2GCXA

Solution structure of ferrous iron transport protein a (feoa) of klebsiella pneumoniae
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
75
structure length
75
Chain Sequence
MQFTPDSAWKITGFSRDISPAYRQKLLSLGMLPGSSFHVVRVAPLGDPVHIETRRVSLVLRKKDLALIELEAVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein A
publication title Solution Structure of Ferrous Iron Transport Protein A (FeoA) of Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae
molecule tags Transport protein
total genus 8
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gcxA01
1BI0A 1QVPA 2GCXA 2QQAA 1FWZA 1BI2A 2LX9A 2K5FA 3E19A 1U8RA 2H3JA 4O6JA 2QQ9A 1BI1A 1FX7A 1G3YA 1BI3A 3HRTA 1QW1A 3GLXA 2K4YA 3HRUA 2K5LA 1BYMA 1G3WA 2QQBA 3HRSA 1G3SA 1P92A 3MHXA 5CVIA 2K5IA 1G3TA 4O5VA
chains in the Genus database with same CATH superfamily
3OS0A 3N5BB 3S3OA 2V1QA 3H8ZA 2EQJA 1LOJA 2RK2A 5GAMj 2E10A 2M1HA 3CMET 1PRMC 1W2BS 1I4K1 4C92D 1JXMA 1NEGA 2PUOB 3AT1B 2P4RA 1YI2T 3M53A 2ED1A 2LCSA 1AOJA 1UGRB 2DX1A 2DXUA 2LJ3A 1T3SA 1IZ6A 1G83A 5GAOl 1S72Q 4J6XA 3MCAB 5GJWB 2AKKA 3JV3A 2PZ1A 4IIMA 5CIUA 2QGFB 4XU3A 3REAB 4F14A 1NLPC 1SHGA 5GMKm 1BK2A 4KUIA 3VS1A 2QA4A 1V1CA 5L23A 3LH5A 1TTHB 1K4US 2HMAA 2OJ2A 2YUQA 1KQSP 1KC8U 4QKUA 2E70A 1BB9A 1RAEB 2PVOB 3VS6A 2MI6A 1M2VA 2DEQA 3JCMf 2KVQG 2AZSA 5GAN3 1HYOA 4J9DA 1X6OA 1BCOA 2ATCB 3M59A 7AT1B 3GNGA 2HL5C 4BD3A 2MCNA 1VQOT 1CKBA 3FDRA 1RAHB 4LUEA 5KYWA 1M9SA 2JM9A 2DKGA 2A3LA 1YIJA 3X20B 4ZGJB 4OB0B 4J5YA 1KD1U 2RK1A 3DB3A 1K8AU 4J9IA 1WLPB 4M78E 1VQ6A 3PTAA 2FZGB 3J7AF 1NJIC 1N8RC 1Y71A 2EIFA 1GFCA 4JS4A 2ZGWA 4DQ2A 1I81A 4WF2A 3OSSC 1U1SA 1ZUKA 2BE7D 3QBYA 3CCVA 2ZPBB 4M75C 2CSQA 3M0SA 2HAXA 1YFNA 2WSFE 3H0HA 2M02A 1QMCA 5ECAA 4Y91A 3O8VA 1Q81U 5DM7R 5KYNA 4M78A 4XU2A 1Q82U 1AEYA 1WXTA 2DLPA 2AHJB 2FYKA 1S72A 4MDXA 2CGHA 4M77F 3I5RA 3SB2A 2LDMA 4ANJA 3CD6Q 2EYWA 2H3JA 1M2VB 3C12A 3KBGA 5GMKj 2HBPA 4E7KA 4JZ3A 4QW2A 2I0NA 4PJMA 4RTVA 2JUFA 1R8OB 2KYMA 4EMGA 1M90U 1OU9A 3LLRA 4OB2B 3PVQA 4A4FA 2C0OA 4Q5WA 4XU0A 3JB9I 2EQMA 1HD3A 4OB1B 2CP6A 3UDCA 3OYFA 2LQWA 5CVIA 1ZQ1A 5KYWB 2QASA 3OYNA 2NUZA 3U23A 3META 2V26A 4JJBA 1U8RA 4DBFA 2KRNA 3L1AA 3I55T 4XTXA 1ABQA 1QW1A 1PKSA 