3IPXA 5HPYB 3RABA 3CBQA 5FI1B 1OH5A 1J99A 4KAXA 4UNQA 3I5YA 3QKUA 1FP6A 1AM4D 1M2OB 4BLPA 1IAQA 2J3EA 2XZPA 2WSSA 1YZTA 1E2JA 1VHLA 2V7QD 1E9RA 1VCMA 3MMPA 4LJAA 3ASYA 4AIIA 1RZ3A 3KTAB 5L3QB 2VHUA 5B57C 1GZSA 3PG5A 4W5WA 3SE0A 5BN4A 1OJLA 2ZJBA 4URYR 4WVFA 4TQ9A 3PJRA 2G0TA 4JL5A 1E9BA 2QSZA 1P73A 2ZS9A 4V0OA 1E2LA 3GEEA 3CO5A 4KYUA 4AYWA 2WVJA 3B9QA 2O8DB 2GTPA 2IYRA 3RAPR 4OHZA 1GRQA 1G18A 3Q5DA 4AYXA 4ZCLA 5C2JB 4PZYA 4KFRA 2WAYA 3FOZA 4G5RA 2A5DA 1HA3A 2WMOB 4PX9A 3QQ5A 2V7QA 3LD9A 4ZDWA 3B2EA 5FOTA 2NMVA 5GADl 4TT3D 5EE5B 4A0RA 3F0TA 3IBYA 4ZV4A 1E2HA 2D3WA 3VU9B 1KAGA 3LWNA 1FQJA 3X1ZA 4LOAA 4DCNA 2ZVQX 3A1WA 1KI8A 1P5ZB 4DZZA 5JMTA 1TNDA 1B0UA 1F3OA 1OXUA 4OI1A 4HDOB 3WMEA 5HKKA 1G21E 3ZD7A 4Q66C 2F43B 4IVRA 1AS3A 5EXTA 1R0XA 4B3BA 3T15A 2PT7A 3NC0C 4BFZA 5TVKA 3RSOA 2O8DA 3ASZA 1JAIA 4II7A 1SVMA 4KLZA 4LCBA 4TZ0A 3I5XA 4QHYA 3IEVA 2ZUBA 4PPQA 4DIEA 4L16A 2CCJA 2HJVA 4TYQA 5E4FA 3ZVLA 1XTQA 4IOKA 3GLFB 1I4LD 2JIZD 4CEIA 4MYHA 4MRSA 3UG6A 4AKHA 4FXPA 4US0R 3U5ZB 3K09A 5DN6A 4HB4A 1L4UA 3UPUA 5GJBA 3VKWA 3OEHA 5DI9A 4ZKDA 4Q18A 4Y0AA 4IDQA 2VF7A 4H1UA 4FMDF 1VCNA 1K5GA 1S2MA 1DG3A 1E6CA 3KKMA 1OH7A 2V3CC 1N5JA 4M9XA 1YVDA 4HB3A 1P6XA 2O8EB 4A2WA 4C2TA 3I3SR 4G0NA 4KXFB 3NTUA 2C96A 1XJQA 1SULA 1W0KA 2AX4A 4KFUA 4A82A 4NTZA 1IN5A 2W83A 3FGNA 2XXAB 4MITA 3F5FA 1WQ1R 5SZIA 3CR8A 4IHQA 2KB0A 1TUEA 1G8HA 2WPDA 1U8AA 1Z0FA 1KMQA 4B33A 2GETA 2IYTA 3WNBA 2KI5A 1DAIA 3DZ8A 4FCTA 4TTQA 3ICQB 1UPTA 3EWAA 4PHGA 3KKOA 2VP9A 4HZUB 4EJSA 3A1TA 4DT1A 1YR8A 3GMTA 5FBQB 4BFUA 2VHJA 2BMFA 3QI2A 4L15A 3H4MA 1IOZA 2ZE7A 3KDSE 1TQDA 1CBUA 1XJ0A 1XFAA 1GFIA 2YOGA 3CPEA 5FR2A 1P7CA 4DSNA 2ZI6A 4C30A 3CNOA 2YWEA 4Q9LA 4FI3C 1KJZA 4PPNA 4WXPA 1E2MA 3NHAA 3FKQA 5CDFE 4HZIA 1M34E 3BH6A 3AV0B 4ZI3A 2V8OA 4TMKA 1IXSB 3K9LA 4V02A 1M7GA 1E0SA 1FP7A 1OYYA 4KVAA 3RDPA 4R98A 4GPTA 4ON9A 5SZJA 1OHHD 4NYIR 4LYAA 4XVQA 3WBKA 1XF9A 1XNJA 1OXVA 1TF7A 5J5CA 4IFEA 3VR1A 3EZ7A 2I4IA 4MYCA 2IL1A 3HDTA 4NYJR 1SXJB 1WE2A 1Z0KA 5LB4A 4EFNA 4CF7A 2ZRNA 3ETLA 5UKDA 4QG7A 5CM8B 5GVRA 4GOXA 1TF5A 1US8A 1XD8A 1H65A 5JSZA 2RGNC 1XMSA 1ZIOA 2R8RA 3DVLA 5JI3E 4B3XA 3DMDA 4UNSA 3SC3A 4Q21A 2CL0X 3EA0A 4ASUA 4ZDKA 2D4HA 2QY9A 2RMKA 1ZM7A 1QRAA 2CHGA 4M1TA 1NVWQ 4EQ6B 1EWQA 3M0EA 3UK6A 4NDZA 1VCOA 5KNDA 2R6DA 4N0DA 1AK2A 3GLHA 2GXSA 2P67A 1LV7A 3FKSA 2FZ4A 3GJ6A 4NYMQ 2F1JA 5TY0A 1IN4A 4RD3A 2DFKB 4Q1EA 3AVOA 1CU1A 4B73A 1DOAA 2QAGC 4C0QC 4LBVA 2F1IA 1YZLA 2WJIA 2FN4A 4PQRA 4NL4H 1ANKA 2ZSBA 1RJ9A 1R2QA 3KFVA 1UF9A 4Q4JA 1KNQA 1CR1A 2BKUA 4YQFA 1G4AE 4N1AA 3QXSA 1N5IA 3F3YA 4BLRA 2GXUA 2XOKA 2Y8EA 3MWLA 2OBNA 4NBSA 2RGBA 4MGZR 4R7ZA 1KK2A 1XD2A 1OF1A 2JAQA 4W7SA 4M53A 4QKQA 5L3SB 1WCV1 4I1SA 4RFSB 5JBQA 2RKOA 5KDLA 1E2GA 1CXZA 1PLJA 1WP9A 2EFHB 3V4RA 1T3LA 1TMKA 4TTPA 4BLTA 2FFHA 3HPRA 4FWTA 5LPNA 2IS1A 1D9ZA 3A58B 3G0HA 3PUZA 5LB2A 2UZ3A 1QDEA 3B5JA 4IJMA 4V0MA 1S3GA 1QBKC 2J9RA 1VG0B 1P2UA 4XH9B 3RVBA 1N6LA 2AD5A 2JGNA 5FBWB 3LX5A 5FPYA 1TEXA 3PEWA 1NVVR 1ZM2A 3GLIE 2WOJA 1XX6A 1W2GA 2FDCA 4TSFA 4W5HA 1Z3IX 1KYIA 3VNUA 2EW1A 5FBVB 4DSOA 1NJFA 5K8LA 5BYKA 5EE9A 3NH9A 1HUQA 4E07A 2OCYC 4PC3A 1T5LA 2FZLA 4XIGS 1S8FA 2XZLA 3LXRA 3QUSA 1ZUHA 3BH7A 3KQHA 1CF4A 3H86A 1U0LA 1N6PA 1QHHB 3C41J 3CRVA 4ASUD 4C7OB 3LVRE 2KE5A 4PC7A 3RC3A 4EFLA 4K8OA 3THYA 5B64A 1X1SA 1X8JA 3CH4B 3AP2A 2R6CA 2PT5A 1JNYA 4B32A 2P5TB 1Z2AA 1M6NA 3MJHA 1VG8A 3P20A 1T91A 2JLSA 3TRFA 2ODBA 2VHCA 1CEEA 3BOSA 4BFTA 2FNAA 2A5GA 2BBOA 4CEHB 2DPXA 4Q9IA 2V9PA 2WTUA 3M1IA 3AVVA 1N6IA 2GXQA 5C4MA 1A4RA 1NSTA 4LYFA 4CZ2A 1UEJA 4HSEA 3CR7A 5FI0B 3RANA 1SQ5A 4G5SA 1GKIA 1NIJA 1TU3A 4LBWA 1N0UA 2P6UA 1P2TA 1ZW6A 2GK6A 3D6TB 3R20A 2Z5FA 1G291 4KHZA 5ANRB 3WHLA 3AF4A 1RYFA 2P6NA 3H0KA 2BKEA 3SEAA 4RSGA 1S1CA 4PTLA 1PV4A 1HQCA 4OHYA 1ODFA 1Z5ZA 2QMUA 3KUDA 1FTSA 1ZCAA 4LJYA 4I1UA 2IYSA 1S9DA 5JS7A 2ZRCA 5SZHB 1IY0A 2IUTA 2YV5A 2B7CA 2OCPA 1P3JA 2W0SA 2XNDA 3UWOA 3C15C 2ZJOA 4H1VA 1E1RA 3P1JA 3TW4A 2JCSA 5E7JA 1D5CA 4C0HA 3THXB 3CWQA 1ONBA 1ZCBA 2AWOA 4HAXA 2ECKA 1MR3F 2VA8A 1CJTC 4X8OA 3D8BA 2F6RA 4KVGA 3OESA 5EXPA 4PZLA 1X3SA 1Q1ZA 2CCGA 2WAXA 2EVWX 4B76A 5BW8A 4TMWA 5DISB 3W6OA 4P4SA 5AK0A 1KKMA 2VP6A 1ZC4A 3A4NA 3VHLB 4ACAA 1XMVA 2EYQA 2GF0A 1R7RA 3I62A 4I1VA 1UFQA 5EZ5A 1E2DA 3K9NA 421PA 5C46F 2KBEA 4QGAA 4QJ3A 