2GCPA

Crystal structure of the human rhoc-gsp complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoC
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 177
sequence length 178
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcpA00
3L43A 1KY3A 2RGNA 2A2ZA 1E9BA 3S1AA 3Q7PA 1WE2A 4PPNA 3AF3A 1N6RA 3BH0A 2XNSA 2DR3A 1UKEA 2WWIA 4MYHA 4Q1EA 4TL9A 5H1YA 3IEUA 2ODNA 3DOEA 4NYMR 3EIHA 3QSYA 1M2OB 1YQTA 1G20E 1K6MA 1OYYA 1KI8A 2ZR7A 1OYWA 4LJ6A 2KBFA 4LYFA 1FOEB 3BH7A 4JLNA 4LV5B 2CCGA 4MRSA 4HLUC 4MITA 5AJVB 4EIWA 2D7DA 4LHWA 2F3TA 1K5GA 1WXQA 4P4SB 4Q9HA 3IIJA 5HPYB 4L9WA 4HUQB 5FPTA 4RD6A 4QKQA 1XMIA 2NO1A 4LYHA 2YV5A 2YWEA 1W2HA 2VHTA 4MRVA 1QHSA 4Z1MA 2ZRJA 4GZMA 4P32A 2ORVA 1GKYA 2ZITA 4LJ8A 4TL8A 1YVDA 1DAKA 3T06B 1KTVA 2ZE5A 2O0JA 1GTVA 1H8HA 2PBRA 2REBA 3NIBA 3ZQJA 4O2RA 3LO5A 2XX3A 3T34A 2KBEA 4IVQA 3UMFA 3AVTA 1II8A 1E0SA 2W6IA 2V6JA 3A6PC 1RRGA 3VKGA 1T4GA 3K9HA 1QBKC 4GI7A 1W47A 3TAUA 4GRAA 4R9UC 2PLFA 2H17A 2RGXA 3VKHA 4MGKR 4DSTA 2A30A 5FOTA 5EP3A 2O5VA 1D2NA 1WCV1 3TMKA 5G40A 1R0WA 5KSYA 3MUFA 4Z54A 1WP9A 2ECKA 1XFAA 3PUYA 3Q8XB 5K8TA 4OHXA 5C4GB 4W5WA 2CE7A 2FN4A 2IA5A 3CNNA 2C9YA 2DBYA 1OH8A 3GJ4A 1XZPA 1DAHA 4JT4A 3REGA 1YJ5A 3MWKA 3NXSA 4LC0A 3DZDA 1I4DD 4AIIA 3T61A 1EXMA 1KZ7B 2G83A 2CVFA 2JLXA 4HDCA 3K70C 1J2JA 5CM8B 1YRBA 1NKSA 2W58A 4BLOA 3V4RA 3CH4B 3THYA 1JALA 1IOZA 3AGPA 3GFPA 5AJZA 1Z07A 3DMNA 4PHTA 3LBNA 1PLLA 1VIAA 1Q1EA 3W5JA 2XSZD 2XTZA 3KJGA 3CF0A 2ERYA 1NBME 4TSFA 2ZPTX 1S1CA 3PJRA 3AKEA 3ADDA 4EPTA 2ZYVX 3EAQA 2VSOA 4G1UC 2WAYA 4ZCMA 2ZR0A 2X19A 2IYWA 2R6AA 3HPRA 4Q19A 4IXMA 1ZU5A 1GWNA 1G7CA 2Z4RA 4IOMA 2VP9A 1Q1ZA 1OXTA 2P5SA 3K0FA 3ND8A 1WMSA 3CR8A 3I62A 3NEJA 3ZH9B 5ELXA 4C0JA 1E1RA 4A6PA 4D0GA 3VMFA 2PT7A 1A4RA 2QY9A 3ICQB 3TVDA 2IYSA 2VHCA 2P65A 1ZUNB 2PL3A 1OB5A 4YXWA 3WYFA 2OILA 3S1AB 4QJ4A 4IOJA 1M1YE 1W1WA 2QU8A 3RS2A 4PTLA 4ITRC 3K0SA 3NHBA 4B3DA 1FTSA 2JLUA 2OBMA 5FTJA 2C03A 2H1LA 4EPYA 3FWYA 4MGIR 1EFRD 3BFVA 1RPZA 5DNYB 4DLVA 1XEXB 4DT1B 1X8JA 5F3WB 3UMSA 3RC8A 2F9MA 2EU8A 3A58B 3OIVA 3TR0A 4QJ3A 3EZ6A 4NPHA 2O0HA 3HU3A 1T8TA 2BWJA 3X2SA 1NJFA 4AYXA 2ZYUX 4YMUA 1FPMA 1OH5A 1MR3F 1QVAA 4Q47A 4B3FX 4G5RA 2O8CA 2AXNA 2RGBA 3K70D 3RRMA 5P21A 3BRWD 4TYPA 4BZXA 4A92A 3MLEA 4AKHA 4JVLA 4URVR 3L0OA 2Q3MA 1KDTA 1X1RA 4IOLA 5D3QA 3B85A 1XTIA 1ODFA 1ELOA 2WWGA 3PUZA 2Z6VA 2ANBA 2ZTSA 1BS1A 2HT1A 2EYUA 3C41J 3NDBB 3GPLA 1G5PA 2N46A 1IONA 2YNMA 3PEYA 2QAJA 4B71A 2GILA 2IS1A 4OK3A 1VECA 1G8YA 1ZM7A 3AVWA 4EFNA 4C0SA 1JEEA 3I4LA 1F48A 2D2EA 1R7RA 4M1MA 1C1YA 2RGEA 3KB2A 3OFNA 4OYHA 4JBYA 3EZ7A 1ZCBA 1J8YF 1DARA 1T5LA 4V0ME 3KFXA 4PZLA 1Z0IA 5EP2A 3EC2A 3CWQA 1KNXA 3DPUA 1SKYE 2GA8A 2JLZA 1BMFA 4ZDKA 3HR7A 3OIUA 3GLGA 3CF6R 2F55A 4PHGA 1HE1C 1VPLA 4EQ6B 1YZNA 5J4LA 3A37A 3W6NA 3THWB 3ND9A 4HI0E 5AK0A 1GKIA 5H70A 3GLFE 4QHTA 1DO2A 3IIMA 3JZAA 3W34A 2RCNA 2Q9BA 4QGAA 4XSHA 3PVSA 4M1TA 4XWKA 1Z63A 4FCTA 1NVWQ 2GNOA 1ZNYA 4B3XA 2WZQA 1ZC3A 5IT5A 1NIPA 1G3RA 1YR9A 1GL9B 2FG5A 2OLJA 1XPOA 2ZJYA 4O3MA 2OE2A 2AHOA 4AWXA 5KO2A 5K8IA 1XPUA 1KO5A 3NBZC 2GBLA 3KKPA 1E4VA 4LI0A 2BC9A 4QBIA 2ZJZA 3FFBA 1AJEA 2V7QD 3M6AA 3D3QA 5FOXA 3IQXA 2WSSA 3GEIA 1Z0JA 3AVOA 1UBEA 2QP3A 5CYPA 4LUCA 3UMRA 1MV5A 3U61B 2ZRBA 4B3CA 1G3QA 4KVAA 4XVQA 2OXRA 4CF7A 3GFOA 4Z51A 1E0JA 2XNDD 3IDQA 4KLNA 3BBPA 4KVGA 3EZ9A 4N3NA 4R2IA 4M8NE 4RZUA 3PXGA 5FBVB 1DAMA 5JRZA 5CK4A 3QBVA 3C5HA 4ACBA 1XCGB 1CRQA 2QE7D 5KPDA 1AZTA 2QGNA 1A7JA 3B1YA 3CPEA 3IBYA 4CGZA 1X1SA 1E9AA 3IIKA 4DHEA 3I1FA 4I1VA 3NH9A 2ZVPX 1IN6A 4WBSA 1AGRA 3B9QA 3ZD7A 1KYIA 2A5YB 4EKDA 4BEBA 2IEZA 3HDTA 1H65A 2MSDB 2REOA 3EIEA 4BFWA 1OV4A 5C46F 2GJSA 1XD8A 1AZSC 2FOLA 4C30A 1K8RA 1XTSA 2N42A 1NIJA 3E1SA 4RD2A 3OEEA 1Z2AA 2WJHA 4HLUA 1UKYA 5FFMA 1NLYA 1VDZA 2D2FA 3M4YA 4GBMA 4B73A 4XD7D 4OHYA 4JBXA 3QKUA 2H16A 3WP0A 1JJVA 1EFHA 2QSYA 3O8RA 3R8FA 3T1OA 4HZIA 1GFIA 1NP6A 1TF2A 1T0JB 2CHQA 3QUSA 4ARZB 3AF4A 1U90A 1RKBA 4NTZA 3VFDA 3QKRB 3O8BA 4PC1A 4PPQA 4AYWA 2G0NA 2YVUA 3NH6A 2EW1A 4TTPA 2Q6TA 5EP4A 4BLTA 1WB9A 4NCHA 1T0HB 4JMPA 1NBMA 3FHTA 4W5HA 2F9LA 5A5GA 4PPGA 2IXEA 5JWOA 4AY2A 3H4MA 4YMWA 2O52A 1TX4B 4C0KA 3EPKA 4R2HA 4JT2A 1ZIOA 3W3AA 1KKMA 2IK8A 1HY3A 2A5GA 4TT3A 1Z8FA 3ZIAA 1GRQA 1ONBA 3K8YA 3UG6A 1ZC4A 1HURA 3QOFA 4MGYR 3X1WA 4LYAA 2WWYA 2OCPA 2RGNC 3HYTA 4MDFA 1AQYA 3SQWA 1TU3A 2ZUBA 2V8OA 3KQKA 4EJSB 2BMJA 1KI3A 1P2SA 4I81A 4A36A 4TTQA 2HCJB 2FSGA 2ZXUA 2G3YA 3CPHA 5KOYA 4ZI3A 3SBEA 5TARA 4QNRA 3ZVLA 2JLQA 2QM8A 2CXXA 2ZAOA 1S9DA 2BVNA 3KXKA 4DEXA 2XITA 3LW7A 1DAGA 5TDHA 3ZZUA 4IFEA 3L8YA 2CCJA 1LS6A 2ZUCA 2MMCA 2RGGA 4Q21A 4Q7MB 1XD2A 1X86B 2Y8EA 3T12A 4M9ZA 4L4UA 3R20A 1F3OA 2RB4A 4LHXA 3G0HA 1GZSA 3KQUA 2PLRA 3QEJA 2QQEA 4B44A 2PH1A 3GFTA 5FOUA 2VTKA 3LAWA 4NH0A 1XTKA 1W5TA 3PUWA 3PV0A 2ZVQX 2OXCA 3QIAA 2JJ1D 2ONJA 4GFDA 4LCBA 4OQXA 4U7DA 4G5GA 3EA0A 1VYVA 4PC2A 2DWQA 1U0LA 3JZMA 2CDNA 5B64A 2PCLA 2C77A 3CUEF 2O8FB 1RIFA 1VTKA 5TVKA 3WY9A 3TJZA 3BC1A 1W2GA 2J7PA 4PHHA 3L0SA 2NPIA 3FB4A 2NGRA 3TRFA 3VNVA 2O8DA 3TQCA 