2E5KA 2LCLA 1KJWA 5IHNA 4PJOG 9ATCB 1RAGB 1VQKA 1VYTA 1D1BA 3VRYA 3OW2A 3CBOA 4ZGDB 2RI3A 5CAIA 1IB8A 2MF2A 2CUBA 1VQ7T 5I11A 3I5SA 3V8LA 4F17A 4M7DA 1VQLQ 3CCUQ 2DK3A 1G3YA 2J7IA 4C8QF 3HPWA 4DOVA 1UGQB 4Z8AA 3RESA 1YIJT 3G71T 2HQXA 2DMOA 1WHHA 2RMOA 4X9CA 4PJNA 3VS5A 2YUPA 5GAN8 2WSEE 2CREA 2GFAA 4FIBA 3DB4A 5IHKA 2JVVA 2BE9B 2DIGA 5KYXA 1KFZA 1NJIU 1N8RU 4ZTFA 2F1LA 2ROTA 4FW1A 1IREB 2EGAA 4J9BA 2RB6A 1K73R 1VQ8Q 2X3XD 5CKDA 1X2QA 1VQ5T 2EPDA 4HCKA 1QVPA 3A98A 2GCXA 5GANh 4F7UA 5CK9A 2K3YA 2RI2A 1D0XA 2YRVA 3CMAQ 4M7AF 1NE8A 3X26B 1XNIA 2DO3A 3RMSA 1WQ7A 3OYMA 2FPFA 1S72T 2OX7A 2ZPEB 3UA6A 2KNBB 1Z9QA 1WQWA 2J05A 4N4HA 1S1NA 2CP3A 4M7AB 1RL2A 5D6XA 1GBQA 1SPKA 1K9MR 3MP1A 3THKA 4O6JA 1B3QA 4B6MA 4RTYA 2KT1A 1X6GA 4M7DB 1UGSB 2DZ9A 4M78C 3CCJT 4PJOE 2DF6A 2RNAA 2GTJA 1UGPB 2DRKA 2L2PA 2XK0A 5KCHA 2CH4W 4OGCA 1YWPA 3JB9J 3GF5A 2K5FA 5D7UA 1KIKA 2MAMA 2JTFA 4RMOA 1VQLA 4XTVA 2H3EB 1OPKA 1K9AA 4NOYA 1QCFA 2O31A 1D09B 5KYXB 4RKUE 3QJ6A 1BYMA 3M0TA 2EGCA 2FL7A 2QQSA 2KGTA 3CCEQ 1NEBA 2HQHA 3EHQA 1IGQA 1QP2A 2F2XA 3QZ5B 3MP8A 2O9VA 4RCBA 4CC2A 3VS7A 4F7UB 4Z02A 2K2VA 1TH7A 2V1RA 1IRXA 2CYZB 2JJ9A 3A5ZB 1VQ8A 4BDZA 2D0QB 2HZYA 3CCMQ 2O9SA 2YWWA 4HXJA 3A8OB 3OYEA 3EG9A 2LX9A 5LJ3h 5I2SA 2YUNA 5IT9E 4C92F 3CMAA 4PL6A 4LDVA 2KT8A 2E4HA 3OYJA 3WVDB 3D7SB 4RTWA 2EJFA 1RAFB 2QGGA 3JAME 3NTIA 4ELZC 3HFNA 4MZMA 4M75G 3RMQA 2QDLA 3CD6T 5GAOn 4N0AA 3QWYA 1M8MA 2HL3A 2YT6A 2IG0A 2A08A 1WHJA 1TXQA 2CH4A 1FMWA 1AHJB 3R6OA 2LX7A 3OYBA 2D8JA 2E6NA 4FT2A 1KQ2A 1U3OA 3G4SQ 2XI9A 1X01A 3H6ZA 1UJYA 3QJYA 1Y07A 4RG8A 1K73C 3OYLA 3L2UA 2DFUA 2O88A 3TU4K 2XHCA 3ER0A 3T9NA 1G8XA 4BE0A 4BE1A 2C06A 3HKSA 1T3LA 4RTUA 4V2SA 4XTYA 2VGNA 1JU5C 3MHXA 1M4ZA 2K5IA 1WFWA 4BY6B 2X4YA 4LUDA 4PFPA 4PFOA 1X27A 1OEBA 1VQ4Q 4JRQA 3CCUT 1H3HA 1R0BG 1M3BA 4HT9A 2DD5A 4FU6A 1K9MC 3E9FA 1BBZA 2YHTA 3NTKA 1YHQA 2F5TX 1HK9A 2FB7A 3JCMd 4MZTA 4C0DB 1WIEA 4NS5A 4OMFB 3HP9A 5GANe 1BI0A 1NLOC 5DLQE 3RIRA 2XDBA 2QK0A 3MEWA 1HJDA 2QXFA 2Y90A 3JB9G 2CP5A 1M1GA 2R58A 1UG1A 5I21A 3GPLA 1VQ8T 2M0OA 3UF4A 3CCQA 4HVUA 2QAZA 3CPFA 4PJOC 5KE3A 2PVDB 3CCRA 2HCKA 2WSCE 3OW2S 2QG9B 2Y4YA 5A2QE 3OSVA 4RTZA 3RKYA 2RN8A 4N4GA 1VQMA 3CMAT 3EFSA 