2CE2X 3NIBA 4UQOA 3AVTA 1W0JA 2ZPTX 3QXJA 2IWRA 3M4YA 1Z6GA 1FL9A 1F48A 1ZD1A 5KSPA 3RS3A 4LJ8A 3LW8A 3B13B 5EE3A 1NBME 1O3YA 5H70A 1R5BA 5HCNA 4KODA 3ZS9A 2ZRAA 4ERNA 5JWOA 4DLWA 2O0JA 4JLBA 3GJ7A 2HYIC 3NWJA 2HXYA 3RS2A 1XXHB 3MWJA 3DOEA 2FA9A 4JLDA 5JJKA 4DSUA 1KI3A 1N5KA 2Q9CA 4RD4A 3K1JA 5BQ5A 4ZI2A 3OE7A 2XTMA 1E79D 2ZRFA 3HR7A 1E9SA 1C9KA 1OW3B 1NI3A 4ACBA 2C2HA 2V4ZA 1G19A 2IYXA 3KKPA 1OE0A 4KSBA 2AFIE 3K70B 3U7HB 3SN6A 5KYKA 2O8BA 1IHUA 4D0LB 1EXMA 1G5TA 2GF9A 3QVVA 3U7GA 2B8TA 2FV8A 1GNQA 1D2NA 1OXTA 1FX0A 3WYGA 3I8XA 1MH1A 3CLVA 1E99A 4PSVA 3SNHA 2O8FA 1Q3HA 4DDTA 2NOAA 4M1MA 2J41A 2YWFA 4HAUA 3TUJC 3K0EA 5AUQA 2EWWA 2QROA 2WJGA 3PQCA 4HZUA 4JJKA 4EJSB 5IK2D 1A2KC 4DIDA 3BAFA 2ZYTX 2D7CA 2YYZA 1ZD8A 2OAQ1 3EIQA 4URZR 1A2BA 1KSFX 2ZI5A 3QKSB 1BH2A 1GITA 4XSHA 2G1JA 4JLPA 4MKFA 5CJ2A 4D81A 5F2EA 3D7MA 1CP2A 1WRBA 2PCJA 2BC9A 3D3QA 3KQKA 4EPWA 3J81k 1HEIA 1RIFA 5JJLA 4MRPA 5J4LA 3K9GA 1Q57A 3MSXA 2NGRA 2JLXA 4GBMA 1SVSA 4M21A 1R5OA 1XEFA 1E9EA 4LJ7A 3AVUA 3UATA 1VTKA 3LNCA 2DWPA 1QHYA 4Q4LA 3B6EA 3MLEA 1ESNA 2CHQA 3FHCB 4DLVA 2ZRKA 2OEPA 4QNMA 1QF9A 2GK7A 4QJ5A 3GJ8A 3PEUA 4L9SA 2QEQA 1HT1E 5FFMA 1TX4B 4XWKA 5CYPA 2GEVA 3E70C 3A1UA 3OEED 1ZJ6A 2N46A 4LJ6A 4B3DA 1NN3A 2P6RA 1K8RA 1YZQA 3RRYA 2PZGA 2GEDA 4IOMA 2GBLA 3Q5EA 3R8FA 3SR0A 2ANCA 3L0SA 4DCTA 2H57A 1JQLB 4OK6A 1GVNB 2J0UA 2ZRIA 3LQQA 4BASA 4B48A 3CZQA 2C04A 5FTKA 1KY2A 1Q1QA 1ZP6A 2KSQA 3NG1A 2ERXA 4LYJA 4HYYA 1QHHA 4DDVA 3HPQA 3CRRA 1D2MA 2VTKA 2G3YA 5J4KA 3FFAA 3KJGA 3OAAD 2FX3A 2IC5A 4HLUC 4OJKA 1QG2A 1RJ9B 5D3MB 1QZXA 2J46A 3CH5A 1IN7A 2PMKA 2AK3A 5H68A 1I4DD 2ZUDA 2ZI7A 3KUCA 2G0NA 2JJ8A 5J4YA 3FPAA 4C0JA 2YWGA 3E1SA 1G6HA 1UDXA 2W0MA 4TL6A 3BK7A 1SXJC 4LBZA 4JBWA 4LBYA 4F4CA 2OFXA 3CF6R 1PLLA 3OIWA 3QPVA 2CLCX 1RE0A 4XTCS 1FNNA 2FSGA 1EFRD 1E79A 2ZM5A 1VIYA 3L8YA 3OIVA 4RCZA 4MYUA 4CVNA 4D4JA 4MA4A 1C1YA 3IO3A 3PFIA 3EIHA 2VP2A 3U60B 5DNYB 3RLFA 3G82C 5G3YA 4CW7A 2VBCA 4F4JA 3KB2A 2HV8A 1ZNXA 3FFBA 5TB5A 4YDHB 4JMPA 3B78A 2JEOA 4M1YA 5HE9A 1XMJA 3AGPA 5CB8A 2Q6TA 2PJRA 1QHNA 5E95A 2QTVB 4NE2A 4DWJA 4CRWB 3VR2A 3UMSA 1VHTA 4AKGA 2QGZA 1KI7A 1T8UA 2FG5A 2GJAA 2ZEJA 4AG5A 1MRSA 3PUYA 4M1WA 2OM2A 2ZTSA 3FYHA 5CLQA 5EP2A 4GNKA 2JLQA 4IFBA 1N0WA 1TTTA 4IOJA 1ZU5A 2BEKA 1MOZA 1EX6A 2Q3HA 2ZR9A 2YOFA 2QBYA 4Q01A 1OKKD 2QI9C 1ZRHA 1DAGA 4YXWD 2O8EA 1DO2A 2REBA 4NYMR 3RSLA 4KU4A 2ZSAA 3AQ4A 1P61B 2OG2A 4KCGA 4UJ5A 2ZS8A 3QF7A 3K0CA 5DGXA 5EE1A 1TQ6A 4E09A 2BM1A 3KX2A 2L0XA 4TMXA 3WHKA 5BN5A 1OYWA 2GZAA 3U2QA 1NF3A 3K8YA 4WZ6A 3W90A 1VCIA 3BIFA 2HCBA 1LF5A 1KI4A 5IHPA 3MG9A 2ZJZA 3ZH9B 1M7HA 2PLRA 2OBLA 2QL6A 1KNXA 3ZGXA 2VSOA 3T06B 4US1R 4MKGA 1NP6A 1GWNA 3K0AA 3B60A 2ANBA 3O47A 2IEZA 4Q47A 4FMDB 1II0A 4O3MA 5KDOA 4FN5A 2ZU0C 1M1YE 3QKTA 3N2EA 1AN0A 1DAKA 2O0HA 3FMFA 4PFSA 3GP8A 3GJ0A 4AY2A 3EZ9A 4B2PA 2QP3A 2CLSA 1R4AA 1E96A 2PH1A 5AR1A 3CRW1 1KMHB 3EC2A 1EK0A 1MABB 5BYJA 1U81A 2JA1A 3RRNA 2DYKA 4QJ4A 3R9WA 3MFYA 4BEBA 2JJ1A 4NPHA 3FHOA 1J8YF 4JLJA 4Q4JB 3QNUA 3ADKA 3ADCA 3ZJYA 1Z0AA 4NCHA 3AKCA 4RJLA 3AGQA 1OLOA 1PUJA 4RD2A 2O8FB 2BIFA 2MMGA 3TIFA 2JLWA 2ZUCA 2W6JD 4OKSA 1U8ZA 2G9NA 4ITRC 3GJ3A 1G5RA 4Q1DA 3AVWA 2OUKA 2AK2A 2FSIA 3IPYA 2JLYA 2OXCA 1IXZA 2FF7A 2E9SA 2NPFA 1EFTA 3FVQA 5F9HA 5KSYA 4OQXA 2RGCA 1NLFA 1DAHA 1XCGB 2VL7A 3CWZA 1Z83A 2EFEB 3ONWA 4KJZA 3THWB 1VG9B 2XGJA 1DEKA 4I1OA 4EPXA 1EFUA 4IRUB 2ZRMA 4EPVA 1EFHA 3N70A 3A6PC 3CX6A 4WA7A 4FCVA 5CK4A 3KKQA 1WA5A 4B6FA 4C2UA 1TADA 4JVSB 2DY1A 2QMEA 2AKAB 3AP1A 2V6IA 4RVCA 2Z4RA 3QKSA 2J5XA 2F43A 4HB2A 3C4JA 4CEJA 3TVTA 3PV0A 4CEIB 5AWFC 4NCJA 1W4BA 3DHWC 2GESA 3ZZTA 2QZ4A 2F3RA 5FUVA 2P65A 2I3BA 4DLYA 4L5BA 3SU8A 3AP3A 3OIUA 4O25A 5F9FA 1E2PA 2ERYA 2AR7A 3DEFA 3L2OB 3H1TA 1ZIPA 1KDPA 2DFNA 4JL8A 4LHXA 1T8TA 2IS4A 4QBFA 2RGGA 1UKZA 5KPDA 5LD2C 3HU3A 2G88A 2XX3A 1CR2A 3C14C 1L2TA 1KMHA 5IDVA 5KDDA 4R9UC 4ESVA 2NO1A 3FB4A 1CR0A 3EPKA 3PUVA 4IDNA 1MT0A 4PZZA 4TTRA 3N2IA 2JATA 1UKYA 4GSYA 4OYHA 2OV2A 3L82B 1IQPA 1E2EA 3GEIA 3P27A 4Y0VA 4D0NA 4PC2A 1YZUA 3VMFA 3WYFA 3CM0A 1XRJA 2YWHA 3X2SA 3WMGA 4AK9A 2IS2A 1GOTA 1JJ7A 4Q1AA 3Q3JB 2J59A 2R6FA 4QXAA 4GOJA 3T1VA 3T1TA 2W2VA 5EZ6B 1N25A 1ZD9A 3UMFA 1OSNA 3U6BA 2E87A 4OQMA 3KTAA 3WMFA 4NCIA 3WXMA 1YZKA 8OHMA 1G41A 3SQXA 2XXAA 1GL6A 1GDDA 1N6RA 2IW3A 2WJYA 2IBMA 