2GCXA

Solution structure of ferrous iron transport protein a (feoa) of klebsiella pneumoniae
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
75
structure length
75
Chain Sequence
MQFTPDSAWKITGFSRDISPAYRQKLLSLGMLPGSSFHVVRVAPLGDPVHIETRRVSLVLRKKDLALIELEAVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein A
publication title Solution Structure of Ferrous Iron Transport Protein A (FeoA) of Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae
molecule tags Transport protein
total genus 8
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gcxA01
3GLXA 3E19A 1BI2A 2LX9A 2H3JA 5CVIA 1BI0A 4O6JA 2QQBA 1QVPA 2K4YA 1G3TA 4O5VA 1G3YA 2GCXA 3HRUA 1G3SA 2K5LA 2QQ9A 2K5IA 1U8RA 1P92A 3MHXA 1FX7A 1FWZA 3HRSA 1QW1A 1BI3A 3HRTA 1G3WA 2QQAA 2K5FA 1BI1A 1BYMA
chains in the Genus database with same CATH superfamily
5I21A 1H92A 5I11A 2K3XA 4XU3A 4FYWB 3C94A 3RKWA 2EGAA 3LGFA 1VQOA 1KQ2A 1QP3A 4MMKA 1QVPA 1Y07A 1BB9A 3JV3A 2D0NA 4YTLA 3A8GB 4PJOE 1QMCA 2FPEA 3EG0A 4HT9A 2CH4W 3VS3A 4RTUA 1KHCA 2EYQA 3OMGA 2CYZB 4M78B 3LGLA 4E7HA 2J06A 4DBQA 3H6ZA 2X3XD 2D6FA 3HTRA 1YHQQ 3NMZC 2WSEE 2D8JA 2DNUA 5GAN5 4OF1A 4AFQC 1D09B 2EGCA 2RI2A 5LJ3h 1IZ6A 2W10A 4IUVA 3ZL7C 2GNCA 2YDLA 2OAWA 2PUOB 3OS5A 3EH2A 3CD6T 2NUPA 3OYCA 4KUDK 3MPUB 3CC2T 1QVFP 1PD1A 4C0ZA 1B34B 4J6WA 1Y96A 1PD0A 1BK2A 4C92C 3NTIA 4A63B 2KK4A 4KULA 5CKBA 5GAN4 2OTJQ 3I56A 2LQ8A 1YJWT 3PMTA 2QEXT 8AT1B 1OQKA 2CP7A 3V7CA 2EVRA 1YP5A 2DPPB 5D6WA 1WQWA 2CZ1B 2MI6A 2DRKA 3QKJA 2LCSA 2HMAA 2GQIA 2L89A 4ZGEB 5HY6A 1QCFA 4QT7A 4HCBA 2VGMA 1FXXA 1X2QA 4JPBW 2MK5A 2E41A 1MNDA 4M7AB 2KAFA 1IO6A 1TU0B 2KEAA 1PNJA 2DETA 1ZBJA 2ATCB 2QK0A 1OYXA 3CMAA 4HCKA 2ZPBB 4BE2A 2XHCA 1KQSS 3A8MB 1NJIU 2VVKA 2PVDB 3M0RA 1JJ2P 1PG5B 3JCMg 3NPFA 2GFUA 4ME7A 1FX7A 3META 1OI1A 2RQUA 4BY6B 2DMOA 1GL5A 3PGGA 2DLPA 2FRWA 4OMOA 4F7UE 1M1GA 4JLIA 4RG8A 1YI2Q 2P0PA 2CP5A 2V8KA 1SPKA 3SD4A 2QA4A 5C0MA 1K0XA 5GAOq 1UEBA 1H3ZA 4FSXA 2OJ2A 5DY9A 3EG2A 3JCMb 1WFWA 3QPHA 5KYWA 1UUEA 5KCHA 3NFCA 2AKLA 3EGDA 4QKUA 3NHNA 4L6V5 4IUUA 1NYGA 3WXMB 2BZXA 5LJ5g 5GAMg 5GMKj 5GAN7 4K11A 2NWMA 5LJ3f 3JRZA 4AT1B 4QW2A 1K76A 4M77F 3CCLQ 3GNGA 4PNOA 4HVUA 1YHQT 4EMHA 3GNFB 2OTLQ 1GFCA 3NTHA 2DYBA 3HKSA 1K73C 1NEBA 1OV3A 1WX6A 1ZA2B 1SEMA 3H9NA 4E7LA 3M4GA 4KGXB 4M78D 3A98A 3EG3A 3TU4K 1WXUA 1W70A 2LTOA 4RKUE 1VIEA 1ZSZB 3REBB 2QG9B 1M30A 3DB4A 1KIKA 3HHTB 2E5QA 1Q82C 5FU6C 3CPWS 1ZLMA 4FIBA 5FU7B 2EFIA 4OMQA 3CMEQ 1U06A 2I0NA 1SSFA 2C0OA 2YLCA 2FHDA 1A0NB 1QKXA 1EX4A 3M4YA 4KUIA 4M75A 4PJLA 4J8OA 1T0HA 2L3RA 2DILA 2KXDA 2ROTA 3JCMX 1YITT 2COYA 2HCKA 2A7YA 2JN0A 4OGCA 3TVTA 3QDFA 3JB9F 2EYWA 3OB9A 2IPOB 4A4FA 4E7KA 3PVQA 2GBQA 4X9DA 3TREA 3OYBA 2QQBA 3OMCA 3S6WA 2XK0A 3JB9G 4C0GA 2QDYB 3G4SQ 2OTJA 3LLRA 3A8HB 2LJ3A 3CCSA 5HK0A 2DL7A 2AT1B 2K5FA 3VV0A 2DIGA 5FLXE 1VQ8Q 2RMOA 3UT1A 1Q7YR 2PVGB 4M7AD 2RM4A 3HP9A 5L23A 3OY9A 4O6JA 4N4HA 2FPDA 1E7OA 1AZGB 1N5ZA 4F16A 2DL3A 5CCAA 4BE0A 1VQPQ 3HRUA 4QVDA 1VQ7Q 5AT1B 1OOTA 2DEUA 5KE2A 4OMPA 2QQAA 4KH0B 2KSSA 4XAXB 3MP1A 1ABQA 3I55T 3J7AF 1NEGA 1B3QA 2RK1A 3OBWA 3PE0A 1VOMA 4QVCA 2LDMA 3PFSA 3OS1A 4Y91A 3AT1B 4R56A 3EFRA 4ZTFA 1D0XA 2GTOA 1QVFA 1K9MR 4L5GA 1VQ9A 3CCLT 2B86A 4OMFB 5GAN6 4IUPA 3BDLA 3CEYA 4OMLA 4PJOB 1K8AU 3LYIA 3CPWP 4FT4A 3WVEB 3RKYA 5KE3A 3URGA 4J9HA 3JCMh 1AWXA 3VYHB 2DIQA 2KXCA 4ATOA 4LDXA 3MHXA 1NPPA 1RI9A 1OU8A 4C8QE 1AHJB 1D1CA 1M8MA 4C5GA 3H8ZA 4JDSA 1Q95G 1RUWA 3QO3A 4BD3A 5CKHA 3MEAA 3E19A 2AIRB 4RTXA 2CP6A 4BDYA 1WHLA 2CZ0B 2HNIA 5KYXB 4EIKA 1M2VB 3ASKA 4WTOB 2XIDA 5D7UA 4RTVA 4JUVA 3ZEHA 1FWZA 2DO3A 5LJ5h 5HKCA 4BDZA 3CBOA 4Z88A 4ESRA 2QGFB 1U3OA 1LPLA 1YJ9A 3OYJA 3PNWC 4HCCA 1VQOQ 1M9SA 3UF4A 4D6WA 1JJ2A 1WDXA 3X24B 1PRMC 1LJOA 2K3BA 4MZTA 2VUBA 3M57A 4C92F 3CCMT 2E12A 2RH2A 3L1AA 3M5AA 1YJNA 3G7ZA 3EG9B 1D3BA 1WXTA 5DLOA 2PZ1A 3CMEA 2Y90A 3HFNA 1VQ4A 2H3JA 4C92G 4EMGA 1M1KC 2MPXC 1IXDA 3MJXA 1VQ8T 1Y57A 2LCLA 1NE8A 3T9NA 4RMOA 1AOJA 2JUFA 4B6MA 6AT1B 1W1FA 3L2RA 5J39A 2RK2A 1VQPT 1V76A 2IIMA 2ZPHB 2DL5A 1RLQC 3CC7A 1TUDA 1VQ7T 3A5ZB 2OAUA 3RBBB 3AHUA 2ABLA 2QGGA 3I35A 2RPNA 2KBTA 2YRVA 5A0DA 4A4HA 2EIFA 3I56Q 2J7IA 4M77A 4M7AC 1WHHA 4F7UB 1Q81R 3VS6A 1P92A 3G4SA 4PJJA 3V7RA 1QW1A 2DYIA 2O9SA 4M7DE 1VQKQ 3JCMf 1SG5A 2XKOC 2YUNA 1I4K1 3BY7A 5DLQE 4IKFA 2G3RA 2JMAA 2O4XB 4BY6C 2G6FX 5GANd 1SKUB 2RJFA 2VKNA 9ATCB 3QBYA 1MMNA 2L3SA 4NL2A 3QWYA 2HQHA 3KFVA 1KHIA 1VQNA 4HA8A 1ZQ1A 2XDDA 5GANj 3JCMV 1YIJA 3CCUA 2HQEA 2P84A 2LQWA 5A0GA 5LJ5f 4O5VA 5GAMf 1XNIA 4PJOD 2CSQA 3QYHB 4KBMB 1D1BA 1RACB 1KC8R 4OGEA 1X2KA 1M90C 1KQ1A 2VYTA 2KRNA 1S72A 3QG1A 4Z89A 4ANJA 2R5MA 1UGPB 2QDLA 1BI0A 1B07A 4IUQA 1VQOT 3VKIA 2HQXA 3SWNA 2LJ0A 2DVEA 1O9SA 1ZSZC 4J9CA 1OPKA 3BDUA 2MWOA 1RAFB 2LT4A 2M9UA 3M0UA 2Y4YA 4FYXB 1MHNA 1T3SA 3CCVQ 2K9GA 3VS4A 4BACA 4XTUA 1RAEB 3R6OA 4JRIA 3M9QA 2X4WA 2GQVA 1VYUA 2WSCE 1BU1A 4J5YA 3VUBA 1WJQA 1YN8A 1LVKA 1QVGP 3V8JA 3FDRA 1TS9A 2KMTA 4D8DA 3E9FA 2KE9A 1NZ9A 1GRIA 2DE0X 1UGRB 1QCOA 1O75A 1WHMA 1KC8U 3A1PA 1V1CA 2XI9A 1WHKA 3VS5A 3OYFA 2V8IA 2B8AA 1UJYA 2E3HA 1VUBA 1WQ7A 4ELZC 2MMPA 3I56T 3JCMc 1JB0E 5FWCA 4BB7A 2LZ6B 3JAME 2O01E 2Z0WA 3JCMP 3X26B 3VYGA 3TEEA 1BI2A 2CT4A 1PM3A 2FRYA 5GAN3 4EPCA 1AD5A 3OYEA 4DBFA 5KCOA 2DXBA 3QIIA 3KXTA 4KH1B 2SEMA 1IHWA 4XQ3A 5J3BA 3UWNA 2ZPEB 2MYSA 1NJIR 3LWIA 2W0ZA 1AWJA 3QSUA 1W2BP 1NLOC 1LOJA 2KRSA 4LDVA 2ENMA 4NL3A 2R5AA 3CMAT 3S3OA 1V29B 4GBQA 5GAN8 3FC3A 4MMLA 1WNLA 3CCSQ 4FYVB 3S3NA 2JTFA 1ZA1B 4RCBA 1PSFA 1H8KA 1VQKA 3OW2S 2YT6A 2CZ6B 4DQ2A 2D8HA 4C8QB 1X01A 1TWBA 3MEVA 2A08A 1JRIA 1KK7A 2QA4T 2HDAA 1I07A 2JXBA 4IUTA 1YCSB 3OBYA 4C92A 3FJPA 1BCMA 3CCET 3ME9A 3CCRT 3JCMQ 1IGUA 3SEMA 3JCMW 5CO7A 4XU1A 3TSWA 1OEBA 5GAOm 3R6NA 3LWHA 1ZUYA 1PCXA 2DVJA 5LJ3d 1QP2A 1W6XA 1M1FA 1NLPC 2J05A 3PVLA 2KR3A 2RB6A 3P8BB 1VQ9Q 2X35A 4LN2A 1HJDA 1RAGB 5LJ3j 4M75E 3QWXX 4M78F 4FT2A 2F2WA 4IIOA 2EPDA 1EFNA 5KYUB 4NOYA 1UGVA 2RQWA 2X51A 4GLMA 4ZN3A 3CCQA 5CIUA 2MIOA 2QEXA 2CKKA 4M78G 2A3LA 1X6OA 2DRMA 1E6HA 1OX8A 2JTEA 3CXCS 4ZNXA 1N9SA 3I5RA 2V8JA 1XTDA 2RJDA 2ZCFB 3FB9A 4C5EA 5KYYB 3NGPA 4QQGA 3CCVA 1N8RU 1RABB 1XQHA 2CUDA 2L2PA 1GCQC 5EC7A 3ULRB 1WJRA 2FVUA 3SWNB 1GFDA 3OYYA 3UA6A 