4LXCA 3I56A 1IHWA 3NTHA 2DAQA 2CP7A 5IAYA 1JJ2P 4B9WA 2QA4Q 5GMKi 2ZPIB 4FM4B 2PQWA 1AVZC 2RA2A 2RJDA 5L8RE 2KY9A 1WXUA 2DRMA 2X4WA 5GAOq 2CDTA 4KT0E 3CCSA 2E12A 1JO8A 4Y92A 2HD0A 4J9CA 4E7SA 2RQRA 4JRPA 2HBWA 1BIBA 4DA4A 2EW3A 2G3RA 4ZNXA 2ZPHB 2M9UA 1Q95G 1K73U 3EG3A 4BE2A 4LE9A 2E3IA 1AT1B 2JW4A 2ED0A 1TSFA 1VQ4A 1FMKA 2H8HA 4AFQC 4JLGA 2AT1B 2HKQB 4M78G 1VYVA 3VS2A 1GCQC 4AG2C 2EYXA 5FRNA 2O01E 4IUUA 3CCET 3BW1A 1YJNT 3UT1A 4JPBW 1WHMA 1M2OA 4E6RA 3MPUB 4FYWB 1Y0MA 5LJ3e 2XDDA 1RUWA 2EKHA 3MEUA 3SEMA 2K9GA 2K6DA 2V8JA 5LJ5d 1K9MU 3QUIA 2CP2A 3CCVQ 1F1BB 3OMCA 3EFOA 2CP0A 3VJPA 3CPWP 3VRZA 3CCMT 3H41A 2KYBA 4A4GA 5FU6B 4J8OA 2HKNA 2KXCA 1WHGA 1RAAB 2EAYA 3M9QA 5LJ3g 4OMLA 4KH1B 1RADB 3PT9A 3EFRA 4AFZC 1N27A 1ZSZA 4M75F 4DEYA 4NL3A 2D0NA 1HXDA 1GRIA 3PGGA 1IHVA 3S3MA 4GY5A 3TVTA 5FROA 3S3NA 4AG1C 4JDSA 1VQ9T 4M7DG 1AWJA 1LJOA 4JRIA 2QQAA 1BCMA 3J80E 4RCCA 1GBRA 2DETA 4PJOD 3OMGA 3QDFA 2EQIA 1W1FA 2E64A 1XJWB 3G4ST 1KG1A 4E2FB 1M1KR 1WHLA 2VYTA 2GQIA 3X25B 1VQKQ 4M77A 3TREA 2DYIA 4ZGEB 4DEXA 5KE2A 4MMKA 1YJWQ 4E7HA 2LC4A 5GAOr 1R0CB 3FIFA 1MMGA 2COYA 2FVUA 4A4HA 2GGRA 3VUZA 4IKFA 1NZ9A 4FL6A 4HVVA 1U06A 4ORZA 2OTLA 1UHCA 1K0SA 1EX4A 4KULA 1B34B 3EFOB 2E1HA 3VS3A 1K0XA 2QTVA 4J7IA 3VS0A 4A4EA 2QEXQ 4R0KA 2DTHA 2EKOA 1VQ4T 1EFNA 5FLXE 1SEMA 4P5NA 2VKNA 2F69A 3M4GA 4EMKB 2DJQA 2JT4A 3FB9A 1T0JA 4R56A 1G2BA 1UB4A 2MYSA 4L59A 5EC7A 3CBMA 1ACMB 1ZSZB 1WX6A 4FSXA 2X35A 4GBQA 1ZLMA 3SDZA 5LL6S 4C5GA 1X75C 2RHUA 1KQSS 5GAMh 3JB9F 3ME9A 5KYUA 3PFSA 3EHRA 1OZ2A 3OYHA 4C8QA 2OAUA 3BDLA 2DTOA 2HDAA 5FU7B 3G7ZA 1OV3A 1M27C 3M4YA 1G3WA 4J6YA 4J9GA 5GAOp 4HCZA 1J3TA 4M77B 2E65A 4M7AE 3CC4A 3CXCP 5GANf 2LQ8A 1W70A 2RHYA 2PUKB 3QPHA 2M16A 2C0IA 5LJ5j 1YITA 4M7DE 1X43A 4J9FA 1BIAA 3M55A 2QA4T 2XKOC 2A28A 4JJCA 3JCMc 3VS4A 2K5LA 2EVRA 1SKUB 3OBWA 1WNLA 1SHFA 1YJWA 2MK5A 2XG8D 3URGA 4QT7A 2KROA 2SEMA 2DE0X 3QZ9B 4M7AA 2GNCA 1H3ZA 2R5MA 3M54A 5IXFA 1YJ9A 1JRIA 1QLYA 1WGSA 3QKJA 2O4XB 5A0DA 1WYXA 2QEXA 4M78F 1TUCA 2JS0A 3M56A 3QYGB 4OMNA 3H0IA 5KYUB 3OYCA 4F7UE 3G6EA 1IO6A 1JEGA 2Y4XA 2KXDA 4LD6A 4PFZA 1VQ6T 2LT1A 3UA7A 4C8QB 2LTOA 3HRTA 1NPRA 5M9OA 3OYKA 2EJGA 1RI0A 2KI7A 5AT1B 1M1KC 4B9XA 5CQYA 1O75A 