4E07A 1ZVQA 2EVWX 3FMOB 4TQUS 1ZW6A 2KB0A 5JCPA 1UF9A 3OZXA 4KYUA 4A2PA 4J0QA 1MABB 2RGAA 1M7BA 3RANA 4P4TA 2ZRLA 3UKDA 3L0PA 4BEJA 2DB3A 1OLOA 3KZ1E 521PA 2P67A 2FDCA 2J9RA 4HAVA 1KO1A 1ZD1A 2AKYA 2HT6A 3K0CA 3TSOA 5IRCD 2HF9A 4B3BA 4YQFA 4BFUA 4RZ3A 2ZR9A 4IOKA 1MO5A 1RRFA 4JBWA 4M22A 3LRPA 1W4AA 3TW8B 4B35A 3RWOA 2HJGA 5GVRA 2VSXA 1FX0B 3BB3A 1Z5ZA 4JKYA 4PSAA 3B5JA 1RYFA 4LK2A 2ZSAA 1OW3B 3AVPA 3RHFA 2FV8A 1OFUX 1DE0A 2I1VB 4RZ2A 2IF2A 1PLKA 4LHYA 1R4AA 2FFQA 4KFUA 2O8BB 2EFHB 2FSIA 2PMDA 4TMWA 3WRYC 4D4MA 4V02A 1GITA 1C4OA 3SYKA 2B7BA 1KY2A 1UJ2A 2JJ2A 3A1WA 1RJ9A 4PR0A 3RNLA 1EK0A 2ZE7A 3AV0B 3VR1A 2F7SA 3PUXA 2NTYC 1AS0A 1W4RA 3MD0A 2NO7A 5EXSA 4F93B 3PITA 1L4YA 2REXB 5BW8A 4JL8A 3RSLA 2A78A 3DL0A 2CLSA 2HXYA 4P0TA 3VU9A 2IBMA 4A0GA 5KPJA 2RHMA 1E2NA 4TMVA 2EFGA 1Q0UA 2RGDA 3O8DA 2BBOA 4KFTA 5EQTA 1SVKA 2CEAA 4EQ6A 4UKDA 4N1AA 1G8HA 5FUXA 3C7KA 4LJYA 4CEHB 2ZRIA 1HA3A 3KXIA 3UXMA 3ZZ0A 4Q1FA 4MYTA 1W4BA 5C2JB 2VQSA 1Z3IX 3A1VA 3EARA 4PQFA 1DPFA 2PJZA 1M34E 2J87A 3LA6A 1CEEA 2F43B 2NQ2C 4M1WA 3QG1A 2DY1A 4PAOA 3VQTA 1E2QA 3UANA 1TU4A 3CKLA 3AEZA 1E9DA 3IUYA 3U6BA 1RC8A 3TLXA 4JLOA 4KO8A 4F38A 1OXXK 2X8AA 1G5RA 2H7VA 3U3MA 4IFBA 1XXHA 2XEXA 4Q18A 2GXUA 3OIYA 1SGWA 3KUCA 4BRUA 2FEMA 4TQAA 3PR1A 5AUPB 4Q00A 3BK7A 5LPNA 3WMFA 1VG0B 1UEIA 4V0NA 5FTNA 1EWQA 5DI3B 4QOSA 3CX7A 4TSFD 4URWR 3OAAD 2G0TA 2WWFA 5M04A 5J5CA 2JGNA 1E2EA 1Q44A 3L82B 2ZI4A 2R62A 2FF7A 4RJLA 1G64A 1Z29A 1N2CE 3SR0A 2BJVA 5F9FA 1E1RD 3VR2A 2HLDD 3CR7A 1NLFA 2BJWA 3ADCA 4NYIR 2OHFA 2XTMA 3KTAA 1HH4A 1Q3TA 3PCRB 1XB2A 4GPTA 1QF9A 2P5TB 4C7OB 3ZLJA 1E2FA 4W5JA 4E03A 5DSZA 4OBEA 2LWIA 2IF0A 1W4CA 4KBFA 1OFIA 2VL7A 4D4LA 5KNBA 4QM7A 2CHVA 1P75A 2ZJ5A 4OQNA 4ACAA 4CT4B 1TEXA 4QNMA 3NWJA 4GMXA 1N0WA 3AGQA 1TPZA 2OFXA 4CEIA 3RWMB 4XH9B 3SDZA 2YWHA 3CPJB 2C96A 5BN5A 1QG4A 1O3YA 3X1ZA 2J5XA 5JEEA 2EWWA 1GNPA 4C0BA 5L3QB 1U9IC 1GIAA 2QM7A 1D8TA 1NNEA 3CRMA 1N0VC 2QZ4A 4LYJA 4IDQA 1KNQA 4TYNA 4QL3A 4C2UA 1S1MA 3BS4A 1TAGA 5E4FA 2BEJA 1KSFX 3MJRA 4RD0A 4UXHA 4CDGA 2GXAA 2GBLC 4HATA 1P62B 1Z28A 3FE2A 2V3CC 2QAGB 3DDCA 1US8B 5E3HA 3VU9B 1TTTA 1S2MA 3VAAA 5EXTA 4F92B 3OESA 1B0UA 1OT3A 4XSGA 3E5HA 5FUVA 2EFEB 2IHYA 4P4UA 3CZQA 1BOFA 4A15A 2ATXA 4LJ7A 4Q4AA 2XXAB 1LW7A 6Q21A 1QDEA 5B58C 3J81k 5LD2C 2XOKA 2EYQA 4MKIA 1MRNA 3OFND 1ZBDA 2ZSDA 4QG7A 1TNDA 2FZLA 3L0IB 3B2EA 4Q1BA 1S4QA 4OKSA 2HDNB 2IWHA 1BMFD 4II7A 2R65A 4B74A 2C5LA 5CB6A 4YMTA 1QZXA 1SVSA 3TW4A 5J4VA 2QPOA 3GLIE 1N25A 3K0AB 4GP6A 1ESNA 2BM0A 4GSYA 1KIMA 4GP7A 4LGMA 3TSZA 3NHAA 3WHLA 1AKEA 4AYTA 3FKSA 1JR6A 1E2LA 2YOHA 3QXCA 2JLSA 5EE5B 2QMUA 4Y0AA 2ZSBA 2ONKA 3B6EA 4G5QA 1JQJC 4C0HA 2YWFA 3V4FA 1U0HC 1N6PA 2BKEA 4NHOA 3SOPA 1P73A 1OSNA 1F2UB 5D3MA 5AUQA 2AWOA 1W44A 4D0LB 1VG8A 4I1OA 2OV2A 3LH5A 1S0UA 3PEVA 5HE8A 1XEWY 1Z0AA 4KU4A 4QGHA 1KI6A 2FEOA 2IT1A 5DHFA 1PZNA 2DWOA 2WSSD 4PAQA 1JR3E 5G41A 1UAAA 4A4DA 5A4JA 4KFRA 2FPMA 2Q9CA 1TADA 3ASZA 3FVQA 2V1XA 2ORWA 1G7SA 1Q22A 1G4AE 1K5DA 1CR1A 1XCPA 4C0QC 1E96A 2ZU6A 4KCGA 1HUQA 1ZP6A 3AKYA 3FYHA 2XZLA 2OCYC 3CNOA 3R7WA 3F8TA 5LBIA 2YYZA 5CB8A 3Q7QA 1HEIA 1FP7A 1KK1A 1KAGA 4MUBA 3W5IA 2ZYTX 3MWJA 1KDOA 4FMDB 1G3MA 3OE7D 3LBHA 4FXPA 1E94E 2J45A 4G3XA 3B8HA 1ZUIA 1KJWA 2HF8A 4DUGD 2O8EA 4HDQB 1G19A 3U6KA 2VF8A 4HZUB 4OI0A 3QG5A 2ZJ8A 4ZKEA 5JJIA 1XTQA 2K5UA 2DHRA 1AN0A 2X2EA 3AH8A 3CRVA 3FMIA 3GLHB 5BYKA 1FFHA 1S96A 3AB3A 4RY2A 1YZKA 5CDFA 1BIFA 1R5BA 2WSMA 1N6IA 2HEIA 3FMPB 5AJXA 1QHHA 3MWLA 3OEED 4Q1DA 1COWD 1AGPA 2CL0X 1KI4A 3TR5A 2YHSA 3OIWA 2AX4A 4TMTA 4PO8A 3KKOA 2XGJA 2BV3A 2D06A 3OAAA 1O87A 3MCAA 4CW7A 3AVUA 3C16C 3G82C 1DEKA 2QQ0A 4LJ4A 5FUYA 1L8QA 2EQBA 3QQ5A 1S3GA 2ZS7A 5FL3A 3BB1A 4JLDA 2E9SA 2CE2X 4KLZA 3SZRA 1GOTA 1NBMD 4FMCB 3QF4A 4JIMA 2XJ4A 1R10A 2HLDA 1G7RA 4RFSB 1AK2A 3O8CA 2IUUA 3AF0A 4CEJA 3T35A 3R9XA 2ZUDA 4TT3D 5FR2A 3ZIAD 3KQNA 2JLWA 4HSEA 3CNLA 2FGJA 2IX3A 1BYIA 5FPKA 1GM5A 2VP0A 3K0CC 1ZIPA 3EA5A 4YMVA 4LY6A 3U44A 4PFSA 2FFBA 3QXJA 2B8TA 2YZ2A 3F0TA 2OLKA 2Z43A 2BIFA 4OJKA 2OM2A 4V0LA 5DO9A 2AR7A 4XIGS 3GJ5A 4TYQA 4M0LA 1W7AA 4BQSA 4LPSA 2IUTA 1IY1A 1ZM3A 4IDOA 1NMZA 1OIWA 2CJWA 2DFNA 4U00A 5H8WA 4NYJQ 1P2TA 1DO0A 2QMEA 2GAAA 4QXAA 4AG6A 1R5NA 2UZ3A 3F5FA 3RDPA 3GJ0A 2QG6A 4OK5A 5GJCA 4BZPA 4LJ9A 1M6NA 3IGFA 4Y0VA 3ZDQA 4L8GA 4ZO4A 4KSBA 1A82A 1ETUA 1U98A 2P3SA 5K8UA 2BCJQ 3EWAA 1TMKA 3KKNA 3EG5A 4WOPA 1U99A 4QBFA 4B2IA 2JDIA 1II8B 3RS5A 2ZRHA 2JJ8A 4HB3A 2I3BA 4KSCA 1MT0A 1S9HA 2C99A 3WYGA 2WV9A 2WWWA 2J7PD 5DE3A 5A0FA 1CJVC 1SXJA 4DCVA 4B34A 1FW6A 2CL7X 2FNAA 4IKEA 4PX9A 3LWNA 2ZRKA 3RVBA 4LDJA 2Q0HA 3AF1A 3Q5DA 4ZDJA 3ZVRA 2J59A 3IPYA 1E2MA 1I2DA 3AF2A 1Z47A 2XB4A 1W0KD 3JVUA 3E70C 1V43A 4DLTA 4ESHA 1R0ZA 2MSCB 1VCNA 2JLVA 1L2TA 1U81A 2OG2A 1E2KA 2N1BA 3UG7A 1R0XA 2GF0A 1IN7A 2RMKA 4YDSA 3LX8A 1LS1A 2W2TA 5DN6A 5J4HA 5AJYA 3THYB 4H1VA 5JHGB 5KU1A 5DISB 5J4KA 3LX5A 1L4UA 3LV8A 4C0LA 2QT0A 5B2ZA 3SJCA 1T8UA 2JCSA 4GZLA 4W9MC 3C14C 1XZQA 1KOFA 4X8MA 3IPXA 1U9IA 4L5BA 5FBRB 4R98A 2VRWA 5KDDA 4US1R 4U02A 2BOVA 