2JM8A 3VUZA 1PWTA 2FZKB 2VB6A 2EQIA 5FW9A 1WYXA 2DZ9A 4F14A 4EMKB 5IHKA 3E2UA 1YJ9Q 2DERA 3GLXA 3RNJA 2EYYA 1M5Q1 2V1RA 2I2LA 2RD1A 2K7AA 4M7DB 3VRZA 4JRPA 3G71A 2HEQA 2K5LA 2ZAEA 3HFOA 2PQWA 1UDLA 1YJNQ 4XK8E 2OTJT 5GANg 1S1NA 2C0TA 4M7AF 1IB8A 2V26A 2LRQA 1VQ4Q 3CCST 5IAYA 4N4GA 3M59A 1UG1A 1UE9A 3UA7A 2EQJA 2LQNA 5IH2A 5HCKA 1ABOA 3RIRA 1VQ6A 1M3CA 2EJGA 2X3WD 4M7AG 2HKNA 3BE3A 2HBWA 3O5ZA 2RHUA 3M0TA 4N0AC 3A8LB 3PT9A 1KQSP 3I5SA 4OB0B 3CC7Q 3CC4Q 3OSVA 1AZEA 2JS0A 2KYBA 3GIBA 2K6DA 2EYXA 3RMSA 4KRTA 3FJ5A 1K8AC 4OMNA 3X25B 3QZ9B 2DXCA 3QZ5B 1QVGA 1K8AR 3CCJA 4HKEA 3L2VA 4M77D 4C8QD 2NUPB 4QQDA 2HSEB 1D0YA 3M55A 4JJDA 3JCMe 1Y96B 1ZUUA 1VYTA 3DLLA 1Q7YC 4OB2B 1G2BA 2SRCA 1BIAA 3RR6A 3CXCP 2JMCA 3FLGA 1ZBXA 3EG1A 1YI2T 1G5VA 1M4ZA 1M27C 5A2QE 2KT8A 4LDYA 1VYVA 2IG0A 4WCIA 5KH6A 4OB1B 4DOVA 1K73U 4L59A 1VQNQ 3VS2A 4DEXA 3VU3C 2ESWA 3KUFA 1YIJQ 5FRMA 4LUEA 3CCUQ 2D0QB 5LJ5e 5GAMe 1CSKA 2CGHA 3EGXA 2YRDA 1X6BA 1NG2A 2YUPA 2RHYA 1K9MC 2E10A 2XG8D 1WZOA 2D9TA 3M58A 2XMFA 1OZ2A 3UATA 2DA9A 1W2BA 2O2OA 1HYOA 1S72Q 4RTTA 2NUTA 3FIFA 2XD0A 1BYMA 4BI4A 2HL3A 3G6EA 1ARKA 5HK3A 2OTLT 1KG1A 1D1AA 1T3LA 2LX9A 4PKCC 1N9RA 2KRMA 3JB9H 5CQXA 3QHSA 1YJ9T 2K4YA 4AFUC 4XU2A 4FYYB 5GAOl 2RF0A 2QTXA 4M77E 4PK4A 3HRSA 1TXQA 3RKXA 1BI1A 1K1ZA 2P0QA 1WHGA 1R0BG 4J9IA 2JS2A 2X4JA 4A4EA 3J81E 3CMET 4JJCA 4M78C 2M16A 5KYWB 1MMAA 4RTYA 2F2VA 3EGDB 1AWWA 4KGVB 4M7DD 5ECAA 1U1TA 5GAMh 2Y4XA 1UHCA 4JS4A 1AWOA 1MV0B 2ED0A 4XTZA 2FZGB 2CREA 1NPRA 2GTJA 3IQLA 3CC7T 4PFZA 3SDZA 2K2VA 4LUDA 3RUXA 2DL4A 4JZ3A 1YWPA 3SFMA 3LX7A 1GBRA 1BKBA 4E47A 3P8DA 4M78A 3G4ST 2DF6A 4A53A 2L3PA 3PIPA 1BCOA 3JCMd 5GAOr 1M3BA 5CK9A 2QASA 3A8OB 2DX1A 5KYNA 2CS7A 3TSZA 1YNZA 3THKA 2COWA 1VQLA 1UGQB 1SHFA 2L3QA 2XDPA 2P4RA 2X9HA 2J6OA 4FU6A 2MAMA 4C8QC 2RI3A 2H3EB 4JJNK 1TSFA 1B34A 4ELYC 2RI5A 1UHFA 3CC4A 1VQNT 4X34A 4PJOF 4B9XA 4DOWA 2E5KA 3OYGA 2FG0A 5FROA 2ECZA 2MOXA 3OS2A 1PC0A 1Q81C 3CCUT 3VS0A 4M75B 1EZZB 2LC4A 3M54A 5LJ5d 1KD1U 1TUGB 2FZCB 5GAMd 2A28A 1WI7A 4BE1A 2PNIA 3C0CA 2IVWA 4WF2A 4PJOG 1PSEA 4TVRA 2JTMA 2HZYA 3C12A 2EJFA 3OYKA 5LJ5j 4A4KA 1JQQA 4AFZC 4DBRA 1S72T 2A36A 1VIFA 2AHJB 4OVAA 4PJNA 2VXEA 2DJQA 4Q5WA 1X6GA 2EKOA 2EW3A 4JZ4A 2NYSA 2QQSA 1MGQA 2RQRA 5I2MA 4M7AA 1PRLC 2EGEA 5GMKm 2F69A 2FYKA 5IT9E 1M3AA 2DD5A 2EQKA 1AEYA 1KC8C 2MF2A 3OSSC 2GGRA 1KQSA 1VQ5A 1M2OA 4C0DB 2DTHA 1OPLA 4LNPA 3REAB 4DBHA 1Z9ZA 1M1KU 2DXTA 3N5BB 3H0IA 3QDRB 4J6XA 4AFSC 4C0FA 4GY5A 1UFFA 4V2SA 5D6YA 1JO8A 3CCQQ 2QEXQ 3F70A 2LP5A 4J9BA 3NTKA 3OQ5A 1X27A 1IREB 4EMKC 2VGNA 4XU0A 3C95A 3QXEB 1YWOA 2E65A 2LX7A 1I81A 1PKSA 1ZSGA 2P0KA 4M7DC 3CXCA 2DK3A 4HVWA 1HK9A 1VQMA 5GANf 1Y71A 3P8HA 2F1LA 4ZGDB 1X75C 3DB3A 1RL2A 4VUBA 1TOVA 4MZPA 5FU7C 2K5IA 3MKDA 2WACA 4F7UF 1Q86U 2J6FA 2E70A 2JOYA 2RO0A 4BI3A 1G3WA 3OYMA 4C92E 2RHXA 1AVZC 8ATCB 2PUKB 2RHZA 4F7UG 2O31A 5CKFA 1AT1B 1ZSZA 2KYMA 1R77A 3G71Q 1SRLA 2JM9A 4N4IA 1M8VA 4ZTJA 4AG2C 1WA7A 1ZX6A 4C5HA 3CPWA 3M53A 2VASA 1JJ2S 5GMKe 1J3TA 4KGZB 3X20B 3EAEA 3SHWA 1VQKT 1H641 1VQ6Q 3Q1JA 1WLPB 1M90U 2EQMA 2V1QA 1UECA 4X9CA 4XTWA 4HCZA 1NJIC 2MCNA 1QLYA 2QXFA 1D0ZA 1YCYA 3M56A 4E2FB 4M75D 2DBKA 1D3BB 2L0AA 4RUGA 3GP8A 2AZVA 2MWPA 2OX7A 1YFNA 4DEYA 1XOVA 2LT1A 3QUIA 3TQ7P 2NUZA 3WVDB 1OZ3A 3CCJQ 3PTAA 1MV3A 4BI8B 1EIFA 2BKDN 1HSQA 2VXFA 2M02A 1KSWA 2AZSA 1JXOA 2DZCA 4OB3B 4M77B 1G3TA 1N8RC 2AK5A 5GJWB 3DKMA 3CBMA 3CCQT 1RADB 5GMKh 1UGSB 1N8RR 4PJOC 3E1SA 2C06A 3L2UA 3EHQA 2RQVA 3JCMJ 4JLGA 3GF5A 5D6XA 5GMKi 1F1BB 4Z02A 1YITQ 1OU9A 3RMQA 1LCKA 3CD6A 1W4SA 3CCVT 1KJWA 2YWWA 2YUOA 3EFSA 3CC2A 3C4SA 2R57A 2E4HA 3HL8A 1BI3A 5IXFA 1C6VX 2F5TX 2JVVA 4PFOA 3ZFJA 1FYNA 2HBPA 3G6EQ 4ZN1A 3HPWA 2KDSA 3L2QA 4J9EA 2RNAA 4PJOA 1YJWA 2JZ2A 3V7SA 4LD6A 3MO8A 4R55A 3MP8A 4NS5A 5GMKl 3OYNA 2CZ7B 4J9FA 4B9WA 1K0SA 2VC8A 3G71T 2DM1A 4J9DA 3QJ6A 5I2SA 2DL8A 3I9QA 3V8LA 2KGTA 4IIMA 1LNXA 1K9AA 2DTOA 1QWFA 2K3YA 4Y28E 1WHJA 2ZPIB 3KBGA 2KI7A 3CCEA 3CCRA 2BIVA 5KYXA 4EDUA 1M2VA 2KROA 2A0FB 3OYLA 3VS7A 1VQ6T 3I55Q 1B7TA 2F5KA 2DEQA 2FEIA 2CP0A 4AG1C 1N6AA 5GAN2 1OULA 3OYHA 4C8QF 1C0MA 1GBQA 3L2ZA 3OW2P 2ZGWA 2C0IA 1TG0A 3CCJT 1WJSA 1GCQA 4M77G 3EG9A 4C8QG 2XDBA 3VRYA 4M75C 1GXIE 3OYDA 1K73R 2OI3A 2WSFE 1VQLQ 1QKWA 4QVZA 2FPFA 3MCAB 1G3SA 2E6NA 2CH4A 4JJBA 4RCCA 2X4YA 3EH1A 1C1AA 3M0SA 1Q82R 5IN1A 1Y7XA 4J7FA 1IRXA 4MDWA 5IXBA 2DTIA 4OP0A 1YHQA 3PIOA 2YLBA 4RG2A 2JT4A 4F7UA 1QCNA 1MNEA 3EHRA 2LNVA 1HD3A 2RJEA 4ORZA 4PJMA 2JNGA 1SSHA 4FW1A 3O8VA 1VQ9T 2BZ8A 1BIBA 1ZUKA 2D1XA 4C0DC 4N0AA 3G6ET 2BE7D 2NLUA 3CCMQ 3M0PA 3L2WA 2O4XA 4KT0E 2ED1A 3E9GA 2M1HA 3OA6A 2YRCA 2DBMA 2KNBB 5AYFA 3OYAA 2RJCA 3HRTA 4D8KA 2F2XA 3RDVA 2LQKA 1SF9A 1FMKA 4LXCA 4JRKA 4Z8AA 4M78E 3VS1A 4JS5A 2L5QA 3V8KA 1CKBA 1QQJA 2ROLA 1YITA 4JRQA 1Q82U 4M7DF 4C92B 1VQ5Q 3GBQA 4FL6A 2A37A 2DFUA 3UDCA 2M51A 2VV5A 1MMGA 3BFMA 3JB9J 4XTXA 1FMVA 3JB9D 4M7DG 1WGSA 3SB2A 3PMIA 1T0JA 2QI2A 5CKDA 1ACMB 5FWBA 1WXBA 3L42A 4HVVA 5L8RE 3DLMA 4MZMA 3CQTA 5CAIA 4GLKA 1OX9A 1CKAA 4J7IA 1NM7A 2YUQA 4M4ZA 2EAYA 5FRNA 2DXUA 5GANe 2LNHB 1YI2A 1YJNT 1VQMQ 3LH0A 1U5SA 4FM4B 2HSPA 4XTYA 1MMDA 3EFOA 1Y0MA 2DAQA 1VQ4T 2M0OA 2EJ9A 4F04B 5A0LA 2QTVA 5EG2A 2GFAA 4E7ZA 1I8FA 1SRMA 4FSSA 4LE9A 4IURA 1KD1C 1VQLT 1Q7YU 2L8DA 4LD9K 3I55A 1WIEA 5IHIA 2H8HA 2KT1A 2KVQG 1KD1R 1WPYA 5GJVB 3TCJA 1QWEA 4HT8A 4CC7A 3GOXA 4M7AE 3CC4T 2RA2A 2ZPGB 2X4XA 4FCYA 2DJZA 3CCLA 4X1VA 2K2MA 2FO0A 1IGQA 1YBYA 3X28B 1PHTA 1PKTA 2CUBA 3S3MA 1N27A 4C5IA 2OTLA 1RAHB 2CP2A 1U1SA 7AT1B 2CP3A 2KQWA 4LDUA 5M9OA 2K57A 3OYIA 3INZA 2EQUA 1I5OB 2HKQB 2RN8A 1RLPC 1RI0A 1DJ7B 3LH5A 2LCCA 2LJ1A 1TH7A 4RTWA 4ZGJB 1I5LA 2ZZDA 1K9MU 2O9VA 1G3YA 4RTZA 1TTHB 2DD4A 2BUDA 2PVOB 2PU9B 3H0FA 1UTIA 2HD0A 4J83A 5GANh 2K79A 1JXMA 1UB4A 4A54A 5LJ3g 4LDWA 2YHTA 2PTKA 3U23A 2KY9A 4M77C 3OS0A 2E1HA 4AMCA 5GAOn 2P4TA 3FRNA 4E7IA 1Z9QA 5CVIA 2HL5C 5GAOp 1RAAB 1YIJT 3G1JA 1M1KR 4HXJA 5DM7R 5IHNA 4CC3A 1G83A 2E6ZA 1GCPA 4CRIA 3EGUA 4II1A 4E7SA 2EKHA 1VQ5T 1VA7A 3GPLA 4A4GA 4CC4B 4R0KA 3QYGB 3D7SB 5GAMj 1MUZA 5FU6B 2YXYA 3BW1A 1QVGS 4J6YA 3ZBDA 1JU5C 3M0QA 1RAIB 4C8QA 3OW2A 3MP6A 3CCMA 2GCXA 1I0CA 4F17A 2QQ9A 4CI0C 4Y92A 1U8RA 4E6RA 1JEGA 2FB7A 2ZPFB 1Q86C 1SHGA 1E6GA 4C92D 2J6KA 2CDTA 1Q86R 2EWNA 1VQ8A 2LMJA 4PFPA 3JSCA 2QYZA 4XTVA 2JJ9A 3CD6Q 1HXDA 3LW5E 1VQMT 2E64A 5I22A 3CC2Q 1VQPA 4FW2A 2CSIA 2XICA 3H41A 1VQ7A 4PLLA 2BZYA 3UPUA 2BTTA 2EYZA 2LVMA 3CMAQ 3SWNC 1R8OB 2O88A 1K4US 3EGXB 3QJYA 3MEWA 1H3HA 1FMWA 3MEUA 1YJWQ 5KYUA 2R58A 1QVFS 1IHVA 1X69A 2JW4A 2E3IA 1W2BS 5CR2A 3HSBA 3CPFA 3FEOA 2COZA 2M0YA 1M90R 5C6SA 2NUTB 2VWFA 4DA4A 2QA4Q 2XU8A 5KYYA 1Q81U 5CQYA 5J26A 3ER0A 3CBPA 3CCEQ 3RERA 1R0CB 2RQTA 3CCRQ 4UC4A 2QQRA 5LL6S 3VJPA 2EBPA 4M75F 1G8XA 4PLIA 1NYFA 3H0HA 1JBMA 3J80E 2YSQA 1TUCA 3RESA 5LJ3e 1X43A 2BE9B 2FL7A 1KFZA 3JB9I 4P5NA 4BUGA 4EMKA 2CT3A 4M75G 4OMMA 5CKEA 2DKGA 3EFOB 1XJWB 4QQ6A 4CC2A 1I1JA 2QAZA 4PL6A 1UJ0A 4E7JA 2RHIA 4M7DA 2AKKA 2HAXA 4MDXA 1ZHIA 1NBEB 1BBZA 2GF7A 4J9GA