1DJ7B 2LQKA 2FO0A 3CCVT 1M3CA 3MKDA 1I0CA 2BTTA 2KQWA 2EYQA 1I1JA 4OVAA 1YCSB 4OMQA 1Q7YR 4EPCA 1XOVA 3L42A 3OYDA 4M75D 3SWNA 1JB0E 2MIOA 4C92E 4J6WA 4J9EA 2RF0A 3UWNA 5GMKh 1GXIE 3A8GB 5LJ3f 4EMHA 4E7JA 2JOYA 1V29B 1JJ2A 1BI1A 3LWIA 2SRCA 2RHXA 3INZA 2P0KA 3C94A 5FWCA 4L6V5 3P8BB 4X1VA 2IVWA 2XU8A 1AWXA 3LW5E 5CR2A 4NL2A 2MWPA 3L2RA 1X6BA 3EH2A 1FYNA 1RLPC 4HT8A 2OAWA 4C92A 1VQPA 4ZN1A 3PIOA 3SHWA 4XK8E 2L89A 1LVKA 2DD4A 4GLKA 1QWFA 2K79A 1C1AA 4RG2A 1VQKT 4DOWA 4KBMB 2ZZDA 2O2OA 3QYHB 1Y57A 4FCYA 3JSCA 1ZUYA 3MO8A 4PLLA 1YJWT 2X4JA 4II1A 2AK5A 2NUTA 1PC0A 2QI2A 1K1ZA 1TUGB 2GBQA 1RLQC 3OS1A 1LCKA 3EG0A 1VQNA 1VYUA 3CQTA 3HHTB 4JJDA 2CZ6B 1QVGP 3CCLA 3OYAA 5IN1A 2JMCA 5GAN2 2DVEA 3KFVA 1C6VX 1AWOA 3LGLA 4PJJA 3ZBDA 3NPFA 1YHQQ 5GAMe 3SWNB 3REBB 1Q86R 2PNIA 4QQ6A 2IPOB 3IQLA 4PJLA 3RKXA 3JB9D 4M7AC 2B8AA 3NHNA 4FW2A 4QQDA 2AKLA 2EQKA 1B07A 1WA7A 4M7DC 3CMEQ 3CPWA 3M57A 3CCQQ 3RUXA 2RD1A 3ULRB 1M1KU 2HSPA 4JS5A 4LN2A 4EIKA 2JXBA 3CCRQ 5GAMg 5CKHA 1N6AA 3C4SA 1T0HA 4C92B 1VQMQ 1E6GA 2OI3A 3I56Q 4DBQA 1WI7A 2KAFA 5CQXA 4ZTJA 2VXFA 3EG2A 2LJ1A 3PMIA 3QO3A 3JCMP 1KQSA 2J06A 1P92A 1KHCA 2NUTB 2F2VA 4PJOF 4CC4B 2RI5A 3CCSQ 2EFIA 4ZN3A 2M0YA 1H92A 3JCMg 4E47A 3JCMX 3RDVA 1C0MA 2YSQA 1MV3A 2CT3A 4UC4A 2YXYA 1PM3A 1OX8A 1Q7YC 3QDRB 2RH2A 3HFOA 3J81E 1WPYA 1QVFP 1GFDA 3MEVA 4VUBA 4M78D 2R57A 4F16A 2QQRA 3OYYA 1VQLT 1RAIB 3VUBA 1YCYA 4XTWA 4OF1A 4E7ZA 2D9TA 1M90R 1I07A 2AIRB 1E6HA 2HNIA 4QQGA 3JCMb 3C95A 2DZCA 4N4IA 2BZYA 4XTUA 2KDSA 4Z88A 3RNJA 1OPLA 5GAN4 3QSUA 3EH1A 2J6OA 4A54A 3EG1A 2L3QA 2LJ0A 2VB6A 3E2UA 2COZA 3ASKA 1M1FA 4XTZA 1NM7A 3CMEA 3OQ5A 3HRUA 2GQVA 1SF9A 1YI2A 5IH2A 3A8LB 1N9SA 2DNUA 5GMKe 1G3SA 3X24B 3JCMV 2VVKA 4QVDA 3ZEHA 2Z0WA 3X28B 5A0GA 1YWOA 2LQNA 3OA6A 2W10A 4M77G 3P8DA 2DJZA 4QVZA 2J6KA 2COWA 1JQQA 4M7DD 1K76A 2QQBA 4PK4A 2E41A 4BY6C 3CXCA 3CBPA 3V7CA 1W2BP 1Q86C 5J3BA 2X9HA 5KYYB 4A4KA 3V8KA 2LP5A 3E9GA 1MNEA 1HSQA 3GLXA 5DY9A 3I55Q 1UJ0A 2L3PA 2DL5A 4C0DC 4CRIA 2RM4A 5EG2A 5LJ5g 1VQOA 2EYZA 2QTXA 2BUDA 3GIBA 2J6FA 3FC3A 5AYFA 2FG0A 1NG2A 4OMOA 4N0AC 3GOXA 1NPPA 3E19A 1VQ7Q 4F04B 5D6WA 4M75A 3HSBA 1PD0A 3RR6A 1ZA2B 2JNGA 2OTLQ 3DLLA 1U5SA 3QXEB 1Q7YU 5GANd 1QQJA 1V76A 