4DIDA 5FH9A 1NKTA 1N5KA 2JJ2D 2V54A 4LPKA 4DWJA 1E6CA 3CZPA 4C4PA 5C18A 4V03A 4A8JC 2ZJBA 3QF4B 1PJRA 3K0FB 4UNRA 4CIDA 1FNMA 2ZS8A 1GNQA 1SVIA 4WW0A 4P3YA 1NVXQ 2PJRA 3NBXX 1OFHA 3W8NA 5JSZA 3K09A 4TQ9A 5LDDC 4PO1A 3KJEA 4QJ5A 1KHTA 1GL6A 1I2MA 4Q1AA 4BLPA 2DYKA 4XTCS 4AKGA 3HWSA 1CTQA 1TF5A 3N2EA 4A6XA 2ORIA 3EPJA 1OKKA 3K53A 4JLJA 1CRPA 2J3EA 2FGKA 2GEUA 2PZFA 4PQYA 2GWHA 3CONA 2BMDA 3KUDA 4AI6A 1Z0FA 4B2PA 3NG1A 1E2JA 4TZ6A 3ZJYA 4X8HA 3ZZTA 1HE8B 3FHOA 2NIPA 3GJXC 3D8BA 3DVLA 5EP1A 5CM9C 1FUKA 2QTFA 3OE7A 2O8CB 4B6FA 2GZDA 4C3ZA 4LBWA 2YOGA 4DUGA 2A5JA 2WKRA 1OFTA 1Q1BA 1XF9A 2PEYA 2WOJA 3EW9A 3LNCA 5J47A 4DBLC 5FBLB 3C15C 2ZAMA 2GCNA 2ODBA 2FU5C 2ZYWX 1YZLA 1CLUA 3MJHA 1E9FA 1P2VA 2V6IA 2DCUA 2AFHE 2KE5A 1P9WA 5HTKA 2OAP1 2J0QA 2IS2A 4M2LA 2V4ZA 4ZIRA 1F2TA 4RCYA 4F4CA 4GOJA 5KYKA 1COWA 1T3HA 4F91B 4DKXA 1TUIA 2ZI7A 4JYCA 4M9QA 821PA 5JWHA 1NY6A 2AK3A 3AVXA 2RHDA 4DC9A 2FH5B 4L9SA 5DLQC 1CKEA 5TMPA 2ZJAA 3MGCA 2Q3HA 2IYZA 3BB4A 1G8GA 4S2EA 3FGNA 1E0KA 3TUZC 3R8CA 3KB1A 3BIFA 4A82A 5L3SA 1BO6A 2ANCA 4RSGA 3X1DA 1XDBA 2ZRAA 1VCIA 3GLGB 4DLWA 3VR5A 2IUSA 4TMZA 3CW2A 4GNKA 4DCSA 1HYQA 1TF7A 2AWNA 5BN3A 1JBKA 2B92A 4A0FA 1ZMXA 3TBKA 2HYIC 4KBGA 1SQ5A 1SHZA 2WHXA 4PO9A 4TLAA 4EAQA 1II0A 2IW3A 1YZGA 1NMXA 4Q4HA 2JEOA 1IXZA 2JIZA 3NEYA 4TLCA 5KTYA 4MDEA 4BASA 3RYTC 2X2FA 1KSJA 1D6JA 1NN3A 3DO6A 3W8RA 1KI2A 1OH7A 3B7GA 2O0KA 1XBTA 3WRXC 1UKZA 1U2RA 2R6FA 3A4LA 3A1UA 4JS0A 3THXA 1VCOA 2GJ8A 3P4YA 2C9CA 1FNNA 4DDWA 1E32A 2D7CA 3QJYA 4XWAA 4WA7A 3RRZA 1G4UR 1ZYUA 4K46A 4BE7B 1KDRA 4JVSB 1KI1A 3G5UA 1KSGA 1SVLA 1WRBA 2VP4A 4WZBE 4QFMA 4MH0R 4OI2A 4NCIA 1D5CA 2NO6A 1SVMA 1RZ3A 1PUIA 3MRSA 4PC7A 4DSOA 4NKRA 5LD2B 3LD9A 2FFHA 3NC1C 4O0MA 5AJWA 5SZHB 5E7JA 3LQRA 1E98A 5B57C 3GLHE 1VMAA 1Z0KA 5KUTA 2XB2A 3UIEA 3AKCA 2WWHA 1KAOA 2XOKD 4B76A 3KJIA 3LDAA 4AK9A 3W9YA 3V00A 3CB4A 2GXQA 2IYLD 5JRJA 1RFLA 2QI9C 3MFYA 1KMHA 3EPHA 2WPDA 2F1HA 4URZR 4Q66C 4LSGA 2B21A 1XMVA 4WAUA 421PA 1W36C 4M4SA 4HDOB 2FFAA 3VR4A 4IDPA 1N5IA 3FDIA 2PZEA 5KNCA 1A2KC 1W0KA 2W2VA 4ZKDA 4D82A 3T1TA 2D4HA 3B60A 1D9ZA 4FMBB 1WBDA 4PHFA 3FKSD 2A5DA 4Q4JA 4OJQA 2YC4C 4V0MA 2AD1A 2ZE8A 3HU2A 1OB2A 1IQPA 4IRUB 2H92A 3Q9LA 1EG7A 4URYR 2QENA 2D3WA 3RRYA 5FR1A 1IY2A 2VEDA 1OHHA 2CK3A 1CJKC 1YR6A 1CJTC 2VHQA 2G6BA 2X77A 3BFXA 3M1IA 1DOAA 2OZEA 1UPTA 1ZAKA 1XU4A 1U8YA 2RKOA 2AXPA 3GMTA 3KJHA 4MRRA 5EUQB 3AP1A 3SFVA 3GLFA 1G17A 1YZQA 4IW3B 5E7MA 4F4JA 1KK0A 2ZANA 4KHZA 3QPVA 3ICEA 3QKSA 4ON9A 1DAEA 5SZIA 2ZRGA 3KFVA 4C2TA 4OHWA 1T9HA 3QKTA 1YR8A 1DAIA 2OUKA 1EFUA 5BWMA 1RYHA 1JXMA 2QBYA 4FW9A 4OL0A 1VHTA 5DYGA 1ZCAA 3VHXA 5B30A 4UJ5A 2R6GA 1TQDA 1IY0A 2XZPA 4QBGB 1VKJA 3A1SA 3LVQE 2NOAA 3TUJC 2GESA 4LHZA 1NI3A 4HB0A 1VYUA 3CWZA 4GDFA 4LV8B 4NU0A 3RLFA 4TZ0A 1NLZA 3QXHA 2YOFA 4HAZA 2J0VA 3AVYA 3QF7A 4Q4HB 3QVVA 2WOOA 1W36D 5BN4A 2IEYA 4QGGA 1Q57A 5CJ2A 1DADA 3P32A 3I5XA 2OO7A 3K9LA 3P27A 4UJ3A 4FCVA 3DMDA 3ASYA 2Z5FA 3IILA 2JLYA 3VX4A 5KSOA 1NG1A 2QA5A 3NKVA 2CNWD 2AK2A 2C9OA 2FMXA 1UKVY 4TYWA 1ZU4A 3QY0A 4LRWA 4D25A 4D81A 2IS4A 2GCOA 3HP1A 4DSNA 1XD2B 3L8ZA 3O47A 4ZCIA 4RKEA 4YC7A 3K70B 4QHYA 5TV2A 1R5OA 3GJ6A 1KGDA 1KJZA 4B75A 4HAYA 3D6TB 2L0XA 3FMFA 2ZJ2A 4B2LA 1OXSC 3LXXA 4EFMA 3JVVA 3FFAA 2IYXA 3WYAA 1N5LA 4M1SA 2OBNA 2P6UA 4A0RA 1IM2A 1TQ6A 3SHFA 2ZJOA 2C8VA 2YJTD 4DLRA 1IN4A 4Q4LA 5FI1B 3A4NA 3WNDA 2F1RA 3RS7A 1GILA 2W2XA 3WBJA 3WMEA 5JJLA 3NDPA 5KDOA 1Z0DA 2QSZA 3EC1A 4K8OA 2BMEA 3TIFA 1G291 2GHIA 2PCJA 2F1IA 1AM4D 2WAXA 3BORA 4IDNA 4RZXA 4BFXA 2OBLA 3SFZA 3X1YA 3SJBA 2BHRA 5BQ5A 4A8JA 4BFYA 2CMKA 2O8DB 3U7GA 1EWRA 4XVRA 3EPLA 1DAFA 1SXJC 1MRSA 4XTRA 3I5YA 3M0EA 4NP6A 3P4XA 4G5SA 4DLYA 1XD9A 1E2DA 3OEHD 4IVPA 1EGAA 1PV4A 2GJ9A 3GCGA 4WXPA 4DIEA 1RW4A 1T5IA 4BLSA 4V0KA 4KAXA 3ECCA 3EWSA 1P5ZB 5G53C 1AQUA 3WNCA 1SKYB 1R8SA 1EX6A 1XJCA 4B48A 3SHWA 3W90A 2R44A 3C4JA 4P4SA 3I72A 4HUQA 3BJIC 3Q85A 2I1QA 1Z83A 2G77B 1E2PA 1DG3A 2IYUA 3R9WA 2A9KA 3TGPA 3Q3JB 1SULA 1UBFA 3NBFA 3A8TA 4TMXA 1E79D 1XWIA 2ATVA 4BFVA 1HQYE 1LY1A 4URXR 2ZU0C 1RJ9B 4DSUA 1EESA 1ZNXA 2OFOA 1NVVR 3DM9B 1IJEA 4I99A 3B1ZA 4DDTA 3AP3A 3GLIB 1E2HA 4ASUA 2H5EA 3PEUA 5JEDA 3U60B 3RSOA 1XMSA 1TUEA 2F6RA 1P7CA 5HZHA 1UFQA 1W5SA 2NO0A 4US2R 2JDID 1VG1A 8OHMA 2P6RA 2EFDB 4JJZA 3H0KA 2R9VA 1YZUA 2OCBA 2VPPA 3AP2A 2BMFA 3K09C 1NVVQ 4EJSC 5DHAA 1SXJD 2FPKA 3U4QA 2RGCA 2ZIAA 3DM5A 2B7CA 3PQCA 3PUVA 3SN6A 4B47A 4BLRA 3QPWA 4WIAA 1V5WA 3A36A 3BWDD 3K9NA 3CBQA 1LF5A 2OSBA 1H8EA 4DJTA 4EUNA 4CVNA 3PEWA 1X6VA 2QUZA 1CU1A 3QVUA 2PX0A 4ZPXA 2UZIR 1WBBA 1CR4A 2CLDX 3ADKA 2ZI9A 2IC5A 3NC0C 2VA8A 3GLGE 3MAAC 4MYUA 3I3SR 2W0SA 3T15A 4PAMA 1CR2A 2ZSFA 3EIQA 1HTWA 4TL7A 3TNFA 5DN6D 1UBCA 1XXHB 2I4IA 3CLVA 1JAIA 2GJKA 3CM0A 3TH5A 2WTUA 3ONWA 4EPWA 2MMGA 2WMOB 2GRJA 4P31A 4R71A 5HKKA 5DI9A 1D9XA 2G1KA 2AL7A 2EFCB 2Z83A 3I92A 4PPFA 3IEVA 2GEDA 4BFSA 3ZS9A 4NDZA 5JECA 1KO8A 2D62A 4Q7LA 2KSQA 2XZOA 5FI0B 5KDLA 1F60A 3REFA 4IEIA 4O25A 5C4MA 4TWZA 2MSEB 4TN1A 1G3IA 4HYYA 1ANKA 1HT2E 1LNZA 3RC3A 4HAXA 721PA 1KMQA 