2GCXA

Solution structure of ferrous iron transport protein a (feoa) of klebsiella pneumoniae
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
75
structure length
75
Chain Sequence
b'MQFTPDSAWKITGFSRDISPAYRQKLLSLGMLPGSSFHVVRVAPLGDPVHIETRRVSLVLRKKDLALIELEAVAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein A
publication title Solution Structure of Ferrous Iron Transport Protein A (FeoA) of Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae
molecule tags Transport protein
total genus 8
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gcxA01
4O5VA 1G3YA 2QQAA 5CVIA 3HRSA 1FX7A 3GLXA 2QQBA 1BI3A 2GCXA 1BI2A 1QVPA 1G3TA 1BI1A 3E19A 3HRTA 2K5IA 1G3WA 2LX9A 1G3SA 1BI0A 1BYMA 1P92A 1QW1A 2K4YA 2K5FA 3HRUA 1FWZA 3MHXA 4O6JA 2K5LA 2QQ9A 2H3JA 1U8RA
chains in the Genus database with same CATH superfamily
2QQAA 3FDRA 2KT8A 4R55A 2CREA 1B34B 2JVVA 1LJOA 5FU7B 2DRKA 1K9MU 1NG2A 3CPWS 1ZSZB 2CP5A 2RNAA 4C92A 4A63B 1WFWA 1S72Q 4FM4B 1K73R 2KNBB 1ZUKA 1WHMA 2DLPA 3M58A 4K11A 1SKUB 2D1XA 3QKJA 2BUDA 4IURA 1UG1A 4E7IA 4FT4A 2G6FX 3CCRT 1RAIB 2DK3A 4XQ3A 4XU0A 4KH0B 1AHJB 3MPUB 3QBYA 4XTVA 1OPKA 4LN2A 3L2UA 2L3SA 3OBWA 2QQ9A 4MMKA 3JCMg 1VQKT 1PM3A 2DM1A 1N5ZA 5I21A 4ORZA 3OBYA 2D6FA 3E9GA 3KXTA 3I55T 1M27C 1EFNA 4FIBA 2YUNA 5CAIA 2LQNA 3T9NA 3M57A 5J26A 1KC8R 2LCCA 2EVRA 5FRNA 1K8AC 3MEUA 2O4XB 4A4HA 1TXQA 5CK9A 1UGQB 3I56Q 3QZ9B 1BIAA 1R8OB 1PRMC 4QT7A 4OMNA 4MZPA 5M9OA 4P5NA 4RTUA 4A4KA 1V76A 2HAXA 2P84A 1Y57A 1VQOQ 1IRXA 3HRTA 1M3BA 2C0TA 5KYNA 1RAAB 3M4YA 1BK2A 1ZLMA 1D3BA 5FU7C 2YSQA 3NTHA 2HCKA 5D6XA 2HSEB 1WA7A 1ZQ1A 2FZGB 4BB7A 2X4YA 3CC2A 1H3HA 2GNCA 1WIEA 5I22A 1YJWQ 1QVGP 4M7DD 2XHCA 5IHIA 4F7UF 1RUWA 5C6SA 2LVMA 1YCSB 4ZTFA 1ZA2B 1NJIC 3CCUQ 1V1CA 2DXCA 5A2QE 5D7UA 1OZ2A 3CMAQ 4PJOC 4M78D 2DYIA 3VUZA 4AFUC 1VQ9Q 1YCYA 2KQWA 2C0OA 1JQQA 2P0KA 2RHXA 1ZBXA 3CCET 2ZPIB 3M56A 3CCVT 2XDPA 1LOJA 4FYWB 2FB7A 1OV3A 1VA7A 1TS9A 2QQSA 4JJDA 4J6WA 2VV5A 4QQDA 1NEGA 1O9SA 2DEQA 1HSQA 5GAN6 3BDLA 3HKSA 5CVIA 1Y0MA 3G71Q 2E3HA 3SEMA 2MWPA 3CCJQ 2KT1A 3G6ET 3TEEA 3UATA 2G3RA 2E1HA 3OS2A 1RADB 1YHQT 2JS2A 3RMQA 1PSFA 2K3XA 4PJOE 2RHUA 2OTJA 1R0CB 4HCBA 5I2SA 1M90C 3JCMd 2L8DA 4GBQA 2K7AA 4E47A 5KE2A 2GCXA 1VQPA 2CUDA 2DXUA 1WHHA 1Q86R 4C5HA 1HXDA 1KQSP 3QDRB 2QI2A 5A0GA 2COZA 2BE7D 2CGHA 3VYGA 2MMPA 2KRNA 3QSUA 3TSWA 1N8RR 1WHLA 1QMCA 1QVFP 2RO0A 2NUTB 2O9SA 2RI3A 1KG1A 1X6BA 3OA6A 2K3BA 1SHFA 1VQ7Q 3ZEHA 4OGEA 3MP6A 2OJ2A 1Y96B 2ESWA 3H6ZA 1BCMA 2RMOA 4RTYA 2D0QB 2PUKB 1UGSB 3F70A 1D1AA 2QDLA 3X26B 1LNXA 4JRKA 5IXFA 1CSKA 4RTVA 1SPKA 1UEBA 1QP2A 3ZL7C 4D8KA 1CKBA 4UC4A 2EBPA 2YWWA 4DEYA 4BDZA 3G4ST 4E7JA 3CCSA 2BTTA 4M7DB 4F7UA 1UDLA 1YITA 4PJOG 1VQ4T 3EFOB 3JCMf 4QVCA 3CMET 3UWNA 3JCMJ 2OAWA 1QWEA 3RKXA 2KROA 2MYSA 4V2SA 2M0YA 3FEOA 4GLKA 3EG1A 1PRLC 4Z02A 4KH1B 4M78B 2RN8A 1NJIU 1UGPB 1MGQA 4A54A 1W2BA 2QAZA 1YI2Q 1B34A 4A4FA 3EFSA 2DX1A 1UJYA 1G8XA 4RG2A 3RNJA 2ECZA 1S1NA 1ZSZA 1JJ2S 2F5KA 2RHIA 3L2WA 4BE1A 3CCLT 3CBOA 4FYYB 2IVWA 1D09B 2X4WA 3CC4A 3KFVA 5HY6A 4E7SA 1X27A 2C06A 3OS1A 2GTJA 3MO8A 3CD6T 2L5QA 2ZPHB 2RJEA 4EIKA 4XU1A 2PTKA 4FCYA 1WX6A 4RMOA 4JRIA 1X75C 3LGLA 1OX9A 3M0QA 4HVWA 2K3YA 2JOYA 1YJNQ 2FZKB 2AK5A 2RK1A 4DBHA 3OYHA 5GMKj 3CCQA 2GGRA 2ZPBB 4NL2A 2YLBA 3HFOA 3LX7A 3JCMe 2NUZA 3P8BB 1VQ6Q 1NE8A 4JLIA 1M1FA 2DBKA 1BIBA 4KGZB 2K57A 1KD1C 4M7DC 1JJ2A 1M4ZA 2FVUA 1C1AA 1N8RU 4PFOA 2XIDA 1M8MA 2ABLA 3VS3A 4DBFA 2B8AA 2I0NA 2O4XA 3DLLA 1W70A 1Y07A 4LD6A 3P8HA 1TUDA 1XQHA 3HP9A 2IG0A 3PIPA 1I8FA 1M9SA 3TSZA 1YJ9Q 3EHQA 3PVQA 1RLQC 2PU9B 2YLCA 3CCMQ 3RKYA 2JT4A 4OB1B 1G83A 1XOVA 4EMKB 4JS4A 2YXYA 4PJJA 3ME9A 2X4JA 5CR2A 4PJLA 2RM4A 1ABOA 5LJ3d 4N4IA 2XK0A 2SEMA 2AKKA 2P0QA 2Y4XA 4RTTA 3EFRA 4J9CA 2RPNA 5HK3A 1VUBA 4OB0B 3A8OB 2A36A 5C0MA 4LD9K 2LQ8A 1RAGB 1S72A 4M7DF 2FRWA 1HJDA 2JN0A 3CC7T 4FYVB 2GF7A 2J05A 2KMTA 2VGNA 3PVLA 1BBZA 4BUGA 3R6NA 3JCMX 1VQMQ 1NPPA 2CH4W 3QZ5B 4JS5A 1WHGA 1E6HA 4IIOA 1QP3A 3GIBA 4M78F 2QA4T 1DJ7B 1VQ5T 2HNIA 4OMPA 2NYSA 4X34A 2ED0A 2QASA 4FSSA 1T3SA 5GMKl 4PJOD 5LJ3f 2DILA 2EGAA 3QXEB 1VQ8A 2E4HA 2RI2A 1G2BA 3L1AA 5GAN8 3OW2P 1BKBA 4JJCA 5J3BA 3NMZC 1RL2A 4E6RA 3I35A 3JB9J 1WGSA 1HYOA 3VYHB 4J7FA 4KULA 1PKTA 5GAN5 1Z9QA 4JLGA 5GMKe 4XTYA 1AOJA 2EKOA 4HVVA 1I1JA 1YWPA 1K0XA 2F69A 1M5Q1 3I56A 4LDXA 2JMAA 3Q1JA 2M51A 3KBGA 3CCRQ 3OMGA 2E5KA 3JB9G 5GANg 4EMKC 4JJNK 1JXMA 1G3YA 4FYXB 2RHZA 4WF2A 1VQOA 1VQKQ 5DLQE 3GF5A 2OAUA 2LRQA 1MNDA 2MI6A 2EAYA 3AHUA 4ZGEB 4M4ZA 4X9CA 1G3SA 2LT1A 3NFCA 2GQIA 5D6WA 4LE9A 2FPFA 2EYZA 3REAB 2E65A 1OU9A 2MPXC 3JCMQ 5KYYB 4LDWA 3GNFB 2BIVA 5GAN3 2NUTA 3TVTA 1YJWA 3HRSA 4CC7A 4L6V5 1QLYA 1Y96A 1IGQA 1G3WA 2JMCA 4QVDA 1AWJA 3CCUA 3PMTA 5DLOA 4RCCA 2FHDA 2DMOA 1AZGB 1OEBA 3BE3A 4BD3A 3CMAA 5LJ3e 4RKUE 3CBPA 1K0SA 2KRMA 3FRNA 4J9DA 2J7IA 2A0FB 1VQ9A 4M7DA 3R6OA 1RI9A 2LQWA 3EFOA 4HA8A 4LDYA 2YDLA 3VRZA 3HRUA 1VQLT 4M77C 4J9GA 4ME7A 4IUVA 3H9NA 2AKLA 2A08A 1K1ZA 1KQ1A 2DD4A 4LDUA 4M78A 3CQTA 4FW1A 2DF6A 1BI1A 4KBMB 2DFUA 1WZOA 4Y92A 2E64A 3PIOA 3G71A 3CCJA 2Y90A 2VASA 5AYFA 4PJOB 2HL5C 1MMDA 3EGXB 1GBRA 2FPDA 4MDXA 3SWNA 2CP3A 1RACB 5I11A 3H0IA 1UUEA 3H0HA 2JM9A 3FJ5A 1VQ8Q 4ELYC 4MZTA 2CZ7B 2JXBA 1KHCA 3PNWC 3CCEQ 3U23A 2AZVA 2DVEA 3CCVQ 1PWTA 3OYIA 5GAOr 9ATCB 1SRLA 3CPWA 2FRYA 4EMGA 1Q95G 2WACA 3KUFA 1I81A 4M77E 1WQWA 1X01A 2QGGA 1TWBA 3URGA 5FWCA 4ANJA 2VC8A 3RUXA 5FWBA 1VQ7A 4J9IA 3G6EQ 3J7AF 1K8AR 1FXXA 3OYNA 2CP0A 3MEVA 4LUDA 1YHQQ 5GANd 1QKWA 4KUDK 3QPHA 3TREA 1WJSA 1WYXA 1TSFA 1QVPA 2PUOB 4KRTA 4LNPA 2HBPA 2DNUA 4J9EA 2LT4A 4VUBA 2RJCA 1BYMA 5GANj 2WSFE 1X43A 1KFZA 2F1LA 2K5LA 1MHNA 4M75C 1NLOC 1JBMA 1ZBJA 2LMJA 4II1A 3ULRB 3JB9D 2V8KA 3G7ZA 2B86A 3JRZA 2CT3A 1OU8A 4EMKA 2KGTA 2QXFA 2KXCA 4M77G 4DA4A 3WXMB 2ZAEA 2L3PA 3A8GB 4OMOA 1BI0A 2CZ0B 3MEWA 4ATOA 2QEXT 1Q7YC 5D6YA 1YI2A 1GFDA 2CKKA 1RAHB 1NJIR 1QVGS 1Z9ZA 2P4TA 1PD0A 4AG1C 4JZ4A 5CIUA 3GOXA 4PL6A 5GANf 1UFFA 3G4SQ 3VKIA 4NOYA 5GAN2 4OGCA 1GCPA 1AWOA 1YIJT 3CMEQ 3PT9A 4Z89A 4PKCC 2LC4A 1GBQA 3DKMA 2K2MA 4XTUA 4KT0E 1Y7XA 2VUBA 3JCMc 2YUQA 1JO8A 3DB4A 4M75E 2DTOA 5KCOA 2K9GA 4AFQC 1N27A 3LWIA 4C8QC 5KYWB 1NYFA 2O2OA 4J8OA 1YJNA 3LWHA 1ZHIA 3CBMA 4IKFA 