1G3TA 5J39A 4DBHA 4FSSA 3LGFA 1N9RA 1W4SA 4L5GA 4C8QG 2F5KA 2MPXC 4O5VA 4C5IA 3G71Q 1AZGB 4LNPA 1ZUUA 3S6WA 2KR3A 2MMPA 2LNVA 2L8DA 3HTRA 1FX7A 3UPUA 3FJPA 1YHQT 2DPPB 2L3RA 5HK3A 1B34A 2JZ2A 1JJ2S 2X51A 1D3BA 1Q81C 1BKBA 4LDUA 3EGXA 2PVGB 4AMCA 2OTJQ 4EMKA 3UATA 1VQ5Q 2DA9A 1X69A 3A1PA 4KRTA 4LDWA 1Y7XA 2RQWA 2JM8A 1TWBA 1MHNA 4OMMA 3OY9A 2CKKA 3OBYA 3CCQT 2NWMA 4OB3B 1OQKA 1ARKA 2ABLA 2RHIA 4M77E 1O9SA 1PRLC 1XQHA 1UE9A 3CCRT 3F70A 1M90C 5GAMf 1TG0A 4M7AG 1QP3A 2P4TA 1SRMA 3L2WA 2DYBA 1VQMT 2ZAEA 3I56T 3CC4Q 4LD9K 1WXBA 4IIOA 5I2MA 4ME7A 4IUTA 1YITQ 2EJ9A 2CUDA 2D6FA 2QQ9A 4M75B 2P0QA 3PMTA 2ZPGB 3I55A 3JCMQ 1ZBXA 2JTEA 1MUZA 4XAXB 1OOTA 1H641 3CCJQ 2X4XA 3CCST 1QWEA 2DIQA 2M51A 2ZPFB 3M0PA 1Q86U 3JCMW 4M4ZA 1MV0B 2XIDA 3PE0A 4RTXA 2PTKA 1VQ7A 5IXBA 2YRCA 3HL8A 4PNOA 1UECA 4AT1B 1YJ9Q 1GCPA 3GBQA 5LJ3d 1M8VA 5FU6C 3CPWS 1XTDA 1D3BB 3RERA 3PVLA 1WHKA 4F7UG 3GNFB 3G71A 3M58A 3EGXB 2VUBA 4RUGA 4Z89A 4C8QE 1BI2A 3G6EQ 3TCJA 5CKFA 1A0NB 1QVGA 1OI1A 1AD5A 4HCCA 1RI9A 4KGZB 1I8FA 4EDUA 2O4XA 4KH0B 4X34A 4FYVB 3VYGA 3OS2A 3ZL7C 3V7RA 3JB9H 1M5Q1 4PKCC 1MNDA 2OTJA 2NLUA 5CO7A 1VQ5A 2QYZA 4RTTA 3KUFA 3OYIA 5GJVB 2KSSA 2EBPA 1MMDA 2AZVA 1VUBA 2D8HA 5HK0A 4CC7A 2RQTA 5GANj 2FRYA 2VGMA 4C92G 2ESWA 1IGUA 2P84A 1SRLA 3FLGA 1SSHA 2KRMA 2YUOA 1E7OA 1OZ3A 2PU9B 2A36A 1VIFA 4KGVB 2L5QA 2P0PA 1WZOA 1I5LA 3Q1JA 3MP6A 1Y96A 1LPLA 3JCMh 2K3BA 4ELYC 4J9HA 5D6YA 4DBRA 1YP5A 2DBKA 4C5HA 3FEOA 1FXXA 1PWTA 3M0UA 3CEYA 1JBMA 2K7AA 3EGUA 3SFMA 3CCJA 1WDXA 1D1CA 2DL7A 4D8KA 4EMKC 3V7SA 4JRKA 1VQPQ 3RKWA 2ZCFB 3M0RA 4OGEA 1UEBA 2CZ1B 4MMLA 2XICA 4JJNK 3LH0A 3WXMB 4HKEA 5HY6A 5J26A 1D0ZA 4A63B 4WTOB 5LJ5f 1ZSZC 2YDLA 1CKAA 1TUDA 3R6NA 1VOMA 2LCCA 2QDYB 4FYYB 1QVFA 3BY7A 1WJQA 2KRSA 2MWOA 1KQ1A 3DLMA 4CC3A 1VQNQ 3FJ5A 2OTLT 2EQUA 3CCLQ 4A53A 2E6ZA 5FU7C 4BI8B 5KH6A 2IIMA 3NFCA 3ZFJA 1NBEB 1N5ZA 2F2WA 4K11A 3AHUA 4M78B 1OYXA 3VU3C 4M77C 2LMJA 2RHZA 1KK7A 2JN0A 2VXEA 3CC7Q 3CXCS 1AZEA 1AWWA 2VC8A 1SG5A 2RPNA 1Y96B 1QCOA 5LJ3j 4BDYA 2KMTA 3QHSA 3VV0A 2L0AA 2CZ7B 4BI3A 3CC2Q 2NUPA 2OTJT 2FPEA 4HVWA 3KXTA 5HKCA 1YNZA 2YRDA 2CSIA 4MZPA 4C0FA 2FHDA 2K2MA 3QIIA 2EWNA 1ZBJA 2A7YA 3NMZC 1FWZA 2DBMA 3GP8A 3CD6A 1QKXA 1EZZB 