chains in the Genus database with same CATH topology
1VQ7T 1LNXA 3A5ZB 5I21A 2DTOA 2D0QB 2OAUA 2K3XA 2K3YA 5LJ5e 3AHUA 5GAMe 4XU3A 4Y28E 2CGHA 3C94A 2ZPIB 3LGFA 3KBGA 3RKWA 1VQOA 1KQ2A 1QP3A 2YRVA 4MMKA 1QVPA 4A4HA 1Y07A 2EIFA 5A0DA 3CCEA 4M77A 3CCRA 4M7AC 2BIVA 4EDUA 4YTLA 3A8GB 2RHYA 4PJOE 4F7UB 1K9MC 2E10A 3OYLA 4HT9A 2XG8D 1VQ6T 2D9TA 1P92A 3M58A 3G4SA 2F5KA 1KHCA 2EYQA 1OZ2A 1QW1A 3V7RA 3OMGA 2CYZB 4M78B 2DEQA 4M7DE 3LGLA 1W2BA 4E7HA 3JCMf 3FIFA 3H6ZA 2XD0A 1BYMA 4BI4A 3G6EA 5HK3A 2XKOC 2OTLT 2D6FA 1KG1A 1N6AA 1I4K1 2LX9A 4PKCC 3BY7A 5GAN2 5DLQE 1N9RA 2WSEE 3OYHA 3JB9H 4IKFA 5CQXA 3QHSA 1YJ9T 2G3RA 5GAN5 2K4YA 2O4XB 4BY6C 4OF1A 4C8QF 2RI2A 5GANd 2RJFA 3L2ZA 5LJ3h 1IZ6A 4IUVA 4XU2A 3QBYA 2ZGWA 5GAOl 2PUOB 3OS5A 3CD6T 2QTXA 4M77E 4NL2A 3HRSA 3OYCA 3CCJT 4KUDK 3CC2T 1KHIA 4C0ZA 1VQNA 1WJSA 4HA8A 3RKXA 1B34B 4J6WA 4M77G 1BI1A 1Y96A 4C8QG 1ZQ1A 2P0QA 2XDDA 4M75C 5GANj 2XDBA 3JCMV 1YIJA 1GXIE 3OYDA 4C92C 3NTIA 3CCUA 2HQEA 2KK4A 2WSFE 2X4JA 4KULA 5CKBA 4A4EA 3J81E 5A0GA 3CMET 5LJ5f 4O5VA 5GAMf 5GAN4 1XNIA 4PJOD 4QVZA 4M78C 3I56A 3QYHB 2M16A 4KBMB 3MCAB 1G3SA 2LQ8A 2E6NA 1YJWT 4RCCA 4OGEA 2X4YA 1M90C 1KQ1A 3PMTA 2QEXT 4M7DD 1U1TA 5GAMh 2Y4XA 4JS4A 2VYTA 5IN1A 1Y7XA 4J7FA 4MDWA 1S72A 3QG1A 2DTIA 4OP0A 3V7CA 4XTZA 2DPPB 1NPRA 2R5MA 5D6WA 1WQWA 1UGPB 2CZ1B 2MI6A 1BI0A 1YHQA 3CC7T 3PIOA 2YLBA 3SDZA 4RG2A 2K2VA 3QKJA 3RUXA 4IUQA 1VQOT 3VKIA 4F7UA 2HQXA 3SWNA 3SFMA 2L89A 4ZGEB 5HY6A 4HCBA 2DVEA 3LX7A 2LNVA 2VGMA 1O9SA 1FXXA 2RJEA 2E41A 1BKBA 4M7AB 2KAFA 4E47A 3P8DA 3BDUA 2JNGA 2MWOA 4M78A 3O8VA 3G4ST 4A53A 1VQ9T 2LT4A 2M9UA 2Y4YA 3PIPA 1BIBA 1MHNA 3JCMd 1OYXA 3CMAA 5GAOr 5CK9A 2ZPBB 4C0DC 4BACA 4N0AA 1JJ2S 3G6ET 3A8OB 2NLUA 2XHCA 4XTUA 4BE2A 1KQSS 2CS7A 3A8MB 3R6OA 3L2WA 2O4XA 4JRIA 1NJIU 3M9QA 2PVDB 1VQLA 2X4WA 1UGQB 2GQVA 3JCMg 4KT0E 2GFUA 2WSCE 2XDPA 4J5YA 3E9GA 2M1HA 4ME7A 1WJQA 1FX7A 4FU6A 3VUBA 3OA6A 3META 1OI1A 5AYFA 3OYAA 2RJCA 3V8JA 3HRTA 2MAMA 4BY6B 3PGGA 3FDRA 2RI3A 4C8QC 2KMTA 3E9FA 4F7UE 4JJNK 1M1GA 4JLIA 1B34A 4RG8A 4ELYC 2P0PA 1NZ9A 2LQKA 2RI5A 2V8KA 3CC4A 1VQNT 4X34A 3SD4A 1UGRB 4PJOF 4B9XA 4JRKA 4DOWA 5C0MA 2QA4A 3OYGA 4M78E 1O75A 5FROA 5GAOq 1KC8U 3OS2A 4JS5A 1UEBA 2L5QA 3V8KA 1Q81C 2XI9A 4FSXA 3OYFA 3CCUT 1YITA 1H3ZA 2V8IA 5DY9A 4M75B 2B8AA 2LC4A 3M54A 4JRQA 1Q82U 4M7DF 5LJ5d 1KD1U 4C92B 5GAMd 3JCMb 1VUBA 1WQ7A 3QPHA 4ELZC 4FL6A 2MMPA 5KCHA 3I56T 3NFCA 3JCMc 4BE1A 2IVWA 1JB0E 4WF2A 4PJOG 3UDCA 1PSEA 4L6V5 4IUUA 2JTMA 4TVRA 3WXMB 3C12A 2VV5A 2EJFA 4BB7A 3OYKA 3BFMA 5LJ5g 3JB9J 5GAMg 5GMKj 3JAME 5GAN7 4XTXA 2O01E 3JCMP 5LJ5j 4A4KA 3X26B 3JB9D 4M7DG 5LJ3f 3VYGA 1WGSA 3TEEA 1BI2A 3PMIA 3SB2A 3JRZA 1S72T 2QI2A 5GAN3 5CKDA 4EPCA 4QW2A 1VIFA 2AHJB 3L42A 3OYEA 4OVAA 4M77F 2VXEA 5KCOA 3GNGA 2DXBA 4PNOA 4Q5WA 5L8RE 1YHQT 3DLMA 3QIIA 4MZMA 4EMHA 3KXTA 5CAIA 2EKOA 3GNFB 4GLKA 4XQ3A 4J7IA 5J3BA 2QQSA 3UWNA 2ZPEB 3NTHA 1MGQA 3HKSA 5I2MA 3LWIA 4M7AA 2EAYA 5GMKm 1K73C 5FRNA 2F69A 2DXUA 5GANe 2FYKA 1YI2A 1YJNT 3QSUA 5IT9E 4E7LA 1LOJA 3M4GA 4M78D 3TU4K 2LTOA 3LH0A 1VIEA 2DD5A 4FM4B 4LDVA 4RKUE 4XTYA 4NL3A 2R5AA 2EQKA 2DAQA 1VQ4T 3CMAT 2M0OA 2EJ9A 1KC8C 5A0LA 2MF2A 3DB4A 5EG2A 3S3OA 1V29B 2GFAA 3HHTB 3OSSC 1I8FA 2E5QA 1KQSA 1VQ5A 5GAN8 4C0DB 3FC3A 2DTHA 4IURA 1Q82C 5FU6C 3CPWS 2L8DA 4MMLA 1WNLA 1Q7YU 1KD1C 3I55A 1VQLT 4LD9K 3S3NA 4FIBA 2JTFA 2KVQG 5FU7B 1WPYA 2EFIA 4RCBA 1M1KU 1PSFA 3TCJA 2DXTA 3N5BB 3QDRB 4J6XA 1VQKA 4HT8A 3OW2S 2CZ6B 1SSFA 4DQ2A 2YLCA 2FHDA 4C0FA 4GY5A 3GOXA 4M7AE 5D6YA 4V2SA 4C8QB 3CC4T 2RA2A 1X01A 3MEVA 2ZPGB 3F70A 2X4XA 1JRIA 3NTKA 2QA4T 2DJZA 3OQ5A 3CCLA 3M4YA 4KUIA 1IREB 4EMKC 2VGNA 4IUTA 4M75A 4XU0A 3OBYA 4J8OA 2L3RA 3C95A 3QXEB 1YBYA 4C92A 2E65A 3FJPA 3JCMX 1YITT 1I81A 3X28B 3CCET 3ME9A 3CCRT 3JCMQ 2JN0A 2A7YA 3S3MA 4OGCA 1N27A 4C5IA 2OTLA 3JCMW 1U1SA 5CO7A 5M9OA 2KQWA 4LDUA 3JB9F 2K57A 4XU1A 3INZA 3OYIA 2EQUA 4A4FA 2P0KA 3OB9A 4M7DC 5GAOm 1RI0A 3CXCA 4E7KA 2DK3A 1DJ7B 4X9DA 2LCCA 1HK9A 3TREA 3OYBA 1TH7A 3LWHA 1VQMA 4ZGJB 1I5LA 5GANf 2ZZDA 2QQBA 1K9MU 1Y71A 3OMCA 3P8HA 3S6WA 5LJ3d 4ZGDB 1X75C 2XK0A 1QP2A 3DB3A 1RL2A 1M1FA 4VUBA 1G3YA 4MZPA 3JB9G 2DD4A 2RB6A 5FU7C 2QDYB 4C0GA 2K5IA 2OTJA 2WACA 2BUDA 4F7UF 1Q86U 2PVOB 3P8BB 2PU9B 2E70A 2HD0A 2X35A 3LLRA 4J83A 3A8HB 2JOYA 5GANh 4A54A 1UB4A 5LJ3g 4LDWA 2YHTA 3CCSA 2RO0A 4BI3A 1G3WA 5LJ3j 4M75E 2KY9A 4M77C 5HK0A 3OYMA 4M78F 2K5FA 4C92E 3VV0A 3OS0A 2DIGA 2RHXA 5FLXE 4FT2A 3UT1A 2E1HA 5GAOn 2P4TA 2PUKB 2RHZA 3FRNA 2PVGB 4E7IA 4M7AD 4F7UG 2RM4A 3HP9A 3OY9A 5CVIA 4NOYA 4O6JA 5GAOp 4N4HA 5CKFA 1YIJT 4ZN3A 3CCQA 5CIUA 5DM7R 2QEXA 5CCAA 4BE0A 3HRUA 2CKKA 4QVDA 4M78G 2A3LA 4N4IA 2E6ZA 1X6OA 4CRIA 1M8VA 4II1A 4ZTJA 3CXCS 5KE2A 1VQ5T 3GPLA 2QQAA 1N9SA 4A4GA 2V8JA 4C5HA 3CPWA 1XTDA 2KSSA 2RJDA 3M53A 2ZCFB 3FB9A 3MP1A 3QYGB 4XAXB 4C5EA 5GMKe 3J7AF 2RK1A 3OBWA 5GAMj 5FU6B 3X20B 3BW1A 4QQGA 1QVGS 3EAEA 4J6YA 3ZBDA 4QVCA 2LDMA 3PFSA 3CCVA 3OS1A 1N8RU 1H641 1VQKT 1XQHA 3Q1JA 4C8QA 3OW2A 4Y91A 3MP6A 3CCMA 1M90U 2GCXA 1WJRA 2EQMA 2FVUA 4X9CA 3OYYA 3SWNB 4XTWA 4HCZA 2QQ9A 4CI0C 4R56A 3EFRA 4ZTFA 3VUZA 1U8RA 1QVFA 1NJIC 2QXFA 4L5GA 3CCLT 2FB7A 1VQ9A 1YCYA 2DZ9A 2ZPFB 3M56A 4M75D 1Q86C 1D3BB 4OMFB 5GAN6 4IUPA 3BDLA 4C92D 4EMKB 3GP8A 2EWNA 2MWPA 3CEYA 1XOVA 3GLXA 2LT1A 1VQ8A 4PJOB 1K8AU 3LYIA 3QUIA 4FT4A 3JSCA 1M5Q1 4XTVA 3WVEB 2I2LA 3RKYA 5KE3A 3URGA 3WVDB 2RD1A 3JCMh 1HXDA 3LW5E 1VQMT 1OZ3A 2E64A 