1WLPB 4PJOF 4EPCA 4JPBW 2IIMA 1T0JA 4ZTJA 2J06A 5CKHA 1VQ6A 3CCLQ 1JRIA 3UT1A 3S3MA 1AWWA 1H3ZA 3OS0A 1VQNT 3EH1A 3V7RA 4HXJA 1YBYA 1UE9A 4BI4A 1JXOA 2EFIA 1M90R 1PNJA 2KR3A 1AZEA 1A0NB 2KVQG 2A3LA 3CD6Q 2DE0X 3HTRA 1K8AU 1U8RA 1YJ9A 4O5VA 4E7KA 1VOMA 1PSEA 1WXTA 3RMSA 1XTDA 3CCMA 4MDWA 1U5SA 3LGFA 4QQGA 3PE0A 2CUBA 3BY7A 2AIRB 5LJ3g 4M75G 1AWXA 2DL4A 4J9HA 1KQSS 4C8QF 4C8QE 5GANe 1BCOA 2ZGWA 1WNLA 2OTLT 4O6JA 5GAN4 1QVFS 3QHSA 2CZ1B 1YFNA 3META 1SEMA 5KYYA 5L23A 2IPOB 1UTIA 3M54A 4N4HA 2VVKA 2BZYA 3CXCP 5CO7A 3SDZA 3V8LA 3M0PA 1YP5A 4PLIA 3VS6A 3OYLA 4RTWA 3VS4A 2EQMA 2F2XA 5GJWB 1MMAA 1VQMA 1U3OA 1SHGA 1NPRA 2X35A 5HKCA 3V7CA 3H0FA 1ZUYA 2DA9A 4NL3A 4ESRA 2X51A 3CXCS 4LDVA 3MEAA 2AHJB 1CKAA 1PD1A 2MAMA 5AT1B 1YN8A 2HBWA 2V8IA 3EG0A 1X2KA 4L59A 2JJ9A 1D0YA 3OYGA 2H3JA 4A4EA 2CSIA 4C8QG 1QVFA 3UDCA 2ZZDA 6AT1B 3EH2A 2PQWA 2D8JA 1QQJA 2I2LA 2HQHA 5J39A 2NUPB 3WVEB 5HCKA 1LPLA 2EQKA 4OMMA 3CC7Q 4F14A 3VS0A 2EYQA 3E9FA 4RCBA 4M77D 1WPYA 3OYCA 1UECA 5EG2A 3OMCA 3CCRA 5GAMd 4PJOA 1OPLA 3EGXA 4PNOA 2QA4Q 2ENMA 4IUTA 3JCMh 1VQ5Q 3LYIA 1IREB 2KEAA 1M2VB 1VQKA 1U1SA 3V8JA 2AT1B 5GAMj 3LLRA 2A37A 4FT2A 1K4US 1B3QA 4N0AC 1M90U 3I55A 2M1HA 3OYAA 4Y28E 2V8JA 2RQWA 1FYNA 2EJ9A 2W10A 2L3RA 4LUEA 2E6NA 4J5YA 1KD1R 1X2QA 1TG0A 1NEBA 3RIRA 2E3IA 2C0IA 2XU8A 4L5GA 1R0BG 2SRCA 3GNGA 1GCQC 3I9QA 2ZPGB 2YRVA 1D0XA 3CC2T 1MUZA 3OYDA 2QGFB 5GAOl 2KRSA 2COWA 4C92C 3QO3A 5GAMf 1E6GA 2JW4A 1WHKA 2CS7A 4X9DA 1IXDA 3JB9H 1WQ7A 2HQXA 2BKDN 2NLUA 3M4GA 4OMQA 3TCJA 4CI0C 2DAQA 2XMFA 3FJPA 2KE9A 2DL7A 1Q81C 3C95A 1LVKA 1FMVA 4HVUA 2J6KA 1B7TA 4BDYA 1OX8A 5LJ3j 5LJ5d 1QKXA 1N9RA 5KYUB 3X24B 3M0RA 1IO6A 3DB3A 2KI7A 3JAME 3JB9F 1ZA1B 2MCNA 2O31A 3L42A 2L3QA 4M75D 3A1PA 2PVOB 2FO0A 2YRDA 1AD5A 2YRCA 2DD5A 2DXBA 5KE3A 3RBBB 4R0KA 4PJNA 1NBEB 3VU3C 4JRPA 3RKWA 3M0SA 1OQKA 4C92E 3E19A 3PGGA 3TQ7P 3QDFA 2FL7A 2LNVA 5A0DA 1FMWA 4XTWA 5GMKm 2DIGA 5IH2A 3L2ZA 1NYGA 3CCEA 3QIIA 3CCVA 3JCMV 3VJPA 5GMKh 4BE0A 3OS5A 1VQLQ 2DL8A 2NWMA 4M77B 1FX7A 3EHRA 4XTXA 2D0NA 2DERA 2DTHA 2DEUA 1VIEA 2OTJT 2PVGB 3UA6A 5KYXB 5LJ5f 1C6VX 1TTHB 1U06A 3E1SA 1QCNA 3OYMA 2KY9A 1WXBA 2HDAA 1VQPT 5GAMe 5KYWA 1W4SA 1FWZA 2F2WA 3V8KA 1GL5A 1AVZC 3VS1A 3G6EA 2KYBA 1KHIA 1QCOA 3NGPA 4ZN1A 3OW2S 2XD0A 5IN1A 2JTFA 3O5ZA 1UGRB 3MJXA 3S6WA 2VXEA 1YHQA 1SRMA 1AT1B 4C8QD 2RQVA 5FU6B 1KK7A 4B6MA 2A28A 3RESA 1UHCA 3VS5A 3UPUA 3I55Q 4C92G 4AMCA 3J81E 1TOVA 2LJ1A 1KD1U 3UF4A 3EGUA 5CKEA 1HD3A 3OQ5A 2HZYA 1V29B 4F04B 2EIFA 4AG2C 3EG2A 3CCST 2XDDA 3LH0A 2MWOA 1YITT 5LJ3h 4BY6B 2K4YA 5IXBA 4RUGA 4GLMA 2Z0WA 4QKUA 1I4K1 1GFCA 2BZXA 3NHNA 2E12A 2K2VA 3OW2A 2DZCA 4J6YA 1T3LA 8ATCB 2VYTA 2K5IA 1VYUA 2D8HA 4BI3A 4MZMA 3G4SA 2QDYB 2A7YA 1GXIE 5LJ5e 3C12A 4FU6A 4Z88A 1VQ4A 1D1CA 3CMEA 1WI7A 1K73C 2BZ8A 2DZ9A 4KGXB 2FEIA 4XU3A 4RG8A 4M75B 2QQRA 1GCQA 1I5LA 2YUOA 2JTEA 3E2UA 2ROLA 3A8LB 3CC4T 4N4GA 5DY9A 1OULA 1P92A 2RH2A 3TU4K 1KIKA 3SHWA 2EGCA 3N5BB 2QEXQ 2J6FA 2O01E 1OOTA 3OSVA 1GRIA 2DRMA 1MMGA 2CT4A 5FU6C 2COYA 1M2OA 1H641 2FYKA 4F16A 5IHNA 2V1RA 2M0OA 2EYYA 2Y4YA 3A8HB 3CCLA 4JUVA 4JRQA 3VUBA 5CQYA 2NUPA 1D0ZA 2JZ2A 1K9AA 2X3WD 2DIQA 1YIJQ 7AT1B 2GQVA 3SB2A 3QG1A 3CCQT 2QTVA 2FZCB 1KC8C 4J7IA 4XK8E 4M77F 4GY5A 4DOVA 5DM7R 3CD6A 4J9FA 2LCSA 4QVZA 2GBQA 2CP6A 4CC2A 1G3TA 1SSHA 4KGVB 4OMFB 4E7LA 4BY6C 1H92A 2LX9A 3HSBA 3JV3A 2LX7A 4JDSA 2JUFA 2K5FA 2EKHA 4C8QB 1M2VA 2DJQA 1LCKA 2DO3A 3ER0A 1M8VA 1MV0B 2RQUA 3RDVA 4ZN3A 3J80E 3FIFA 4WCIA 5L8RE 5FLXE 2J6OA 3V7SA 1G5VA 4ZGJB 4PJMA 1VQNQ 4IIMA 2OX7A 2EYXA 3IQLA 4HCZA 1M3AA 3OB9A 4QQ6A 3C0CA 1WJQA 1ZSGA 2DPPB 3FB9A 1X6OA 1BI2A 2H3EB 1UGVA 2K79A 1M3CA 2E70A 2E5QA 4A4GA 2RQTA 2DL5A 1ZSZC 5KCHA 3PFSA 2ZCFB 1S72T 3OYFA 3ZBDA 3RERA 4M7AB 1O75A 2ZPEB 3VS2A 2ROTA 2O88A 4F7UE 1U1TA 4OB3B 3I5SA 1HK9A 4DBRA 4XU2A 2OTLQ 1IHWA 4C92D 3UA7A 3A98A 1WJRA 2FG0A 2EJGA 5IHKA 2JTMA 1BU1A 3EG9B 3EGDB 1MV3A 3OYYA 4EDUA 2DTIA 3QUIA 2DYBA 5FW9A 1Q7YR 1Q82C 5KYUA 1EX4A 3C94A 1VQ4Q 4EMHA 1TU0B 2ZPFB 2KBTA 1YNZA 2EJFA 1NZ9A 4FW2A 1B07A 3CC7A 1K73U 3EG3A 4CRIA 2MIOA 5GAMg 1I0CA 4M75F 2R58A 1VQ8T 1Q82R 2KSSA 1IB8A 2VXFA 4HCKA 2GTOA 3OSSC 2L0AA 4C0FA 3HHTB 4ELZC 2CZ6B 2F5TX 2QA4A 4C5EA 1VQ5A 1KSWA 2MK5A 8AT1B 2P4RA 3PTAA 2LDMA 3NPFA 1PG5B 1OZ3A 3NTIA 3OYJA 2E6ZA 3I56T 2R5AA 4DQ2A 3L2VA 1QVGA 2VKNA 3VRYA 3X25B 1KJWA 4F7UG 3BDUA 4M77A 2MOXA 4C5IA 1M30A 4NS5A 2M9UA 1UHFA 2CP7A 5KYXA 1VQOT 5KH6A 1Q86C 4BI8B 2RF0A 4AFZC 2GFUA 3HPWA 1EZZB 2P0PA 2QTXA 1N8RC 1W2BP 1KC8U 2L2PA 5GANh 4M7AC 3VS7A 3L2RA 4KUIA 1BB9A 1YJWT 5FROA 2OI3A 2KXDA 5CQXA 1N6AA 2XKOC 4F17A 1T0HA 2MF2A 3I5RA 3CCUT 4QW2A 2EQIA 4D6WA 1W2BS 1K76A 4ZGDB 5LJ5g 2RA2A 2X4XA 5ECAA 4AFSC 3L2QA 4B9XA 2JS0A 3GLXA 1C0MA 1ZUUA 5IT9E 2O9VA 3ASKA 2DETA 2KAFA 3CMAT 2PZ1A 3OY9A 2KYMA 2HSPA 1VQ9T 3SD4A 2LTOA 4Y91A 3H41A 2V1QA 3C4SA 3LH5A 2VB6A 4OF1A 1KQ2A 4J83A 4TVRA 2JM8A 1OI1A 2KDSA 1JB0E 2YT6A 3CC2Q 1MNEA 1M1KC 1RABB 4M7AF 4C92B 4M7AE 4A53A 3SFMA 2PVDB 1ABQA 3D7SB 1UJ0A 2EYWA 1JJ2P 3HL8A 1X6GA 1Q7YU 1KQSA 4IUQA 3MHXA 3M0TA 3JCMP 2LJ3A 2H8HA 4JJBA 1H8KA 2R5MA 4HT8A 4PFZA 3G71T 2EW3A 1M1KR 3CCJT 4HKEA 3M0UA 1RI0A 3CPFA 1X69A 2JNGA 4OVAA 2LJ0A 4M75A 4X1VA 1Q82U 5GAOn 1SSFA 1VQLA 3CEYA 4PLLA 1M1GA 2D9TA 2QK0A 4J6XA 1PKSA 4CC3A 1WHJA 4Z8AA 1XJWB 4Q5WA 3GBQA 3SWNB 2EQUA 2DL3A 5GAOp 4PK4A 2HQEA 3M9QA 1IGUA 1BI3A 4B9WA 4XAXB 3P8DA 5CCAA 4DEXA 3BFMA 4MMLA 2M16A 3M59A 3MP8A 4HT9A 2VGMA 2VWFA 2EQJA 3GP8A 3CXCA 3RR6A 1JU5C 4M7AG 3PMIA 1VQ7T 2DKGA 1RLPC 1J3TA 3GPLA 2ATCB 2RB6A 3LW5E 1D1BA 3MKDA 4ZNXA 1WXUA 2FPEA 3QJYA 3EAEA 2OTJQ 1Q86U 2YUPA 2R57A 5CKFA 1UB4A 1ZX6A 2HKNA 3QWXX 2K6DA 4C0DB 1TUCA 3INZA 2XDBA 1VQPQ 2WSCE 4XTZA 1D3BB 4C8QA 2W0ZA 2F2VA 3OYBA 2LZ6B 4JZ3A 3QWYA 2QYZA 5GAOm 1FMKA 2EGEA 4CC4B 2RHYA 2X3XD 2CH4A 4DBQA 3MP1A 3QYHB 1QW1A 3MCAB 1R77A 3X28B 2HMAA 4M78C 3BW1A 1VYTA 2KK4A 4C5GA 1TUGB 1YI2T 2HEQA 1ACMB 4IUPA 1IZ6A 5LL6S 2RI5A 3JCMW 2RD1A 1K9MC 1Y71A 2LQKA 5GAOq 1Q81R 1YWOA 4E2FB 3M55A 1E7OA 3SWNC 3OYKA 4M7AA 3CCSQ 1VYVA 2E41A 3A5ZB 2CP2A 5LJ5j 1YITQ 4LXCA 3JB9I 1PCXA 4M7DE 4R56A 3S3OA 3JSCA 2EPDA 1K9MR 2DBMA 5A0LA 1RAFB 2QEXA 3AT1B 4BE2A 1M1KU 4C92F 2CYZB 3JCMb 2DJZA 3EG9A 3EGDA 1MMNA 2DXTA 1JEGA 3HFNA 4DOWA 2XG8D 3DLMA 5GAN7 1I5OB 3S3NA 5I2MA 1YJNT 1RAEB 3M5AA 4M78E 2HKQB 5EC7A 3G1JA 3NTKA 2CDTA 1YIJA 2LNHB 1QCFA 1NM7A 1W1FA 4E7HA 1I07A 5FRMA 5GAMh 3REBB 2X9HA 1EIFA 4RTZA 1VQ6T 2RJFA 1NLPC 2M02A 2WSEE 3VV0A 5GMKi 3QYGB 3OYEA 4C0DC 4YTLA 5CKBA 3WVDB 3CC4Q 2PNIA 2CSQA 5IAYA 2XI9A 3ZFJA 4C0ZA 3THKA 3QJ6A 1F1BB 2QQBA 1PHTA 1VIFA 4J9BA 4PFPA 4C0GA 1YJ9T 4M7DG 4E7ZA 1AEYA 1WDXA 3O8VA 1TH7A 4OB2B 3CCMT 1N9SA 2RQRA 1SF9A 5CKDA 2V26A 4OMLA 2GFAA 5HK0A 2HD0A 1QWFA 2EWNA 1VQNA 4RTXA 1SG5A 3CCQQ 4BACA 4FL6A 4M78G 2L89A 2DVJA 2RK2A 1PC0A 2YHTA 2LCLA 4HCCA 2XICA 4F7UB 3A8MB 2ED1A 2HL3A 4AT1B 4FSXA 4IUUA 4D8DA 2RJDA 3H8ZA 4M7AD 2BE9B 2AZSA 3M53A 3X20B 1W6XA 1XNIA 5LJ5h 2OTLA 1VQMT 3CPWP 4N0AA 3FC3A 2LP5A 2E10A 3FLGA 1OYXA 4OP0A 1ARKA 1IHVA 2QG9B 4WTOB 5GJVB 1Q81U