4LDYA 1VIEA 4C0ZA 4YTLA 4X9DA 2VASA 1UDLA 1R77A 5HCKA 5GMKl 4M7DF 2DL3A 4BB7A 2DVJA 2JTMA 5LJ5h 1YBYA 3L2QA 3CC4T 2DERA 2RO0A 3VKIA 1YITT 2DL8A 2FPDA 2FEIA 1W2BA 1VA7A 5IHIA 2DXBA 4C8QC 1BI3A 4E7IA 4ATOA 1UFFA 2DXTA 4FT4A 1EIFA 4C0GA 1SSFA 1UTIA 2K57A 2RQUA 3OS5A 1BU1A 2ROLA 4OMPA 4E7LA 3CCUA 1YJ9T 2VWFA 4F7UF 3A8HB 2FZCB 3MJXA 4XU1A 4JZ4A 3E1SA 1KC8R 3PNWC 2QEXT 2NUPB 3RBBB 4PJOA 1ABOA 1YJNQ 2E3HA 2KE9A 3P8HA 5CKBA 2BIVA 1PG5B 3G6ET 4QVCA 2V8KA 1UHFA 3TSWA 3CC7A 2I2LA 3I9QA 2WACA 2CT4A 4IURA 1B7TA 5CCAA 1YI2Q 3CC2A 4PLIA 2RJFA 1WJSA 1Z9ZA 2L3SA 2GF7A 2GTOA 2FRWA 1GL5A 3L2VA 3M5AA 8AT1B 4KGXB 2A37A 3VYHB 1WJRA 4M77D 3OB9A 1QCNA 3JCMe 1KD1R 1K8AR 2DXCA 5FRMA 5A0LA 1PCXA 5KCOA 2DM1A 3EGDA 1IXDA 1YN8A 2YLBA 5GAOm 3PIPA 4AFSC 5CKEA 2FZKB 2RJCA 3LWHA 1VQ9Q 2BZXA 4IUPA 3L2ZA 1GCQA 2EGEA 2ENMA 1NYFA 4XQ3A 2DTIA 1Q81R 1QVGS 3I35A 1OU8A 5FWBA 1Q82R 4C5EA 3OW2P 1FMVA 4LDXA 3SWNC 1UUEA 5FW9A 1VQOQ 1VQPT 1MMNA 4PJOB 4WCIA 1X2KA 3G1JA 4OP0A 2KEAA 3JCMJ 1MMAA 3C0CA 4BI4A 3TQ7P 5KYYA 2XDPA 3FRNA 3QG1A 3V8JA 3WVEB 5GAMd 1ZSGA 2ECZA 2LVMA 4KUDK 1LNXA 4C8QD 2XMFA 2KK4A 1ZA1B 2D1XA 3HRSA 1OULA 5C0MA 1RABB 3LX7A 3CCEA 2HSEB 1YJNA 1VQNT 2GFUA 2RJEA 1CSKA 2HEQA 4C92C 3CCLT 1G5VA 3BE3A 1M3AA 3EG9B 2C0TA 3LYIA 4IUVA 2K4YA 4HCBA 1PSFA 3EGDB 4D8DA 1UGVA 2G6FX 3MEAA 1TS9A 3CCMA 4MDWA 3O5ZA 2HQEA 3H9NA 1M30A 3CC7T 2DILA 1KSWA 1OX9A 2EYYA 3JRZA 4IUQA 1D1AA 5I22A 1RACB 3CC2T 1U1TA 3EAEA 4M7AD 6AT1B 2LT4A 2KBTA 4AFUC 5LJ5e 3M0QA 4JUVA 3A8MB 2BZ8A 4J7FA 3TEEA 1W6XA 1KC8C 3SD4A 3OYGA 2LNHB 1I5OB 1ZX6A 1VQ9A 1QVFS 2XD0A 1H8KA 2B86A 1D0YA 2YLCA 2DL4A 5GANg 4M75E 3H0FA 5DLOA 2W0ZA 4TVRA 1NJIR 2MOXA 1N8RR 2JMAA 4FYXB 1PHTA 2DEUA 4J83A 1ZHIA 4Y28E 4BUGA 3G4SA 2NYSA 4ESRA 2K3XA 1PSEA 2E5QA 2JS2A 1TOVA 4HA8A 1NYGA 1PD1A 2R5AA 4D6WA 2CZ0B 4JLIA 5GAN5 5GAN7 2CS7A 8ATCB 2A0FB 1KD1C 1K8AC 1PNJA 5C6SA 2VV5A 4R55A 1JXOA 5GAN6 2BKDN 4CI0C 1PKTA 1YIJQ 3NGPA 4GLMA 2V8IA 1QKWA 3QWXX 1MGQA 1VQ6Q 2RQVA 2X3WD 2LZ6B 3BDUA 1TU0B 1KHIA 3TSZA 2LRQA 4BACA 1Q82C 3BFMA 3DKMA
chains in the Genus database with same CATH topology