1NBMD 2AKYA 1JEEA 3P4YA 4U02A 4XOIA 1Q1BA 3NXSA 1XTKA 1PZNA 3CF0A 3PEVA 1CS4C 2BOVA 2OFOA 3X1YA 2Z83A 621PA 2BMDA 3DKVA 1V5WA 3E5HA 1Z07A 4P4UA 4BRUA 2WJHA 2YC2C 1Q0UA 2HEIA 1VDZA 1XMIA 2PMDA 2IXFA 1W0KD 2WWWA 5DO9A 3I32A 3BGWA 5AJWA 4O2LA 4DHEA 3AUYA 1NLZA 3BWDD 4PC1A 2P2LA 4Q19A 2BBTA 1VMAA 3QF4A 3JZMA 3K0SA 2OCAA 1W49A 1UEIA 3DOFA 4I4LA 5E3HA 2G77B 2XTNA 4Q03A 4A2QA 3BC1A 3MCAA 5KPJA 3EWSA 4YLGA 3A1VA 4P0TA 4M1SA 4Z8YA 1BYUA 1L8QA 4BZPA 4WZBE 3SI7A 4NMMA 3SYNA 4ZIRA 3FHTA 1W0JD 1HE1C 5DH9A 3X1DA 1F2UA 1HT2E 1N6KA 5FOVA 1II8A 3QY0A 3R9IA 5FUXA 5JS8A 1CJMA 1MABA 4JZKA 4BLQA 2VP0A 3WP1B 3THXA 3SHFA 1QVRA 1YRAA 3ZYCA 3U6KA 2NO9A 2XB4A 1G8PA 1U98A 1R0YA 5FPHA 1E3MA 4DDWA 2OCBA 1OV4A 1KO5A 1GL7A 1G3MA 3QOFA 2W6JA 2H16A 4HDQB 2WMNB 2ZJAA 4PHFA 4JLOA 1E9FA 1AA9A 5EJEA 2RGDA 1YKSA 3MRSA 5G3ZA 4ZCIA 3K70D 1VYVA 2J0VA 1UDWA 5K8UA 4ZO4A 1DO0A 2JJ1D 1G8YA 2GJ9A 1Z29A 4DLUA 2BMJA 2F1HA 1X86B 2O52A 5D3MA 1CKEA 4GFDA 1GKYA 4FINA 4QNRA 4LV5B 5FR1A 2QRZA 3LLUA 2OSBA 5A4JA 2EWVA 4HLDA 3EC1A 2DBYA 2OZEA 4NCNA 1KI9A 3NDPA 2ZJ8A 3V4FA 2N42A 1XP8A 5AJYA 2ZXUA 1G3QA 2CL6X 2QTFA 4LK2A 4L9WA 3GLIB 3QENA 2JLVA 3W6PA 5IT5A 2GCOA 4HB0A 2EFCB 5LBIA 2ZJ5A 2QQ0A 2ZR0A 5P21A 3AF2A 4A8JA 4GZLA 2A5JA 5IK2A 5L8VA 1KHTA 4UXJA 4DXAA 2QU8A 1JAHA 1E94E 1FMJA 1N6HA 2UKDA 4DSTA 1DG1G 5CB6A 1COWD 1YZGA 2ZE6A 3W34A 3NBZC 4TN1A 1LFDB 4X8MA 2VHQA 4B2IA 4Z54A 5FTNA 1S3SA 1N0VC 2OESA 1P60A 3AVQA 4OI4A 1Q21A 3EW9A 3EA5A 2ODEA 4MGIR 1KK0A 1ZVQA 1Z0JA 3A37A 1KAOA 2VSXA 1MO3A 3AUXA 3CNLA 4R2IA 3U44B 4ZDJA 1NG9A 5E7IA 4XWOA 4GP6A 3T61A 4PQFA 1XPOA 4PO9A 3THYB 1KSGA 4D0GA 2IWHA 3ZD6A 4M22A 1OIWA 2CHVA 2F9MA 3H84A 4Q9HA 2C95A 4Z8XA 1TQ4A 3TUZC 1N6OA 5J47A 1RW4A 2D06A 1Q12A 2ZRDA 4JKYA 2C9YA 3RS7A 2J1LA 2NZJA 1JPJA 3KJEA 4BLSA 2R62A 1DBSA 1G20E 1WDTA 2FGJA 4M2LA 4JT4A 3LAWA 4N0EA 3TR0A 4YMTA 1CIPA 1U8YA 1WMSA 3LH5A 4HUQB 2BM0A 4QGGA 2CXXA 3C7KA 1KJYA 2FFAA 3QJYA 1N2CE 4B74A 2CEAA 3TBKA 4M0LA 4I99A 2ZYVX 3W6NA 4XWAA 2IK8A 1R5NA 2H7VA 3QXXA 1AIPA 3MUFA 3QBTA 1QHSA 1F60A 2YC4C 5C4GB 3O8DA 1JB1A 2QPAA 5DE3A 3K0FB 2QP4A 2XTZA 4HDCA 2J0UB 1TEVA 1I4TD 1BS1A 2RB4A 1KK1A 2BCJQ 3IGFA 1NY6A 5KUTA 2ZI4A 2B7BA 2BJWA 2KJQA 2CNWD 5JRZA 3B1ZA 3K9HA 4LJ9A 1NMXA 4LHYA 4DJTA 5DIFA 4OBEA 3LBHA 2GA8A 4ARZA 4ESHA 4BEJA 4LJ4A 2IYWA 2RHDA 3HYTA 4QC2A 1II8B 4RCYA 2V55B 6Q21A 2P5SA 3R8CA 1JI0A 4K46A 3M6AA 4C0LA 4IDPA 4BUJA 5JLJA 2WJVA 3PUXA 4GL2A 3BFVA 2IYYA 1CULC 5JI2E 3TLXA 2XEXA 3QG1A 1F2TB 5FL7A 1SKYB 2ONJA 1YR6A 1OFIA 3W5JA 2F55A 4F93B 4A8JB 3KXKA 1UBEA 2VQSA 3I72A 3Q85A 1E4YA 1Q20A 2CVHA 2PCLA 5IRCD 4KFTA 1A82A 3RS5A 5CYOA 1US8B 2VO1A 2DWOA 4DC9A 4Z1MA 1G8FA 1W36D 4UKDA 1AZSC 2A5YB 5B58C 4D25A 5B30A 3FTQA 1HQYE 1OXXK 4MDEA 2C77A 4BWYA 4NU0A 5CIQA 5HKKD 3OEEA 3ZIAA 4EJSC 4GMDA 4TMVA 5EP1A 1RRPA 4JT2A 3QEOA 4C9BA 1IY1A 4BRWA 1II9A 3TJZA 4RKEA 4IDHA 5TMPA 2GJ8A 1H8HD 3HU2A 5FTLA 4QGHA 4HLCA 2DFLA 4TZ6A 2ZETA 1KDTA 5DI3B 3O8RA 1IN6A 4E03A 2GCOB 4FMBB 1MRNA 3WBJA 4M9ZA 2OAP1 3QKRB 4NONA 1JXMA 3RS4A 1IXRC 2X8AA 1AGRA 4E22A 2XNDD 1DELA 3DKPA 5J4VA 1C4OA 4LWZA 4A15A 3RWMB 1X1RA 4Q02A 4A0HA 3SYLA 3Q7PA 3V9PA 2QAJA 3I4LA 2HF9A 4NCKA 3ECCA 3U7EB 2IEYA 2A5FA 1KO8A 1KJWA 2J0QA 2NQ2C 3KXIA 1P9NA 2FE4A 4B6EA 2PZFA 2B21A 4PXAA 3GCGA 2J7PD 2R65A 2Z43A 1XTJA 2IXEA 4LC1A 2YNMA 5FUWA 1ZUNB 3EX7C 1W5TA 2XJ4A 1PJRA 4MGYR 1QVAA 3PXGA 4QM6A 1OH6A 2REXB 4KYIB 4HUQA 4G3XA 2TMKA 3LBNA 2WPDD 1W4CA 4JYCA 2J45A 4YMVA 4ABYA 3RC8A 2NTYC 1KO7A 2VHTA 4TYPA 4LV6A 3REFA 4MDFA 1IY2A 3DZDA 4IOLA 2D7DA 3JZAA 3K0AB 4YMUA 4ZCMA 1W2HA 1ESMA 3EASA 3ZDQA 4B3CA 1CLUA 3IQWA 3O8CA 3PIRA 4X8HA 1S96A 4P4SB 5K8TA 5ELXA 2CMKA 1JJVA 1F6BA 1G1MA 3MGCA 3F8TA 3TQCA 4WZAE 4QBHA 3GFPA 5F3WB 5IF9A 4C0KA 2QE7A 2Q9AA 4IVPA 3AH8A 5KTYA 1AS2A 3KZ1E 3VR3A 1GM5A 3I92A 1QHGA 2C98A 3WYAA 3TUIC 4D6PA 4D2IA 2EYUA 2N1BA 3Q7QA 4RZ2A 2CDNA 5FPTA 4KBFA 4G1UC 5CK5A 3THOA 2WWYA 1SHZA 4LY6A 4Q4AA 3SHWA 3U3JA 2JLZA 1DAFA 4OQLA 4OI0A 2VH5R 4MKIA 2ZJYA 3RYTC 2F9LA 3BRWD 3TW8B 4US2R 2BEJA 3BE4A 1P4SA 1AKEA 2GNOA 3PUWA 1F2TA 1KGDA 2VP5A 3D31A 1J90A 4PO8A 3V00A 2VYFA 3SFZA 2ORIA 2GRJA 4MYTA 3BXZA 2ZANA 4V0KA 3GD7A 2IT1A 2QUZA 4C0BA 3BFXA 2CBZA 4M9QA 1V43A 2ZITA 1G5PA 4IXNA 4LHZA 1PLKA 1Z06A 2CNWA 1BO6A 2ZRJA 1NLYA 2QM7A 3FWYA 3OF5A 4OJQA 1Q22A 1MO5A 2OLKA 4XJXA 1X8LA 