4M7DB 3VYHB 2DIQA 3G71A 3PTAA 4JRPA 1VQPA 2K5LA 4ATOA 3HFOA 4BI8B 4LDXA 1EIFA 2PQWA 2XICA 3MHXA 1NPPA 2BKDN 4C8QE 4XK8E 1AHJB 1VQ7A 4C5GA 4PLLA 2OTJT 5GANg 3H8ZA 3UPUA 4M7AF 4JDSA 3QO3A 2LRQA 2LVMA 4BD3A 2VXFA 5CKHA 3CCST 3MEAA 3SWNC 5IAYA 4N4GA 3M59A 1R8OB 3E19A 2EQJA 3QJYA 2DZCA 3MEWA 3MEUA 3I55T 4OB3B 4M77B 4BDYA 1G3TA 2HNIA 2CZ0B 2R58A 3RIRA 1QVFS 1VQ6A 3ASKA 2EJGA 2XIDA 1N8RC 4M7AG 3DKMA 4JUVA 1W2BS 3CBMA 3ZEHA 5CR2A 3CCQT 3HSBA 5GMKh 1UGSB 4PJOC 1FWZA 2RHUA 2DO3A 3CPFA 3E1SA 4N0AC 3FEOA 5HKCA 5LJ5h 2C06A 3A8LB 3L2UA 3PT9A 4BDZA 3CBOA 5C6SA 3JCMJ 4OB0B 4JLGA 4DA4A 3GF5A 3OSVA 5D6XA 5GMKi 1YJ9A 3OYJA 2XU8A 3PNWC 1Q81U 5CQYA 3GIBA 4HCCA 5J26A 1M9SA 3RMSA 4Z02A 3ER0A 3CBPA 4D6WA 1K8AC 1JJ2A 3RERA 3RMQA 4UC4A 3X24B 3X25B 2QQRA 5LL6S 1LJOA 3QZ9B 3VJPA 3CD6A 2DXCA 3QZ5B 1W4SA 4MZTA 1QVGA 2VUBA 3CCJA 4M75F 4HKEA 3M57A 3CCVT 3L2VA 3EFSA 4M77D 3C4SA 4PLIA 4C92F 4C8QD 3CC2A 4QQDA 2R57A 2E12A 1JBMA 3J80E 3CCMT 3HL8A 3M55A 2RH2A 3L1AA 3M5AA 3JCMe 1BI3A 1YJNA 3RESA 3G7ZA 5LJ3e 2F5TX 1D3BA 1Y96B 2JVVA 2FL7A 3ZFJA 2HBPA 3JB9I 3DLLA 5DLOA 1Q7YC 4OB2B 4P5NA 4BUGA 4EMKA 1VQ4A 3CMEA 2Y90A 3HFNA 2KDSA 3HPWA 5CKEA 4M75G 4ZN1A 3L2QA 4PJOA 2DKGA 1BIAA 2H3JA 4C92G 4EMGA 1M1KC 4QQ6A 3FLGA 1ZBXA 2JZ2A 3V7SA 1YJWA 1YI2T 1VQ8T 1G5VA 4LD6A 3MO8A 2LCLA 1M4ZA 4R55A 1NE8A 3MP8A 4PL6A 3T9NA 4E7JA 2RHIA 4NS5A 4RMOA 4M7DA 2JUFA 5GMKl 5A2QE 4LDYA 3OYNA 2CZ7B 4B9WA 2IG0A 2HAXA 5KH6A 2VC8A 4MDXA 1ZHIA 4OB1B 4DOVA 3L2RA 5J39A 2RK2A 4L59A 3G71T 1VQPT 1K73U 2ZPHB 3QJ6A 5I2SA 3VU3C 3V8LA 3KUFA 2GF7A 5FRMA 3CC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLX A;  3E19 A;  1BI2 A;  2LX9 A;  2H3J A;  5CVI A;  1BI0 A;  4O6J A;  2QQB A;  1QVP A;  2K4Y A;  1G3T A;  4O5V A;  1G3Y A;  2GCX A;  3HRU A;  1G3S A;  2K5L A;  2QQ9 A;  2K5I A;  1U8R A;  1P92 A;  3MHX A;  1FX7 A;  1FWZ A;  3HRS A;  1QW1 A;  1BI3 A;  3HRT A;  1G3W A;  2QQA A;  2K5F A;  1BI1 A;  1BYM A; 
#chains in the Genus database with same CATH topology
 5I21 A;  1H92 A;  5I11 A;  2K3X A;  4XU3 A;  4FYW B;  3C94 A;  3RKW A;  2EGA A;  3LGF A;  1VQO A;  1KQ2 A;  1QP3 A;  4MMK A;  1QVP A;  1Y07 A;  1BB9 A;  3JV3 A;  2D0N A;  4YTL A;  3A8G B;  4PJO E;  1QMC A;  2FPE A;  3EG0 A;  4HT9 A;  2CH4 W;  3VS3 A;  4RTU A;  1KHC A;  2EYQ A;  3OMG A;  2CYZ B;  4M78 B;  3LGL A;  4E7H A;  2J06 A;  4DBQ A;  3H6Z A;  2X3X D;  2D6F A;  3HTR A;  1YHQ Q;  3NMZ C;  2WSE E;  2D8J A;  2DNU A;  5GAN 5;  4OF1 A;  4AFQ C;  1D09 B;  2EGC A;  2RI2 A;  5LJ3 h;  1IZ6 A;  2W10 A;  4IUV A;  3ZL7 C;  2GNC A;  2YDL A;  2OAW A;  2PUO B;  3OS5 A;  3EH2 A;  3CD6 T;  2NUP A;  3OYC A;  4KUD K;  3MPU B;  3CC2 T;  1QVF P;  1PD1 A;  4C0Z A;  1B34 B;  4J6W A;  1Y96 A;  1PD0 A;  1BK2 A;  4C92 C;  3NTI A;  4A63 B;  2KK4 A;  4KUL A;  5CKB A;  5GAN 4;  2OTJ Q;  3I56 A;  2LQ8 A;  1YJW T;  3PMT A;  2QEX T;  8AT1 B;  1OQK A;  2CP7 A;  3V7C A;  2EVR A;  1YP5 A;  2DPP B;  5D6W A;  1WQW A;  2CZ1 B;  2MI6 A;  2DRK A;  3QKJ A;  2LCS A;  2HMA A;  2GQI A;  2L89 A;  4ZGE B;  5HY6 A;  1QCF A;  4QT7 A;  4HCB A;  2VGM A;  1FXX A;  1X2Q A;  4JPB W;  2MK5 A;  2E41 A;  1MND A;  4M7A B;  2KAF A;  1IO6 A;  1TU0 B;  2KEA A;  1PNJ A;  2DET A;  1ZBJ A;  2ATC B;  2QK0 A;  1OYX A;  3CMA A;  4HCK A;  2ZPB B;  4BE2 A;  2XHC A;  1KQS S;  3A8M B;  1NJI U;  2VVK A;  2PVD B;  3M0R A;  1JJ2 P;  1PG5 B;  3JCM g;  3NPF A;  2GFU A;  4ME7 A;  1FX7 A;  3MET A;  1OI1 A;  2RQU A;  4BY6 B;  2DMO A;  1GL5 A;  3PGG A;  2DLP A;  2FRW A;  4OMO A;  4F7U E;  1M1G A;  4JLI A;  4RG8 A;  1YI2 Q;  2P0P A;  2CP5 A;  2V8K A;  1SPK A;  3SD4 A;  2QA4 A;  5C0M A;  1K0X A;  5GAO q;  1UEB A;  1H3Z A;  4FSX A;  2OJ2 A;  5DY9 A;  3EG2 A;  3JCM b;  1WFW A;  3QPH A;  5KYW A;  1UUE A;  5KCH A;  3NFC A;  2AKL A;  3EGD A;  4QKU A;  3NHN A;  4L6V 5;  4IUU A;  1NYG A;  3WXM B;  2BZX A;  5LJ5 g;  5GAM g;  5GMK j;  5GAN 7;  4K11 A;  2NWM A;  5LJ3 f;  3JRZ A;  4AT1 B;  4QW2 A;  1K76 A;  4M77 F;  3CCL Q;  3GNG A;  4PNO A;  4HVU A;  1YHQ T;  4EMH A;  3GNF B;  2OTL Q;  1GFC A;  3NTH A;  2DYB A;  3HKS A;  1K73 C;  1NEB A;  1OV3 A;  1WX6 A;  1ZA2 B;  1SEM A;  3H9N A;  4E7L A;  3M4G A;  4KGX B;  4M78 D;  3A98 A;  3EG3 A;  3TU4 K;  1WXU A;  1W70 A;  2LTO A;  4RKU E;  1VIE A;  1ZSZ B;  3REB B;  2QG9 B;  1M30 A;  3DB4 A;  1KIK A;  3HHT B;  2E5Q A;  1Q82 C;  5FU6 C;  3CPW S;  1ZLM A;  4FIB A;  5FU7 B;  2EFI A;  4OMQ A;  3CME Q;  1U06 A;  2I0N A;  1SSF A;  2C0O A;  2YLC A;  2FHD A;  1A0N B;  1QKX A;  1EX4 A;  3M4Y A;  4KUI A;  4M75 A;  4PJL A;  4J8O A;  1T0H A;  2L3R A;  2DIL A;  2KXD A;  2ROT A;  3JCM X;  1YIT T;  2COY A;  2HCK A;  2A7Y A;  2JN0 A;  4OGC A;  3TVT A;  3QDF A;  3JB9 F;  2EYW A;  3OB9 A;  2IPO B;  4A4F A;  4E7K A;  3PVQ A;  2GBQ A;  4X9D A;  3TRE A;  3OYB A;  2QQB A;  3OMC A;  3S6W A;  2XK0 A;  3JB9 G;  4C0G A;  2QDY B;  3G4S Q;  2OTJ A;  3LLR A;  3A8H B;  2LJ3 A;  3CCS A;  5HK0 A;  2DL7 A;  2AT1 B;  2K5F A;  3VV0 A;  2DIG A;  5FLX E;  1VQ8 Q;  2RMO A;  3UT1 A;  1Q7Y R;  2PVG B;  4M7A D;  2RM4 A;  3HP9 A;  5L23 A;  3OY9 A;  4O6J A;  4N4H A;  2FPD A;  1E7O A;  1AZG B;  1N5Z A;  4F16 A;  2DL3 A;  5CCA A;  4BE0 A;  1VQP Q;  3HRU A;  4QVD A;  1VQ7 Q;  5AT1 B;  1OOT A;  2DEU A;  5KE2 A;  4OMP A;  2QQA A;  4KH0 B;  2KSS A;  4XAX B;  3MP1 A;  1ABQ A;  3I55 T;  3J7A F;  1NEG A;  1B3Q A;  2RK1 A;  3OBW A;  3PE0 A;  1VOM A;  4QVC A;  2LDM A;  3PFS A;  3OS1 A;  4Y91 A;  3AT1 B;  4R56 A;  3EFR A;  4ZTF A;  1D0X A;  2GTO A;  1QVF A;  1K9M R;  4L5G A;  1VQ9 A;  3CCL T;  2B86 A;  4OMF B;  5GAN 6;  4IUP A;  3BDL A;  3CEY A;  4OML A;  4PJO B;  1K8A U;  3LYI A;  3CPW P;  4FT4 A;  3WVE B;  3RKY A;  5KE3 A;  3URG A;  4J9H A;  3JCM h;  1AWX A;  3VYH B;  2DIQ A;  2KXC A;  4ATO A;  4LDX A;  3MHX A;  1NPP A;  1RI9 A;  1OU8 A;  4C8Q E;  1AHJ B;  1D1C A;  1M8M A;  4C5G A;  3H8Z A;  4JDS A;  1Q95 G;  1RUW A;  3QO3 A;  4BD3 A;  5CKH A;  3MEA A;  3E19 A;  2AIR B;  4RTX A;  2CP6 A;  4BDY A;  1WHL A;  2CZ0 B;  2HNI A;  5KYX B;  4EIK A;  1M2V B;  3ASK A;  4WTO B;  2XID A;  5D7U A;  4RTV A;  4JUV A;  3ZEH A;  1FWZ A;  2DO3 A;  5LJ5 h;  5HKC A;  4BDZ A;  3CBO A;  4Z88 A;  4ESR A;  2QGF B;  1U3O A;  1LPL