2X4YA 1VIFA 4C92A 1VQPA 4ZN1A 3PIOA 3N5BB 3OS0A 3S3OA 2L5QA 2P0PA 4JRQA 3H8ZA 2EQJA 1I5LA 3Q1JA 4XK8E 1LOJA 2L89A 2RK2A 3CCUT 3MP6A 2DD4A 5GAMj 4GLKA 2E10A 1Y96A 2M1HA 3CMET 1W2BS 3JCMh 1I4K1 4ELYC 4C92D 2PUOB 4RG2A 1YI2T 5D6YA 1VQKT 4HT9A 2DD5A 4DOWA 4KBMB 4FU6A 2ZZDA 4C5HA 3E9FA 3QYHB 3FEOA 2YHTA 3M53A 1K9MC 1FXXA 3JSCA 3NTKA 1YHQA 3MO8A 4PLLA 2F5TX 1UGRB 1HK9A 2DXUA 2X4JA 2FB7A 3CEYA 3JCMd 1JBMA 4MZTA 4C0DB 3SFMA 4II1A 1IZ6A 4NS5A 5GAOl 2QI2A 3CCJA 4J6XA 3MCAB 4OMFB 4EMKC 3HP9A 3V7SA 1BI0A 5GANe 4JRKA 3OS1A 5DLQE 1VQNA 3RKWA 3RIRA 2XDBA 5CIUA 2ZCFB 3HHTB 4OGEA 1UEBA 4XU3A 2CZ1B 3MEWA 2CZ6B 2QXFA 2XICA 2Y90A 4MMLA 3CCLA 3OYAA 5GMKm 3JB9G 5IN1A 4JJNK 3LH0A 3WXMB 4HKEA 5GAN2 1M1GA 4KUIA 2DVEA 5HY6A 2QA4A 5J26A 2R58A 5I21A 3GPLA 1VQ8T 2M0OA 3LGLA 3CCQA 5LJ5f 3ZBDA 1KC8U 2LCCA 3CPFA 5GAMe 2QDYB 2E70A 4PJOC 1QVFA 5KE3A 3SWNB 2PVDB 3CCRA 2WSCE 3OW2S 3BY7A 4QQ6A 1WJQA 2Y4YA 5A2QE 3OSVA 2MWOA 1KQ1A 2PVOB 3RKYA 4N4GA 3DLMA 3RKXA 3JB9D 1VQMA 3CMAT 2B8AA 3EFSA 2MI6A 4M7AC 2DEQA 3JCMf 4QQDA 2EQKA 3I56A 2OTLT 2EQUA 3NTHA 2KVQG 5GAN3 4A53A 2DAQA 2E6ZA 4M7DC 5FU7C 4BI8B 5IAYA 1X6OA 4B9WA 3M59A 5KH6A 3CPWA 5GMKi 3M57A 2ZPIB 3NFCA 3GNGA 4FM4B 3ZFJA 2PQWA 2RA2A 4BD3A 3RUXA 2RJDA 1VQOT 2RD1A 1M1KU 5L8RE 3FDRA 3AHUA 4M78B 4JS5A 1OYXA 2KY9A 3VU3C 4M77C 2RHZA 1M9SA 2DKGA 2A3LA 2X4WA 5GAMg 5GAOq 1YIJA 2JN0A 3X20B 4KT0E 3CCSA 5CKHA 1N6AA 2E12A 3C4SA 4C92B 2VXEA 2HD0A 3CXCS 4ZGJB 4OB0B 4J5YA 2VC8A 2RK1A 3DB3A 1K8AU 1KD1U 2KAFA 5CQXA 1Y96B 2VXFA 4ZTJA 4JRPA 4M78E 5LJ3j 1BIBA 4BDYA 1VQ6A 2KMTA 3QHSA 3PMIA 3VV0A 2CZ7B 4BI3A 3PTAA 3QO3A 4DA4A 2G3RA 3JCMP 3J7AF 1KQSA 2ZPHB 2M9UA 1NJIC 2OTJT 1N8RC 1Y71A 1K73U 2EIFA 3KXTA 1P92A 1KHCA 4JS4A 4BE2A 5HKCA 2ZGWA 4DQ2A 4MZPA 4C0FA 4PJOF 1I81A 2FHDA 2RI5A 3QIIA 2EWNA 4WF2A 2A7YA 1VQ4A 1FWZA 2EFIA 3OSSC 3GP8A 3CD6A 1U1SA 4ZN3A 3QBYA 4LDYA 4JLGA 4M78G 3CCVA 2ZPBB 1VIEA 3JCMg 4C0ZA 4M75C 4YTLA 4X9DA 2HAXA 2WSFE 5GMKl 5FRNA 4Y91A 2O01E 4IUUA 3O8VA 1Q81U 4E47A 5DM7R 4M7DF 3JCMX 4UC4A 4M78A 4XU2A 4BB7A 1Q82U 3CCET 3BW1A 2JTMA 1YJNT 3UT1A 5LJ5h 1YBYA 1Q7YC 3L2QA 3CC4T 3QDRB 2AHJB 2RH2A 3HFOA 2FYKA 2RO0A 1WPYA 3VKIA 3J81E 1YITT 1S72A 3MEVA 4MDXA 2CGHA 4M77F 4VUBA 5LJ3e 4M78D 2XDDA 1W2BA 2R57A 3MEUA 2QQRA 3SB2A 3OYYA 1VQLT 2V8JA 2LDMA 5LJ5d 2DXBA 1YCYA 2H3JA 3VUBA 3C12A 3KBGA 3QUIA 