2ZREA 3G5UA 3IIMA 1AJEA 2GWHA 4YONB 2QRNA 2HF8A 3QIAA 1ELOA 1G16A 3NEYA 1KZ7B 2G6BA 3A4MA 5FOSA 4DUGD 1AQYA 2CE7A 3KB1A 4QBGB 2GJKA 2VRWA 1E2FA 1NMYA 5KNCA 4QFMA 1SVLA 2R9VA 2ZVPX 5FOWA 3CW2A 4DLSA 1X8KA 4KI0A 4NYIQ 1Q1EA 3AKEA 4G5QA 1UADA 1OPXA 1XB2A 4FMCB 2PX0A 4NHOA 2YINC 1MO4A 3FDIA 5CLLA 1R6BX 2GJSA 1YU9A 4BFVA 4XD7D 1GILA 3CX7A 3TAHA 1U2RA 1NVXQ 3QVUA 4OHWA 1XTRA 4P4TA 2ZSDA 4Q7JB 4RD6A 5EUMA 5FL7D 1U94A 5JSZB 1FUUA 4GOKA 4KLNA 2JLUA 1G7CA 4FCWA 1DADA 1Z28A 2ZIAA 1SXJA 1T0JB 2FFQA 1P9WA 2W6ID 5HZKA 2O8CA 3A1SA 3OHMA 1G9XA 1E9DA 2X1VA 4BLOA 2XITA 1KSHA 1LS6A 2VPPA 5JECA 4DLRA 2QAGB 1XTSA 2WSMA 1EWRA 1DARA 1EFRA 2FEOA 2KWIA 1TPZA 2ZQ5A 3TSZA 4A92A 2GXAA 1COWA 1KZGB 1TL7C 2HCJB 1SVIA 3IEUA 1W47A 1OKKA 4F38A 5KHOC 1E0AA 1JQJC 2WZQA 5DSZA 3GLIA 4YMWA 4XVUA 2LKDA 5FBLB 3ADBA 4AKIA 3I1FA 2H8KA 3HP1A 3SQWA 4W9MC 1BKDR 4PR0A 2GAOA 3MWKA 4GI7A 4V0ME 1FW6A 2DB3A 1E2IA 3VR4A 2QSYA 2HLDA 3U44A 2F3TA 1F2UB 1WB9A 3NH6A 1SVKA 2XSZD 4TL9A 2ZSFA 2EQBA 3SZRA 3T5DA 1KI6A 2ZRGA 3KQUA 1XBTA 1NNEA 4DDUA 1TAGA 3ZQ6A 4LC0A 2WIAA 3VAAA 4TT3A 4C4PA 3A8TA 1K5DA 1XWIA 4E5UA 2ZRBA 1RVDA 2AXPA 2RAPA 2XZOA 3ZIAD 3N5CA 1ZNYA 4C0AC 3P4XA 1NKSA 1CRQA 1E98A 4TLBA 4OQFA 1FX0B 4YXWA 1JR3A 4MRVA 1G6OA 4C0SA 3TR5A 1QG4A 5CM9C 3KQLA 2XOKD 1EFCA 2RH5A 3IHLA 2V1UA 2PLFA 4L4UA 3RRZA 2JDIA 3UG7A 3KFXA 2AWNA 3QKRA 2PBRA 4G01B 3KXLA 2ZYUX 3AVYA 1RRFA 4F92B 1DVRA 3TH5A 3BFKA 2I1VB 3FKSD 2FWRA 2YJTD 4AD8A 2H1LA 3GLHE 4AKEA 1DE0A 5HCIA 3TAUA 3KJIA 4JSYA 4BECA 4B34A 1OH8A 4Q4HB 3QXCA 4BFYA 3RHFA 4P3YA 1E2NA 3A36A 4F4IA 1P75A 1ZINA 4ZIRB 1DAMA 1N3BA 2QM8A 3BD9A 2O0KA 3DO6A 4JBYA 2V1XA 4Q7MB 4RZXA 2YKGA 3B82A 1L7VC 2WIBA 1HH4A 3QSYA 2ORWA 4OK5A 3GLHB 3H2YA 4LPSA 4B3FX 2FOLA 4B44A 4AG6A 3LFUA 4OHVA 1Z6AA 2PEZA 2ODNA 4JBXA 3THWA 1Z2CA 1SVOA 1A7JA 1D6JA 1ETUA 5AJZA 2JIZA 4Q7KA 3VR5A 3SBEA 1RC8A 2ZRHA 1BIFA 4R2HA 5JJIA 1UBCA 2V54A 1U0HC 3FMPB 2FH5B 3SYKA 3HR8A 1KO1A 1NKTA 4F7WA 5HR5A 1OT3A 2OHFA 3QG5A 1FQKA 2C5LA 5JCPA 4WAUA 1KSJA 5CDFA 4B3GA 1NN5A 1G64A 1A1VA 4PC6A 4LRWA 1PUIA 2X19A 1YHNA 4D4MA 3VKGA 3VU9A 4BFWA 2IYUA 4JVNA 3AKDA 1SVWA 4YMSA 3SJCA 4HAVA 4KBGA 5JHHB 2UZIR 4G5OA 5JRJA 4UXIA 5AUPB 2F7SA 4Q4AB 5DHFA 3C5CA 2ATXA 4GRAA 5L3RA 2ZRPA 4IDOA 2C03A 1E1QA 3PR1A 2OBMA 3AEZA 3PVSA 3QPWA 4LUCA 1G3UA 1H8HA 3NC1C 2WM9B 4FWIB 4IEEA 3KQNA 1R8QA 4OQNA 4P31A 1CTQA 3UKDA 2FPKA 5H8WA 2GKSA 1NN0A 4MH0R 3T34A 4DLZA 1E4VA 1YE8A 5FPSA 1KY3A 2QPTA 4A6PA 5DI3A 4D80A 4URWR 5F98A 4L8GA 1ZAKA 2AL7A 1S9HA 5BN3A 4EDHA 2FFBA 1RKBA 2WBLC 3I73A 3W9YA 2WSSD 2AD1A 3OZXA 5AJXA 4WXRA 5JHGB 3OAAA 2A3RA 1XPRA 1X6VA 4POAA 3CRMA 5AUOB 1XEWY 1AQUA 4EUNA 2QP9X 2WJJA 4TMTA 4Q9JA 3TSWA 1G17A 3B85A 3C16C 4CDGA 1FZQA 2QE7D 3ZLJA 3IQXA 1JR6A 5TDHA 1NJGA 2QENA 4ILEA 1JXOA 3VX3A 1S4QA 3L0IB 4TLEA 2BVNA 5DN6D 2PEYA 3MJRA 3DM9B 4UNNA 2B92A 1SZPA 4DCUA 5FH9A 3OEHD 2WHXA 1LS1A 1UKVY 3VHXA 1P2SA 3RS0A 1LTQA 1GAJA 1NL3A 1E2QA 2HLDD 1W36B 4HAZA 4HLQB 1ZMXA 3UWKA 1FFHA 1PVOA 4LHWA 3GLGA 1VECA 3GFOA 1KI1A 3S1AA 1AGPA 1EGAA 2GCNA 3RWOA 4M9SA 1Z6TA 2A2ZA 3KKNA 2ZE8A 2RGNA 4P32A 3QF4B 4BFXA 5CIWA 2R6GA 3GLFE 2HT6A 1GRRA 1M74A 3EAQA 1T6NA 2NZ8A 4NYJQ 3U4QB 4C7OA 5A5GA 3W3ZB 1GP2A 3IDQA 2WWGA 5JZVA 1GKUB 1LW7A 4LPKA 5H1YA 2O8BB 2DHRA 1NY5A 4XVRA 3CIOA 5GJCA 3K0FA 4HAYA 4DB2A 1FMLA 4HAWA 2CJWA 3B8HA 5L3SA 2X2FA 2IS6A 1OIVA 1VKJA 4DB4A 2A30A 4CGZA 3RRMA 3SS8A 2IHBA 3ICEA 2DCUA 2YZ2A 3CKLA 3IHWA 3ZZ0A 1W46A 1LF0A 1SXJE 2H5EA 2MSEB 3EARA 4IKEA 4UJ3A 3GQBA 4A0GA 4M1OA 1W5SA 1T4GA 2AXNA 4DCVA 3R7WA 1ZNWA 3LVQE 2GAAA 2ASEA 5B2ZA 2J87A 2IX3A 3SOPA 4QOSA 1TQ2A 4JLAA 1SGWA 1YRBA 4K81B 4LJ5A 1KI6B 2Q3FA 3CF2A 1GNPA 3KJHA 1T5IA 4MGKR 1BOFA 1XEXB 3TK1A 1SHKA 2X2EA 3PCRB 4D26A 2WWIA 2FMXA 1Z08A 1XZPA
chains in the Genus database with same CATH superfamily