chains in the Genus database with same CATH topology
2LQ8A 4XU2A 1VQMA 1S72A 4M7DF 2QQAA 3FDRA 1NPRA 4C92D 1WJRA 2X35A 4R55A 2EJGA 1B34B 2JTMA 3OYYA 3V7CA 4EDUA 5HKCA 2DTIA 2JN0A 3CC7T 4LD9K 3QUIA 2JVVA 1LJOA 2GF7A 5FU7B 4NL3A 2KMTA 1K9MU 1Q82C 2VGNA 4BUGA 3CPWS 3C94A 3CXCS 4EMHA 4LDVA 3MEAA 2AHJB 2ZPFB 4C92A 4FM4B 1NPPA 2MAMA 3JCMX 2EJFA 1NZ9A 3QZ5B 4JS5A 3M58A 2V8IA 4L59A 3CC7A 3OYGA 2H3JA 1QP3A 4A4EA 1K73U 3GIBA 4CRIA 4M78F 3QKJA 2BUDA 2QA4T 4C8QG 1DJ7B 5GAMg 4M75F 1VQ5T 2R58A 3UDCA 4IURA 1VQ8T 1QVFA 2ZZDA 2HNIA 2KSSA 4X34A 2PQWA 4E7IA 4FT4A 2VXFA 2I2LA 3OSSC 5J39A 3CCRT 3CD6T 3WVEB 2EQKA 4C0FA 3HHTB 4ELZC 5GMKl 4PJOD 2DK3A 4XQ3A 2CZ6B 2EYQA 5LJ3f 2F5TX 4XU0A 2QA4A 4C5EA 3QXEB 1VQ5A 1VQ8A 3E9FA 1AHJB 3QBYA 4XTVA 4RCBA 3PTAA 2LDMA 2RI2A 4M77D 3L2UA 3L1AA 1OZ3A 3NTIA 2QQ9A 2E6ZA 1WPYA 3OBWA 4MMKA 3JCMg 5GAN8 3OYCA 3OYJA 3I56T 2R5AA 1VQKT 5EG2A 1BKBA 3OMCA 4DQ2A 5I21A 5GAMd 5J3BA 3L2VA 3CCRA 3JB9J 1RL2A 1QVGA 4PJOA 3OBYA 1WGSA 3VYHB 4J7FA 4PNOA 4KULA 3X25B 4F7UG 4IUTA 3JCMh 3BDUA 5GAN5 2D6FA 4JLGA 3E9GA 4M77A 3KXTA 5GMKe 4XTYA 3I55T 2EKOA 3LYIA 4NS5A 4C5IA 2M9UA 1IREB 2F69A 1M5Q1 4FIBA 3I56A 4LDXA 1VQKA 5CAIA 1VQOT 3Q1JA 5KH6A 1U1SA 1Q86C 3KBGA 3V8JA 3T9NA 3M57A 5J26A 5GAMj 3LLRA 4BI8B 2LCCA 3OMGA 4FT2A 2GFUA 5FRNA 3JB9G 3HPWA 4EMKC 5GANg 4JJNK 1K8AC 2P0PA 2QTXA 1N8RC 4N0AC 3MEUA 1M90U 3I55A 1KC8U 1G3YA 2O4XB 2RHZA 2M1HA 3OYAA 4WF2A 4A4HA 4Y28E 5CK9A 1UGQB 3QZ9B 2V8JA 1VQOA 5DLQE 5GANh 4M7AC 1BIAA 1R8OB 3GF5A 2EJ9A 2OAUA 3L2RA 2LRQA 2MI6A 4KUIA 2EAYA 2L3RA 4MZPA 3AHUA 4ZGEB 1YJWT 4X9CA 5FROA 5M9OA 2E6NA 4P5NA 1G3SA 2LT1A 3NFCA 4J5YA 5D6WA 5CQXA 3RIRA 4A4KA 1N6AA 2E65A 2XKOC 2HAXA 2XU8A 3JCMQ 4L5GA 4LDWA 3GNFB 3GNGA 3HRTA 2BIVA 2ZPGB 2MF2A 2YRVA 3CC2T 5GAN3 3OYDA 5GAOl 4QW2A 3CCUT 4D6WA 1W2BS 1YJWA 5LJ5g 4ZGDB 3M4YA 4C92C 2RA2A 2X4XA 1D3BA 3HRSA 5FU7C 3L2QA 3QO3A 4B9XA 3GLXA 4L6V5 5IT9E 3ASKA 5GAMf 2KAFA 3CMAT 3NTHA 1Y96A 3OY9A 5D6XA 2CS7A 1G3WA 4X9DA 1ZQ1A 4QVDA 4BB7A 2X4YA 3CC2A 3JB9H 1WQ7A 2HQXA 3CCUA 1VQ9T 2BKDN 2NLUA 3M4GA 3PMTA 3SD4A 3TCJA 4RCCA 4CI0C 5DLOA 2DAQA 4M7DD 2LTOA 3FJPA 2XHCA 4Y91A 2FHDA 1Q81C 4F7UF 3C95A 4BD3A 3CMAA 5LJ3e 4RKUE 5C6SA 2LVMA 3C4SA 3CBPA 4BDYA 5LJ3j 4OF1A 5LJ5d 3FRNA 4J83A 4TVRA 1KQ2A 1N9RA 4ZTFA 1NJIC 1OI1A 2KDSA 1JB0E 1VQ9A 4M7DA 3R6OA 3X24B 1M1KC 2DXCA 4M7AF 4C92B 4M7AE 5A2QE 4A53A 3DB3A 3JAME 3SFMA 3JB9F 2PVDB 4HA8A 1OZ2A 4PJOC 4LDYA 3HL8A 3HRUA 1Q7YU 4M78D 4IUQA 3VUZA 1KQSA 3L42A 3MHXA 4M75D 3JCMP 1VQLT 4M77C 2PVOB 4ME7A 4IUVA 2R5MA 4HT8A 1YCYA 2KQWA 3G71T 3CCJT 2DD5A 4HKEA 2DXBA 5KE3A 1KQ1A 1RI0A 3CPFA 2P0KA 3VU3C 2RHXA 1ZBXA 4JRPA 2DD4A 2JNGA 3RKWA 4C92E 4LDUA 4OVAA 4M78A 3CCET 2ZPIB 3M56A 1BI1A 3E19A 2XDPA 3PGGA 4M75A 3CCVT 1LOJA 1Q82U 4KBMB 1SSFA 2FB7A 5GAOn 2QQSA 2FL7A 3CEYA 1VQLA 4J6WA 1M1GA 4PLLA 2D9TA 2E64A 3PIOA 3G71A 2LNVA 5A0DA 3CCJA 2VV5A 4J6XA 4QQDA 4XTWA 5GMKm 2Y90A 2DIGA 1O9SA 3L2ZA 4Q5WA 3CCEA 2DEQA 3QIIA 5AYFA 2EQUA 3SWNB 5GAN6 3CCVA 4PJOB 3JCMV 3VJPA 3BDLA 3HKSA 5GMKh 4BE0A 5CVIA 3OS5A 5GAOp 2HQEA 4M77B 4MDXA 3SWNA 1FX7A 4XTXA 3M9QA 4B9WA 1BI3A 2MWPA 2DTHA 1VIEA 2OTJT 2PVGB 4XAXB 5LJ5f 3G6ET 3P8DA 3TEEA 5CCAA 4ELYC 4MZTA 2CZ7B 3BFMA 4MMLA 1KHCA 3PNWC 3E1SA 2M16A 2G3RA 3M59A 3MP8A 2DVEA 4HT9A 3OYMA 3OYIA 2KY9A 5GAOr 2E1HA 2VGMA 1VQPT 5GAMe 2EQJA 3OS2A 3CPWA 4EMGA 1YHQT 3GP8A 3CXCA 1W4SA 3RMQA 1PSFA 2K3XA 4PJOE 1FWZA 2RHUA 3PMIA 4M7AG 1VQ7T 3V8KA 2OTJA 2DKGA 3G6EA 5I2SA 1KHIA 1M90C 4HCBA 2WACA 3KUFA 3JCMd 1I81A 4M77E 1WQWA 4ZN1A 1X01A 3OW2S 2L8DA 3GPLA 2XD0A 5IN1A 2RB6A 3LW5E 4E47A 5KE2A 3URGA 2JTFA 2GCXA 1UGRB 2DXUA 3S6WA 1VQPA 2VXEA 1YHQA 2VC8A 3RUXA 4C5HA 4C8QD 1HXDA 5FU6B 4JRQA 3QDRB 2QI2A 3QJYA 1VQ7A 5A0GA 3EAEA 2CGHA 3VYGA 2MMPA 3RESA 3J7AF 3QSUA 1Q86U 2R57A 5CKFA 3UPUA 1UB4A 1FXXA 4C92G 2RO0A 3J81E 3OYNA 4C0DB 3MEVA 3INZA 2XDBA 2RI3A 1KD1U 2WSCE 4XTZA 1D3BB 4C8QA 1KG1A 5GANd 3OA6A 5CKEA 4KUDK 3QPHA 3OYBA 3TREA 3ZEHA 3OQ5A 4OGEA 1WJSA 3MP6A 1Y96B 1V29B 5GAOm 1QVPA 3H6ZA 2PUOB 2D0QB 2EIFA 2PUKB 2HBPA 1UGSB 2RHYA 3F70A 3CCST 2XDDA 3LH0A 2LT4A 2MWOA 3MP1A 4VUBA 3X26B 1YITT 1LNXA 2RJCA 5LJ3h 4JRKA 4BY6B 3QYHB 1QW1A 2K4YA 5GANj 1BYMA 2WSFE 3MCAB 3X28B 1UEBA 1QP2A 2K5LA 4M78C 1MHNA 3BW1A 4UC4A 4M75C 2KK4A 4BDZA 1JBMA 1I4K1 3G4ST 4C5GA 4E7JA 3CCSA 4M7DB 2E12A 2K2VA 4F7UA 1YI2T 4II1A 1YITA 4IUPA 4PJOG 3OW2A 2DZCA 1IZ6A 2V8KA 3JCMf 3JB9D 1VQ4T 3G7ZA 4J6YA 3JRZA 5LL6S 4QVCA 3CMET 4EMKA 2QXFA 2VYTA 2K5IA 2RI5A 3UWNA 3JCMW 2RD1A 3JCMJ 1Y71A 2LQKA 4M77G 4BI3A 1K9MC 4DA4A 5GAOq 3WXMB 3A8GB 1BI0A 2CZ0B 3MEWA 4ATOA 2QEXT 3M55A 4MZMA 3RKXA 2QDYB 3G4SA 3SWNC 3OYKA 2A7YA 1Q7YC 5LJ5e 5D6YA 3C12A 4FU6A 1YI2A 4M7AA 4V2SA 1GXIE 2CKKA 2E41A 3A5ZB 3FEOA 5LJ5j 1VQ4A 4GLKA 1QVGS 3JB9I 3CMEA 2P4TA 4M7DE 4R56A 4Z02A 2DZ9A 3S3OA 1K73C 3JSCA 5CIUA 4XU3A 4M78B 3GOXA 4RG8A 4M75B 2QQRA 5A0LA 1UGPB 1NJIU 4PL6A 1MGQA 2QEXA 5GANf 4A54A 1W2BA 4BE2A 1M1KU 4C92F 2CYZB 3VKIA 4NOYA 2DJZA 3JCMb 4OGCA 5GAN2 1I5LA 1B34A 4A4FA 3EFSA 2DXTA 1YIJT 3A8LB 4RG2A 3PT9A 3CC4T 4N4GA 3HFNA 5DY9A 1P92A 2RH2A 4PKCC 4DOWA 2LC4A 3TU4K 3DKMA 2XG8D 2F5KA 2RHIA 3DLMA 4XTUA 5GAN7 3L2WA 3N5BB 4BE1A 1JJ2S 3S3NA 4KT0E 1Y7XA 2VUBA 2O01E 5I2MA 3CCLT 3JCMc 1YJNT 3CBOA 3M5AA 4M78E 3OSVA 3DB4A 4M75E 2IVWA 2X4WA 3NTKA 2DTOA 1YIJA 5KCOA 3CC4A 5FU6C 4E7HA 2FYKA 1H641 5GAMh 5HY6A 5FRMA 2M0OA 1EIFA 1N27A 2Y4YA 3LWIA 4C8QC 1VQ6T 2C06A 3OS1A 3A8HB 2RJFA 3MO8A 