1OE0A 1VIYA 3B9PA 1EFTA 3KTAB 2WJJA 2QN6A 4XVUA 2IWRA 1U8ZA 4X8OA 4FINA 4BFZA 4RVCA 1XEXA 4QC2A 4DT1A 4KYIB 5CK5A 1Q21A 1I4LD 3RAPR 2VH5R 1AIPA 2ZRDA 4KFSA 4PZYA 3TSWA 1UM8A 3U2QA 4DCNA 1E1QD 1OKKD 1N6NA 1Z6AA 3FTQA 4D2IA 1KSHA 3PIRA 4OHZA 1JR3D 1LTQA 2IYVA 4DRZA 4B33A 5AR1A 4CEIB 4GL2A 1OIXA 3LY5A 1GNRA 3QNUA 1GL7A 4NCJA 4WVFA 4NYMQ 1TL7C 1JJ7A 4HLCA 1KI7A 3D31A 1NF3A 3MWYW 4BWYA 1LV7A 4FD2A 5DYIA 3VX3A 3HYRA 4E09A 2CNWA 4M1YA 2QGZA 1DVRA 5GJVC 1E2GA 2WJIA 3GJ7A 1YR7A 1CJMA 1LF0A 1XEFA 4U5XA 1ZRHA 2VIIA 3D7MA 4UXIA 4B32A 1JEDA 1HT1E 1UADA 4LOAA 4YONB 3V9PA 3DHWC 4UNPA 4TTRA 2YKGA 5FPYA 5UKDA 2TMKA 4NBSA 3GP8A 4NCNA 3VKWA 4DB4A 3LVRE 2QTHA 3ADBA 2J1LA 4RFVA 3NBYC 5JMTA 221PA 2GTPA 3I73A 3KQHA 2WIAA 3LFUA 1J70A 4FWTA 2QTVB 1IBRA 4D6PA 3KX2A 4TLDA 3LBIA 4EPVA 2J7KA 4HEJA 4Q4AB 4XOIA 3U4QB 3BGWA 1XTJA 1XJ0A 3FPAA 1P61B 4S35A 5EJEA 4M9XA 4PXAA 5DH9A 3WP1B 1BKDR 3K9GA 3VTKA 4DLUA 5CLLA 3CF2A 1XP8A 3LLMA 2DWPA 2V9PA 4A2WA 1R6BX 2NZ8A 4JLMA 3THWA 1XCMA 2XJ9A 4OQLA 2RAPA 4YLGA 2E1RA 2IL1A 1A5TA 3SC3A 5FBQB 3FKQA 5KNDA 1NN0A 1YE8A 3OEHA 3LQQA 3PENA 1MO6A 5HE9A 2ZRMA 2WWXA 4Q9KA 4X8LA 1KK3A 2E87A 2GXSA 4IDHA 3U3RA 2AKAB 5ANRB 1J90A 2A7QA 1Z08A 2JIZD 4PANA 5IK2A 1P9RA 1MO4A 1WDTA 5FL7D 1NN1A 4ILEA 2OCAA 4FI3C 4FMDF 4JSYA 4NYJR 3CRW1 5KHOC 1WA5A 4A2QA 2ZRPA 1Z6GA 1CR0A 3H84A 2CVHA 5D3MB 3I8XA 3K1JA 2BEKA 1FP6A 4RD4A 1G21E 4CYMA 2GKSA 3IO3A 3ZD6A 4KODA 3HPQA 1IHUA 1E79A 3N2IA 1QG2A 1JB1A 3P26A 3H1TA 3U7FB 1ZUHA 3H86A 4G0NA 2QPTA 1M74A 1N6OA 2HUPA 2C04A 3BOSA 1XNJA 1U8AA 3TUIC 1KI6B 4GMDA 1MH1A 1IN5A 2ODEA 4EPXA 3EX7C 4NE2A 2OAQ1 4CT5A 1C9KA 3ZYCA 5BXQC 1TEVA 5JHHB 1J7KA 4DXAA 3TQFA 1N6LA 2GVDC 1W49A 2ZETA 4BFTA 1FQJA 1GSIA 1U0JA 4L16A 4QRHA 1LVGA 2QMHA 3AKDA 3SU8A 1OJLA 1QHGA 2RH5A 3R7WB 1W36B 4E5UA 5HZKA 4Q48A 5IDVA 2JAQA 3VR3A 3SJAA 4FMCF 1R0YA 2FZ4A 2WPDD 2WJVA 5JJKA 1NMYA 2QRZA 3I32A 4TMKA 1CS4C 1GUAA 2C95A 3UWOA 2NG1A 1G7TA 3GJ8A 1KO4A 3IKJA 4A1FA 1P6XA 4M1KA 2ZQ5A 3IHWA 2CCKA 5FOVA 3N70A 5TXGA 4AURA 2O8EB 2GK7A 2FPLA 4US0R 3EXAA 5C1BA 4PSVA 4Z8YA 5JS8A 1G6OA 2CL6X 2DFLA 2QAGC 1IXSB 2OT3B 1KK2A 4MUAA 1SVWA 5JBQA 1QHNA 2QMOA 121PA 3KDSE 4LJAA 4JLKA 4JKIA 1ZD8A 2ZROA 2OESA 1EX7A 4RD1A 1G18A 2VP5A 3DKVA 5FOWA 1QHHB 5JLJA 1OHHD 2CK3D 3UK6A 4ARZA 2AN9A 1P3JA 1XEWX 5FUWA 2VHUA 3QKRA 3GLIA 4M9SA 2BBWA 3W6PA 1OPXA 4Q5IA 4UNNA 1UDWA 3T1QA 4C9BA 3P1JA 1NY5A 2G88A 1BYUA 2Q9AA 3QE0A 4JLPA 3Q72A 3I8SA 2Z0MA 3ZGXA 3AQ4A 3ETLA 4ZV4A 1TQ2A 4KJZA 4DEYA 2Q3FA 4Q02A 2ZREA 3EASA 2Z4SA 3C8UA 2IXGA 3E2IA 1X8KA 2IYRA 2ZEJA 5GJBA 3VHLB 5KSPA 4E22A 4IHQA 1CJUC 2CBZA 2PZGA 4MKFA 5EE3A 1CP2A 3B13B 1G8FA 4JSTA 3WBKA 1RRCA 4M21A 3OHMA 1L7VC 1Z06A 4ZI2A 1G9XA 1QHXA 4CEJB 1RRPA 1NSTA 3WNBA 4CZ2A 4EJSA 1N0UA 1P72A 4N0DA 4AKIA 2YWGA 3B1XA 3RS3A 1YKSA 2A3RA 4KV9A 1Y63A 2SHKA 1GDDA 4NCKA 4EDHA 1E1QA 4NL4H 3ZVMA 1F6BA 4Q7JB 3U44B 4JVNA 3NTUA 4JVMA 1JR3A 1N6KA 3KQLA 1IAQA 2C78A 2ZI6A 4M53A 1B23P 3GD7A 4NONA 1ZM9A 4MKGA 5CIWA 4QGFA 3QXSA 1UDXA 3EZ2A 1N6HA 4Q9JA 3GJ3A 2ZRCA 3FOZA 4KI0A 1BH2A 2CJWB 2HV8A 3BXZA 4YDHB 2FSHA 1P4SA 2WJYA 4AC9A 3DKPA 5FTLA 3RS4A 3T1VA 1NSFA 3B82A 4KXFB 1SZPA 1XRJA 1T91A 4GOKA 1LB1B 2O8FA 2VBCA 2VSFA 1I4TD 3WHKA 4B6EA 2HCBA 1Z6TA 2YINC 3TAHA 1IJFA 3MMPA 4OQMA 5EXXA 4UNQA 4B3GA 2VLIA 1XXHE 2JATA 2NMVA 5FOSA 4L15A 3QI2A 4LBVA 4ABYA 1J99A 1TQ4A 2F3RA 1JQLB 1S3SA 1SXJB 1MABA 3TVTA 4XJXA 1S8FA 4TLBA 2GVZC 5EZ5A 2BM1A 2NZJA 2G9NA 4FWIB 1T6NA 4JLBA 3B1WA 2C98A 2WIBA 3CRQA 3SBDA 2ZI3A 1M7HA 2ZRFA 4JZKA 5KSZA 1DG1G 2PMKA 4LX0A 4OK6A 1FQKA 1FX0A 1Z2CA 2FJUA 3WXMA 3SJZA 1SHKA 1ZNWA 1Q1QA 4QM6A 1MOZA 2V55B 5IF9A 3HR8A 1GRRA 4JLVA 1J8MF 2QP4A 5F2EA 2XSZA 5EZ6B 4IJMA 5FPSA 1YHNA 1DELA 4JL5A 3ZS8A 4W7SA 1Z6XA 2O8BA 5GJWC 4EFLA 5G3ZA 4ESVA 1E9SA 3QPUA 4OI4A 3AUXA 3FHCB 1JPJA 3B78A 1GKUB 2IYYA 2QORA 3THOA 5FL7A 2UVQA 2H8KA 4URUR 4HB2A 2GDJA 5BYJA 1OF1A 2JLRA 4BECA 5TY0A 1D2MA 1FL9A 2GZAA 2AD5A 4TYYA 1E9CA 2WJGA 1E2IA 1JI0A 4K81B 2BCGY 3IQWA 4MRPA 1G16A 4ZDWA 4BUJA 4ASUD 5J4YA 1VCMA 3QXXA 3RABA 2QRNA 2PT5A 4RKFA 3ZQ6A 4CEHA 2HYDA 1W0JD 5JSZB 1G3UA 1FUUA 4H1UA 2R8RA 4GOXA 1EFRA 1HV8A 2HXSA 2QP9X 4MYCA 4TL6A 1N3BA 4BZQA 1NN5A 2FSFA 4LJ5A 4DCUA 1FMJA 5EUMA 4FN5A 3CX6A 2PX3A 3OF5A 4A9AA 2B8WA 2QT1A 4GT1A 2CLCX 2F43A 3K0EA 2VYFA 3W6OA 1VHLA 2X1VA 5JZVA 1E69A 3QENA 2BBTA 4LWZA 1E99A 1F5NA 1OIVA 3BERA 3CO5A 1DS6A 1H8ED 2W6JD 2A5FA 4HLQB 4ZCLA 1E4YA 1N5JA 4F4IA 4AD8A 5K8LA 1NRJB 2IHBA 1DTSA 5AUNB 4OQFA 2WVJA 3SNHA 4CRWB 3WMGA 1E3MA 3RS0A 3Q5EA 5CLQA 5G3YA 3MSXA 1OXVA 1GAJA 4WZ6A 2QNRA 3U7HB 1DBSA 5E95A 3A4MA 1KJYA 1T3LA 2WBLC 4Q01A 4RD3A 5DI3A 4XWOA 2QEQA 3QEOA 1G1MA 4MA4A 4QHSA 2LCFA 3CH5A 1IXRC 1KDPA 2P0EA 3SYLA 4IVRA 3W3ZB 3IO5A 2R2AA 5AUOB 5GADl 5HKKD 1Q12A 4MKHA 5L8VA 3AM1A 1JECA 1R2QA 4ZIRB 4F7WA 4HB4A 5E7IA 1AA9A 1F2TB 4HAWA 2ODWA 4DB2A 5FTMA 2FX3A 4DLZA 5HR5A 3T5DA 5EE0A 1XPRA 4G01B 1UBGA 1X3SA 2GZHA 1AS3A 4FCWA 1PVOA 4BPBA 2J41A 1W46A 2FA9A 1JNYA 2OEPA 5F98A 1P60A 5DGXA 4C7OA 5HCIA 5L3SB 2ERXA 3VNUA 2EWVA 3TK1A 1U94A 4P33A 2V1UA 