1JB9A 3T5GA 1GPAA 4G0YA 1XO1A 5ITVA 3JZDA 5DOZA 4UBOA 3O4HA 3QXHA 1ID8A 2B4QA 4MMYB 2PD3A 3PRYA 5F33A 3AKYA 4II2A 5SZKB 1Q1GA 4QICA 3HGTA 3SBDA 3PGMA 1Y8RA 1Z8NA 1JPNA 2KYRA 3ENWA 4R2WA 3OOHA 2E5LB 1L6IA 4FYPA 4LDZA 3OT4A 4GR5A 5ALIA 3IEXA 1UDAA 2Z6VA 3FVWA 2BM9A 2IYOA 4DW8A 1J70A 4AWXA 4J2OA 4ILKA 1QHIA 5JEEA 3FPCA 1X74A 1DEHA 2HFJA 3ENNA 3QI7A 3TNDA 4LOHA 4KQ2A 4A9AA 2BJVA 4L74A 4LF9B 1MRZA 5E3IA 3VM6A 3IKJA 4DNXA 1BYIA 1CEXA 1VYUA 2XF8A 3UK7A 2VAWA 3VYWA 2VUSA 3VU8A 2OLJA 4V0LA 1CG6A 3DTTA 1MQAA 3DBIA 2A4KA 3P32A 4QEKA 3TIGA 2GZDA 2PPVA 3O8OA 1TD1A 3SIPA 3UAWA 1KVUA 2XUOA 1DIGA 1NE2A 3RNLA 3TW6A 2IBTA 1HF3A 2DP4E 4KIJA 2NG1A 4J91A 5JSYA 5FQOA 3KUXA 3NASA 3IR5A 4G97A 1QH0A 1TW2A 3PC8C 4JJZA 4ZQGA 5JC8A 4DDKA 2DWQA 1SCUB 2W9XA 3E9NA 1CJUC 1D0IA 1S5PA 4X92A 3GJ5A 3PYLA 2OILA 5IDYA 3UV3A 4DHWA 2EW8A 4FMCF 4OXXA 2J30A 4AP5A 4EYOA 1TYZA 1T3HA 1E1RD 3VSCA 3MYYA 3EAGA 4HSGA 3VFDA 2QYOA 5DNCA 1PNVA 4PPGA 4P7FA 1H94A 3M89A 3QFRA 5CCEA 2H7XA 4C1NA 2WIGA 1PQWA 2PN1A 2O3RA 5AI4A 2CD7A 1YJ5A 3VTKA 4KFSA 3UJAA 2X0EA 4DRZA 2Q2OA 4IUBS 1EUCB 4M8NE 5DLPA 2GBLC 4GDFA 3WLHA 3DE2X 2CCKA 4JP8A 2O57A 1GZ6A 3BB3A 4BGVA 1SC6A 1WSDA 4GYWA 1ENPA 4KO8A 4C4TA 2EDCA 4J0CA 4M46A 1I10A 2B8WA 2NW6A 2OE2A 3NUGA 4JJAA 2W6OA 1N0IA 2ZULA 2G04A 2WT8A 3PA8A 1HYQA 4OD0A 4OI2A 3GLGB 4ZO8A 3UCXA 3RV3A 3KE8A 2ZRLA 3QEBZ 5GV8A 3OP1A 5CNIA 1OBCA 3OFKA 2G5GX 5ILGA 3RSGA 3G8CA 1UBJS 2X0NA 1YD7A 1DT5A 3VKHA 2VJMA 3HO1A 3HR4A 3P0FA 3NATA 1Z68A 2WP0A 4GZMA 4D3ZA 4XWTA 3ZXSA 1PL8A 3IALA 3REGA 5I7WA 2Q9BA 1XHLA 2C9OA 2FPGA 3ECSA 1NX9A 4RCVA 4ARZB 4LGMA 1LK0A 2BZGA 2GZHA 2RGXA 3GFQA 5EQDA 3I61A 3IJEB 3T9BA 4BEWA 5KEIA 4RDCA 3ZLBA 3UJHA 1H8EA 4IAOA 3OT5A 5T4FA 4YAIA 2IA5A 2WIKA 1IIBA 3AU8A 2I4TA 3HADA 5HX7A 2D6FA 2JAUA 4MVJD 1YA8A 2GN1A 3E4CA 3RC9A 4HNHA 3MAAC 1DS6A 1PR3A 4HV4A 1K5PA 2Q1TA 3WS7A 3LT5A 3LVBA 3LHFA 5CGZA 3VR4H 5DV9A 5L3VA 4KE6A 1W35A 1KFEB 3G59A 3OQNA 4RTQA 1JT9A 4Q4HA 5FDFA 2QVCA 1L9XA 1V7CA 3I9JA 3NFRA 2GT1A 1CVLA 5KJCA 5KINB 1DAEA 3IEKA 3LZDA 1P1JA 2PQ0A 4JEMA 2HIAA 4TSFD 1Z47A 4FIZA 2ZB4A 3HJUA 3BXHA 3DO8A 2C1EA 1J2JA 3E2IA 5J40A 2IU0A 3LY8A 5A2GA 1T4DA 3CZRA 3DGFC 5D84A 3SC2B 5IG2A 3V97A 5FXMA 1GUFA 2GRAA 4HKTA 4JYMA 1NW6A 1M6VB 1XCMA 2JBHA 4YECA 4ZCPA 1XTPA 4I7EA 3NHWA 2C00A 1E5XA 2P9FA 2R7AA 3A0UA 3HKEB 1XEXA 5I7VA 3DVRX 4H1TA 1P9RA 1XD2B 2QG6A 1VLJA 4U6SA 3ZK8A 3VV2A 2IYFA 4EK9A 1C3XA 3H04A 1VFPA 2FSPA 2ZROA 3EDQA 4NEQA 1NN1A 2X2OA 3RAEC 2FAXA 3L43A 4G5FA 4QDUA 1PFQA 4URVR 4H77A 2A35A 3PHGA 4HMQA 4QHTA 1KY5A 3ZU4A 3D3JA 1BXGB 4LZZA 1KI2A 3KEQA 1QNFA 1OB5A 3MEQA 1JLMA 3E05A 3HWSA 4ZEOA 2HXSA 1T9HA 3G2JA 3MGBA 1W59A 1UK8A 1NXWA 4XDYA 3TQTA 1XKLA 4EIWA 2UUBB 4BV2A 3MCTA 3RWBA 4X8LA 2OOSA 4O4LF 1BTOA 2BFFB 5D7BA 3KSAC 5FUYA 1VBFA 1A2OA 1H66A 2JASA 5M5BA 2HR1A 4L51A 4TWJA 4YB8A 3FOAA 4ZT2A 4NBWA 4DWOA 2O6LA 4IPTA 1TZ2A 4RADA 1A9OA 1Y1PA 1IN8A 1EG7A 4NABA 5BO5A 4MUGA 1QHXA 4AG3A 3TEJA 4X20B 1ZVMA 1SA0B 2NQTA 1AQLA 3F9CA 1Z2PX 1ZM3A 4LXQA 4BDTA 3ZDDA 2R68A 5IN5A 4YRBA 1MAHA 3ZNQA 1J7KA 1JR4A 1UWKA 3REOA 5G0SA 4BGUA 1RDFA 3ETDA 4F4HA 2O07A 3WNCA 5LQAA 2DSTA 3DMNA 2ISQA 1LBHA 4Y2SA 2FW1A 3C6ZA 3G02A 4ZZ1A 3W5IA 4Z9YA 3FSGD 4B0PA 2V65A 4YAFA 3HVJA 3HCNA 3M4ZA 5JWRA 1FFCA 5FLEX 5TLSA 1P91A 2CDBA 1WHSB 2C7BA 4CNQA 3RUPA 4REQB 3L0PA 4JVMA 4URXR 2Q62A 3LRPA 2ZATA 1QKJA 1FXUA 3WDMA 4D4LA 2HYDA 1V7PC 2VF8A 3H8SA 4I5EA 2FPWA 4JVLA 4YLEA 4EYSA 5IKXA 4YUAA 4FKMA 1U0JA 1TQ8A 1T1RA 1WXFA 1N2CA 2BCGY 3DYBA 1RWBA 1ZPDA 3I8SA 2Q7OE 3S1AB 5BQ3A 1XK7A 4D4KA 1GYPA 3AB8A 4AQDA 5C18A 1OGYA 5F12A 2IUSA 3GRPA 1O9GA 3F46A 3NBUA 3UMBA 3N76A 2OC4A 3QPAA 4J0EA 2V0CA 5TPZA 4Q39A 3RF6A 5JFGA 1NTOA 2O1XA 2ONCA 3BQ9A 3MJCA 4JSTA 5E38A 3ZGNA 1E9CA 4YT5A 2E85A 4B8WA 2C3MA 5AYVA 3KQMA 3WZ2A 2PAAA 3R9XA 2CWWA 1YZHA 2XEDA 3O1LA 1FNMA 5LR6A 2EGUA 2P35A 5K09A 2PKYX 4FOOA 3NTVA 3KRTA 3P5SA 1Q7GA 4N0QA 5LD2B 2HSZA 2ZM6B 1HTWA 5JNSA 3HDHA 4R0VA 4CQNA 3Q3EA 3M3DA 4ZI7B 3M4XA 4FJ2A 3KEFA 1MXFA 1SB9A 1ZOPA 2WAMA 4KIFA 2XYPA 3B20A 3T5MA 3WBBA 4DJDC 1VE3A 5AVZA 5CCDA 3NDBB 5LFAA 3FBWA 3G79A 4WNAB 3NRJA 5A0TA 3IVMA 1SURA 2Q41A 4LXUA 5LOVF 1XQ6A 1R9MA 4H9GA 2ATVA 4B17A 5LQSA 5IKMA 1UWVA 3CW9A 3D3NA 5FWAA 3BYZA 5B36A 5IZCA 1DTWA 1EEHA 1WXGA 2HDNB 2R4QA 1ZNZA 4C87A 3NBXX 4Q00A 4ZC1A 2F17A 4NBUA 2C2YA 1DIOB 2QJRA 4WH0A 1FFWA 3PU6A 2NIPA 4BO2A 4BJ1A 1GXSB 5A0FA 4LXGA 5KB3A 1F6WA 2EKZA 2XZTA 3GRYA 3EPJA 1GTL1 4IX9A 3NAQA 3WLIA 1X1EA 3T35A 2IF2A 3VX4A 3WKBA 1HR0B 1VLHA 1SKQA 3CJRA 1Q0ZA 2HOQA 1TU4A 4FD2A 5EP3A 1AB6A 3IHKA 3JYLA 3F7MA 3DM5A 3R41A 1PV1A 1UBMS 4OYRA 5LP6A 2Z04A 1E8MA 2ZW9A 3RT9A 1X38A 2H4HA 2QORA 3TZHA 1B23P 4HI0E 4DV6B 2CYCA 4FT2A 2H08A 2O59A 2C8VA 4M37A 1X13A 1GTVA 1S89A 4IWYA 2D0PB 3KKKA 4P0PB 5EC8A 1S1MA 4Z6KA 2IYAA 1D6SA 2VHZA 4RVUA 2XUJA 3FNIA 3HYRA 3GJSA 1EDBA 3UJNA 