A;  1YJ9 A;  3OYJ A;  3PNW C;  4HCC A;  1VQO Q;  1M9S A;  3UF4 A;  4D6W A;  1JJ2 A;  1WDX A;  3X24 B;  1PRM C;  1LJO A;  2K3B A;  4MZT A;  2VUB A;  3M57 A;  4C92 F;  3CCM T;  2E12 A;  2RH2 A;  3L1A A;  3M5A A;  1YJN A;  3G7Z A;  3EG9 B;  1D3B A;  1WXT A;  5DLO A;  2PZ1 A;  3CME A;  2Y90 A;  3HFN A;  1VQ4 A;  2H3J A;  4C92 G;  4EMG A;  1M1K C;  2MPX C;  1IXD A;  3MJX A;  1VQ8 T;  1Y57 A;  2LCL A;  1NE8 A;  3T9N A;  4RMO A;  1AOJ A;  2JUF A;  4B6M A;  6AT1 B;  1W1F A;  3L2R A;  5J39 A;  2RK2 A;  1VQP T;  1V76 A;  2IIM A;  2ZPH B;  2DL5 A;  1RLQ C;  3CC7 A;  1TUD A;  1VQ7 T;  3A5Z B;  2OAU A;  3RBB B;  3AHU A;  2ABL A;  2QGG A;  3I35 A;  2RPN A;  2KBT A;  2YRV A;  5A0D A;  4A4H A;  2EIF A;  3I56 Q;  2J7I A;  4M77 A;  4M7A C;  1WHH A;  4F7U B;  1Q81 R;  3VS6 A;  1P92 A;  3G4S A;  4PJJ A;  3V7R A;  1QW1 A;  2DYI A;  2O9S A;  4M7D E;  1VQK Q;  3JCM f;  1SG5 A;  2XKO C;  2YUN A;  1I4K 1;  3BY7 A;  5DLQ E;  4IKF A;  2G3R A;  2JMA A;  2O4X B;  4BY6 C;  2G6F X;  5GAN d;  1SKU B;  2RJF A;  2VKN A;  9ATC B;  3QBY A;  1MMN A;  2L3S A;  4NL2 A;  3QWY A;  2HQH A;  3KFV A;  1KHI A;  1VQN A;  4HA8 A;  1ZQ1 A;  2XDD A;  5GAN j;  3JCM V;  1YIJ A;  3CCU A;  2HQE A;  2P84 A;  2LQW A;  5A0G A;  5LJ5 f;  4O5V A;  5GAM f;  1XNI A;  4PJO D;  2CSQ A;  3QYH B;  4KBM B;  1D1B A;  1RAC B;  1KC8 R;  4OGE A;  1X2K A;  1M90 C;  1KQ1 A;  2VYT A;  2KRN A;  1S72 A;  3QG1 A;  4Z89 A;  4ANJ A;  2R5M A;  1UGP B;  2QDL A;  1BI0 A;  1B07 A;  4IUQ A;  1VQO T;  3VKI A;  2HQX A;  3SWN A;  2LJ0 A;  2DVE A;  1O9S A;  1ZSZ C;  4J9C A;  1OPK A;  3BDU A;  2MWO A;  1RAF B;  2LT4 A;  2M9U A;  3M0U A;  2Y4Y A;  4FYX B;  1MHN A;  1T3S A;  3CCV Q;  2K9G A;  3VS4 A;  4BAC A;  4XTU A;  1RAE B;  3R6O A;  4JRI A;  3M9Q A;  2X4W A;  2GQV A;  1VYU A;  2WSC E;  1BU1 A;  4J5Y A;  3VUB A;  1WJQ A;  1YN8 A;  1LVK A;  1QVG P;  3V8J A;  3FDR A;  1TS9 A;  2KMT A;  4D8D A;  3E9F A;  2KE9 A;  1NZ9 A;  1GRI A;  2DE0 X;  1UGR B;  1QCO A;  1O75 A;  1WHM A;  1KC8 U;  3A1P A;  1V1C A;  2XI9 A;  1WHK A;  3VS5 A;  3OYF A;  2V8I A;  2B8A A;  1UJY A;  2E3H A;  1VUB A;  1WQ7 A;  4ELZ C;  2MMP A;  3I56 T;  3JCM c;  1JB0 E;  5FWC A;  4BB7 A;  2LZ6 B;  3JAM E;  2O01 E;  2Z0W A;  3JCM P;  3X26 B;  3VYG A;  3TEE A;  1BI2 A;  2CT4 A;  1PM3 A;  2FRY A;  5GAN 3;  4EPC A;  1AD5 A;  3OYE A;  4DBF A;  5KCO A;  2DXB A;  3QII A;  3KXT A;  4KH1 B;  2SEM A;  1IHW A;  4XQ3 A;  5J3B A;  3UWN A;  2ZPE B;  2MYS A;  1NJI R;  3LWI A;  2W0Z A;  1AWJ A;  3QSU A;  1W2B P;  1NLO C;  1LOJ A;  2KRS A;  4LDV A;  2ENM A;  4NL3 A;  2R5A A;  3CMA T;  3S3O A;  1V29 B;  4GBQ A;  5GAN 8;  3FC3 A;  4MML A;  1WNL A;  3CCS Q;  4FYV B;  3S3N A;  2JTF A;  1ZA1 B;  4RCB A;  1PSF A;  1H8K A;  1VQK A;  3OW2 S;  2YT6 A;  2CZ6 B;  4DQ2 A;  2D8H A;  4C8Q B;  1X01 A;  1TWB A;  3MEV A;  2A08 A;  1JRI A;  1KK7 A;  2QA4 T;  2HDA A;  1I07 A;  2JXB A;  4IUT A;  1YCS B;  3OBY A;  4C92 A;  3FJP A;  1BCM A;  3CCE T;  3ME9 A;  3CCR T;  3JCM Q;  1IGU A;  3SEM A;  3JCM W;  5CO7 A;  4XU1 A;  3TSW A;  1OEB A;  5GAO m;  3R6N A;  3LWH A;  1ZUY A;  1PCX A;  2DVJ A;  5LJ3 d;  1QP2 A;  1W6X A;  1M1F A;  1NLP C;  2J05 A;  3PVL A;  2KR3 A;  2RB6 A;  3P8B B;  1VQ9 Q;  2X35 A;  4LN2 A;  1HJD A;  1RAG B;  5LJ3 j;  4M75 E;  3QWX X;  4M78 F;  4FT2 A;  2F2W A;  4IIO A;  2EPD A;  1EFN A;  5KYU B;  4NOY A;  1UGV A;  2RQW A;  2X51 A;  4GLM A;  4ZN3 A;  3CCQ A;  5CIU A;  2MIO A;  2QEX A;  2CKK A;  4M78 G;  2A3L A;  1X6O A;  2DRM A;  1E6H A;  1OX8 A;  2JTE A;  3CXC S;  4ZNX A;  1N9S A;  3I5R A;  2V8J A;  1XTD A;  2RJD A;  2ZCF B;  3FB9 A;  4C5E A;  5KYY B;  3NGP A;  4QQG A;  3CCV A;  1N8R U;  1RAB B;  1XQH A;  2CUD A;  2L2P A;  1GCQ C;  5EC7 A;  3ULR B;  1WJR A;  2FVU A;  3SWN B;  1GFD A;  3OYY A;  3UA6 A;  2JM8 A;  3VUZ A;  1PWT A;  2FZK B;  2VB6 A;  2EQI A;  5FW9 A;  1WYX A;  2DZ9 A;  4F14 A;  4EMK B;  5IHK A;  3E2U A;  1YJ9 Q;  2DER A;  3GLX A;  3RNJ A;  2EYY A;  1M5Q 1;  2V1R A;  2I2L A;  2RD1 A;  2K7A A;  4M7D B;  3VRZ A;  4JRP A;  3G71 A;  2HEQ A;  2K5L A;  2ZAE A;  3HFO A;  2PQW A;  1UDL A;  1YJN Q;  4XK8 E;  2OTJ T;  5GAN g;  1S1N A;  2C0T A;  4M7A F;  1IB8 A;  2V26 A;  2LRQ A;  1VQ4 Q;  3CCS T;  5IAY A;  4N4G A;  3M59 A;  1UG1 A;  1UE9 A;  3UA7 A;  2EQJ A;  2LQN A;  5IH2 A;  5HCK A;  1ABO A;  3RIR A;  1VQ6 A;  1M3C A;  2EJG A;  2X3W D;  4M7A G;  2HKN A;  3BE3 A;  2HBW A;  3O5Z A;  2RHU A;  3M0T A;  4N0A C;  3A8L B;  3PT9 A;  1KQS P;  3I5S A;  4OB0 B;  3CC7 Q;  3CC4 Q;  3OSV A;  1AZE A;  2JS0 A;  2KYB A;  3GIB A;  2K6D A;  2EYX A;  3RMS A;  4KRT A;  3FJ5 A;  1K8A C;  4OMN A;  3X25 B;  3QZ9 B;  2DXC A;  3QZ5 B;  1QVG A;  1K8A R;  3CCJ A;  4HKE A;  3L2V A;  4M77 D;  4C8Q D;  2NUP B;  4QQD A;  2HSE B;  1D0Y A;  3M55 A;  4JJD A;  3JCM e;  1Y96 B;  1ZUU A;  1VYT A;  3DLL A;  1Q7Y C;  4OB2 B;  1G2B A;  2SRC A;  1BIA A;  3RR6 A;  3CXC P;  2JMC A;  3FLG A;  1ZBX A;  3EG1 A;  1YI2 T;  1G5V A;  1M4Z A;  1M27 C;  5A2Q E;  2KT8 A;  4LDY A;  1VYV A;  2IG0 A;  4WCI A;  5KH6 A;  4OB1 B;  4DOV A;  1K73 U;  4L59 A;  1VQN Q;  3VS2 A;  4DEX A;  3VU3 C;  2ESW A;  3KUF A;  1YIJ Q;  5FRM A;  4LUE A;  3CCU Q;  2D0Q B;  5LJ5 e;  5GAM e;  1CSK A;  2CGH A;  3EGX A;  2YRD A;  1X6B A;  1NG2 A;  2YUP A;  2RHY A;  1K9M C;  2E10 A;  2XG8 D;  1WZO A;  2D9T A;  3M58 A;  2XMF A;  1OZ2 A;  3UAT A;  2DA9 A;  1W2B A;  2O2O A;  1HYO A;  1S72 Q;  4RTT A;  2NUT A;  3FIF A;  2XD0 A;  1BYM A;  4BI4 A;  2HL3 A;  3G6E A;  1ARK A;  5HK3 A;  2OTL T;  1KG1 A;  1D1A A;  1T3L A;  2LX9 A;  4PKC C;  1N9R A;  2KRM A;  3JB9 H;  5CQX A;  3QHS A;  1YJ9 T;  2K4Y A;  4AFU C;  4XU2 A;  4FYY B;  5GAO l;  2RF0 A;  2QTX A;  4M77 E;  4PK4 A;  3HRS A;  1TXQ A;  3RKX A;  1BI1 A;  1K1Z A;  2P0Q A;  1WHG A;  1R0B G;  4J9I A;  2JS2 A;  2X4J A;  4A4E A;  3J81 E;  3CME T;  4JJC A;  4M78 C;  2M16 A;  5KYW B;  1MMA A;  4RTY A;  2F2V A;  3EGD B;  1AWW A;  4KGV B;  4M7D D;  5ECA A;  1U1T A;  5GAM h;  2Y4X A;  1UHC A;  4JS4 A;  1AWO A;  1MV0 B;  2ED0 A;  4XTZ A;  2FZG B;  2CRE A;  1NPR A;  2GTJ A;  3IQL A;  3CC7 T;  4PFZ A;  3SDZ A;  2K2V A;  4LUD A;  3RUX A;  2DL4 A;  4JZ3 A;  1YWP A;  3SFM A;  