1E9RA 1FMLA 2VO1A 1WQ1R 1FZQA 2IYTA 3U3JA 1OXUA 2GK6A 2GF9A 2ZSEA 5CITA 1Z22A 5EE9A 4UQOA 4DLSA 3R9IA 3KKQA 1QHYA 3UPUA 4PSKA 4JLAA 5L3RA 1T3SA 3GEHA 4IEEA 3SEAA 3H2YA 2W0MA 4R7ZA 2PEZA 5L3QA 3CX8A 1UEJA 3LXRA 3EZFA 621PA 2HJVA 4RCZA 1ZD9A 3U3OA 2ZM5A 2QROA 2WKQA 3BAFA 4MRNA 4DZZA 2GCPA 2WMNB 4C0AC 4Z1MD 5TB5A 2GEVA 1OH6A 3DEFA 5IHPA 2V7QA 2VF7A 3THXB 2BBSA 1NJGA 4Q9IA 1E9EA 1H8HD 1KKLA 2QAGA 3DZ8A 2NO9A 3KL4A 1US8A 4PZZA 4D4JA 2ZRNA 3RRNA 2QL6A 4UXJA 2R6DA 2W6ID 4IXNA 2UKDA 3U5ZB 1Q20A 1Q3HA 5HCNA 5GVSA 2WKPA 1GVNB 3CIOA 1R8QA 4DDVA 2XXAA 2XNDA 3QBTA 3GQBA 4AG5A 2DFTA 4TLEA 5LB4A 1AKYA 1P9NA 5JFGA 2Q21A 2OFWA 1AS2A 2NPFA 1JPNA 3BE4A 2D74A 2QE7A 2J0UA 4WZAE 4OI1A 2KI5A 4Q9LA 5CDFE 3C5CA 1FTNA 4JJKA 2G1JA 4I1SA 4EPRA 2H18A 3BFKA 1KMHB 1ZM4A 2VP6A 2ZS9A 3TE6A 4V0OA 3K0AA 2FWRA 3AVVA 2ZE6A 3HU1A 1IN8A 1PUJA 1XX6A 4I4LA 2J46A 2YC2C 1CULC 3X1XA 4FIDA 2DPXA 3AUYA 3U7EB 1GG2A 1SVOA 4KITB 5JS7A 4O2LA 4D26A 3IBGA 4LZZA 4H9GA 1W48A 4PC3A 4B43A 3BD9A 3SI7A 1D2EA 3CRRA 4BRWA 2C2HA 4Q4JB 5CIQA 3LW8A 5DIFA 1SKQA 2KWIA 4AKEA 2WICA 3NVAA 1F2UA 4Z8XA 4XD7A 1QRAA 1KO7A 3HJNA 4BLQA 5IK2D 2IXFA 2F1JA 2P2LA 2P6NA 4PC6A 5L3VA 4WXRA 1KZGB 2GETA 1ZNZA 5FPHA 3KXLA 1ESMA 3DOFA 3SQXA 1G8PA 3GLFB 1QVRA 4D0NA 2IS6A 2JA1A 3SS8A 1JXOA 3T5GA 1YRAA 4ERNA 2ZI5A 2KJQA 2XAUA 3L2OB 3QKSB 4Q7KA 4YXWD 1VYTA 1RE0A 3A1TA 1XTRA 3LLUA 4PQRA 3BH6A 1CIPA 5F9HA 4DLXA 4DCTA 1A2BA 5JWRA 4LBYA 2QBYB 1VG9B 1YU9A 1A1VA 4NMMA 1MKYA 2FE4A 1GRNA 4N0EA 4MQBA 2DFKB 3N5CA 4NZYA 3PG5A 2ASEA 4JYBA 1G41A 4LBZA 4QBHA 4ZDIA 4A0HA 2IYQA 5FTKA 1ZM2A 2QPAA 4NYIQ 1G6HA 5EE1A 5JCZA 3KKMA 4Q1CA 1W0JA 2VP2A 1XJQA 2VHJA 2B6HA 4MGZR 3PFIA 4HUTA 2H57A 3SE0A 1II9A 1MO3A 3P20A 1NG9A 1E0AA 3SYNA 1GP2A 3F3YA 4OHVA 1CBUA 5H68A 1NVUQ 3I61A 5J40A 5EXPA 4LC1A 1P2UA 5JI2E 1WF3A 4HZUA 2CHGA 4BGDA 4UNSA 1SXJE 1NL3A 4DVGA 2W6JA 1CF4A 2LKDA 1M7GA 4D80A 5LB2A 3GLHA 2BDTA 4LV6A 5AWFC 4HAUA 4LHVA 1CXZA 2W83A 1LFDB 3ZVNA 2AFIE 4JL6A 2GCOB 5SZKB 3AVQA 4HLDA 3GEEA 4POAA 1Z6YA 2XTNA 2JJ1A 3B1VA 4D4KA 1PLJA 3IHLA 2GJAA 1XMJA 4M1OA 2LKCA 1ZINA 2BKUA 1X8LA 2GAOA 1KI9A 1JAHA 3UWKA 1Y3AA 2J0SA 3VR6A 1ZJ6A 5CJPA 3U3KA 2WM9B 2J0UB 4I1UA 1HQCA 3TKLA 3MG9A 5FBWB 4DDUA 2R6CA 4G5OA 5CYOA 3UATA 5JI3E 1YZTA 1G5TA 1QHIA 2W00A 4YMSA 2JASA 4A8JB 1RVDA 1EFCA 4Q03A 5SZJA 4RFSA 1M8PA
chains in the Genus database with same CATH superfamily
3KPYA 3L43A 2ISQA 2DQ4A 3DA8A 1KY3A 3H99A 2CVQA 2PXCA 5DM60 1VPWA 5IT0A 2A2ZA 1I7PA 2C5BA 5CPBA 1IMOA 3VJLA 4D44A 2XRFA 1WE2A 1QDUA 1C14A 3BH0A 2CXRA 3M70A 4MLDA 4MYHA 1Z82A 4O4HF 5HG0A 4EMUA 1L7PA 4ZZ1A 3K9WA 1BKYA 3CZ4A 3S2FA 1YH3A 3MJCA 2V5AA 3DOEA 1Z62A 2LNDA 4I55B 4IXTA 2AMJA 4KIFA 1JSXA 3UK2A 5AVTA 1WZIA 4LTNA 1RZUA 3AONB 4L85A 3DR3A 2Z98A 4MMYB 2XWQA 4JT9A 1CUAA 1OILA 1OYWA 4LJ6A 4OB6A 3BH7A 4JLNA 4MRSA 2W7TA 4HLUC 4MITA 5AJVB 3S1SA 5J2UF 2HWYA 3OOJA 1JKXA 3GZTB 5FWYA 3N86A 4BZWA 1K5GA 4Q9HA 2QX9A 1ESCA 2JZCA 2RONA 4L9WA 4MS4B 3VUEA 2LGJA 3ASVA 4FLMA 4RD6A 3FPBA 3TD2A 1ADBA 2YV5A 1DKOA 1PGOA 4HEHA 2GPAA 1YQWA 2VHTA 1U2SA 2ZJ3A 5A2GA 4MR8B 1QHSA 3B3GA 4Z1MA 3H6GA 4QG3A 1X3LA 1T2DA 2ZRJA 4LZWA 4E7OA 3QITA 3P9XA 1U02A 3GH1A 2NZUG 1YVDA 1DAKA 3J7AC 1WUYA 2BF4A 3ECAA 5KHAA 1U7WA 5IKPA 2QSUA 5BUZA 1CRZA 1Y9EA 3T34A 4C5AA 4DMMA 3IP5A 1J5PA 4IVQA 4YJGB 1L5VA 2QRGA 4H3VA 2W6IA 1E0SA 4M0FA 5FCDA 3AVTA 1TAUA 3PUHA 1X80A 2WDPA 3H75A 5HBRA 1YD7A 3IUMA 3LOUA 4GRAA 4R9UC 4X94A 4QPPA 5TMBA 2PLFA 3TAUA 1XALA 1JMYA 1PL8A 1TKBA 2RGXA 4J2HA 4R4JA 4ZT6A 5IW8A 4BCBA 1KRXA 3VKHA 2A30A 4NEQA 3HCPA 5LU9A 1I33A 1MBZA 3BDAA 2VZ8A 3WNVA 3WDKA 1UK7A 1ND6A 1R0WA 1FU8A 3DEAA 4U2CA 5KSYA 2Y92A 5ENVA 1WP9A 2BN4A 2NQ8A 1XFAA 1MTZA 4Y9TA 2A33A 4HNVA 4YV1A 3WQSB 2AG6A 4E1VA 2C61A 5K8TA 3PQEA 1XKTA 4W5WA 3IUPA 4K6MA 4EJ2A 3GT3A 3L6OO 1X7HA 4D79A 2C7PA 2IA5A 3CNNA 3R5FA 2JLAA 5AFSA 4W7HA 1NULA 4R9NA 3REGA 2ZT5A 3NP7A 3RVDA 3T61A 3EH1A 1EXMA 1LA2A 3DV0A 3JWEA 2XYQA 3AOEC 2FHPA 1VSQA 4IUDS 5DOVA 5LZ4A 2XZLA 1YRBA 2W58A 4TXHA 2I87A 3QI7A 4MDYA 4QDKA 1BOOA 2YTZA 5JANA 3U1BA 3KT6A 1ZCJA 3DMNA 4YR9A 1P5FA 2EKLA 1PLLA 1VIAA 2JCVA 2XUHA 1O6FA 3JQDA 3T7TA 3IOBA 3AO0B 4XEHA 4M6WA 4C0WA 2FMFA 3D1LA 3F4KA 4PIVA 1X0VA 2TMGA 1S1CA 4UTZA 3HJFA 3AKEA 3STYA 1WXHA 4O4LA 4BNVA 2JL1A 2JD0A 2HJSA 4GLFA 3ADDA 4Y6SA 3EAQA 1RD4A 4DR5B 5A2QA 3N87A 1RZRD 4OP1A 2IZ0A 2H7CA 4UEOA 1CUWA 1DSSG 3N8NA 4OJNA 2WZBA 4Q19A 4PLGA 4FYXA 1G7CA 5J1SB 4S1PA 1XAIA 3DTYA 3QE4A 4WTOA 3B36A 1OXTA 2P5SA 3F5MA 2VT6A 3K0FA 3ND8A 3TO5A 3ABOB 3ZH9B 2IOQA 2ZYGA 1H22A 2RAUA 4KPFC 3ICQB 1TT7A 2O7RA 1YTUA 1R9GA 2GARA 1ECCA 1W5EA 4I4NA 1JIKA 2QK4A 2P65A 2QOEA 1ZUNB 1MQ9A 3JQPA 4WX2B 4HFMA 3OZBA 3WYFA 4Z6KA 4DQ0A 3EQ8A 1BRMA 4B4OA 1AUXA 2PUJA 3B6KA 4KQHA 1T13A 2WA1A 3GJSA 4CG2A 4IOJA 2QU8A 5AOBA 3MTJA 3KDAA 4IINA 3K0SA 3NHBA 3PC7A 4TMYA 5B2EA 4AMGA 3HVUA 4WKBA 3LQ4A 4CHTA 1ND5A 2OBMA 1MAWA 3OTIA 4OA5A 4RK7A 3LIIA 1IOWA 1MZVA 1QIGA 4AJIA 4EPYA 4YRGA 3AINA 3RU3A 1V4BA 4DT1B 5F3WB 2XRMA 2AOVA 3T0FA 1MW8X 5CBPB 2F9MA 3OIVA 3PT5A 4TWAA 2VDRB 3TR0A 1XV5A 