3CCLA 4J8OA 1YJNA 3LWHA 4JUVA 3VV0A 1ZHIA 2WSEE 2L5QA 3QYGB 3VUBA 5CQYA 3CBMA 4C0DC 5GMKi 2ZPHB 2RJEA 3OYEA 4IKFA 2JZ2A 4XU1A 4YTLA 5CKBA 2DIQA 3WVDB 4PJOF 2GQVA 3SB2A 3QG1A 4JRIA 4EPCA 4RMOA 3CCQT 1X75C 5IAYA 2XI9A 3ZFJA 4ZTJA 3LGLA 4C0ZA 5CKHA 1KC8C 4J7IA 4XK8E 4M77F 4GY5A 2K3YA 4DOVA 1VQ6A 1JRIA 2JOYA 3UT1A 5DM7R 3CD6A 2RK1A 3QJ6A 3S3MA 2QQBA 4QVZA 1VIFA 1G3TA 3OYHA 3OS0A 1VQNT 1H3ZA 3V7RA 4OMFB 4C0GA 1YJ9T 1YBYA 5GMKj 4BY6C 4E7LA 4M7DG 3CCQA 3O8VA 1TH7A 4OB2B 2ZPBB 3CCMT 1N9SA 2LX9A 3HSBA 4NL2A 4BI4A 2YLBA 2EFIA 3HFOA 4JDSA 5CKDA 3LX7A 3JCMe 2JUFA 3P8BB 2K5FA 4C8QB 1NE8A 2KVQG 4JLIA 1M1FA 2A3LA 2GFAA 1BIBA 5HK0A 2HD0A 2DO3A 2K57A 1KD1C 4M7DC 3ER0A 1JJ2A 1M4ZA 2EWNA 2FVUA 1K8AU 1U8RA 1VQNA 1M8VA 1YJ9A 1N8RU 4O5VA 2XIDA 4E7KA 1PSEA 3RMSA 3CCMA 1XTDA 4MDWA 3LGFA 4QQGA 2B8AA 4ZN3A 3J80E 3FIFA 2O4XA 4BACA 3DLLA 1Y07A 3BY7A 5L8RE 5FLXE 5LJ3g 4FL6A 4LD6A 3V7SA 4M78G 1G5VA 2L89A 3P8HA 1XQHA 3HP9A 4M75G 2IG0A 4ZGJB 1I8FA 3PIPA 2RK2A 1M9SA 1KQSS 2YHTA 4C8QF 4C8QE 5GANe 2ZGWA 2LCLA 4HCZA 1WNLA 2PU9B 3OB9A 2YLCA 4QQ6A 3RKYA 4HCCA 4OB1B 2OTLT 2XICA 4O6JA 1WJQA 5GAN4 2DPPB 3FB9A 1QVFS 1X6OA 1BI2A 2CZ1B 3QHSA 3A8MB 4F7UB 1XOVA 3META 2E70A 2E5QA 4FSXA 4IUUA 4EMKB 2RJDA 4A4GA 3H8ZA 4JS4A 4M7AD 3ME9A 2X4JA 5CR2A 3M53A 3M54A 3PFSA 4N4HA 5KCHA 2RM4A 3X20B 5LJ3d 5LJ5h 1XNIA 2OTLA 2ZCFB 4N4IA 2XK0A 1VQMT 3OYFA 2P0QA 3ZBDA 1S72T 4N0AA 3RERA 5CO7A 4M7AB 3SDZA 1O75A 2Y4XA 3FC3A 2ZPEB 3EFRA 2E10A 3V8LA 3FLGA 4PLIA 1OYXA 1VUBA 4OB0B 4OP0A 5HK3A 3OYLA 4F7UE 1U1TA 3A8OB 4OB3B 1Q81U 2EQMA 1HK9A 5C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5V A;  1G3Y A;  2QQA A;  5CVI A;  3HRS A;  1FX7 A;  3GLX A;  2QQB A;  1BI3 A;  2GCX A;  1BI2 A;  1QVP A;  1G3T A;  1BI1 A;  3E19 A;  3HRT A;  2K5I A;  1G3W A;  2LX9 A;  1G3S A;  1BI0 A;  1BYM A;  1P92 A;  1QW1 A;  2K4Y A;  2K5F A;  3HRU A;  1FWZ A;  3MHX A;  4O6J A;  2K5L A;  2QQ9 A;  2H3J A;  1U8R A; 
#chains in the Genus database with same CATH topology
 2QQA A;  3FDR A;  2KT8 A;  4R55 A;  2CRE A;  1B34 B;  2JVV A;  1LJO A;  5FU7 B;  2DRK A;  1K9M U;  1NG2 A;  3CPW S;  1ZSZ B;  2CP5 A;  2RNA A;  4C92 A;  4A63 B;  1WFW A;  1S72 Q;  4FM4 B;  1K73 R;  2KNB B;  1ZUK A;  1WHM A;  2DLP A;  3M58 A;  4K11 A;  1SKU B;  2D1X A;  3QKJ A;  2BUD A;  4IUR A;  1UG1 A;  4E7I A;  4FT4 A;  2G6F X;  3CCR T;  1RAI B;  2DK3 A;  4XQ3 A;  4XU0 A;  4KH0 B;  1AHJ B;  3MPU B;  3QBY A;  4XTV A;  1OPK A;  4LN2 A;  3L2U A;  2L3S A;  3OBW A;  2QQ9 A;  4MMK A;  3JCM g;  1VQK T;  1PM3 A;  2DM1 A;  1N5Z A;  5I21 A;  4ORZ A;  3OBY A;  2D6F A;  3E9G A;  3KXT A;  3I55 T;  1M27 C;  1EFN A;  4FIB A;  2YUN A;  5CAI A;  2LQN A;  3T9N A;  3M57 A;  5J26 A;  1KC8 R;  2LCC A;  2EVR A;  5FRN A;  1K8A C;  3MEU A;  2O4X B;  4A4H A;  1TXQ A;  5CK9 A;  1UGQ B;  3I56 Q;  3QZ9 B;  1BIA A;  1R8O B;  1PRM C;  4QT7 A;  4OMN A;  4MZP A;  5M9O A;  4P5N A;  4RTU A;  4A4K A;  1V76 A;  2HAX A;  2P84 A;  1Y57 A;  1VQO Q;  1IRX A;  3HRT A;  1M3B A;  2C0T A;  5KYN A;  1RAA B;  3M4Y A;  1BK2 A;  1ZLM A;  1D3B A;  5FU7 C;  2YSQ A;  3NTH A;  2HCK A;  5D6X A;  2HSE B;  1WA7 A;  1ZQ1 A;  2FZG B;  4BB7 A;  2X4Y A;  3CC2 A;  1H3H A;  2GNC A;  1WIE A;  5I22 A;  1YJW Q;  1QVG P;  4M7D D;  2XHC A;  5IHI A;  4F7U F;  1RUW A;  5C6S A;  2LVM A;  1YCS B;  4ZTF A;  1ZA2 B;  1NJI C;  3CCU Q;  1V1C A;  2DXC A;  5A2Q E;  5D7U A;  1OZ2 A;  3CMA Q;  4PJO C;  4M78 D;  2DYI A;  3VUZ A;  4AFU C;  1VQ9 Q;  1YCY A;  2KQW A;  2C0O A;  1JQQ A;  2P0K A;  2RHX A;  1ZBX A;  3CCE T;  2ZPI B;  3M56 A;  3CCV T;  2XDP A;  1LOJ A;  4FYW B;  2FB7 A;  1OV3 A;  1VA7 A;  1TS9 A;  2QQS A;  4JJD A;  4J6W A;  2VV5 A;  4QQD A;  1NEG A;  1O9S A;  2DEQ A;  1HSQ A;  5GAN 6;  3BDL A;  3HKS A;  5CVI A;  1Y0M A;  3G71 Q;  2E3H A;  3SEM A;  2MWP A;  3CCJ Q;  2KT1 A;  3G6E T;  3TEE A;  3UAT A;  2G3R A;  2E1H A;  3OS2 A;  1RAD B;  1YHQ T;  2JS2 A;  3RMQ A;  1PSF A;  2K3X A;  4PJO E;  2RHU A;  2OTJ A;  1R0C B;  4HCB A;  5I2S A;  1M90 C;  3JCM d;  2L8D A;  4GBQ A;  2K7A A;  4E47 A;  5KE2 A;  2GCX A;  1VQP A;  2CUD A;  2DXU A;  1WHH A;  1Q86 R;  4C5H A;  1HXD A;  1KQS P;  3QDR B;  2QI2 A;  5A0G A;  2COZ A;  2BE7 D;  2CGH A;  3VYG A;  2MMP A;  2KRN A;  3QSU A;  3TSW A;  1N8R R;  1WHL A;  1QMC A;  1QVF P;  2RO0 A;  2NUT B;  2O9S A;  2RI3 A;  1KG1 A;  1X6B A;  3OA6 A;  2K3B A;  1SHF A;  1VQ7 Q;  3ZEH A;  4OGE A;  3MP6 A;  2OJ2 A;  1Y96 B;  2ESW A;  3H6Z A;  1BCM A;  2RMO A;  4RTY A;  2D0Q B;  2PUK B;  1UGS B;  3F70 A;  1D1A A;  2QDL A;  3X26 B;  1LNX A;  4JRK A;  5IXF A;  1CSK A;  4RTV A;  1SPK A;  1UEB A;  1QP2 A;  3ZL7 C;  4D8K A;  1CKB A;  4UC4 A;  2EBP A;  2YWW A;  4DEY A;  4BDZ A;  3G4S T;  4E7J A;  3CCS A;  2BTT A;  4M7D B;  4F7U A;  1UDL A;  1YIT A;  4PJO G;  1VQ4 T;  3EFO B;  3JCM f;  4QVC A;  3CME T;  3UWN A;  3JCM J;  2OAW A;  1QWE A;  3RKX A;  2KRO A;  2MYS A;  4V2S A;  2M0Y A;  3FEO A;  4GLK A;  3EG1 A;  1PRL C;  4Z02 A;  4KH1 B;  4M78 B;  2RN8 A;  1NJI U;  1UGP B;  1MGQ A;  4A54 A;  1W2B A;  2QAZ A;  1YI2 Q;  1B34 A;  4A4F A;  3EFS A;  2DX1 A;  1UJY A;  1G8X A;  4RG2 A;  3RNJ A;  2ECZ A;  1S1N A;  1ZSZ A;  1JJ2 S;  2F5K A;  2RHI A;  3L2W A;  4BE1 A;  3CCL T;  3CBO A;  4FYY B;  2IVW A;  1D09 B;  2X4W A;  3CC4 A;  3KFV A;  5HY6 A;  4E7S A;  1X27 A;  2C06 A;  3OS1 A;  2GTJ A;  3MO8 A;  3CD6 T;  2L5Q A;  2ZPH B;  2RJE A;  4EIK A;  4XU1 A;  2PTK A;  4FCY A;  1WX6 A;  4RMO A;  4JRI A;  1X75 C;  3LGL A;  1OX9 A;  3M0Q A;  4HVW A;  2K3Y A;  2JOY A;  1YJN Q;  2FZK B;  2AK5 A;  2RK1 A;  4DBH A;  3OYH A;  5GMK j;  3CCQ A;  2GGR A;  2ZPB B;  4NL2 A;  2YLB A;  3HFO A;  3LX7 A;  3JCM e;  2NUZ A;  3P8B B;  1VQ6 Q;  1NE8 A;  4JLI A;  1M1F A;  2DBK A;  1BIB A;  4KGZ B;  2K57 A;  1KD1 C;  4M7D C;  1JJ2 A;  1M4Z A;  2FVU A;  1C1A A;  1N8R U;  4PFO A;  2XID A;  1M8M A;  2ABL A;  3VS3 A;  4DBF A;  2B8A A;  2I0N A;  2O4X A;  3DLL A;  1W70 A;  1Y07 A;  4LD6 A;  3P8H A;  1TUD A;  1XQH A;  3HP9 A;  2IG0 A;  3PIP A;  1I8F A;  1M9S A;  3TSZ A;  1YJ9 Q;  3EHQ A;  3PVQ A;  1RLQ C;  2PU9 B;  2YLC A;  3CCM Q;  3RKY A;  2JT4 A;  4OB1 B;  1G83 A;  1XOV A;  4EMK B;  4JS4 A;  2YXY A;  4PJJ A;  3ME9 