3LX7 A;  1GBR A;  1BKB A;  4E47 A;  3P8D A;  4M78 A;  3G4S T;  2DF6 A;  4A53 A;  2L3P A;  3PIP A;  1BCO A;  3JCM d;  5GAO r;  1M3B A;  5CK9 A;  2QAS A;  3A8O B;  2DX1 A;  5KYN A;  2CS7 A;  3TSZ A;  1YNZ A;  3THK A;  2COW A;  1VQL A;  1UGQ B;  1SHF A;  2L3Q A;  2XDP A;  2P4R A;  2X9H A;  2J6O A;  4FU6 A;  2MAM A;  4C8Q C;  2RI3 A;  2H3E B;  4JJN K;  1TSF A;  1B34 A;  4ELY C;  2RI5 A;  1UHF A;  3CC4 A;  1VQN T;  4X34 A;  4PJO F;  4B9X A;  4DOW A;  2E5K A;  3OYG A;  2FG0 A;  5FRO A;  2ECZ A;  2MOX A;  3OS2 A;  1PC0 A;  1Q81 C;  3CCU T;  3VS0 A;  4M75 B;  1EZZ B;  2LC4 A;  3M54 A;  5LJ5 d;  1KD1 U;  1TUG B;  2FZC B;  5GAM d;  2A28 A;  1WI7 A;  4BE1 A;  2PNI A;  3C0C A;  2IVW A;  4WF2 A;  4PJO G;  1PSE A;  4TVR A;  2JTM A;  2HZY A;  3C12 A;  2EJF A;  3OYK A;  5LJ5 j;  4A4K A;  1JQQ A;  4AFZ C;  4DBR A;  1S72 T;  2A36 A;  1VIF A;  2AHJ B;  4OVA A;  4PJN A;  2VXE A;  2DJQ A;  4Q5W A;  1X6G A;  2EKO A;  2EW3 A;  4JZ4 A;  2NYS A;  2QQS A;  1MGQ A;  2RQR A;  5I2M A;  4M7A A;  1PRL C;  2EGE A;  5GMK m;  2F69 A;  2FYK A;  5IT9 E;  1M3A A;  2DD5 A;  2EQK A;  1AEY A;  1KC8 C;  2MF2 A;  3OSS C;  2GGR A;  1KQS A;  1VQ5 A;  1M2O A;  4C0D B;  2DTH A;  1OPL A;  4LNP A;  3REA B;  4DBH A;  1Z9Z A;  1M1K U;  2DXT A;  3N5B B;  3H0I A;  3QDR B;  4J6X A;  4AFS C;  4C0F A;  4GY5 A;  1UFF A;  4V2S A;  5D6Y A;  1JO8 A;  3CCQ Q;  2QEX Q;  3F70 A;  2LP5 A;  4J9B A;  3NTK A;  3OQ5 A;  1X27 A;  1IRE B;  4EMK C;  2VGN A;  4XU0 A;  3C95 A;  3QXE B;  1YWO A;  2E65 A;  2LX7 A;  1I81 A;  1PKS A;  1ZSG A;  2P0K A;  4M7D C;  3CXC A;  2DK3 A;  4HVW A;  1HK9 A;  1VQM A;  5GAN f;  1Y71 A;  3P8H A;  2F1L A;  4ZGD B;  1X75 C;  3DB3 A;  1RL2 A;  4VUB A;  1TOV A;  4MZP A;  5FU7 C;  2K5I A;  3MKD A;  2WAC A;  4F7U F;  1Q86 U;  2J6F A;  2E70 A;  2JOY A;  2RO0 A;  4BI3 A;  1G3W A;  3OYM A;  4C92 E;  2RHX A;  1AVZ C;  8ATC B;  2PUK B;  2RHZ A;  4F7U G;  2O31 A;  5CKF A;  1AT1 B;  1ZSZ A;  2KYM A;  1R77 A;  3G71 Q;  1SRL A;  2JM9 A;  4N4I A;  1M8V A;  4ZTJ A;  4AG2 C;  1WA7 A;  1ZX6 A;  4C5H A;  3CPW A;  3M53 A;  2VAS A;  1JJ2 S;  5GMK e;  1J3T A;  4KGZ B;  3X20 B;  3EAE A;  3SHW A;  1VQK T;  1H64 1;  1VQ6 Q;  3Q1J A;  1WLP B;  1M90 U;  2EQM A;  2V1Q A;  1UEC A;  4X9C A;  4XTW A;  4HCZ A;  1NJI C;  2MCN A;  1QLY A;  2QXF A;  1D0Z A;  1YCY A;  3M56 A;  4E2F B;  4M75 D;  2DBK A;  1D3B B;  2L0A A;  4RUG A;  3GP8 A;  2AZV A;  2MWP A;  2OX7 A;  1YFN A;  4DEY A;  1XOV A;  2LT1 A;  3QUI A;  3TQ7 P;  2NUZ A;  3WVD B;  1OZ3 A;  3CCJ Q;  3PTA A;  1MV3 A;  4BI8 B;  1EIF A;  2BKD N;  1HSQ A;  2VXF A;  2M02 A;  1KSW A;  2AZS A;  1JXO A;  2DZC A;  4OB3 B;  4M77 B;  1G3T A;  1N8R C;  2AK5 A;  5GJW B;  3DKM A;  3CBM A;  3CCQ T;  1RAD B;  5GMK h;  1UGS B;  1N8R R;  4PJO C;  3E1S A;  2C06 A;  3L2U A;  3EHQ A;  2RQV A;  3JCM J;  4JLG A;  3GF5 A;  5D6X A;  5GMK i;  1F1B B;  4Z02 A;  1YIT Q;  1OU9 A;  3RMQ A;  1LCK A;  3CD6 A;  1W4S A;  3CCV T;  1KJW A;  2YWW A;  2YUO A;  3EFS A;  3CC2 A;  3C4S A;  2R57 A;  2E4H A;  3HL8 A;  1BI3 A;  5IXF A;  1C6V X;  2F5T X;  2JVV A;  4PFO A;  3ZFJ A;  1FYN A;  2HBP A;  3G6E Q;  4ZN1 A;  3HPW A;  2KDS A;  3L2Q A;  4J9E A;  2RNA A;  4PJO A;  1YJW A;  2JZ2 A;  3V7S A;  4LD6 A;  3MO8 A;  4R55 A;  3MP8 A;  4NS5 A;  5GMK l;  3OYN A;  2CZ7 B;  4J9F A;  4B9W A;  1K0S A;  2VC8 A;  3G71 T;  2DM1 A;  4J9D A;  3QJ6 A;  5I2S A;  2DL8 A;  3I9Q A;  3V8L A;  2KGT A;  4IIM A;  1LNX A;  1K9A A;  2DTO A;  1QWF A;  2K3Y A;  4Y28 E;  1WHJ A;  2ZPI B;  3KBG A;  2KI7 A;  3CCE A;  3CCR A;  2BIV A;  5KYX A;  4EDU A;  1M2V A;  2KRO A;  2A0F B;  3OYL A;  3VS7 A;  1VQ6 T;  3I55 Q;  1B7T A;  2F5K A;  2DEQ A;  2FEI A;  2CP0 A;  4AG1 C;  1N6A A;  5GAN 2;  1OUL A;  3OYH A;  4C8Q F;  1C0M A;  1GBQ A;  3L2Z A;  3OW2 P;  2ZGW A;  2C0I A;  1TG0 A;  3CCJ T;  1WJS A;  1GCQ A;  4M77 G;  3EG9 A;  4C8Q G;  2XDB A;  3VRY A;  4M75 C;  1GXI E;  3OYD A;  1K73 R;  2OI3 A;  2WSF E;  1VQL Q;  1QKW A;  4QVZ A;  2FPF A;  3MCA B;  1G3S A;  2E6N A;  2CH4 A;  4JJB A;  4RCC A;  2X4Y A;  3EH1 A;  1C1A A;  3M0S A;  1Q82 R;  5IN1 A;  1Y7X A;  4J7F A;  1IRX A;  4MDW A;  5IXB A;  2DTI A;  4OP0 A;  1YHQ A;  3PIO A;  2YLB A;  4RG2 A;  2JT4 A;  4F7U A;  1QCN A;  1MNE A;  3EHR A;  2LNV A;  1HD3 A;  2RJE A;  4ORZ A;  4PJM A;  2JNG A;  1SSH A;  4FW1 A;  3O8V A;  1VQ9 T;  2BZ8 A;  1BIB A;  1ZUK A;  2D1X A;  4C0D C;  4N0A A;  3G6E T;  2BE7 D;  2NLU A;  3CCM Q;  3M0P A;  3L2W A;  2O4X A;  4KT0 E;  2ED1 A;  3E9G A;  2M1H A;  3OA6 A;  2YRC A;  2DBM A;  2KNB B;  5AYF A;  3OYA A;  2RJC A;  3HRT A;  4D8K A;  2F2X A;  3RDV A;  2LQK A;  1SF9 A;  1FMK A;  4LXC A;  4JRK A;  4Z8A A;  4M78 E;  3VS1 A;  4JS5 A;  2L5Q A;  3V8K A;  1CKB A;  1QQJ A;  2ROL A;  1YIT A;  4JRQ A;  1Q82 U;  4M7D F;  4C92 B;  1VQ5 Q;  3GBQ A;  4FL6 A;  2A37 A;  2DFU A;  3UDC A;  2M51 A;  2VV5 A;  1MMG A;  3BFM A;  3JB9 J;  4XTX A;  1FMV A;  3JB9 D;  4M7D G;  1WGS A;  3SB2 A;  3PMI A;  1T0J A;  2QI2 A;  5CKD A;  1ACM B;  5FWB A;  1WXB A;  3L42 A;  4HVV A;  5L8R E;  3DLM A;  4MZM A;  3CQT A;  5CAI A;  4GLK A;  1OX9 A;  1CKA A;  4J7I A;  1NM7 A;  2YUQ A;  4M4Z A;  2EAY A;  5FRN A;  2DXU A;  5GAN e;  2LNH B;  1YI2 A;  1YJN T;  1VQM Q;  3LH0 A;  1U5S A;  4FM4 B;  2HSP A;  4XTY A;  1MMD A;  3EFO A;  1Y0M A;  2DAQ A;  1VQ4 T;  2M0O A;  2EJ9 A;  4F04 B;  5A0L A;  2QTV A;  5EG2 A;  2GFA A;  4E7Z A;  1I8F A;  1SRM A;  4FSS A;  4LE9 A;  4IUR A;  1KD1 C;  1VQL T;  1Q7Y U;  2L8D A;  4LD9 K;  3I55 A;  1WIE A;  5IHI A;  2H8H A;  2KT1 A;  2KVQ G;  1KD1 R;  1WPY A;  5GJV B;  3TCJ A;  1QWE A;  4HT8 A;  4CC7 A;  3GOX A;  4M7A E;  3CC4 T;  2RA2 A;  2ZPG B;  2X4X A;  4FCY A;  2DJZ A;  3CCL A;  4X1V A;  2K2M A;  2FO0 A;  1IGQ A;  1YBY A;  3X28 B;  1PHT A;  1PKT A;  2CUB A;  3S3M A;  1N27 A;  4C5I A;  2OTL A;  1RAH B;  2CP2 A;  1U1S A;  7AT1 B;  2CP3 A;  2KQW A;  4LDU A;  5M9O A;  2K57 A;  3OYI A;  3INZ A;  2EQU A;  1I5O B;  2HKQ B;  2RN8 A;  1RLP C;  1RI0 A;  1DJ7 B;  3LH5 A;  2LCC A;  2LJ1 A;  1TH7 A;  4RTW A;  4ZGJ B;  1I5L A;  2ZZD A;  1K9M U;  2O9V A;  1G3Y A;  4RTZ A;  1TTH B;  2DD4 A;  2BUD A;  2PVO B;  2PU9 B;  3H0F A;  1UTI A;  2HD0 