1YONA 3LC2O 3PFBA 2FSVA 2VJNA 4NICA 4O4JF 4IG9A 2UVDA 5DRYA 4BQEA 4DQXA 1TRKA 2ZCVA 3P9KA 4AYXA 4EYQA 3IKTA 4GLOA 1OH5A 3D02A 4OHMA 4IQFA 3ZY6A 4K0KB 1R6UA 4M1EA 1KZ1A 2PYIA 2WFLA 3DP7A 4X6UA 4RLFA 3M5WA 5P21A 3WR5A 2VPZA 2P6MA 4URVR 2Q3MA 1KDTA 4Y1FA 5DM4A 4QXRA 1A2OA 7YASA 5TJHA 1FXUA 4FGWA 2Z6VA 1A72A 1TAQA 1H3EA 2Q6IA 2HT1A 2HGZA 1ZK4A 1TA4A 1P1IA 2N46A 1E5DA 5F77A 2YH2A 2YNMA 3BREA 2RGYA 2GILA 3VNSA 1DBRA 1ZM7A 5ALJA 5EMLA 2VUIB 2X1LA 3ICCA 3LOPA 3I4LA 1Y6ZA 3C45A 1F48A 1QYDA 3BXHA 4LYGA 4KOEC 1IL0A 3UAWA 3JQ9A 1A8SA 4E6EA 1EIZA 3KB2A 3OFNA 4MPDA 4OYHA 3RJZA 4CR7A 3EZ7A 5AP9A 1ZIDA 1ZCBA 3PC2A 5TPZD 1SA0A 2UYHA 1PD1A 3EC2A 4J1TA 3JAMA 1T2VA 4DJDC 1KNXA 3C3MA 2GA8A 2JLZA 2P9EA 1BMFA 1E8MA 1LPOA 2XPCA 3HR7A 3OIUA 4CN9A 4ZDKA 3QUTA 2QXYA 4PHGA 1ZFNA 1UT5A 5FNVB 5IEBA 4QUGA 1D2AA 3AVWA 1ECPA 3A37A 1RTTA 2DAPA 1RHQA 3RF6A 5LQUA 2DTXA 5AK0A 3GLFE 1I14A 3P2KA 1WO8A 4U6SA 1U5BA 4KIGA 2VTBA 1U65A 1DO2A 1IATA 1W581 3FFXA 3IIMA 4QHTA 5EXEA 4H6WA 3E7WA 2VBFA 2B9EA 1DTWB 4L4ZA 1YKGA 5BWCA 2CXHA 4JLUA 4WLOA 4JI2B 4L0DA 2EF1A 2Q9BA 4J75A 2RD2A 1HFEL 3WWCA 2P41A 4XWKA 1UEXC 3AJ9A 5FQNA 4COOA 4FCTA 1NVWQ 5LDHA 1ZNYA 2W6PA 4UCXA 3KOZA 4IQGA 1Y8ZA 1G3RA 1YR9A 2PBFA 3FPJA 1POXA 2H2AA 3JQEA 3KHSA 1RHKA 1XPOA 4DUZB 3CKMA 3H18A 4NOMA 1YAHA 4IILA 5DW3A 2HREA 2G67A 4BTVA 1DJPA 1IBSA 2OFFA 2I6SA 2GBLA 4ZA2A 4AXBA 4ZK2A 3PC8C 4S1WA 3ODGA 4QGSA 1NBAA 4TWJA 1DKLA 1EI9A 1E4VA 1EMDA 4R8LA 3RBVA 4QBIA 5IXSA 4G07A 3JZFA 2PBLA 3BJRA 3NP9A 4S24A 3CO0S 1C9NA 3M6AA 3IVCA 3O83A 2C7RA 1FW8A 2WILA 3VMMA 2BGGA 2WSSA 2EFJA 1YCHA 1Z0JA 1ULBA 3AUTA 1K92A 1DFHA 3CT4A 1UBEA 4JCCA 4DRYA 1WY5A 1OX4B 4BKPA 5ADVA 1T36B 3OBIA 3WYEA 3WJ1A 1G3QA 3NT4A 2OBFA 3O84A 4K5QA 5JDIC 3GFOA 1KVUA 2BFFB 1MGOA 2QVYX 4OMCA 1AKMA 3OG9A 4N41A 5MGNA 2DX7A 4KO1S 2I2WA 1Q0ZA 3BBPA 1EAYA 3STXA 5MN6A 1H2FA 1E0AA 1T15A 2WUWE 5JXHA 1ZDMA 2FXVA 4FKBA 4OGKA 5BV1A 2BFCB 3QBVA 1K3TA 3M3DA 2PX5A 4MIYA 4LQCA 4BVLA 2QE7D 3RBAA 3L06A 4KG7A 1QIJA 2F1KA 4DN6A 2R5FA 4P35A 4CGZA 4J7CA 2XRZA 3WK6A 1Z4IA 3T38A 1YGYA 4G09A 2GN2A 2QIOA 5CA0A 4QEKA 1P77A 3ANXA 1U0NA 2Z3VA 4PLYA 3GRYA 4ICIA 1RI2A 5I5GA 3ZGLA 9MHTA 3L8EA 3SBOA 3J80A 4Z7QB 3ZD7A 2A5YB 1SPXA 1Q0TA 1KE2A 3DMTC 2BPOA 4PBSA 3NYRA 1C9DB 1KEKA 3DVSX 2J08A 1QC5A 2G06A 4FGLA 1NBHA 5HKLA 4BFWA 5KYXB 1OV4A 2Z9CA 1QIFA 1DOHA 3ANMA 4TYMA 3HA7A 5EINA 1Z38A 1AZSC 3BQNB 1N33B 3D6UA 3AKZA 1K8RA 3U4MA 1ONSA 1GFSA 1QO0D 3OEEA 1Y1SA 1NLYA 1UBHS 3M4YA 3EC7A 4B73A 1YOVA 1FBNA 2PMCA 3PVZA 1EX1A 1EFHA 3ADOA 4DHWA 1T35A 4HZIA 1B42A 2R8YA 1AKWA 1KY5A 1NP6A 5KQRA 1TF2A 2XYRA 4MOWA 4QO8A 3IUSA 2WE8A 4BDSA 1I9GA 3QKRB 4YQZA 1OA1A 4PPQA 3RSCA 2G0NA 2YVUA 2E82A 1UC9A 3NH6A 2P35A 5EP4A 3W1VA 4L22A 4DSAA 4HPJB 4Z1OA 1K75A 4Z2AA 1T0HB 5A3QA 1QK4A 3FUCA 2A3NA 1ZH8A 4UZEA 2QGFA 4K9SA 5EKDA 1L7EA 1VYHA 4AY2A 4KZKA 2FQQA 4CU5A 3BN3A 5A7GA 3NYIA 2B2NA 3E0QA 2RHOA 4C0KA 3ABSB 3EPKA 4ARAA 1P3DA 1EGMB 3CR3C 1U5CA 4X63A 5AVQA 2VTBB 1JJBA 4OP3A 5K3CA 2HR1A 2AMYA 2FUG1 1HY3A 2A5GA 4L5IA 1Z8FA 2R7NA 1D6NA 2G9RA 3ENNA 4OJYA 3K8YA 4TT3A 5ELMA 3ZIAA 4DBLE 1NXOA 1GR0A 1Q6ZA 5KWJA 1E3WA 2WD7A 3V8QA 4MGYR 3X1WA 2OCPA 1E3QA 3HYTA 4PZ0A 2SKDA 1CEYA 1TYCA 1OLUA 3DF9A 1G21A 3HKBA 1YR1A 3EHDA 3FAKA 4A36A 1ZPDA 3IQGX 4IP0A 2WUGA 3GGCA 1V4VA 3JAWA 2FSGA 2JHGA 3N2KB 3CPHA 5FYDA 1C3VA 1ZIXA 3BHNA 4RUKA 5JD4A 5LQMA 1Z68A 2ZAOA 2EL9A 5ALIA 3TCKA 3Q3IA 3H5IA 1U2QA 2PQ2A 3QLVA 5TQ0A 1HE3A 2CCJA 1LS6A 3E7XA 2IH2A 1XD2A 2Y8EA 1R9NA 1WXWA 3KEQA 4M9ZA 2QMQA 3T12A 3G0HA 1L8LA 3KQUA 2PLRA 3RODA 3QEJA 4E31A 5A5DA 3DFFA 3GFTA 5FOUA 3EIUA 4B44A 3B6JA 4DMRA 4CMEC 5I3ZA 4HLNA 4ZV9A 4KIUA 3NRJA 3S5UA 4HQRA 4FXOA 1ZJYA 4N3BA 4B4DA 3QIAA 3BGSA 5A62A 2ONJA 1ITZA 1U28C 1WF6A 2B4TO 3O9MA 3AOGA 3EA0A 4G5GA 4LYEA 1VYVA 4M8LA 4PC2A 2PFSA 3OKCA 5HBGA 4LRYA 3FSRA 3ONNA 1X1QA 2O8FB 2GKOA 3BF8A 3BC1A 4KGDA 2HJRA 4Z4GA 5I9TA 2VDWB 5IAAA 3FB4A 2NGRA 1G2QA 3MCTA 2O8DA 4E07A 1TJ3A 1O9HA 4O33A 4ER5A 1FFXA 1UIMA 1ZH6A 1RP7A 1IM8A 1UT6A 2GWRA 5KTMA 1NSYA 4DCOA 4YA6A 3P2IA 3TTTA 2KB0A 2YVQA 3G3EA 5ITZA 4A2PA 4J0QA 4KSYA 2RGAA 2OD9A 3ANNA 3L0PA 4QGBA 1G2OA 5LYJF 1P2BA 3JQ7B 4RGYA 4JYPA 2J9RA 521PA 4HJXA 2IHKA 2AKYA 1ZD1A 1RHMA 4RXMA 5F7JA 3TSOA 4AL4A 1A8IA 2HF9A 4YQFA 1Q7RA 2OCXA 4ZGWA 4RZ3A 2ZR9A 3MF4A 2R48A 3AHJA 4P3KA 2DGDA 1YRHA 3LRPA 4HK4A 4PZCA 4B35A 2HJGA 3CA8A 5GVRA 3S7TA 2VSXA 2JS7A 1ZMBA 1FX0B 3QZUA 5COAA 2H00A 3K0HA 5KHLB 4XQ9A 1RYFA 2ZSAA 2PMBA 2FPPB 3DXZA 5GOZA 4YRBA 3PU6A 5HQJA 5KWSA 1OV6A 4IIUA 1QYXA 1V4NA 3GLSA 2DFDA 4FZVA 4PGAA 4TM7A 3COYA 4DMCA 5CIYA 5TVGA 1FRVA 1R4AA 4MUHA 2OMKA 2OP1A 1BVHA 4F96A 1YGPA 3T3NA 1LPPA 2B7BA 5DULA 2XHZA 4U8GA 2D1TA 3GGDA 4P9NA 2ZE7A 3AV0B 5GV7A 2JFQA 3OX2A 3PUXA 5JLAA 5AM5A 4AVYA 4BNXA 3HM9A 1P1KA 3DQQA 4TTVA 4ONEA 4WY5A 3T5PA 2ZTUA 2JJMA 1XNQB 1CZNA 4BLUA 1JHQA 2UV8A 3PITA 5EIWA 4C76A 2ZM6B 2VWQA 4CQLA 4DXDA 5BW8A 3TTWA 4L0MA 4UBOA 4PU0A 3G9XA 1Y9ZA 3RHSA 1LSUA 2ECOA 2PUHA 4P0TA 4KRXA 4CIXA 5KPJA 1VJGA 1Y37A 2Y1OA 3E7FA 3OUZA 1CS0A 4HRYA 4PNPA 4TMVA 5FEUA 5IXJA 2EFGA 