A;  2X4J A;  5CR2 A;  4PJL A;  2RM4 A;  1ABO A;  5LJ3 d;  4N4I A;  2XK0 A;  2SEM A;  2AKK A;  2P0Q A;  2Y4X A;  4RTT A;  3EFR A;  4J9C A;  2RPN A;  5HK3 A;  1VUB A;  4OB0 B;  3A8O B;  2A36 A;  5C0M A;  4LD9 K;  2LQ8 A;  1RAG B;  1S72 A;  4M7D F;  2FRW A;  1HJD A;  2JN0 A;  3CC7 T;  4FYV B;  2GF7 A;  2J05 A;  2KMT A;  2VGN A;  3PVL A;  1BBZ A;  4BUG A;  3R6N A;  3JCM X;  1VQM Q;  1NPP A;  2CH4 W;  3QZ5 B;  4JS5 A;  1WHG A;  1E6H A;  4IIO A;  1QP3 A;  3GIB A;  4M78 F;  2QA4 T;  1DJ7 B;  1VQ5 T;  2HNI A;  4OMP A;  2NYS A;  4X34 A;  2ED0 A;  2QAS A;  4FSS A;  1T3S A;  5GMK l;  4PJO D;  5LJ3 f;  2DIL A;  2EGA A;  3QXE B;  1VQ8 A;  2E4H A;  2RI2 A;  1G2B A;  3L1A A;  5GAN 8;  3OW2 P;  1BKB A;  4JJC A;  5J3B A;  3NMZ C;  1RL2 A;  4E6R A;  3I35 A;  3JB9 J;  1WGS A;  1HYO A;  3VYH B;  4J7F A;  4KUL A;  1PKT A;  5GAN 5;  1Z9Q A;  4JLG A;  5GMK e;  4XTY A;  1AOJ A;  2EKO A;  4HVV A;  1I1J A;  1YWP A;  1K0X A;  2F69 A;  1M5Q 1;  3I56 A;  4LDX A;  2JMA A;  3Q1J A;  2M51 A;  3KBG A;  3CCR Q;  3OMG A;  2E5K A;  3JB9 G;  5GAN g;  4EMK C;  4JJN K;  1JXM A;  1G3Y A;  4FYX B;  2RHZ A;  4WF2 A;  1VQO A;  1VQK Q;  5DLQ E;  3GF5 A;  2OAU A;  2LRQ A;  1MND A;  2MI6 A;  2EAY A;  3AHU A;  4ZGE B;  4M4Z A;  4X9C A;  1G3S A;  2LT1 A;  3NFC A;  2GQI A;  5D6W A;  4LE9 A;  2FPF A;  2EYZ A;  3REA B;  2E65 A;  1OU9 A;  2MPX C;  3JCM Q;  5KYY B;  4LDW A;  3GNF B;  2BIV A;  5GAN 3;  2NUT A;  3TVT A;  1YJW A;  3HRS A;  4CC7 A;  4L6V 5;  1QLY A;  1Y96 A;  1IGQ A;  1G3W A;  2JMC A;  4QVD A;  1AWJ A;  3CCU A;  3PMT A;  5DLO A;  4RCC A;  2FHD A;  2DMO A;  1AZG B;  1OEB A;  3BE3 A;  4BD3 A;  3CMA A;  5LJ3 e;  4RKU E;  3CBP A;  1K0S A;  2KRM A;  3FRN A;  4J9D A;  2J7I A;  2A0F B;  1VQ9 A;  4M7D A;  3R6O A;  1RI9 A;  2LQW A;  3EFO A;  4HA8 A;  4LDY A;  2YDL A;  3VRZ A;  3HRU A;  1VQL T;  4M77 C;  4J9G A;  4ME7 A;  4IUV A;  3H9N A;  2AKL A;  2A08 A;  1K1Z A;  1KQ1 A;  2DD4 A;  4LDU A;  4M78 A;  3CQT A;  4FW1 A;  2DF6 A;  1BI1 A;  4KBM B;  2DFU A;  1WZO A;  4Y92 A;  2E64 A;  3PIO A;  3G71 A;  3CCJ A;  2Y90 A;  2VAS A;  5AYF A;  4PJO B;  2HL5 C;  1MMD A;  3EGX B;  1GBR A;  2FPD A;  4MDX A;  3SWN A;  2CP3 A;  1RAC B;  5I11 A;  3H0I A;  1UUE A;  3H0H A;  2JM9 A;  3FJ5 A;  1VQ8 Q;  4ELY C;  4MZT A;  2CZ7 B;  2JXB A;  1KHC A;  3PNW C;  3CCE Q;  3U23 A;  2AZV A;  2DVE A;  3CCV Q;  1PWT A;  3OYI A;  5GAO r;  9ATC B;  1SRL A;  3CPW A;  2FRY A;  4EMG A;  1Q95 G;  2WAC A;  3KUF A;  1I81 A;  4M77 E;  1WQW A;  1X01 A;  2QGG A;  1TWB A;  3URG A;  5FWC A;  4ANJ A;  2VC8 A;  3RUX A;  5FWB A;  1VQ7 A;  4J9I A;  3G6E Q;  3J7A F;  1K8A R;  1FXX A;  3OYN A;  2CP0 A;  3MEV A;  4LUD A;  1YHQ Q;  5GAN d;  1QKW A;  4KUD K;  3QPH A;  3TRE A;  1WJS A;  1WYX A;  1TSF A;  1QVP A;  2PUO B;  4KRT A;  4LNP A;  2HBP A;  2DNU A;  4J9E A;  2LT4 A;  4VUB A;  2RJC A;  1BYM A;  5GAN j;  2WSF E;  1X43 A;  1KFZ A;  2F1L A;  2K5L A;  1MHN A;  4M75 C;  1NLO C;  1JBM A;  1ZBJ A;  2LMJ A;  4II1 A;  3ULR B;  3JB9 D;  2V8K A;  3G7Z A;  2B86 A;  3JRZ A;  2CT3 A;  1OU8 A;  4EMK A;  2KGT A;  2QXF A;  2KXC A;  4M77 G;  4DA4 A;  3WXM B;  2ZAE A;  2L3P A;  3A8G B;  4OMO A;  1BI0 A;  2CZ0 B;  3MEW A;  4ATO A;  2QEX T;  1Q7Y C;  5D6Y A;  1YI2 A;  1GFD A;  2CKK A;  1RAH B;  1NJI R;  1QVG S;  1Z9Z A;  2P4T A;  1PD0 A;  4AG1 C;  4JZ4 A;  5CIU A;  3GOX A;  4PL6 A;  5GAN f;  1UFF A;  3G4S Q;  3VKI A;  4NOY A;  5GAN 2;  4OGC A;  1GCP A;  1AWO A;  1YIJ T;  3CME Q;  3PT9 A;  4Z89 A;  4PKC C;  2LC4 A;  1GBQ A;  3DKM A;  2K2M A;  4XTU A;  4KT0 E;  1Y7X A;  2VUB A;  3JCM c;  2YUQ A;  1JO8 A;  3DB4 A;  4M75 E;  2DTO A;  5KCO A;  2K9G A;  4AFQ C;  1N27 A;  3LWI A;  4C8Q C;  5KYW B;  1NYF A;  2O2O A;  4J8O A;  1YJN A;  3LWH A;  1ZHI A;  3CBM A;  4IKF A;  1WLP B;  4PJO F;  4EPC A;  4JPB W;  2IIM A;  1T0J A;  4ZTJ A;  2J06 A;  5CKH A;  1VQ6 A;  3CCL Q;  1JRI A;  3UT1 A;  3S3M A;  1AWW A;  1H3Z A;  3OS0 A;  1VQN T;  3EH1 A;  3V7R A;  4HXJ A;  1YBY A;  1UE9 A;  4BI4 A;  1JXO A;  2EFI A;  1M90 R;  1PNJ A;  2KR3 A;  1AZE A;  1A0N B;  2KVQ G;  2A3L A;  3CD6 Q;  2DE0 X;  3HTR A;  1K8A U;  1U8R A;  1YJ9 A;  4O5V A;  4E7K A;  1VOM A;  1PSE A;  1WXT A;  3RMS A;  1XTD A;  3CCM A;  4MDW A;  1U5S A;  3LGF A;  4QQG A;  3PE0 A;  2CUB A;  3BY7 A;  2AIR B;  5LJ3 g;  4M75 G;  1AWX A;  2DL4 A;  4J9H A;  1KQS S;  4C8Q F;  4C8Q E;  5GAN e;  1BCO A;  2ZGW A;  1WNL A;  2OTL T;  4O6J A;  5GAN 4;  1QVF S;  3QHS A;  2CZ1 B;  1YFN A;  3MET A;  1SEM A;  5KYY A;  5L23 A;  2IPO B;  1UTI A;  3M54 A;  4N4H A;  2VVK A;  2BZY A;  3CXC P;  5CO7 A;  3SDZ A;  3V8L A;  3M0P A;  1YP5 A;  4PLI A;  3VS6 A;  3OYL A;  4RTW A;  3VS4 A;  2EQM A;  2F2X A;  5GJW B;  1MMA A;  1VQM A;  1U3O A;  1SHG A;  1NPR A;  2X35 A;  5HKC A;  3V7C A;  3H0F A;  1ZUY A;  2DA9 A;  4NL3 A;  4ESR A;  2X51 A;  3CXC S;  4LDV A;  3MEA A;  2AHJ B;  1CKA A;  1PD1 A;  2MAM A;  5AT1 B;  1YN8 A;  2HBW A;  2V8I A;  3EG0 A;  1X2K A;  4L59 A;  2JJ9 A;  1D0Y A;  3OYG A;  2H3J A;  4A4E A;  2CSI A;  4C8Q G;  1QVF A;  3UDC A;  2ZZD A;  6AT1 B;  3EH2 A;  2PQW A;  2D8J A;  1QQJ A;  2I2L A;  2HQH A;  5J39 A;  2NUP B;  3WVE B;  5HCK A;  1LPL A;  2EQK A;  4OMM A;  3CC7 Q;  4F14 A;  3VS0 A;  2EYQ A;  3E9F A;  4RCB A;  4M77 D;  1WPY A;  3OYC A;  1UEC A;  5EG2 A;  3OMC A;  3CCR A;  5GAM d;  4PJO A;  1OPL A;  3EGX A;  4PNO A;  2QA4 Q;  2ENM A;  4IUT A;  3JCM h;  1VQ5 Q;  3LYI A;  1IRE B;  2KEA A;  1M2V B;  1VQK A;  1U1S A;  3V8J A;  2AT1 B;  5GAM j;  3LLR A;  2A37 A;  4FT2 A;  1K4U S;  1B3Q A;  4N0A C;  1M90 U;  3I55 A;  2M1H A;  3OYA A;  4Y28 E;  2V8J A;  2RQW A;  1FYN A;  2EJ9 A;  2W10 A;  2L3R A;  4LUE A;  2E6N A;  4J5Y A;  1KD1 R;  1X2Q A;  1TG0 A;  1NEB A;  3RIR A;  2E3I A;  2C0I A;  2XU8 A;  4L5G A;  1R0B G;  2SRC A;  3GNG A;  1GCQ C;  3I9Q A;  2ZPG B;  2YRV A;  1D0X A;  3CC2 T;  1MUZ A;  3OYD A;  2QGF B;  5GAO l;  2KRS A;  2COW A;  4C92 C;  3QO3 A;  5GAM f;  1E6G A;  2JW4 A;  1WHK A;  2CS7 A;  4X9D A;  1IXD A;  3JB9 H;  1WQ7 A;  2HQX A;  2BKD N;  2NLU A;  3M4G A;  4OMQ A;  3TCJ A;  4CI0 C;  2DAQ A;  2XMF A;  3FJP A;  2KE9 A;  2DL7 A;  1Q81 C;  3C95 A;  1LVK A;  1FMV A;  