A;  4J83 A;  5GAN h;  2K79 A;  1JXM A;  1UB4 A;  4A54 A;  5LJ3 g;  4LDW A;  2YHT A;  2PTK A;  3U23 A;  2KY9 A;  4M77 C;  3OS0 A;  2E1H A;  4AMC A;  5GAO n;  2P4T A;  3FRN A;  4E7I A;  1Z9Q A;  5CVI A;  2HL5 C;  5GAO p;  1RAA B;  1YIJ T;  3G1J A;  1M1K R;  4HXJ A;  5DM7 R;  5IHN A;  4CC3 A;  1G83 A;  2E6Z A;  1GCP A;  4CRI A;  3EGU A;  4II1 A;  4E7S A;  2EKH A;  1VQ5 T;  1VA7 A;  3GPL A;  4A4G A;  4CC4 B;  4R0K A;  3QYG B;  3D7S B;  5GAM j;  1MUZ A;  5FU6 B;  2YXY A;  3BW1 A;  1QVG S;  4J6Y A;  3ZBD A;  1JU5 C;  3M0Q A;  1RAI B;  4C8Q A;  3OW2 A;  3MP6 A;  3CCM A;  2GCX A;  1I0C A;  4F17 A;  2QQ9 A;  4CI0 C;  4Y92 A;  1U8R A;  4E6R A;  1JEG A;  2FB7 A;  2ZPF B;  1Q86 C;  1SHG A;  1E6G A;  4C92 D;  2J6K A;  2CDT A;  1Q86 R;  2EWN A;  1VQ8 A;  2LMJ A;  4PFP A;  3JSC A;  2QYZ A;  4XTV A;  2JJ9 A;  3CD6 Q;  1HXD A;  3LW5 E;  1VQM T;  2E64 A;  5I22 A;  3CC2 Q;  1VQP A;  4FW2 A;  2CSI A;  2XIC A;  3H41 A;  1VQ7 A;  4PLL A;  2BZY A;  3UPU A;  2BTT A;  2EYZ A;  2LVM A;  3CMA Q;  3SWN C;  1R8O B;  2O88 A;  1K4U S;  3EGX B;  3QJY A;  3MEW A;  1H3H A;  1FMW A;  3MEU A;  1YJW Q;  5KYU A;  2R58 A;  1QVF S;  1IHV A;  1X69 A;  2JW4 A;  2E3I A;  1W2B S;  5CR2 A;  3HSB A;  3CPF A;  3FEO A;  2COZ A;  2M0Y A;  1M90 R;  5C6S A;  2NUT B;  2VWF A;  4DA4 A;  2QA4 Q;  2XU8 A;  5KYY A;  1Q81 U;  5CQY A;  5J26 A;  3ER0 A;  3CBP A;  3CCE Q;  3RER A;  1R0C B;  2RQT A;  3CCR Q;  4UC4 A;  2QQR A;  5LL6 S;  3VJP A;  2EBP A;  4M75 F;  1G8X A;  4PLI A;  1NYF A;  3H0H A;  1JBM A;  3J80 E;  2YSQ A;  1TUC A;  3RES A;  5LJ3 e;  1X43 A;  2BE9 B;  2FL7 A;  1KFZ A;  3JB9 I;  4P5N A;  4BUG A;  4EMK A;  2CT3 A;  4M75 G;  4OMM A;  5CKE A;  2DKG A;  3EFO B;  1XJW B;  4QQ6 A;  4CC2 A;  1I1J A;  2QAZ A;  4PL6 A;  1UJ0 A;  4E7J A;  2RHI A;  4M7D A;  2AKK A;  2HAX A;  4MDX A;  1ZHI A;  1NBE B;  1BBZ A;  2GF7 A;  4J9G A; 
#chains in the Genus database with same CATH homology
 1VQ7 T;  1LNX A;  3A5Z B;  5I21 A;  2DTO A;  2D0Q B;  2OAU A;  2K3X A;  2K3Y A;  5LJ5 e;  3AHU A;  5GAM e;  4XU3 A;  4Y28 E;  2CGH A;  3C94 A;  2ZPI B;  3LGF A;  3KBG A;  3RKW A;  1VQO A;  1KQ2 A;  1QP3 A;  2YRV A;  4MMK A;  1QVP A;  4A4H A;  1Y07 A;  2EIF A;  5A0D A;  3CCE A;  4M77 A;  3CCR A;  4M7A C;  2BIV A;  4EDU A;  4YTL A;  3A8G B;  2RHY A;  4PJO E;  4F7U B;  1K9M C;  2E10 A;  3OYL A;  4HT9 A;  2XG8 D;  1VQ6 T;  2D9T A;  1P92 A;  3M58 A;  3G4S A;  2F5K A;  1KHC A;  2EYQ A;  1OZ2 A;  1QW1 A;  3V7R A;  3OMG A;  2CYZ B;  4M78 B;  2DEQ A;  4M7D E;  3LGL A;  1W2B A;  4E7H A;  3JCM f;  3FIF A;  3H6Z A;  2XD0 A;  1BYM A;  4BI4 A;  3G6E A;  5HK3 A;  2XKO C;  2OTL T;  2D6F A;  1KG1 A;  1N6A A;  1I4K 1;  2LX9 A;  4PKC C;  3BY7 A;  5GAN 2;  5DLQ E;  1N9R A;  2WSE E;  3OYH A;  3JB9 H;  4IKF A;  5CQX A;  3QHS A;  1YJ9 T;  2G3R A;  5GAN 5;  2K4Y A;  2O4X B;  4BY6 C;  4OF1 A;  4C8Q F;  2RI2 A;  5GAN d;  2RJF A;  3L2Z A;  5LJ3 h;  1IZ6 A;  4IUV A;  4XU2 A;  3QBY A;  2ZGW A;  5GAO l;  2PUO B;  3OS5 A;  3CD6 T;  2QTX A;  4M77 E;  4NL2 A;  3HRS A;  3OYC A;  3CCJ T;  4KUD K;  3CC2 T;  1KHI A;  4C0Z A;  1VQN A;  1WJS A;  4HA8 A;  3RKX A;  1B34 B;  4J6W A;  4M77 G;  1BI1 A;  1Y96 A;  4C8Q G;  1ZQ1 A;  2P0Q A;  2XDD A;  4M75 C;  5GAN j;  2XDB A;  3JCM V;  1YIJ A;  1GXI E;  3OYD A;  4C92 C;  3NTI A;  3CCU A;  2HQE A;  2KK4 A;  2WSF E;  2X4J A;  4KUL A;  5CKB A;  4A4E A;  3J81 E;  5A0G A;  3CME T;  5LJ5 f;  4O5V A;  5GAM f;  5GAN 4;  1XNI A;  4PJO D;  4QVZ A;  4M78 C;  3I56 A;  3QYH B;  2M16 A;  4KBM B;  3MCA B;  1G3S A;  2LQ8 A;  2E6N A;  1YJW T;  4RCC A;  4OGE A;  2X4Y A;  1M90 C;  1KQ1 A;  3PMT A;  2QEX T;  4M7D D;  1U1T A;  5GAM h;  2Y4X A;  4JS4 A;  2VYT A;  5IN1 A;  1Y7X A;  4J7F A;  4MDW A;  1S72 A;  3QG1 A;  2DTI A;  4OP0 A;  3V7C A;  4XTZ A;  2DPP B;  1NPR A;  2R5M A;  5D6W A;  1WQW A;  1UGP B;  2CZ1 B;  2MI6 A;  1BI0 A;  1YHQ A;  3CC7 T;  3PIO A;  2YLB A;  3SDZ A;  4RG2 A;  2K2V A;  3QKJ A;  3RUX A;  4IUQ A;  1VQO T;  3VKI A;  4F7U A;  2HQX A;  3SWN A;  3SFM A;  2L89 A;  4ZGE B;  5HY6 A;  4HCB A;  2DVE A;  3LX7 A;  2LNV A;  2VGM A;  1O9S A;  1FXX A;  2RJE A;  2E41 A;  1BKB A;  4M7A B;  2KAF A;  4E47 A;  3P8D A;  3BDU A;  2JNG A;  2MWO A;  4M78 A;  3O8V A;  3G4S T;  4A53 A;  1VQ9 T;  2LT4 A;  2M9U A;  2Y4Y A;  3PIP A;  1BIB A;  1MHN A;  3JCM d;  1OYX A;  3CMA A;  5GAO r;  5CK9 A;  2ZPB B;  4C0D C;  4BAC A;  4N0A A;  1JJ2 S;  3G6E T;  3A8O B;  2NLU A;  2XHC A;  4XTU A;  4BE2 A;  1KQS S;  2CS7 A;  3A8M B;  3R6O A;  3L2W A;  2O4X A;  4JRI A;  1NJI U;  3M9Q A;  2PVD B;  1VQL A;  2X4W A;  1UGQ B;  2GQV A;  3JCM g;  4KT0 E;  2GFU A;  2WSC E;  2XDP A;  4J5Y A;  3E9G A;  2M1H A;  4ME7 A;  1WJQ A;  1FX7 A;  4FU6 A;  3VUB A;  3OA6 A;  3MET A;  1OI1 A;  5AYF A;  3OYA A;  2RJC A;  3V8J A;  3HRT A;  2MAM A;  4BY6 B;  3PGG A;  3FDR A;  2RI3 A;  4C8Q C;  2KMT A;  3E9F A;  4F7U E;  4JJN K;  1M1G A;  4JLI A;  1B34 A;  4RG8 A;  4ELY C;  2P0P A;  1NZ9 A;  2LQK A;  2RI5 A;  2V8K A;  3CC4 A;  1VQN T;  4X34 A;  3SD4 A;  1UGR B;  4PJO F;  4B9X A;  4JRK A;  4DOW A;  5C0M A;  2QA4 A;  3OYG A;  4M78 E;  1O75 A;  5FRO A;  5GAO q;  1KC8 U;  3OS2 A;  4JS5 A;  1UEB A;  2L5Q A;  3V8K A;  1Q81 C;  2XI9 A;  4FSX A;  3OYF A;  3CCU T;  1YIT A;  1H3Z A;  2V8I A;  5DY9 A;  4M75 B;  2B8A A;  2LC4 A;  3M54 A;  4JRQ A;  1Q82 U;  4M7D F;  5LJ5 d;  1KD1 U;  4C92 B;  5GAM d;  3JCM b;  1VUB A;  1WQ7 A;  3QPH A;  4ELZ C;  4FL6 A;  2MMP A;  5KCH A;  3I56 T;  3NFC A;  3JCM c;  4BE1 A;  2IVW A;  1JB0 E;  4WF2 A;  4PJO G;  3UDC A;  1PSE A;  4L6V 5;  4IUU A;  2JTM A;  4TVR A;  3WXM B;  3C12 A;  2VV5 A;  2EJF A;  4BB7 A;  3OYK A;  3BFM A;  5LJ5 g;  3JB9 J;  5GAM g;  5GMK j;  3JAM E;  5GAN 7;  4XTX A;  2O01 E;  3JCM P;  5LJ5 j;  4A4K A;  3X26 B;  3JB9 D;  4M7D G;  5LJ3 f;  3VYG A;  1WGS A;  3TEE A;  1BI2 A;  3PMI A;  3SB2 A;  3JRZ A;  1S72 T;  2QI2 A;  5GAN 3;  5CKD A;  4EPC A;  4QW2 A;  1VIF A;  2AHJ B;  3L42 A;  3OYE A;  4OVA A;  4M77 F;  2VXE A;  5KCO A;  3GNG A;  2DXB A;  4PNO A;  4Q5W A;  5L8R E;  1YHQ T;  3DLM A;  3QII A;  4MZM A;  4EMH A;  3KXT A;  5CAI A;  2EKO A;  3GNF B;  4GLK A;  4XQ3 A;  4J7I A;  5J3B A;  