2QZZA 1TPYA 3SHOA 3NT5A 1Z7YA 3PKIA 5EQTA 4KFTA 1G0NA 1SVKA 3GFQA 4A7PA 4B7UA 1NU6A 4JH0A 3VH4A 2VAWA 1HA3A 3HKBB 2Q7OE 3WLIA 2Q99A 3L1HA 4MV5A 1IPEA 1ZRNA 1KGSA 5C2JB 3AU8A 1EXWA 1Z15A 2E37A 2B1JA 4FR2A 3EARA 4XWWA 2AC2A 3L1VA 4I2NA 4O2AB 5KVQA 3BXXA 4PNHA 4QPCA 1DPFA 5J5VA 4RLSA 5JQGB 1M34E 3QUBA 4ZHQF 2VAXA 1E64A 3ZHSA 3IODA 4M1WA 2QWXA 2DY1A 1Z8HA 3QG1A 2MDTA 4PAOA 4F04A 1ABEA 3HUDA 3F9IA 5EUCA 1LH0A 2B4KA 3B7WA 3U6BA 1GQRA 2WVHA 1RC8A 1GLVA 2C2YA 3O0TA 2GQ0A 4HS9A 3U81A 4ARSA 4AXXA 3VDQA 2GDZA 3W8EA 4C4XA 1L5MA 2H7VA 3U3MA 4IFBA 2XEXA 4AF6A 3DL2A 2GXUA 3OIYA 1KBQA 3R5SA 4GX1A 4JEMA 3B6ZA 4Q18A 4RH1A 4BRUA 4MVJI 4TQAA 3LUDA 1MGPA 5FV4A 3BK7A 3PA6A 5CCDA 1MOPA 5ARCA 4NBLA 3UMYA 2DPMA 3KU1A 5T7BA 4HH0A 4V0NA 3ZLTA 1WXGA 2Y68A 3FTFA 5CVUA 1QYRA 2D1RA 2OHIA 5DI3B 1EWQA 3R40A 2CXTA 3QVLA 1UH5A 4QNNA 4URWR 4CV1A 4BX0A 1A7KA 3CNEA 3BTUA 2QQ5A 3BD8A 3VO8A 5J5CA 3VSAA 1IY9A 3HKEA 3E23A 2YN4A 2ZI4A 1NC3A 4JAVC 1YE5A 3GOQA 3RAPR 1IDOA 1WW3A 3PNSA 4RJLA 5CHYA 5ISMA 4HTFB 2EG5A 4LTDA 3L4KA 2D5IA 4P0QB 4YP6A 5BN1A 1E1RD 3HKCA 5F9FA 4NPCA 3A3KA 2FWJA 1NLFA 2BJWA 4ZYZA 4NYIR 5BR7A 2YUTA 3ADCA 1WSWA 4LXGA 3UV3A 1K3FA 2E4XA 4YRTA 3IEPA 1QF9A 1TGYA 4C07A 4BB6A 4OO3A 3ZLJA 3KQYA 5CFZA 3THSA 2AVNA 3IMCA 5EHNA 1LPNA 4E03A 5EKSA 4FFNA 3ZXXA 2GAFA 3CGGA 1EWKA 4FFPA 4NESA 2CHVA 1DJOA 2OGZA 3EQ6A 1BQ3A 2IY9A 1HKUA 4G4IA 4ACAA 1Z75A 2CDCA 3EMBA 4XUEA 4GNRA 2ALJA 3EZGA 3ELBA 4CEIA 4MUKA 3LT0A 4UCFA 3EVNA 3CPJB 4TV9B 4TKVB 2Z5LA 4XA8A 2XVZA 5K1ZA 1A9XA 2C96A 4TRRA 5BN5A 1PI3A 1C80A 3BMOB 6NULA 2X3FA 4Z9AA 5JEEA 2EWWA 2VN8A 3LXUX 2QM7A 1YF3A 1RRMA 3OWOA 5KAMA 1D8TA 4LXYA 4B3SB 2QZ4A 1NAIA 4QL3A 1S1MA 2E7ZA 3PI6A 1C0IA 1VFNA 5E4FA 2Y6VA 2CNDA 1SKUA 1EFKA 3MJRA 4RD0A 2GXAA 3G02A 3N1UA 1YFZA 1BW9B 2CB0A 3LT5A 4KMSA 3NOQA 4HATA 4NR0A 2YX1A 2PA3A 4AJ4A 3O1IC 4ESEA 1WAMA 3SF0A 1US8B 4OMDA 5E3HA 1E3IA 4HN2A 1S2MA 2G4LA 1HFKA 5EWJB 5EXTA 3OA2A 3H5VA 3MMZA 4FLEA 3Q2IA 5CUQA 1OT3A 3FTNA 5IU6A 4M36A 3E5HA 4MPTA 4TVKA 2IHYA 2Y76A 2AKEA 1I6MA 4JYZA 1RLIA 3FPEA 3G85A 4FQ8A 3J7TA 1LW7A 3E7PA 1JFFA 1QDEA 4Q4AA 3V7FA 2XXAB 2NVUB 2JI6A 4C7VA 4OBBA 1I3NA 3G2KA 5FWDA 2HB6A 1XAGA 1UXGA 3RJ5A 1JLKA 1TNDA 2IZOA 4YFVA 3B2EA 1JP7A 3BQMB 4Q1BA 4OKSA 3WYBA 2Y0CA 3S2GA 7MDHA 3LYLA 2YN0A 5JZBA 2FMKA 3MCVA 5CB6A 4X7MA 2YZNA 4PQGA 2GN1A 1N25A 3UH1A 2FP4B 4ZK6A 2XQJA 4PLPA 4QREA 5F7OA 4GSYA 3TSZA 3BSWA 2R6JA 2EARA 2AQHA 3KHTA 3WK7A 5LQNA 5BQ3A 1MDBA 3ABRB 3KT0A 2YOHA 1V26A 2JLSA 3NTOA 4IFTA 3T0GA 5AI5A 4N7BA 5JYBA 1MLDA 3FSGA 2YV1A 2I34A 3UC9A 2OVBA 4H6PA 2VBGA 1SBIA 4KGXA 1PJ3A 3G0CA 2BKEA 5AKZA 3SOPA 5HDBB 5LUBA 5HSGA 1QH8A 5B58T 1UBTS 1GZ4A 3WIVA 5D3MA 1KOGA 3HCRA 1B8VA 5I9BA 2O3SA 3HKEB 1BHO1 1X1TA 1Z3CA 3K1AB 1WJGA 1GGVA 4KK3A 3TQRA 3DPIA 4DMFA 2OV2A 4RJKA 1S0UA 3PEVA 4KQGA 3QYPA 5GGXA 1NF9A 4YJ2B 3A7DA 3HKCB 1PTKA 2IOFK 2BGRA 4KU4A 4P38A 1SXPA 1H4VB 2FEOA 4XM0A 1PZNA 2AN4A 1NQ5A 3D7NA 1W88B 1JR3E 4I8DA 4PAQA 4C06A 5G41A 4DMLA 4KPYA 2I5PO 2W5UA 5K0FA 1TM7E 1GGJA 4WQMA 3FVQA 1F8YA 2TSYB 1RHUA 2FE1A 5B1HA 4CKWB 2QN7A 4NQRA 4ER3A 4KR9A 1G4AE 3KYJB 7ABPA 1XK7A 2HMUA 1E96A 3NBMA 4REMA 5TNXA 3TF5A 2QW8A 4MW5A 4W9NC 4H7HA 3FYHA 1JDVA 3ZOZA 2OCYC 5HOEA 3CNOA 3R7WA 3BWCA 1T0BA 3F8TA 2GSWA 2YYZA 2DECA 5CB8A 3QP9A 3QEBZ 3AHFA 2PSEA 3OEWA 1HEIA 3DUFB 3K6SB 1V95A 3KKKA 4R7TA 1X9GA 3E9DA 4CG0A 3WNQA 1KAGA 3W5IA 4M98A 3KELA 3E5MA 2F3PA 3AESB 4FMDB 1OXKB 2KMLA 3SP1A 3ZE6A 4FXPA 3RNOA 1VRWA 4WZBB 4XRRA 1DU4A 4UPDA 2ZT7A 2WTBA 1PGPA 2ZTLA 3B8HA 3UAVA 5LL6P 2CFIA 4DA4A 1KZ6A 2HF8A 3R3XA 3U6KA 3I37X 2A1UA 2O06A 3NM6B 4B3TB 1H6DA 4C04A 1GNLA 4BRZA 2XCSB 5BT8A 5LKAA 5K2MA 3ET5A 3SZMA 5K4AA 3NOOA 4YP7A 3DTTA 4GMFA 5DIZA 2FW0A 2K5UA 4HGOA 1AT1A 1FFHA 2ZULA 3ROQA 3AB3A 4E14A 1YZKA 2WSMA 1J39A 1N6IA 3FMPB 3P9PA 3V1MA 2RJNA 1QHHA 4HNGA 1CR6A 2VYCA 5C4IA 3TECE 1AV7A 1ISGA 1FS5A 2F64A 5LIRA 3OPVA 1GGEA 5AO9A 5EZYF 3TR5A 3FLMA 2X0RA 3OT4A 3OIWA 4BVJA 3AL0C 3CX3A 1U1GA 1ZL0A 1WY7A 1Y4AE 3I9V6 4OFBA 3MCAA 2LIPA 4CW7A 3AVUA 4ARCA 1N34B 4ZI7A 5AK6A 1SELA 3SZ3A 3QQ5A 5ER6A 1S3GA 2Q07A 4N82A 1JF8A 2VNJA 5FL3A 1W19A 4AY3A 5HJ5A 5DWDA 1XDGA 2CE2X 4LMAA 5FUMA 3AERA 4EO7A 4N5MA 2BZSA 3UHAA 5EJAA 4FMCB 3WGJA 3UB3A 5GONB 1NTRA 3C3KA 1FSFA 5D5HA 1G6Q1 3LECA 1J0AA 4RQBA 3ZCTA 3EF0A 3RVRA 3ESQA 6PFKA 2MR5A 4LMBA 4WBNA 1JFSA 4LSMA 2IUUA 1QGYA 1NX6A 4KXXA 1FRNA 4ALKA 5K0LA 1P9LA 4XCXA 1SXGA 3T35A 2VPIA 3TIIA 1UIRA 2WHRA 3QIVA 3AHCA 1XTVA 3AHGA 4QPZA 3VKUA 4A2CA 5KZMB 4A26A 4U63A 1GPH1 1U3GA 3KSRA 3V1TC 1U1IA 3EGOA 1VM6A 3NATA 4TKLA 1LBQA 1PG2A 3K0CC 4MI3A 2Q1SA 2G40A 4YMVA 2IBSA 3VKFA 5HZGA 1JHUA 4PFSA 2WU8A 2DBRA 4N7MA 3ME5A 2YZ2A 4GPIB 2BIFA 1U8XX 3CW9A 3IP3A 5KINB 4V0LA 3CLTD 2A9QA 4XYBA 3RYFB 2IKQA 3T7SA 2AJLI 2NZ2A 1RLMA 4XEUA 2I6XA 4M0LA 3FNIA 1S01A 1SG6A 4IDOA 4IDCA 3EGVA 3FCYA 4ITVA 4U00A 3BICA 3OZAA 2DQZA 1DO0A 2QMEA 3RSGA 3RR2A 5A5FA 2IDKA 3RDPA 4JGGA 1F17A 2F17A 3URMA 4LJ9A 2HWXA 2XUFA 1JIIA 2PSDA 3E22A 3IPLA 2I9KA 2WK1A 2YQ4A 4EUFA 5KVVA 1DTEA 2P3SA 2X9NA 3T52A 1L7OA 1J09A 2ZIWB 