4HVU A;  2J6K A;  1B7T A;  4BDY A;  1OX8 A;  5LJ3 j;  5LJ5 d;  1QKX A;  1N9R A;  5KYU B;  3X24 B;  3M0R A;  1IO6 A;  3DB3 A;  2KI7 A;  3JAM E;  3JB9 F;  1ZA1 B;  2MCN A;  2O31 A;  3L42 A;  2L3Q A;  4M75 D;  3A1P A;  2PVO B;  2FO0 A;  2YRD A;  1AD5 A;  2YRC A;  2DD5 A;  2DXB A;  5KE3 A;  3RBB B;  4R0K A;  4PJN A;  1NBE B;  3VU3 C;  4JRP A;  3RKW A;  3M0S A;  1OQK A;  4C92 E;  3E19 A;  3PGG A;  3TQ7 P;  3QDF A;  2FL7 A;  2LNV A;  5A0D A;  1FMW A;  4XTW A;  5GMK m;  2DIG A;  5IH2 A;  3L2Z A;  1NYG A;  3CCE A;  3QII A;  3CCV A;  3JCM V;  3VJP A;  5GMK h;  4BE0 A;  3OS5 A;  1VQL Q;  2DL8 A;  2NWM A;  4M77 B;  1FX7 A;  3EHR A;  4XTX A;  2D0N A;  2DER A;  2DTH A;  2DEU A;  1VIE A;  2OTJ T;  2PVG B;  3UA6 A;  5KYX B;  5LJ5 f;  1C6V X;  1TTH B;  1U06 A;  3E1S A;  1QCN A;  3OYM A;  2KY9 A;  1WXB A;  2HDA A;  1VQP T;  5GAM e;  5KYW A;  1W4S A;  1FWZ A;  2F2W A;  3V8K A;  1GL5 A;  1AVZ C;  3VS1 A;  3G6E A;  2KYB A;  1KHI A;  1QCO A;  3NGP A;  4ZN1 A;  3OW2 S;  2XD0 A;  5IN1 A;  2JTF A;  3O5Z A;  1UGR B;  3MJX A;  3S6W A;  2VXE A;  1YHQ A;  1SRM A;  1AT1 B;  4C8Q D;  2RQV A;  5FU6 B;  1KK7 A;  4B6M A;  2A28 A;  3RES A;  1UHC A;  3VS5 A;  3UPU A;  3I55 Q;  4C92 G;  4AMC A;  3J81 E;  1TOV A;  2LJ1 A;  1KD1 U;  3UF4 A;  3EGU A;  5CKE A;  1HD3 A;  3OQ5 A;  2HZY A;  1V29 B;  4F04 B;  2EIF A;  4AG2 C;  3EG2 A;  3CCS T;  2XDD A;  3LH0 A;  2MWO A;  1YIT T;  5LJ3 h;  4BY6 B;  2K4Y A;  5IXB A;  4RUG A;  4GLM A;  2Z0W A;  4QKU A;  1I4K 1;  1GFC A;  2BZX A;  3NHN A;  2E12 A;  2K2V A;  3OW2 A;  2DZC A;  4J6Y A;  1T3L A;  8ATC B;  2VYT A;  2K5I A;  1VYU A;  2D8H A;  4BI3 A;  4MZM A;  3G4S A;  2QDY B;  2A7Y A;  1GXI E;  5LJ5 e;  3C12 A;  4FU6 A;  4Z88 A;  1VQ4 A;  1D1C A;  3CME A;  1WI7 A;  1K73 C;  2BZ8 A;  2DZ9 A;  4KGX B;  2FEI A;  4XU3 A;  4RG8 A;  4M75 B;  2QQR A;  1GCQ A;  1I5L A;  2YUO A;  2JTE A;  3E2U A;  2ROL A;  3A8L B;  3CC4 T;  4N4G A;  5DY9 A;  1OUL A;  1P92 A;  2RH2 A;  3TU4 K;  1KIK A;  3SHW A;  2EGC A;  3N5B B;  2QEX Q;  2J6F A;  2O01 E;  1OOT A;  3OSV A;  1GRI A;  2DRM A;  1MMG A;  2CT4 A;  5FU6 C;  2COY A;  1M2O A;  1H64 1;  2FYK A;  4F16 A;  5IHN A;  2V1R A;  2M0O A;  2EYY A;  2Y4Y A;  3A8H B;  3CCL A;  4JUV A;  4JRQ A;  3VUB A;  5CQY A;  2NUP A;  1D0Z A;  2JZ2 A;  1K9A A;  2X3W D;  2DIQ A;  1YIJ Q;  7AT1 B;  2GQV A;  3SB2 A;  3QG1 A;  3CCQ T;  2QTV A;  2FZC B;  1KC8 C;  4J7I A;  4XK8 E;  4M77 F;  4GY5 A;  4DOV A;  5DM7 R;  3CD6 A;  4J9F A;  2LCS A;  4QVZ A;  2GBQ A;  2CP6 A;  4CC2 A;  1G3T A;  1SSH A;  4KGV B;  4OMF B;  4E7L A;  4BY6 C;  1H92 A;  2LX9 A;  3HSB A;  3JV3 A;  2LX7 A;  4JDS A;  2JUF A;  2K5F A;  2EKH A;  4C8Q B;  1M2V A;  2DJQ A;  1LCK A;  2DO3 A;  3ER0 A;  1M8V A;  1MV0 B;  2RQU A;  3RDV A;  4ZN3 A;  3J80 E;  3FIF A;  4WCI A;  5L8R E;  5FLX E;  2J6O A;  3V7S A;  1G5V A;  4ZGJ B;  4PJM A;  1VQN Q;  4IIM A;  2OX7 A;  2EYX A;  3IQL A;  4HCZ A;  1M3A A;  3OB9 A;  4QQ6 A;  3C0C A;  1WJQ A;  1ZSG A;  2DPP B;  3FB9 A;  1X6O A;  1BI2 A;  2H3E B;  1UGV A;  2K79 A;  1M3C A;  2E70 A;  2E5Q A;  4A4G A;  2RQT A;  2DL5 A;  1ZSZ C;  5KCH A;  3PFS A;  2ZCF B;  1S72 T;  3OYF A;  3ZBD A;  3RER A;  4M7A B;  1O75 A;  2ZPE B;  3VS2 A;  2ROT A;  2O88 A;  4F7U E;  1U1T A;  4OB3 B;  3I5S A;  1HK9 A;  4DBR A;  4XU2 A;  2OTL Q;  1IHW A;  4C92 D;  3UA7 A;  3A98 A;  1WJR A;  2FG0 A;  2EJG A;  5IHK A;  2JTM A;  1BU1 A;  3EG9 B;  3EGD B;  1MV3 A;  3OYY A;  4EDU A;  2DTI A;  3QUI A;  2DYB A;  5FW9 A;  1Q7Y R;  1Q82 C;  5KYU A;  1EX4 A;  3C94 A;  1VQ4 Q;  4EMH A;  1TU0 B;  2ZPF B;  2KBT A;  1YNZ A;  2EJF A;  1NZ9 A;  4FW2 A;  1B07 A;  3CC7 A;  1K73 U;  3EG3 A;  4CRI A;  2MIO A;  5GAM g;  1I0C A;  4M75 F;  2R58 A;  1VQ8 T;  1Q82 R;  2KSS A;  1IB8 A;  2VXF A;  4HCK A;  2GTO A;  3OSS C;  2L0A A;  4C0F A;  3HHT B;  4ELZ C;  2CZ6 B;  2F5T X;  2QA4 A;  4C5E A;  1VQ5 A;  1KSW A;  2MK5 A;  8AT1 B;  2P4R A;  3PTA A;  2LDM A;  3NPF A;  1PG5 B;  1OZ3 A;  3NTI A;  3OYJ A;  2E6Z A;  3I56 T;  2R5A A;  4DQ2 A;  3L2V A;  1QVG A;  2VKN A;  3VRY A;  3X25 B;  1KJW A;  4F7U G;  3BDU A;  4M77 A;  2MOX A;  4C5I A;  1M30 A;  4NS5 A;  2M9U A;  1UHF A;  2CP7 A;  5KYX A;  1VQO T;  5KH6 A;  1Q86 C;  4BI8 B;  2RF0 A;  4AFZ C;  2GFU A;  3HPW A;  1EZZ B;  2P0P A;  2QTX A;  1N8R C;  1W2B P;  1KC8 U;  2L2P A;  5GAN h;  4M7A C;  3VS7 A;  3L2R A;  4KUI A;  1BB9 A;  1YJW T;  5FRO A;  2OI3 A;  2KXD A;  5CQX A;  1N6A A;  2XKO C;  4F17 A;  1T0H A;  2MF2 A;  3I5R A;  3CCU T;  4QW2 A;  2EQI A;  4D6W A;  1W2B S;  1K76 A;  4ZGD B;  5LJ5 g;  2RA2 A;  2X4X A;  5ECA A;  4AFS C;  3L2Q A;  4B9X A;  2JS0 A;  3GLX A;  1C0M A;  1ZUU A;  5IT9 E;  2O9V A;  3ASK A;  2DET A;  2KAF A;  3CMA T;  2PZ1 A;  3OY9 A;  2KYM A;  2HSP A;  1VQ9 T;  3SD4 A;  2LTO A;  4Y91 A;  3H41 A;  2V1Q A;  3C4S A;  3LH5 A;  2VB6 A;  4OF1 A;  1KQ2 A;  4J83 A;  4TVR A;  2JM8 A;  1OI1 A;  2KDS A;  1JB0 E;  2YT6 A;  3CC2 Q;  1MNE A;  1M1K C;  1RAB B;  4M7A F;  4C92 B;  4M7A E;  4A53 A;  3SFM A;  2PVD B;  1ABQ A;  3D7S B;  1UJ0 A;  2EYW A;  1JJ2 P;  3HL8 A;  1X6G A;  1Q7Y U;  1KQS A;  4IUQ A;  3MHX A;  3M0T A;  3JCM P;  2LJ3 A;  2H8H A;  4JJB A;  1H8K A;  2R5M A;  4HT8 A;  4PFZ A;  3G71 T;  2EW3 A;  1M1K R;  3CCJ T;  4HKE A;  3M0U A;  1RI0 A;  3CPF A;  1X69 A;  2JNG A;  4OVA A;  2LJ0 A;  4M75 A;  4X1V A;  1Q82 U;  5GAO n;  1SSF A;  1VQL A;  3CEY A;  4PLL A;  1M1G A;  2D9T A;  2QK0 A;  4J6X A;  1PKS A;  4CC3 A;  1WHJ A;  4Z8A A;  1XJW B;  4Q5W A;  3GBQ A;  3SWN B;  2EQU A;  2DL3 A;  5GAO p;  4PK4 A;  2HQE A;  3M9Q A;  1IGU A;  1BI3 A;  4B9W A;  4XAX B;  3P8D A;  5CCA A;  4DEX A;  3BFM A;  4MML A;  2M16 A;  3M59 A;  3MP8 A;  4HT9 A;  2VGM A;  2VWF A;  2EQJ A;  3GP8 A;  3CXC A;  3RR6 A;  1JU5 C;  4M7A G;  3PMI A;  1VQ7 T;  2DKG A;  1RLP C;  1J3T A;  3GPL A;  2ATC B;  2RB6 A;  3LW5 E;  1D1B A;  3MKD A;  4ZNX A;  1WXU A;  2FPE A;  3QJY A;  3EAE A;  2OTJ Q;  1Q86 U;  2YUP A;  2R57 A;  5CKF A;  1UB4 A;  1ZX6 A;  2HKN A;  3QWX X;  2K6D A;  4C0D B;  1TUC A;  3INZ A;  2XDB A;  1VQP Q;  2WSC E;  4XTZ A;  1D3B B;  4C8Q A;  2W0Z A;  2F2V A;  3OYB A;  2LZ6 B;  4JZ3 A;  3QWY A;  2QYZ A;  5GAO m;  1FMK