3EVNA 3ZKWB 2N47A 4JASB 5ALUA 2VAVA 3V80A 5CMLA 4OH1A 5EXEA 4QGFA 4Z4CA 3MNFA 1QJ4A 3OKPA 16PKA 3ZCVA 2WVAA 1N5LA 3EVDA 4N3NA 3W2FA 2I6TA 3R3ZA 3B2QA 1VE6A 4QOEA 2QG9A 4LNAA 3AY7A 5K5EA 1WETA 4LXXA 3VNAA 2G06A 2QTTA 4DEXA 4C5AA 5E9WA 1T9BA 3ZZ1A 1KYYA 3CUTA 2ZU6A 4YRNA 4FN4A 2EDAA 3ZE2B 2YY7A 1LVGA 4IMJB 2CK3A 2CHFA 5EIBD 5LQKA 2G1KA 4KQFA 3KIPA 1QGDA 5TRTA 2DT8A 4HDSB 3SY8A 4AJIA 1W0CA 2NPIA 2R6AA 4DV1B 3BCUA 3CQ9A 1XAJA 4N18A 3QWIA 4A36A 1OD6A 2PZEA 2WHPA 4YHHB 4YTEA 3RHZA 1UOQA 1KFBB 1NQUA 3AZPA 3NHMA 4EG1A 1U0BB 1GARA 1PT9A 2WF9A 3ESQA 3HLYA 2DQYA 2ODTX 2JJMA 2DCMA 2NO7A 4EA8A 1WPRA 1YU6A 3LGAA 4FUTA 4U9HS 4RGQA 3TD2A 1H4VB 2WMDA 1OFTA 1G8GA 1OFHA 3B9RA 1YB1A 3K1AB 2GVZC 1WB6A 1ESZA 3AESB 3BG5A 3GN1A 1ZGGA 1KQGA 3LUHA 3MUEA 3HWWA 3TG2A 3FNEA 3GGGA 4YUVA 2IOFK 4PPFA 1JRLA 4Q48A 2X22A 1DCFA 1C41A 1V37A 2EFGA 3OJWA 3OTIA 1WZ2A 5HKAA 1J8MF 2JB9A 1UPFA 2F9FA 3GZ4A 4PBRA 3WLEA 3N1UA 2MMCA 2BGWA 2I3DA 2RG7A 2DJIA 2ZK7A 3PB3A 4P3OA 3WV5A 5M34A 4ND4A 3IRVA 1E3TA 3NAGA 5A4DA 4BX3A 3E9DA 2VXCA 1IPHA 1VBNA 2GYWA 3SQDA 3VH1A 2I71A 1P62B 2OT3B 1ID1A 3PPIA 1DC5A 2VDUE 1IRXA 3CONA 3PUKA 4R9VA 4A1FA 1V1JA 5BW6B 4YC7A 5FWXA 2EU8A 4ENRA 2WIFA 1T36A 4BMNA 3PEEA 2EIHA 1Y1SA 5JAOA 2P0EA 1VPLA 2PK3A 3FMIA 4HDNA 4PAQA 4RVOA 5GM1A 3HGMA 4ALIA 2C0PA 3HMQA 4I4IA 3AB3A 4R54A 4ZQCB 5BP7A 1KDRA 5JARA 3GEHA 2J4CA 3JSXA 4WGFA 2C57A 3WOVA 3W7BA 2XWPA 5K4GA 4R1OA 5KYYA 2OHJA 5LP1A 1ZCJA 3I58A 1JUDA 2VQ6A 3U49A 5AVUA 1CCWA 2XJ9A 1I6MA 1SQ6A 4NVRA 3GA5A 4FP9A 4Q1BA 3DW1X 4HQLA 4DLBA 1WKVA 3ZVKA 1BDHA 4X94A 1TYEB 3ZCRA 3TGPA 3O8NA 1UM9A 2IY8A 2W70A 3TLYA 1G7RA 2CFCA 3ND6A 3FROA 1PS8A 4IM7A 4JN6B 4EP1A 5I5EA 4U2DA 1GPMA 4Q3CA 1CF2O 1D09A 3PWKA 1XL1A 1QK4A 1T15A 3WC4A 3HBJA 3O4RA 3SFVA 3IO5A 2QXTA 4XGQA 2W2QA 4QASA 5BRNA 3UJ8A 2ZS7A 2FMHA 4BWFB 3RYCB 5JO9A 3TNFA 4HX5A 2IY9A 2LVBA 5HF9A 3HSYA 2N75A 2Q28A 3R9KA 4BGDA 2H63A 4MIEA 2ZI9A 3JAKA 3ZGYA 1W48A 5CAEB 3EQZA 521PA 1HY3A 4W8HA 1CEQA 2VUUA 1R6AA 3JVVA 1DT3A 2X0JA 3O8BA 4J16A 1COZA 4LZOA 3MTEA 3STTA 5CU7A 3ZWOA 2D0IA 2PUGA 3TLEA 4EJMA 3WRYC 2R8ZA 2QF7A 3BORA 4JI3B 4XDGA 3AXTA 3UIEA 2XWSA 3AFMA 3T12A 3K7EA 1KXJA 4FFBA 2M2IA 1ZBDA 4TZTA 1NMEA 4CIAA 1HQDA 1RRGA 1GGNA 3EG5A 3HB7A 1JFVA 5FBRB 1HDEA 4DPKA 1QH8B 1PNOA 4UU1A 3H6HA 4D8VA 4JI0B 1NNEA 2O3QA 1YJAA 1FLDA 1JA0A 2ZXFA 2FG7C 1NZFA 1PFVA 3BB4A 5I8WA 2GLTA 3BERA 1U3DA 4W9NA 2Q6IA 2LIPA 3LO5A 1H2RS 1HV8A 1YZNA 2BI8A 2H18A 4OA5A 4KACA 4TLAA 4ZXFA 5SY9A 3V8BA 5CURA 4HDMA 3M1LA 4M1KA 3U4QA 1W36C 1JA1A 2ZR7A 3MMSA 4NJOA 2BEVB 2Q6OA 3C3XA 4B40A 3AOGA 4NIMA 3RTCA 2KBFA 1I1QB 2Z2XA 4R31A 3F73A 3CUEF 4GH5A 3W78A 2WYUA 2MYTA 1A3CA 3LGXA 4HN9A 2K4MA 2GWRA 4RQBA 3BHMA 1PVDA 2JHFA 5DLDA 5F35A 1C14A 2LCFA 1Q7RA 1YBAA 3PC8A 2G7ZA 3PQ6A 2FPIB 3IBTA 1P77A 3FJ1A 2K7ZA 3W2IA 4DFDA 3BH0A 5EN4A 1U9IA 1AZLA 4I8IA 4R9SA 1D8TA 1Q44A 4UNPA 2WQ7A 3U13A 2L17A 1IUOA 3KT8A 3OLXA 3WRWA 5FWXB 3D6NB 4LX0A 1NVUQ 1CUFA 3O2QB 4I81A 1TO2E 4JBNA 4GYJA 3RGWS 1Y3IA 3CX4A 5HPYB 1XZHA 3T5TA 3V1KA 4YYZA 1JL3A 4QGSA 4YK7A 4UNQA 3VYVA 2UZ4A 3QKUA 4D8WA 1FP6A 4H7IA 3FGPA 4DABA 2B69A 1M2OB 4HDAA 3L7LA 3DXZA 1O94A 4KXNA 2GEKA 1TTQB 2A88A 1PDOA 1IAQA 2PBLA 2XZPA 1GTSA 3IVXA 4DBZA 2WA1A 3HLKA 3JD0A 1H4QA 4I8XA 4TGLA 4DNQA 3BMCB 1ZGJA 4P35A 1MX3A 1VCMA 4LJAA 4AIIA 4DE5A 4C4AA 4WBNF 5L3QB 3HDQA 1Q92A 1TUBA 2PUWA 1I3KA 2Q1UA 1AHIA 1GZSA 3NBQA 4EKGA 1JFFA 3PG5A 4GPZA 3SE0A 2OBFA 4URYR 3V3TA 2BHLA 2PG3A 2P11A 4YYEA 2QSZA 3UCEA 3QZUA 1E2LA 3GEEA 3I2FA 3VJKA 4UTRA 1LK5A 2WVJA 3FDJA 4DIFA 3KEMA 1E6WA 2O8DB 4R8KA 2IYRA 2W48A 1I1HA 5BWNA 1GRQA 1G18A 2XA9A 2HN9A 5H5JA 4CM8A 3O3CA 4PZYA 5B55A 4KFRA 2PUVA 4G5RA 3UJDA 2UZ0A 3C3CA 5DTIA 1FDIA 3F1LA 2V7QA 4YRKA 4X6LA 3LD9A 4ZDWA 4QBKA 4TRRA 1NJ5A 1SC9A 4HDSA 4CL2A 3CXUA 1DFGA 3L7CA 3IL2A 4TT3D 5DXJA 3F0TA 4WKCA 4GOMD 1J5PA 3EEIA 3VC1A 5EHQA 3VVLA 3CEJA 3LWNA 4LOAA 5JSUA 4JI4B 4P3PA 1CSEE 1LDBA 2EIXA 2YZGA 3ISTA 3S2SA 2VBFA 3VAYA 4LRXA 4N3BA 1TJ3A 1W6RA 2BGNA 1OXUA 3CEPB 4MS4B 4KQ1A 4UMEA 4L5YA 1K6JA 1NVFA 1UK6A 4OI1A 3S6JA 1BS2A 4AWAA 3HCCA 2VZEA 4HBZA 3S1LA 3T15A 6REQB 1RXIA 2PT7A 5JS8A 4D92A 3IP3A 4S1OA 3OA0A 4L85A 3ASZA 2HPHA 4KMRA 5FNVF 2DFDA 2IXTA 4ND1A 4LCBA 4DDHA 5J2TA 3I5XA 2AR9A 1JVSA 2INGX 3I09A 4QHYA 2NXWA 2VPQA 4DIEA 1MN6A 1Q0SA 4JR2A 5BORA 3JWPA 1P7YA 