2QQS A;  3UWN A;  2ZPE B;  3NTH A;  1MGQ A;  3HKS A;  5I2M A;  3LWI A;  4M7A A;  2EAY A;  5GMK m;  1K73 C;  5FRN A;  2F69 A;  2DXU A;  5GAN e;  2FYK A;  1YI2 A;  1YJN T;  3QSU A;  5IT9 E;  4E7L A;  1LOJ A;  3M4G A;  4M78 D;  3TU4 K;  2LTO A;  3LH0 A;  1VIE A;  2DD5 A;  4FM4 B;  4LDV A;  4RKU E;  4XTY A;  4NL3 A;  2R5A A;  2EQK A;  2DAQ A;  1VQ4 T;  3CMA T;  2M0O A;  2EJ9 A;  1KC8 C;  5A0L A;  2MF2 A;  3DB4 A;  5EG2 A;  3S3O A;  1V29 B;  2GFA A;  3HHT B;  3OSS C;  1I8F A;  2E5Q A;  1KQS A;  1VQ5 A;  5GAN 8;  4C0D B;  3FC3 A;  2DTH A;  4IUR A;  1Q82 C;  5FU6 C;  3CPW S;  2L8D A;  4MML A;  1WNL A;  1Q7Y U;  1KD1 C;  3I55 A;  1VQL T;  4LD9 K;  3S3N A;  4FIB A;  2JTF A;  2KVQ G;  5FU7 B;  1WPY A;  2EFI A;  4RCB A;  1M1K U;  1PSF A;  3TCJ A;  2DXT A;  3N5B B;  3QDR B;  4J6X A;  1VQK A;  4HT8 A;  3OW2 S;  2CZ6 B;  1SSF A;  4DQ2 A;  2YLC A;  2FHD A;  4C0F A;  4GY5 A;  3GOX A;  4M7A E;  5D6Y A;  4V2S A;  4C8Q B;  3CC4 T;  2RA2 A;  1X01 A;  3MEV A;  2ZPG B;  3F70 A;  2X4X A;  1JRI A;  3NTK A;  2QA4 T;  2DJZ A;  3OQ5 A;  3CCL A;  3M4Y A;  4KUI A;  1IRE B;  4EMK C;  2VGN A;  4IUT A;  4M75 A;  4XU0 A;  3OBY A;  4J8O A;  2L3R A;  3C95 A;  3QXE B;  1YBY A;  4C92 A;  2E65 A;  3FJP A;  3JCM X;  1YIT T;  1I81 A;  3X28 B;  3CCE T;  3ME9 A;  3CCR T;  3JCM Q;  2JN0 A;  2A7Y A;  3S3M A;  4OGC A;  1N27 A;  4C5I A;  2OTL A;  3JCM W;  1U1S A;  5CO7 A;  5M9O A;  2KQW A;  4LDU A;  3JB9 F;  2K57 A;  4XU1 A;  3INZ A;  3OYI A;  2EQU A;  4A4F A;  2P0K A;  3OB9 A;  4M7D C;  5GAO m;  1RI0 A;  3CXC A;  4E7K A;  2DK3 A;  1DJ7 B;  4X9D A;  2LCC A;  1HK9 A;  3TRE A;  3OYB A;  1TH7 A;  3LWH A;  1VQM A;  4ZGJ B;  1I5L A;  5GAN f;  2ZZD A;  2QQB A;  1K9M U;  1Y71 A;  3OMC A;  3P8H A;  3S6W A;  5LJ3 d;  4ZGD B;  1X75 C;  2XK0 A;  1QP2 A;  3DB3 A;  1RL2 A;  1M1F A;  4VUB A;  1G3Y A;  4MZP A;  3JB9 G;  2DD4 A;  2RB6 A;  5FU7 C;  2QDY B;  4C0G A;  2K5I A;  2OTJ A;  2WAC A;  2BUD A;  4F7U F;  1Q86 U;  2PVO B;  3P8B B;  2PU9 B;  2E70 A;  2HD0 A;  2X35 A;  3LLR A;  4J83 A;  3A8H B;  2JOY A;  5GAN h;  4A54 A;  1UB4 A;  5LJ3 g;  4LDW A;  2YHT A;  3CCS A;  2RO0 A;  4BI3 A;  1G3W A;  5LJ3 j;  4M75 E;  2KY9 A;  4M77 C;  5HK0 A;  3OYM A;  4M78 F;  2K5F A;  4C92 E;  3VV0 A;  3OS0 A;  2DIG A;  2RHX A;  5FLX E;  4FT2 A;  3UT1 A;  2E1H A;  5GAO n;  2P4T A;  2PUK B;  2RHZ A;  3FRN A;  2PVG B;  4E7I A;  4M7A D;  4F7U G;  2RM4 A;  3HP9 A;  3OY9 A;  5CVI A;  4NOY A;  4O6J A;  5GAO p;  4N4H A;  5CKF A;  1YIJ T;  4ZN3 A;  3CCQ A;  5CIU A;  5DM7 R;  2QEX A;  5CCA A;  4BE0 A;  3HRU A;  2CKK A;  4QVD A;  4M78 G;  2A3L A;  4N4I A;  2E6Z A;  1X6O A;  4CRI A;  1M8V A;  4II1 A;  4ZTJ A;  3CXC S;  5KE2 A;  1VQ5 T;  3GPL A;  2QQA A;  1N9S A;  4A4G A;  2V8J A;  4C5H A;  3CPW A;  1XTD A;  2KSS A;  2RJD A;  3M53 A;  2ZCF B;  3FB9 A;  3MP1 A;  3QYG B;  4XAX B;  4C5E A;  5GMK e;  3J7A F;  2RK1 A;  3OBW A;  5GAM j;  5FU6 B;  3X20 B;  3BW1 A;  4QQG A;  1QVG S;  3EAE A;  4J6Y A;  3ZBD A;  4QVC A;  2LDM A;  3PFS A;  3CCV A;  3OS1 A;  1N8R U;  1H64 1;  1VQK T;  1XQH A;  3Q1J A;  4C8Q A;  3OW2 A;  4Y91 A;  3MP6 A;  3CCM A;  1M90 U;  2GCX A;  1WJR A;  2EQM A;  2FVU A;  4X9C A;  3OYY A;  3SWN B;  4XTW A;  4HCZ A;  2QQ9 A;  4CI0 C;  4R56 A;  3EFR A;  4ZTF A;  3VUZ A;  1U8R A;  1QVF A;  1NJI C;  2QXF A;  4L5G A;  3CCL T;  2FB7 A;  1VQ9 A;  1YCY A;  2DZ9 A;  2ZPF B;  3M56 A;  4M75 D;  1Q86 C;  1D3B B;  4OMF B;  5GAN 6;  4IUP A;  3BDL A;  4C92 D;  4EMK B;  3GP8 A;  2EWN A;  2MWP A;  3CEY A;  1XOV A;  3GLX A;  2LT1 A;  1VQ8 A;  4PJO B;  1K8A U;  3LYI A;  3QUI A;  4FT4 A;  3JSC A;  1M5Q 1;  4XTV A;  3WVE B;  2I2L A;  3RKY A;  5KE3 A;  3URG A;  3WVD B;  2RD1 A;  3JCM h;  1HXD A;  3LW5 E;  1VQM T;  1OZ3 A;  2E64 A;  4M7D B;  3VYH B;  2DIQ A;  3G71 A;  3PTA A;  4JRP A;  1VQP A;  2K5L A;  4ATO A;  3HFO A;  4BI8 B;  4LDX A;  1EIF A;  2PQW A;  2XIC A;  3MHX A;  1NPP A;  2BKD N;  4C8Q E;  4XK8 E;  1AHJ B;  1VQ7 A;  4C5G A;  4PLL A;  2OTJ T;  5GAN g;  3H8Z A;  3UPU A;  4M7A F;  4JDS A;  3QO3 A;  2LRQ A;  2LVM A;  4BD3 A;  2VXF A;  5CKH A;  3CCS T;  3MEA A;  3SWN C;  5IAY A;  4N4G A;  3M59 A;  1R8O B;  3E19 A;  2EQJ A;  3QJY A;  2DZC A;  3MEW A;  3MEU A;  3I55 T;  4OB3 B;  4M77 B;  4BDY A;  1G3T A;  2HNI A;  2CZ0 B;  2R58 A;  3RIR A;  1QVF S;  1VQ6 A;  3ASK A;  2EJG A;  2XID A;  1N8R C;  4M7A G;  3DKM A;  4JUV A;  1W2B S;  3CBM A;  3ZEH A;  5CR2 A;  3CCQ T;  3HSB A;  5GMK h;  1UGS B;  4PJO C;  1FWZ A;  2RHU A;  2DO3 A;  3CPF A;  3E1S A;  4N0A C;  3FEO A;  5HKC A;  5LJ5 h;  2C06 A;  3A8L B;  3L2U A;  3PT9 A;  4BDZ A;  3CBO A;  5C6S A;  3JCM J;  4OB0 B;  4JLG A;  4DA4 A;  3GF5 A;  3OSV A;  5D6X A;  5GMK i;  1YJ9 A;  3OYJ A;  2XU8 A;  3PNW C;  1Q81 U;  5CQY A;  3GIB A;  4HCC A;  5J26 A;  1M9S A;  3RMS A;  4Z02 A;  3ER0 A;  3CBP A;  4D6W A;  1K8A C;  1JJ2 A;  3RER A;  3RMQ A;  4UC4 A;  3X24 B;  3X25 B;  2QQR A;  5LL6 S;  1LJO A;  3QZ9 B;  3VJP A;  3CD6 A;  2DXC A;  3QZ5 B;  1W4S A;  4MZT A;  1QVG A;  2VUB A;  3CCJ A;  4M75 F;  4HKE A;  3M57 A;  3CCV T;  3L2V A;  3EFS A;  4M77 D;  3C4S A;  4PLI A;  4C92 F;  4C8Q D;  3CC2 A;  4QQD A;  2R57 A;  2E12 A;  1JBM A;  3J80 E;  3CCM T;  3HL8 A;  3M55 A;  2RH2 A;  3L1A A;  3M5A A;  3JCM e;  1BI3 A;  1YJN A;  3RES A;  3G7Z A;  5LJ3 e;  2F5T X;  1D3B A;  1Y96 B;  2JVV A;  2FL7 A;  3ZFJ A;  2HBP A;  3JB9 I;  3DLL A;  5DLO A;  1Q7Y C;  4OB2 B;  4P5N A;  4BUG A;  4EMK A;  1VQ4 A;  3CME A;  2Y90 A;  3HFN A;  2KDS A;  3HPW A;  5CKE A;  4M75 G;  4ZN1 A;  3L2Q A;  4PJO A;  2DKG A;  1BIA A;  2H3J A;  4C92 G;  4EMG A;  1M1K C;  4QQ6 A;  3FLG A;  1ZBX A;  2JZ2 A;  3V7S A;  1YJW A;  1YI2 T;  1VQ8 T;  1G5V A;  4LD6 A;  3MO8 A;  2LCL A;  1M4Z A;  4R55 A;  1NE8 A;  3MP8 A;  4PL6 A;  3T9N A;  4E7J A;  2RHI A;  4NS5 A;  4RMO A;  4M7D A;  2JUF A;  5GMK l;  5A2Q E;  4LDY A;  3OYN A;  2CZ7 B;  4B9W A;  2IG0 A;  2HAX A;  5KH6 A;  2VC8 A;  4MDX A;  1ZHI A;  4OB1 B;  4DOV A;  3L2R A;  5J39 A;  2RK2 A;  4L59 A;  3G71 T;  1VQP T;  1K73 U;  2ZPH B;  3QJ6 A;  5I2S A;  3VU3 C;  3V8L A;  3KUF A;  2GF7 A;  5FRM A;  3CC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...