A;  2EGE A;  4CC4 B;  2RHY A;  2X3X D;  2CH4 A;  4DBQ A;  3MP1 A;  3QYH B;  1QW1 A;  3MCA B;  1R77 A;  3X28 B;  2HMA A;  4M78 C;  3BW1 A;  1VYT A;  2KK4 A;  4C5G A;  1TUG B;  1YI2 T;  2HEQ A;  1ACM B;  4IUP A;  1IZ6 A;  5LL6 S;  2RI5 A;  3JCM W;  2RD1 A;  1K9M C;  1Y71 A;  2LQK A;  5GAO q;  1Q81 R;  1YWO A;  4E2F B;  3M55 A;  1E7O A;  3SWN C;  3OYK A;  4M7A A;  3CCS Q;  1VYV A;  2E41 A;  3A5Z B;  2CP2 A;  5LJ5 j;  1YIT Q;  4LXC A;  3JB9 I;  1PCX A;  4M7D E;  4R56 A;  3S3O A;  3JSC A;  2EPD A;  1K9M R;  2DBM A;  5A0L A;  1RAF B;  2QEX A;  3AT1 B;  4BE2 A;  1M1K U;  4C92 F;  2CYZ B;  3JCM b;  2DJZ A;  3EG9 A;  3EGD A;  1MMN A;  2DXT A;  1JEG A;  3HFN A;  4DOW A;  2XG8 D;  3DLM A;  5GAN 7;  1I5O B;  3S3N A;  5I2M A;  1YJN T;  1RAE B;  3M5A A;  4M78 E;  2HKQ B;  5EC7 A;  3G1J A;  3NTK A;  2CDT A;  1YIJ A;  2LNH B;  1QCF A;  1NM7 A;  1W1F A;  4E7H A;  1I07 A;  5FRM A;  5GAM h;  3REB B;  2X9H A;  1EIF A;  4RTZ A;  1VQ6 T;  2RJF A;  1NLP C;  2M02 A;  2WSE E;  3VV0 A;  5GMK i;  3QYG B;  3OYE A;  4C0D C;  4YTL A;  5CKB A;  3WVD B;  3CC4 Q;  2PNI A;  2CSQ A;  5IAY A;  2XI9 A;  3ZFJ A;  4C0Z A;  3THK A;  3QJ6 A;  1F1B B;  2QQB A;  1PHT A;  1VIF A;  4J9B A;  4PFP A;  4C0G A;  1YJ9 T;  4M7D G;  4E7Z A;  1AEY A;  1WDX A;  3O8V A;  1TH7 A;  4OB2 B;  3CCM T;  1N9S A;  2RQR A;  1SF9 A;  5CKD A;  2V26 A;  4OML A;  2GFA A;  5HK0 A;  2HD0 A;  1QWF A;  2EWN A;  1VQN A;  4RTX A;  1SG5 A;  3CCQ Q;  4BAC A;  4FL6 A;  4M78 G;  2L89 A;  2DVJ A;  2RK2 A;  1PC0 A;  2YHT A;  2LCL A;  4HCC A;  2XIC A;  4F7U B;  3A8M B;  2ED1 A;  2HL3 A;  4AT1 B;  4FSX A;  4IUU A;  4D8D A;  2RJD A;  3H8Z A;  4M7A D;  2BE9 B;  2AZS A;  3M53 A;  3X20 B;  1W6X A;  1XNI A;  5LJ5 h;  2OTL A;  1VQM T;  3CPW P;  4N0A A;  3FC3 A;  2LP5 A;  2E10 A;  3FLG A;  1OYX A;  4OP0 A;  1ARK A;  1IHV A;  2QG9 B;  4WTO B;  5GJV B;  1Q81 U; 
#chains in the Genus database with same CATH homology
 2LQ8 A;  4XU2 A;  1VQM A;  1S72 A;  4M7D F;  2QQA A;  3FDR A;  1NPR A;  4C92 D;  1WJR A;  2X35 A;  4R55 A;  2EJG A;  1B34 B;  2JTM A;  3OYY A;  3V7C A;  4EDU A;  5HKC A;  2DTI A;  2JN0 A;  3CC7 T;  4LD9 K;  3QUI A;  2JVV A;  1LJO A;  2GF7 A;  5FU7 B;  4NL3 A;  2KMT A;  1K9M U;  1Q82 C;  2VGN A;  4BUG A;  3CPW S;  3C94 A;  3CXC S;  4EMH A;  4LDV A;  3MEA A;  2AHJ B;  2ZPF B;  4C92 A;  4FM4 B;  1NPP A;  2MAM A;  3JCM X;  2EJF A;  1NZ9 A;  3QZ5 B;  4JS5 A;  3M58 A;  2V8I A;  4L59 A;  3CC7 A;  3OYG A;  2H3J A;  1QP3 A;  4A4E A;  1K73 U;  3GIB A;  4CRI A;  4M78 F;  3QKJ A;  2BUD A;  2QA4 T;  4C8Q G;  1DJ7 B;  5GAM g;  4M75 F;  1VQ5 T;  2R58 A;  3UDC A;  4IUR A;  1VQ8 T;  1QVF A;  2ZZD A;  2HNI A;  2KSS A;  4X34 A;  2PQW A;  4E7I A;  4FT4 A;  2VXF A;  2I2L A;  3OSS C;  5J39 A;  3CCR T;  3CD6 T;  3WVE B;  2EQK A;  4C0F A;  3HHT B;  4ELZ C;  5GMK l;  4PJO D;  2DK3 A;  4XQ3 A;  2CZ6 B;  2EYQ A;  5LJ3 f;  2F5T X;  4XU0 A;  2QA4 A;  4C5E A;  3QXE B;  1VQ5 A;  1VQ8 A;  3E9F A;  1AHJ B;  3QBY A;  4XTV A;  4RCB A;  3PTA A;  2LDM A;  2RI2 A;  4M77 D;  3L2U A;  3L1A A;  1OZ3 A;  3NTI A;  2QQ9 A;  2E6Z A;  1WPY A;  3OBW A;  4MMK A;  3JCM g;  5GAN 8;  3OYC A;  3OYJ A;  3I56 T;  2R5A A;  1VQK T;  5EG2 A;  1BKB A;  3OMC A;  4DQ2 A;  5I21 A;  5GAM d;  5J3B A;  3L2V A;  3CCR A;  3JB9 J;  1RL2 A;  1QVG A;  4PJO A;  3OBY A;  1WGS A;  3VYH B;  4J7F A;  4PNO A;  4KUL A;  3X25 B;  4F7U G;  4IUT A;  3JCM h;  3BDU A;  5GAN 5;  2D6F A;  4JLG A;  3E9G A;  4M77 A;  3KXT A;  5GMK e;  4XTY A;  3I55 T;  2EKO A;  3LYI A;  4NS5 A;  4C5I A;  2M9U A;  1IRE B;  2F69 A;  1M5Q 1;  4FIB A;  3I56 A;  4LDX A;  1VQK A;  5CAI A;  1VQO T;  3Q1J A;  5KH6 A;  1U1S A;  1Q86 C;  3KBG A;  3V8J A;  3T9N A;  3M57 A;  5J26 A;  5GAM j;  3LLR A;  4BI8 B;  2LCC A;  3OMG A;  4FT2 A;  2GFU A;  5FRN A;  3JB9 G;  3HPW A;  4EMK C;  5GAN g;  4JJN K;  1K8A C;  2P0P A;  2QTX A;  1N8R C;  4N0A C;  3MEU A;  1M90 U;  3I55 A;  1KC8 U;  1G3Y A;  2O4X B;  2RHZ A;  2M1H A;  3OYA A;  4WF2 A;  4A4H A;  4Y28 E;  5CK9 A;  1UGQ B;  3QZ9 B;  2V8J A;  1VQO A;  5DLQ E;  5GAN h;  4M7A C;  1BIA A;  1R8O B;  3GF5 A;  2EJ9 A;  2OAU A;  3L2R A;  2LRQ A;  2MI6 A;  4KUI A;  2EAY A;  2L3R A;  4MZP A;  3AHU A;  4ZGE B;  1YJW T;  4X9C A;  5FRO A;  5M9O A;  2E6N A;  4P5N A;  1G3S A;  2LT1 A;  3NFC A;  4J5Y A;  5D6W A;  5CQX A;  3RIR A;  4A4K A;  1N6A A;  2E65 A;  2XKO C;  2HAX A;  2XU8 A;  3JCM Q;  4L5G A;  4LDW A;  3GNF B;  3GNG A;  3HRT A;  2BIV A;  2ZPG B;  2MF2 A;  2YRV A;  3CC2 T;  5GAN 3;  3OYD A;  5GAO l;  4QW2 A;  3CCU T;  4D6W A;  1W2B S;  1YJW A;  5LJ5 g;  4ZGD B;  3M4Y A;  4C92 C;  2RA2 A;  2X4X A;  1D3B A;  3HRS A;  5FU7 C;  3L2Q A;  3QO3 A;  4B9X A;  3GLX A;  4L6V 5;  5IT9 E;  3ASK A;  5GAM f;  2KAF A;  3CMA T;  3NTH A;  1Y96 A;  3OY9 A;  5D6X A;  2CS7 A;  1G3W A;  4X9D A;  1ZQ1 A;  4QVD A;  4BB7 A;  2X4Y A;  3CC2 A;  3JB9 H;  1WQ7 A;  2HQX A;  3CCU A;  1VQ9 T;  2BKD N;  2NLU A;  3M4G A;  3PMT A;  3SD4 A;  3TCJ A;  4RCC A;  4CI0 C;  5DLO A;  2DAQ A;  4M7D D;  2LTO A;  3FJP A;  2XHC A;  4Y91 A;  2FHD A;  1Q81 C;  4F7U F;  3C95 A;  4BD3 A;  3CMA A;  5LJ3 e;  4RKU E;  5C6S A;  2LVM A;  3C4S A;  3CBP A;  4BDY A;  5LJ3 j;  4OF1 A;  5LJ5 d;  3FRN A;  4J83 A;  4TVR A;  1KQ2 A;  1N9R A;  4ZTF A;  1NJI C;  1OI1 A;  2KDS A;  1JB0 E;  1VQ9 A;  4M7D A;  3R6O A;  3X24 B;  1M1K C;  2DXC A;  4M7A F;  4C92 B;  4M7A E;  5A2Q E;  4A53 A;  3DB3 A;  3JAM E;  3SFM A;  3JB9 F;  2PVD B;  4HA8 A;  1OZ2 A;  4PJO C;  4LDY A;  3HL8 A;  3HRU A;  1Q7Y U;  4M78 D;  4IUQ A;  3VUZ A;  1KQS A;  3L42 A;  3MHX A;  4M75 D;  3JCM P;  1VQL T;  4M77 C;  2PVO B;  4ME7 A;  4IUV A;  2R5M A;  4HT8 A;  1YCY A;  2KQW A;  3G71 T;  3CCJ T;  2DD5 A;  4HKE A;  2DXB A;  5KE3 A;  1KQ1 A;  1RI0 A;  3CPF A;  2P0K A;  3VU3 C;  2RHX A;  1ZBX A;  4JRP A;  2DD4 A;  2JNG A;  3RKW A;  4C92 E;  4LDU A;  4OVA A;  4M78 A;  3CCE T;  2ZPI B;  3M56 A;  1BI1 A;  3E19 A;  2XDP A;  3PGG A;  4M75 A;  3CCV T;  1LOJ A;  1Q82 U;  4KBM B;  1SSF A;  2FB7 A;  5GAO n;  2QQS A;  2FL7 A;  3CEY A;  1VQL A;  4J6W A;  1M1G A;  4PLL A;  2D9T A;  2E64 A;  3PIO A;  3G71 A;  2LNV A;  5A0D A;  3CCJ A;  2VV5 A;  4J6X A;  