5EY5B 1XTQA 2W6QA 4X97A 4Z7QB 4WL0A 5CJJA 2A1IA 3VR6D 4US0R 3U5ZB 4Y1FA 4XI9A 5DN6A 4B7AA 5GMOA 1YACA 2P9HA 2FCRA 3VKWA 1KR2A 3OEHA 3VTZA 1KYWA 4Q18A 5CVVA 3I01A 4ZKDA 2ZTVA 1E8NA 3MS7A 4OU5A 4FMDF 3KT0A 4GGPA 3P2KA 1JDUA 3E1GA 3RKUA 1C9MA 3KKMA 1E6CA 3MB5A 1OH7A 1F14A 1N5JA 1PNTA 4NNPA 1X1BA 2GD6A 2PNFA 1SU7A 1ZSVA 1VDMA 4PCVA 1YH3A 1YVDA 3OKFA 4HB3A 3HUDA 3NT2A 2LBPA 3B3JA 2BMVA 3PNSA 2M1ZA 1Q17A 3FCUB 4C2TA 2ZLBA 1YQGA 2F48A 4KXFB 2AN3A 2RDMA 3NTUA 4KQHA 4BNMA 2IY7A 4KFUA 4A82A 4NTZA 3FGNA 3TBHA 5AVRA 3C1TA 4X85A 2NZXA 4Z4EA 3ZHOA 2AE2A 2V6MA 5SZIA 3RVPA 5BUSA 4EHAA 1DKQA 4E31A 4DANA 2GETA 1NUQA 1ZJ4A 4YH1A 2NWQA 1EE1A 3SLRA 3LK6A 4NARA 3DPSA 1DAIA 4FCTA 3C8DA 4TTQA 3ZKAA 2JGJA 5ICFA 3EWAA 5CAEA 3KKOA 2VP9A 4HN4B 1PQUA 1QV7A 2Z8XA 4I1IA 4MSUA 1J25A 1FTYA 1YR8A 1Z13A 3JASA 3SF0A 2BMFA 3OCYA 3SD7A 2P9GA 3H4MA 2QLNA 2ZE7A 3KDSE 3KCQA 5EHXA 2IHZA 4EUSA 2I54A 5JNUA 3OBIA 4N5DA 3CNOA 4X7MA 2YWEA 3BM5A 3OTWA 2AA3A 1Z15A 3MPOA 4FI3C 4Q9LA 1KJZA 1I4OA 1M54A 3DAYA 1EBBA 1T25A 2XECA 3P9KA 3ZE6A 2DY0A 4HZIA 3ZW7A 1M34E 3PGJA 4C2AA 3BGVA 1FSGA 1JX6A 4BQQA 1Y8AA 5LYJA 1FP7A 1LBEA 2OV3A 1NASA 3MJVA 4KVAA 1GR0A 5LP6F 3RVSA 1YOBA 2HY7A 3PLAE 3L3BA 4KQIA 4JR1A 1OHHD 4XVQA 3WBKA 1DUIA 3JQRA 4UTOA 3RREA 1XNJA 1K0UA 2WZDA 3B7PA 1QRUA 1Y4DE 2A84A 3IPLA 3MTAA 3BSWA 1JXAA 3HDTA 5EG5A 1Z5GA 4Y6OA 4BVGA 5LB4A 1Z0KA 5TMDA 4HMPA 3F3SA 5ECGC 4EFNA 2AEMA 4WFKA 3R5JA 5UKDA 4QG7A 1TF5A 1NDHA 1XD8A 1H65A 1GJRA 3FTNA 3KYCB 4R05A 4X0EA 5JSZA 5ALXA 1ZIOA 5DT9A 2PL9A 3DVLA 4B3XA 1BU8A 2C3OA 1PK8A 2A7XA 2NZUG 4NMXB 4JJ8A 4R5HA 2IDJA 3GHHA 3ZWBA 2WDZA 4Z9BA 4ASUA 2D4HA 4B6PA 1CRWG 1IFXA 2EAUA 1KMMA 4EBFA 5ALGA 1O0BA 2OVFA 1TYBE 4EQ6B 4AW9A 2IH2A 4IINA 2P1ZA 2R6DA 3CX3A 4N0DA 1AK2A 5T67A 2D5BA 2AB0A 3VR3D 4NYMQ 1D2CA 2F1JA 2HDOA 2HBYA 2Y71A 5HW0A 3GWGA 1IN4A 2DSNA 1TCBA 3KZXA 3LKBA 2I33A 3LPAA 3UB2A 1JFSA 1T9AA 3IB3A 3OU7A 4B73A 1DOAA 2YHIA 3EH2A 4ER6A 1D6NA 4Q3KA 1QTRA 1H2HA 1IRIA 2F1IA 2VJKA 3JQ9C 2FN4A 4IHAA 3LP5A 4P7GA 4QOJA 2ESRA 3U7QB 5JYEA 1NR5A 3SS7X 1FTQA 2P9BA 1KZ6A 3WLMA 5LYJF 5CX1B 3QVSA 3KFVA 3L84A 4DJ5X 1G4AE 3U26A 2DM6A 3QPCA 1ADJA 2GXUA 2JFFA 2XOKA 2Y8EA 8ATCA 3WSVA 4DV4B 5KTMA 1ZL0A 1DDIA 1KK2A 4W7SA 5BWLA 2RKOA 3FVTA 2Z2ZA 4EZEA 4RJTA 5KDLA 1PLJA 2BF7A 5TGDA 1SOUA 2HRRA 4A8PA 3ELBA 5FJIA 2PKQO 4U7HA 3WB9A 4DV0B 5LPNA 1AXRA 3D7RA 2NSYA 4YAOA 4ND8A 4YS6A 5L51A 3QHQA 1SRQA 4A03A 1QDEA 3E5RA 4XR4A 5JXIA 1BCSA 3WK9A 1XZBA 4DUYB 1VMDA 4YHBA 2QQ5A 4XH9B 2YJZA 3LX5A 3RU3A 1FVXA 1DWOA 5IAAA 1J6UA 4LZWA 4ZT3A 3G9ZA 3LUAA 1RLIA 5K4AA 3GLIE 2H0AA 3DFZA 5KNDD 4TSFA 4ZYVA 1Y1LA 1Z3IX 1W76A 1NUAA 5C8VA 2HAEA 3TFQA 1BA3A 4CCAA 5BYKA 2OORA 5HS4A 3W2HA 4BO8A 4E07A 2C94A 2OCYC 1U0GA 3R7AA 1Z36A 3P71T 4XIGS 5FADA 1QRSA 3BT7A 2XZLA 2AQHA 3CUUA 1Y5LA 3KQHA 1PFWA 2EKBA 3W0LB 1CF4A 2L82A 2ZYAA 1X19A 3H86A 4X7BA 4UTPA 1OVGA 5AM4A 1QHHB 3CRVA 5TNXA 2WTMA 3AL0C 3K8QA 1AKWA 1H1DA 4WOBA 2KE5A 4PC7A 4RKWA 3R5KA 2HIHA 1G8JA 3R7NA 3DDWA 4M1ZA 1PRYA 3CH4B 1BE0A 1CNFA 2UUPA 5GONF 4OB7A 3EVTA 4B32A 3GROA 4H6XA 4KMMA 1S3IA 1SVUA 2W2LA 3MJHA 3P20A 5KQMA 1NFFA 1RNLA 3TRFA 1SA0A 1QFYA 1BW9A 1YZ3A 3EWNA 4P2GA 2FSSA 4DJJA 1QCYA 3L7YA 5I7HA 4BFTA 1TA9A 2X1MA 2FNAA 1JILA 2A5GA 2BBOA 1PFYA 1DRUA 2X6RA 5DXAA 3M1IA 4AB1A 4CEHB 1N6IA 2GD1O 3FX2A 4F5WA 3JYQA 2WJ6A 5C4MA 2AG1A 1UEJA 3OJCA 4HSEA 2AHRA 5IF3A 5EJ7A 4M0KA 3RANA 3NEAA 1LRKA 2I6GA 4CI9A 2WC1A 4TOIA 1NIJA 4B83A 4OFBA 5JATA 3F3MA 3L6BA 2PKXA 1Y6GA 2FYTA 3IKLA 2ZIXB 1G291 1J22A 4E4RA 2R1UA 5ANRB 4LQLA 3AF4A 2P6NA 2XYQA 3H18A 3R3YA 4WINA 4HPXB 1BEZA 4JGGA 4M8KA 4S2UA 5IEJA 1PG5A 5IW8A 3OQHA 2B1QA 4ZREA 4OHYA 1V2HE 1YC2A 1Z5ZA 4RPCA 3KUDA 5ADWA 4H3VA 1RACA 3HJTA 3FZYA 2IYSA 1L7MA 2D8MA 1S9DA 4DG8A 3CZ4A 1LBTA 3Q0TA 1E6MA 1CQPA 2YV5A 2QD2A 2W0SA 1XZGA 2ZJOA 1E1RA 3TW4A 1YFLA 3DQPA 3AUJB 1JA9A 1ZK4A 1SD2A 1FU4A 3QE3A 4MVJF 4YROA 5E7JA 1Q84A 3TTVA 1SHUX 3O2SB 4LI3X 2GVNA 4PONA 2HMVA 4L57A 4MQLA 5AI8A 2ECKA 5TC4A 4EL0A 1NPYA 3MTIA 1BWSA 3X3HA 4EG4A 2SBTA 3MJEA 2UYGA 4YEDA 1IY8A 1UPUA 4X8OA 4PG8A 3D8BA 4KVGA 3DDHA 3KP1A 2DLCX 2XUDA 5B4TA 2CCGA 2BRUA 3ZBTA 3AR7A 2DQKA 3WE7A 3HUUA 5BW8A 1ADCA 5FUQA 2MR5A 2XT9A 1KKMA 3A4NA 1ZC4A 3OT1B 1K0FA 3RSSA 2QZJA 4HEA1 3RRJA 4ACAA 1ZI8A 1R7RA 2X2PA 2I2AA 5ALZA 1UFQA 3QOWA 5AOAA 5AVKA 5C34B 1U3UA 