3CU5A 5LQKA 2IQ5A 4WOPA 1U99A 1O95C 1TCBA 4HWSA 3TRHA 4O6VA 3RS5A 5CDTA 4EG5A 4OGGA 4BV9A 3EOZA 1LW6E 4NU8X 1SC6A 3MMNA 3O1JC 3UUGA 5DE3A 3WZLA 1F1JA 3HBMA 2GM4A 4JOSA 3FPLA 1J6UA 1JHZA 4G85A 4JY7A 3WV4A 2CL7X 2QUHA 1NU8A 4IKEA 3NCTA 4PX9A 4GGPA 2WSYB 1D6SA 4LDJA 2Q0HA 3N58A 2J32A 3FRHA 4ZDJA 1J00A 1K9VF 2OECA 4RPJA 2VOEA 4IAOA 4BX8A 4NBTA 3E70C 2RHJA 2I1WA 2WQZA 1VRVA 2OPBA 4O08A 4TS9A 1L7XA 2MSCB 3FSJX 4B4UA 3PF9A 1R4NB 5TJ9A 1U81A 1R74A 1XQXA 1E2KA 4LE1A 4LISA 3PI7A 3PX7A 1R0XA 3HI4A 3M6WA 1LS1A 2W2TA 5DN6A 3ADPA 4B83A 1RMQA 4H1VA 5AVVA 2R87A 1J2TA 4G8DA 4AP9A 2W6NA 3KE9A 5B2ZA 4C0LA 1WABA 2H1CA 2I6TA 3JAKB 2JCSA 3QGMA 4GZLA 4M9UA 3VISA 4AJHA 4RPKA 3PTAA 3NETA 4XPIA 3CVVA 1I5RA 3BVPA 4K9RA 3RT7A 2X0DA 5ES4B 4C4YA 1MHPA 2VWGA 1OVMA 4BJHB 2BOVA 3WL7A 2TRSB 4TM8A 4DIDA 5FH9A 1N5KA 2N0SA 3WLJA 4A10A 2ZATA 4AMBA 1W1UA 2FW8A 2XA9A 5LUAA 1E6CA 2VWPA 4D9CA 5C18A 2G9UA 5JNTA 1R4MA 5I4IA 3CZ9A 3JQFC 4B09A 1WPGA 1ZISA 4XFKA 3V6LA 4TV8F 1ZVMA 3LC7O 2UXBB 1GNQA 3H9CA 4WW0A 4MQEA 2C1XA 1P44A 1U0EA 5BSEA 4NCBA 1OFHA 3HP7A 3ITKA 5FUQA 1XQWA 1TIPA 3W8NA 5ICSA 2OR3A 3HUUA 4PO1A 4QJ5A 3ZNNA 1I2MA 1JHMA 2V96A 3VC1A 3B7PA 3RGGA 1Q92A 4XQCA 2PUDA 2ZYDA 4A6XA 2IDZA 1K7EB 3RK4A 1V37A 4IH9A 3ENZA 1UOOA 2GCGA 3EPJA 4M7RA 4I5DA 3AXSA 3UMMA 3K53A 2XT9A 1NRWA 2FGKA 5HUQA 3TDMA 2FSPA 4PQYA 2GWHA 1PWYE 1UPBA 2DVMA 3CONA 4BKRA 2BMDA 3H17A 1LDGA 3QTBA 4AQDA 4B2PA 2PZBA 2ASVA 4LY3A 1CUHA 3S7ZA 1DWUA 1HE8B 4M0MA 4A91A 4LZJA 1MB9A 2VA9A 3D8BA 2ZIZA 5EP1A 5CM9C 5JAMA 3SIXA 3Q0EA 4WY8A 1N1DA 3WGVA 4C3ZA 2ZTHA 3C5WP 1NATA 4E2FA 4MSUA 2MINB 3H1PA 2WKRA 2G17A 2AUTA 3LNCA 4IYJA 3PXXA 2EP5A 4WXMA 2JGMA 1T0PA 3HDHA 3RH0A 1EUDB 3ANLA 1CLUA 3HXKA 1PR4A 5CXXA 2QUKA 5DNEA 4BNJA 2BGTA 2J9XB 4O1MA 2AFHE 5HTKA 3E4CA 3N8GA 2J0QA 1L5LA 2VT7A 5H4GA 5CB4A 1DXHA 3OD1A 2C2BA 1T6YA 1TW3A 4F4CA 2XCLA 1QZ3A 4NXMB 4CL3A 2OYCA 2Z95A 1TUIA 1WDKA 3RV3A 4REOA 821PA 2MTBA 4M0UA 5C52B 5FBKA 3H2GA 1IAVA 4KE8A 4LDRA 1VXRA 3GLTA 2IYZA 2PX6A 1GZVA 2EX4A 2JGIA 3OU2A 3QU2A 1IRIA 4DR4B 2IYPA 4YRAA 2OHJA 4KGVA 4A5SA 3LY8A 4B3JA 1HE5A 1EPUA 2VDQB 3AI1A 2ANCA 5EJ6A 1VKZA 1R6DA 4PS1A 1MMFB 1VCIA 3DMFA 4JR2A 4AZSA 3GLGB 1GT91 4ZYXA 3DVAA 4OYRA 1HYQA 4I46A 2AOXA 2I4OA 2C3OA 3AWDA 4A27A 2A9OA 4R2KA 2AWNA 5BN3A 1NLUA 1LUAA 2B92A 1ZGGA 5KNBD 4C3OB 1ZMXA 3M82A 3TBKA 4C7XA 4X61A 5EESA 2CMGA 4HQNA 3GY0A 4FBLA 2FDXA 1VLVA 1ZITA 1IQRA 3FSEA 5KTNA 4DLNA 1RAFA 3W4KA 1NUHA 4R8MA 2HA0A 1KFEB 1T8WA 2JIZA 5H9WA 1W5AA 1KPIA 3NRBA 4MJLA 1NTOA 1CETA 1R6TA 4MV9A 1X92A 1V7QA 2CD7A 1BDHA 4RK0A 1KI2A 1V11A 2W2LD 2O0KA 1UKZA 1U11A 3A1UA 1FRZA 4JS0A 3THXA 1R8YA 2G5TA 4HDKB 5LLDA 2UZAA 2GJ8A 1UMBA 2AJCA 4HTAA 2YY5A 3WRVA 4YUWA 4LF5B 4FSHA 4WA7A 1U04A 4YAJA 3AMVA 3LG2A 3L6BA 1WSBA 5EMKA 4BO8A 3ZZMA 2P78A 4JVSB 5JBNA 5DTIA 3OLZA 3G5UA 4IJ6A 4DIBA 5KQGA 5LVAA 3OU6A 3JWIA 4QFMA 4RSHA 5I7VA 4XSVA 1JI3A 3OOSA 4OI2A 4NCIA 1D5CA 4I3FA 5L9AA 3VO1A 4IIEA 4II2A 2Q5OA 2I8AA 1G8MA 3BJEA 4V3BA 1N5DA 1W6UA 1ESEA 1YJQA 3PDUA 3PL5A 1BX1A 5B7PA 3N75A 5E7JA 1O03A 4PGHA 2O0LA 5TQVA 4XDHA 2VHXA 1NOIA 2V58A 3GLHE 4YRCA 1JEYA 1GARA 3FH0A 3AKCA 2WWHA 1GCIA 2XOKD 4LNUA 3NHRA 4TUYB 5JFOA 2UYOA 1XTBA 3B6IA 5IJAA 1V1JA 3CB4A 4OHUA 4N76A 1WVMA 2P9JA 5JRJA 1R6XA 5HK8A 1B43A 4HSGA 2Z9BA 3FVRA 3EPHA 2WPDA 5A6SB 4Q66C 4MRMA 4LSGA 5HK9A 2FHSA 1W36C 4INZA 2GD1O 2VJBA 4L0CA 4WOKA 5HZMA 5U4QA 3FNRA 2GRUA 1PSZA 4CMGA 4CM1A 1MPXA 2C9DA 1BGVA 2YJ4A 3FDIA 5KNCA 2ETXA 1CY0A 1LFAA 2P27A 2A9PA 4MR7A 4D82A 5I7HA 3B60A 2XUOA 1PGNA 4FMBB 1WBDA 5DMHA 1EB8A 1B14A 3DC7A 4NABA 4Q4JA 3H2HA 1XQ1A 2B35A 5HJ2A 4DE5A 4Q4DA 2Y0DA 4XR4A 1M0EA 2V6FA 2FW1A 1DIAA 3HNRA 2JI4A 2Q3JA 3HU2A 3OZGA 2YFHA 2EF0A 4PZEA 3MB5A 4RQTA 3U1VA 2AE1A 1YB7A 4IRUB 1IUPA 4TPKA 4DUPA 2B94A 2H92A 2F4VB 3PE6A 1AN9A 2XCUA 2QJTA 3W9BA 2X9GA 3OVMA 4LW8A 1OHHA 1KHHA 1CJKC 1Z17A 1CJTC 2MYNA 2VHQA 2X77A 3O2JA 4MQ6A 1DOAA 2BEUA 4JJ8A 4JU9A 3WNZA 3QMWA 3ZWAA 3OCUA 2DHQA 4K6HA 2XUAA 4RMNA 5J58A 3MNFA 4OA8A 2J48A 1W4ZA 2Y0PA 2X3YA 1JA0A 1G17A 4BC1A 3GLFA 1BC5A 2JGJA 3NASA 4Q9AA 5LA6A 3K6SA 1KK0A 3AR5A 3ICEA 3KTOA 1RI5A 4OBXA 3ZW7A 2ZIGA 3TOXA 1DAEA 1T9AA 4IWXA 3U9LA 4C2TA 4EX7A 3HO1A 3R3HA 4Q37A 1T9HA 1G63A 2OUKA 2QM3A 1RYHA 4KN9S 1M9NA 1VGQA 3KHKA 1ZWKA 4EB0A 2WJ3A 3LCUA 4OL0A 4ZU1X 2X23A 3VHXA 4KR0A 5B30A 2WHEA 5ALGA 1TQDA 2NU9B 4QBGB 3N9IA 2GESA 1AGNA 3QFHA 2V7WA 1HKHA 3CWZA 4NU0A 3RLFA 1JUDA 3A6LA 4F5WA 1NLZA 3AUAA 4EMTA 3SC4A 1XZGA 3RASA 1XQYA 2O7VA 3QXHA 3I23A 4HAZA 1PS9A 2J0VA 3ZVRA 3E6AA 3OD5A 3QVTA 1LPMA 2WOOA 3HYSA 2QVLA 3I9JA 4U2FA 5BN4A 1BNCA 1Z73A 3RF7A 4EG0A 3FNHA 3K9LA 3JASA 5K0SA 2I8CA 1MQAA 3EVCA 4UUOA 2BKXA 5DBOA 3NJ4A 4TXNA 2IPXA 1A5AB 3FWPA 4D98A 5KSOA 1M2VB 4YRDA 2C2MA 3TZCA 2W11A 4CG1A 3EYWA 5K05A 2FMXA 4FEGA 4TYWA 3P4UA 4D25A 5IXYA 3BMNB 4E3WA 1QP4A 2FKNA 5DYWA 4DSNA 1VBKA 1SR8A 1I80A 3OURA 3OZDA 4RKEA 1BCRA 3K70B 2FWMX 4CMAA 1T9CA 4G67A 3P96A 1XNGA 4PN3A 2BR3A 3V1UA 4NOKA 2NM0A 4R1PA 2ZJ2A 4XD2A 1E7WA 2PUEA 1QQAA 2VKQA 2WNSA 3LXXA 3ZHOA 4ZOBA 4ENQA 4EFMA 4J16A