4QQD A;  4XTW A;  5GMK m;  2Y90 A;  2DIG A;  1O9S A;  3L2Z A;  4Q5W A;  3CCE A;  2DEQ A;  3QII A;  5AYF A;  2EQU A;  3SWN B;  5GAN 6;  3CCV A;  4PJO B;  3JCM V;  3VJP A;  3BDL A;  3HKS A;  5GMK h;  4BE0 A;  5CVI A;  3OS5 A;  5GAO p;  2HQE A;  4M77 B;  4MDX A;  3SWN A;  1FX7 A;  4XTX A;  3M9Q A;  4B9W A;  1BI3 A;  2MWP A;  2DTH A;  1VIE A;  2OTJ T;  2PVG B;  4XAX B;  5LJ5 f;  3G6E T;  3P8D A;  3TEE A;  5CCA A;  4ELY C;  4MZT A;  2CZ7 B;  3BFM A;  4MML A;  1KHC A;  3PNW C;  3E1S A;  2M16 A;  2G3R A;  3M59 A;  3MP8 A;  2DVE A;  4HT9 A;  3OYM A;  3OYI A;  2KY9 A;  5GAO r;  2E1H A;  2VGM A;  1VQP T;  5GAM e;  2EQJ A;  3OS2 A;  3CPW A;  4EMG A;  1YHQ T;  3GP8 A;  3CXC A;  1W4S A;  3RMQ A;  1PSF A;  2K3X A;  4PJO E;  1FWZ A;  2RHU A;  3PMI A;  4M7A G;  1VQ7 T;  3V8K A;  2OTJ A;  2DKG A;  3G6E A;  5I2S A;  1KHI A;  1M90 C;  4HCB A;  2WAC A;  3KUF A;  3JCM d;  1I81 A;  4M77 E;  1WQW A;  4ZN1 A;  1X01 A;  3OW2 S;  2L8D A;  3GPL A;  2XD0 A;  5IN1 A;  2RB6 A;  3LW5 E;  4E47 A;  5KE2 A;  3URG A;  2JTF A;  2GCX A;  1UGR B;  2DXU A;  3S6W A;  1VQP A;  2VXE A;  1YHQ A;  2VC8 A;  3RUX A;  4C5H A;  4C8Q D;  1HXD A;  5FU6 B;  4JRQ A;  3QDR B;  2QI2 A;  3QJY A;  1VQ7 A;  5A0G A;  3EAE A;  2CGH A;  3VYG A;  2MMP A;  3RES A;  3J7A F;  3QSU A;  1Q86 U;  2R57 A;  5CKF A;  3UPU A;  1UB4 A;  1FXX A;  4C92 G;  2RO0 A;  3J81 E;  3OYN A;  4C0D B;  3MEV A;  3INZ A;  2XDB A;  2RI3 A;  1KD1 U;  2WSC E;  4XTZ A;  1D3B B;  4C8Q A;  1KG1 A;  5GAN d;  3OA6 A;  5CKE A;  4KUD K;  3QPH A;  3OYB A;  3TRE A;  3ZEH A;  3OQ5 A;  4OGE A;  1WJS A;  3MP6 A;  1Y96 B;  1V29 B;  5GAO m;  1QVP A;  3H6Z A;  2PUO B;  2D0Q B;  2EIF A;  2PUK B;  2HBP A;  1UGS B;  2RHY A;  3F70 A;  3CCS T;  2XDD A;  3LH0 A;  2LT4 A;  2MWO A;  3MP1 A;  4VUB A;  3X26 B;  1YIT T;  1LNX A;  2RJC A;  5LJ3 h;  4JRK A;  4BY6 B;  3QYH B;  1QW1 A;  2K4Y A;  5GAN j;  1BYM A;  2WSF E;  3MCA B;  3X28 B;  1UEB A;  1QP2 A;  2K5L A;  4M78 C;  1MHN A;  3BW1 A;  4UC4 A;  4M75 C;  2KK4 A;  4BDZ A;  1JBM A;  1I4K 1;  3G4S T;  4C5G A;  4E7J A;  3CCS A;  4M7D B;  2E12 A;  2K2V A;  4F7U A;  1YI2 T;  4II1 A;  1YIT A;  4IUP A;  4PJO G;  3OW2 A;  2DZC A;  1IZ6 A;  2V8K A;  3JCM f;  3JB9 D;  1VQ4 T;  3G7Z A;  4J6Y A;  3JRZ A;  5LL6 S;  4QVC A;  3CME T;  4EMK A;  2QXF A;  2VYT A;  2K5I A;  2RI5 A;  3UWN A;  3JCM W;  2RD1 A;  3JCM J;  1Y71 A;  2LQK A;  4M77 G;  4BI3 A;  1K9M C;  4DA4 A;  5GAO q;  3WXM B;  3A8G B;  1BI0 A;  2CZ0 B;  3MEW A;  4ATO A;  2QEX T;  3M55 A;  4MZM A;  3RKX A;  2QDY B;  3G4S A;  3SWN C;  3OYK A;  2A7Y A;  1Q7Y C;  5LJ5 e;  5D6Y A;  3C12 A;  4FU6 A;  1YI2 A;  4M7A A;  4V2S A;  1GXI E;  2CKK A;  2E41 A;  3A5Z B;  3FEO A;  5LJ5 j;  1VQ4 A;  4GLK A;  1QVG S;  3JB9 I;  3CME A;  2P4T A;  4M7D E;  4R56 A;  4Z02 A;  2DZ9 A;  3S3O A;  1K73 C;  3JSC A;  5CIU A;  4XU3 A;  4M78 B;  3GOX A;  4RG8 A;  4M75 B;  2QQR A;  5A0L A;  1UGP B;  1NJI U;  4PL6 A;  1MGQ A;  2QEX A;  5GAN f;  4A54 A;  1W2B A;  4BE2 A;  1M1K U;  4C92 F;  2CYZ B;  3VKI A;  4NOY A;  2DJZ A;  3JCM b;  4OGC A;  5GAN 2;  1I5L A;  1B34 A;  4A4F A;  3EFS A;  2DXT A;  1YIJ T;  3A8L B;  4RG2 A;  3PT9 A;  3CC4 T;  4N4G A;  3HFN A;  5DY9 A;  1P92 A;  2RH2 A;  4PKC C;  4DOW A;  2LC4 A;  3TU4 K;  3DKM A;  2XG8 D;  2F5K A;  2RHI A;  3DLM A;  4XTU A;  5GAN 7;  3L2W A;  3N5B B;  4BE1 A;  1JJ2 S;  3S3N A;  4KT0 E;  1Y7X A;  2VUB A;  2O01 E;  5I2M A;  3CCL T;  3JCM c;  1YJN T;  3CBO A;  3M5A A;  4M78 E;  3OSV A;  3DB4 A;  4M75 E;  2IVW A;  2X4W A;  3NTK A;  2DTO A;  1YIJ A;  5KCO A;  3CC4 A;  5FU6 C;  4E7H A;  2FYK A;  1H64 1;  5GAM h;  5HY6 A;  5FRM A;  2M0O A;  1EIF A;  1N27 A;  2Y4Y A;  3LWI A;  4C8Q C;  1VQ6 T;  2C06 A;  3OS1 A;  3A8H B;  2RJF A;  3MO8 A;  3CCL A;  4J8O A;  1YJN A;  3LWH A;  4JUV A;  3VV0 A;  1ZHI A;  2WSE E;  2L5Q A;  3QYG B;  3VUB A;  5CQY A;  3CBM A;  4C0D C;  5GMK i;  2ZPH B;  2RJE A;  3OYE A;  4IKF A;  2JZ2 A;  4XU1 A;  4YTL A;  5CKB A;  2DIQ A;  3WVD B;  4PJO F;  2GQV A;  3SB2 A;  3QG1 A;  4JRI A;  4EPC A;  4RMO A;  3CCQ T;  1X75 C;  5IAY A;  2XI9 A;  3ZFJ A;  4ZTJ A;  3LGL A;  4C0Z A;  5CKH A;  1KC8 C;  4J7I A;  4XK8 E;  4M77 F;  4GY5 A;  2K3Y A;  4DOV A;  1VQ6 A;  1JRI A;  2JOY A;  3UT1 A;  5DM7 R;  3CD6 A;  2RK1 A;  3QJ6 A;  3S3M A;  2QQB A;  4QVZ A;  1VIF A;  1G3T A;  3OYH A;  3OS0 A;  1VQN T;  1H3Z A;  3V7R A;  4OMF B;  4C0G A;  1YJ9 T;  1YBY A;  5GMK j;  4BY6 C;  4E7L A;  4M7D G;  3CCQ A;  3O8V A;  1TH7 A;  4OB2 B;  2ZPB B;  3CCM T;  1N9S A;  2LX9 A;  3HSB A;  4NL2 A;  4BI4 A;  2YLB A;  2EFI A;  3HFO A;  4JDS A;  5CKD A;  3LX7 A;  3JCM e;  2JUF A;  3P8B B;  2K5F A;  4C8Q B;  1NE8 A;  2KVQ G;  4JLI A;  1M1F A;  2A3L A;  2GFA A;  1BIB A;  5HK0 A;  2HD0 A;  2DO3 A;  2K57 A;  1KD1 C;  4M7D C;  3ER0 A;  1JJ2 A;  1M4Z A;  2EWN A;  2FVU A;  1K8A U;  1U8R A;  1VQN A;  1M8V A;  1YJ9 A;  1N8R U;  4O5V A;  2XID A;  4E7K A;  1PSE A;  3RMS A;  3CCM A;  1XTD A;  4MDW A;  3LGF A;  4QQG A;  2B8A A;  4ZN3 A;  3J80 E;  3FIF A;  2O4X A;  4BAC A;  3DLL A;  1Y07 A;  3BY7 A;  5L8R E;  5FLX E;  5LJ3 g;  4FL6 A;  4LD6 A;  3V7S A;  4M78 G;  1G5V A;  2L89 A;  3P8H A;  1XQH A;  3HP9 A;  4M75 G;  2IG0 A;  4ZGJ B;  1I8F A;  3PIP A;  2RK2 A;  1M9S A;  1KQS S;  2YHT A;  4C8Q F;  4C8Q E;  5GAN e;  2ZGW A;  2LCL A;  4HCZ A;  1WNL A;  2PU9 B;  3OB9 A;  2YLC A;  4QQ6 A;  3RKY A;  4HCC A;  4OB1 B;  2OTL T;  2XIC A;  4O6J A;  1WJQ A;  5GAN 4;  2DPP B;  3FB9 A;  1QVF S;  1X6O A;  1BI2 A;  2CZ1 B;  3QHS A;  3A8M B;  4F7U B;  1XOV A;  3MET A;  2E70 A;  2E5Q A;  4FSX A;  4IUU A;  4EMK B;  2RJD A;  4A4G A;  3H8Z A;  4JS4 A;  4M7A D;  3ME9 A;  2X4J A;  5CR2 A;  3M53 A;  3M54 A;  3PFS A;  4N4H A;  5KCH A;  2RM4 A;  3X20 B;  5LJ3 d;  5LJ5 h;  1XNI A;  2OTL A;  2ZCF B;  4N4I A;  2XK0 A;  1VQM T;  3OYF A;  2P0Q A;  3ZBD A;  1S72 T;  4N0A A;  3RER A;  5CO7 A;  4M7A B;  3SDZ A;  1O75 A;  2Y4X A;  3FC3 A;  2ZPE B;  3EFR A;  2E10 A;  3V8L A;  3FLG A;  4PLI A;  1OYX A;  1VUB A;  4OB0 B;  4OP0 A;  5HK3 A;  3OYL A;  4F7U E;  1U1T A;  3A8O B;  4OB3 B;  1Q81 U;  2EQM A;  1HK9 A;  5C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...