2IEAA 5C46F 4QJ3A 4QGAA 2CE2X 4CQLB 1B3RA 3AONB 4UQOA 4WFQA 1GAXA 3LZ6A 3GOHA 3AWDA 4UD6A 2XKKA 2BFPA 2IWRA 3DBLB 3OOEA 3Q6NA 3OO0A 1F48A 1ZD1A 1GT91 2OGTA 3GEDA 3SMQA 4LFCB 1FRFS 1ODIA 4EUFA 2CFRA 4E11A 1JLSA 1K7CA 1R5BA 2E4UA 4ERNA 2OD7A 4WN9A 1ETHA 4NZPA 1C0EA 2CW5A 4JLBA 3I5UA 3LOQA 4NECA 4UUMA 3ZHTA 4E4TA 4BQPA 1A9ZA 3IXMA 1X7HA 2C83A 5KVVA 4BB9A 2NSLA 1D2GA 3DOEA 2FA9A 2JANA 2DHEA 3G2OA 4GRIA 4JLDA 4DSUA 3WOHA 1KI3A 1N5KA 1JEJA 2Q9CA 4RD4A 1YK1A 4ZI2A 4CHTA 1E79D 1C1XA 2B1RA 2X9LA 3HR7A 3JQAB 4TKUA 1C9KA 3DKIA 1NI3A 3C3DA 5BUZA 3Q10A 4JNCA 2LGJA 3DE4X 5C1IA 2DJ5A 1OE0A 4GICA 3U7HB 2O8BA 4J6FA 2AC2A 4F4UA 2GF9A 4FS8A 3WJ7A 3EGXA 3S29A 3K8ZA 3JD3A 1FX0A 2JFWA 1LSJA 4KO3S 3EEYA 1EQAA 5FLYA 1DAPA 1MH1A 3GXBA 3CLVA 4RDHA 4WCDA 4MW1A 2R6HA 2QTVA 1Q3HA 3MJDA 4NBLA 4E2ZA 2SICE 3EBOA 4PN7A 3G5TA 3SR4A 5ER6A 4HAUA 1MW9X 3DOJA 5C5EA 1X1DA 5CBKA 2HK9A 4EJSB 2WI8A 1PSDA 3BHIA 4ZODA 4Y30A 5IK2D 3ZY2A 4BV8A 5BR7A 2AOXA 4IIVA 4M87A 5JS2A 7REQB 2PYIA 3V33A 2D7CA 2YYZA 3FAZA 4RM3A 3VH2A 3EIQA 3W1WA 4R8RA 4UREA 2RAUA 5DM4A 3U48A 2JCBA 1XVLA 1EH5A 4EUKA 1A2BA 4KH1A 1YRWA 3RW9A 3F4KA 4JIGA 4F8EA 1JHRA 4XSHA 2G1JA 4CG0A 4QU9A 3R8XA 5F2EA 5B3AA 3MCZA 1FDVA 1GGJA 2PCJA 3DJFA 2BC9A 1P7PA 3D3QA 3SBXA 3RU9A 4EPWA 1HEIA 1RIFA 3DLCA 1J06A 4MRPA 4J4HA 4C0WA 1VHQA 3L6OO 3PX3A 3QUQA 5ARCA 5KX5A 4GBMA 1SVSA 2ZTMA 2BFWA 1R66A 2C4MA 1DG9A 3G0DA 3IP7A 4G5HA 4TM8A 3RCBA 1NR1A 3IT1A 4LJ7A 4YJGB 2AKEA 1QVVA 1CZLA 2G07A 1DWQA 2CC2A 1AGXA 4YCDA 5LZ2A 3AVUA 4QOHA 2GM4A 1MZPA 4Q4LA 4L78A 1N9ZA 3B6EA 4HNVA 1VB3A 1M1UA 2YR0A 5A9SB 2WJPA 4QQKA 5ALSA 3U09A 1QF9A 4C22A 3PEUA 2VPXA 4QUDA 1ORDA 1H93A 2QEQA 3WFJA 4E46A 3ZGLA 2OGUA 4MO2A 5TT0A 1X15A 3Q8WA 4OKIA 4ZYZA 1T1EA 4PPYA 1J49A 1ZJ6A 2A33A 1ISPA 2FMFA 2VPYA 2X8LA 3LG2A 2BHSA 3OEED 3QUAA 4MI9A 1Q1NA 1V16B 2AE1A 3CF4A 3T9AA 1NN3A 3FPLA 1KYXA 5E6SA 4KPEC 1YZQA 1C7RA 1Q7BA 3AFNA 1SBHA 3RYFB 4IOMA 3Q5EA 3R8FA 3PCTA 3JW8A 4C4YA 3N6XA 3I12A 2R7LA 3L0SA 5IBRA 4Z0NA 1EA5A 2ZRIA 1A71A 4BASA 4C76A 2Q2VA 1SXQA 3L79A 4OBXA 1KY2A 1Q1QA 3S3TA 5C3MA 1PL0A 5AVYA 1CV2A 5A4FS 3EHDA 5EMNA 4PO3X 1QHHA 4DDVA 1D4OA 1HYEA 3DC2A 4YGYA 5NULA 1NATA 1J8VA 5U4XA 5KWSA 4QQRA 5GP1A 4IHJB 2G3YA 2HA6A 3PR3A 4G65A 3ZTWA 1NHGA 5TQVA 1L5KA 3WK8A 1Z2EA 2IC5A 5K3EA 2NU7B 3PQ7A 4AUMA 4XPIA 3FYTA 2J46A 5T3YA 1IN7A 3GPBA 2AK3A 3BSFA 2ZI7A 3OPNA 4MZXA 1X1AA 2YZ7A 4GR4A 4JJ4A 2EJVA 2G0NA 3NANA 4O4LB 3RFXA 1WZIA 1PZEA 5KQGA 4B7ZA 4AJNA 2YJ5A 2JGDB 3E81A 4KIGA 3GAMA 5EZSA 2W0MA 3RFCA 2D4AA 1ZJJA 3ZXIA 4RYLA 1QC5B 4JXJA 4QYTA 5LXTB 3EUEA 3E7WA 3F49S 3H1EA 3JVDA 3QPVA 3EBLA 4KQKA 1QPGA 4MOWA 2B94A 4NMWA 4B7CA 1DU4A 1I7NA 1V8PA 1E79A 1VIYA 2JW5A 3L8YA 3GFGA 1YA4A 3D4LA 1Y9EA 1G6Q1 1ZRNA 4OB8A 3NHUA 4D4JA 4LF8B 4EG6A 1Z8HA 4MA4A 2RHWA 1RADA 3PFIA 5DSXA 4TUYB 2EKPA 5AP9A 3PFBA 3QVXA 4FK8A 4U8GA 3AK4A 1AHPA 3UQYS 5ITZB 5FEMA 3SVTA 3PT9A 2AOVA 1ZNXA 2HV8A 2OUIA 3CN9A 3PC2A 1Y9DA 1XZEA 2JEOA 2Q4BA 1XMJA 4R7GA 4CODB 5CB8A 4FYYA 4NE7A 5AIAA 4PG7A 3EODA 1I32A 5FQNA 3VR2A 3UMSA 2YHUA 1G20B 1QH1B 1VHTA 2VFAA 4I66A 1Z75A 3D6FA 4R81A 1PTKA 4K6MA 2CLHB 4JI8B 4C5BA 4NMHA 3GOQA 1N2EA 2PA0A 1MRSA 2CMGA 3WRXC 2OM2A 3FYHA 5CT9A 1PBNA 5CLQA 4IFBA 4PLWA 3EXHA 4D9IA 1N0WA 3WYBA 5CEJA 3R3HA 2BEKA 3O94A 4TN5A 3UTDA 3IAM6 4LW8A 3VNSA 3DEKA 4JV5B 3AJ9A 2H1HA 1Q7EA 2P40A 3GFSA 3HCFA 5ILQA 3QSGA 3OA2A 4FQ8A 3RVKA 3ZU5A 4KQ9A 4CDRA 1CUGA 4W1PA 2P2YA 5A7FA 2FF5A 1LW6E 2MWMA 1P61B 4X91A 2CUZA 2V03A 4CIXA 3I9V6 5A7HA 1LDYA 3RIHA 3WL4A 4EF5A 2ZSUA 4BQEA 2NV0A 4KVFA 3R44A 5EE1A 5EINA 5E6SB 2XVYA 5JDIA 2EARA 2H1WA 4B4OA 4E09A 5M2QA 2I6QA 4PYKA 3D0RA 3KYCA 3EGIA 4ZQBA 1Z39A 1DBIA 3WHKA 5BN5A 3NVKI 2GZAA 1RP1A 5ALJA 2J33A 3T9FA 1AOXA 1NF3A 2LXNA 3R3JA 4FILA 4PR3A 3BIFA 4GE3A 1I4WA 3MOSA 5JAHA 2QYTA 4YVFA 2PLRA 4TS3A 5DTEA 1Q11A 2QL6A 3ZGXA 3T06B 2DAPA 4OGKA 3BJRA 5DBGA 1GWNA 3K0AA 3ADOA 4LGVA 3DLBA 1GO2A 2IEZA 4LJLA 2YN4A 5T8KC 1U9JA 3DLIA 1JLRA 1SUPA 3LUDA 3T4EA 1AN0A 1MOQA 3LRXA 4JUCA 2EWMA 4KQXA 3I9OA 3WWDA 5JNTA 3K9FC 5SYMA 2EJBA 2QP3A 4LFBB 1O8BA 1OGIA 4RK6A 5AR1A 1VSUA 2NU7A 3DEAA 1B93A 1MCZA 3GJRA 1EK0A 5EJMA 5BYJA 1U81A 2BCEA 1HKUA 2FVXA 2JIMA 5AH0A 1TUBB 2OZLA 1TM4E 3R9WA 4CKBB 3MFYA 1WB4A 3MCWA 4NPHA 1GVHA 1QGOA 4JLJA 1C9DB 4L0CA 2D3TA 4DQKA 4J0IA 1SC3A 4NCHA 4RJLA 5IM5A 1PUJA 4N8EA