4C8QC 5GMKj 4XTWA 2HBPA 4E7KA 1K9MU 4OF1A 2D9TA 4QW2A 1BI3A 3OMCA 4E7IA 4ATOA 2JUFA 1R8OB 2HNIA 4QQGA 2DXTA 4FT4A 3VJPA 4EMGA 1EIFA 3LLRA 4C0GA 3JCMb 4OB2B 1SSFA 3C95A 2DZCA 3CCMT 4N4IA 4A4FA 4Q5WA 4XTUA 4XU0A 3JB9I 4A4GA 2EQMA 2KDSA 5FU6B 3OYFA 4OB1B 3UDCA 2K57A 4J8OA 5CVIA 1ZQ1A 3OS5A 5GAN4 3QSUA 3OYNA 4A54A 3META 2EAYA 3M9QA 1U8RA 5LJ3g 4E7LA 3CCUA 3PT9A 1YJ9T 3L1AA 3I55T 4XTXA 1QW1A 1M1FA 2LCLA 3ASKA 4XTZA 4PJOG 3A8HB 3EFRA 4F7UF 3CMEA 3OQ5A 1N27A 3HRUA 2GQVA 4XU1A 4M75F 3E1SA 4NL3A 1YI2A 1HXDA 3PNWC 2QEXT 1VQKA 3A8LB 3OW2A 3PGGA 1N9SA 3S3MA 4GY5A 3CBOA 5FROA 4PJOA 5GMKe 1G3SA 3X24B 4ZGDB 3S3NA 2RI3A 3JCMV 5CKBA 3P8HA 5CAIA 4JDSA 1VQ9T 2BIVA 4M7DG 3G6ET 2MF2A 4QVDA 1LJOA 4JRIA 3ZEHA 3X28B 5A0GA 2QQAA 1VQ7T 3J80E 4RCCA 4QVCA 2V8KA 4PJOD 3OMGA 3CC7A 2I2LA 3V8LA 3OA6A 4M7DA 2WACA 2DK3A 4M77G 2E64A 1G3YA 3P8DA 4IURA 3G4ST 2DJZA 4QVZA 1KG1A 4C8QF 3HPWA 4DOVA 5CCAA 2VYTA 3X25B 1UGQB 3CC2A 4M7DD 4PLIA 2QQBA 3RESA 4M77A 2RJFA 3G71T 3TREA 1WJSA 2HQXA 5KE2A 4ZGEB 1YIJT 2GF7A 2E41A 4MMKA 3L2VA 4BY6C 3M5AA 3CXCA 4E7HA 2LC4A 4X9CA 5GAOr 3VYHB 5GAN8 1WJRA 3CBPA 2WSEE 3FIFA 4M77D 3OB9A 3V7CA 3JCMe 2DXCA 5J3BA 1Q86C 2FVUA 5FRMA 2GFAA 4FIBA 4A4KA 4A4HA 3V8KA 3VUZA 4IKFA 1NZ9A 3E9GA 3DB4A 4FL6A 2JVVA 5A0LA 2DIGA 2OTLA 3GLXA 5DY9A 1NJIU 5KCOA 1N8RU 4ZTFA 4KULA 2YLBA 1B34B 5GAOm 2E1HA 4C0DC 1IREB 4J7IA 2RB6A 3PIPA 4CRIA 2RM4A 5EG2A 4A4EA 5CKDA 5LJ5g 1VQOA 2QTXA 2DTHA 2EKOA 5CKEA 1VQ4T 1VQ5T 2BUDA 3GIBA 5FLXE 4P5NA 1QVPA 2RJCA 5AYFA 3M4GA 2F69A 4EMKB 3FC3A 3LWHA 2GCXA 4N0AC 5GANh 3GOXA 3FB9A 4IUPA 1NPPA 3E19A 4F7UA 5CK9A 2K3YA 2RI2A 3L2ZA 2YRVA 5D6WA 4M75A 4R56A 1NE8A 1UB4A 3HSBA 4M7AF 3X26B 4XQ3A 2DTIA 1XNIA 2JNGA 4L59A 1QVGS 3DLLA 2DO3A 3QXEB 3RMSA 1Q7YU 1WQ7A 3CBMA 5GANd 3OYMA 3BFMA 1S72T 4FSXA 2ZPEB 2X35A 5J39A 4C5EA 3SDZA 5LL6S 4C5GA 1X75C 4LDXA 3SWNC 2RHUA 1VQPT 3LGFA 1N9RA 1W4SA 4L5GA 4C8QG 5GAMh 2F5KA 4C5IA 3ME9A 4O5VA 1WQWA 1KQSS 4OP0A 3JB9F 4PJOB 3PFSA 3JCMJ 4N4HA 4BI4A 3S6WA 4M7AB 1RL2A 5D6XA 2MMPA 1OZ2A 2LNVA 2L8DA 2XDPA 3FRNA 3MP1A 2OAUA 3BDLA 4C8QA 3OYHA 4O6JA 3QG1A 3V8JA 2DTOA 3WVEB 5GAMd 1FX7A 4M7DB 2LVMA 1UGSB 3FJPA 5FU7B 3UPUA 1YHQT 2DPPB 4KUDK 1LNXA 2L3RA 2DZ9A 1B34A 3G7ZA 2JZ2A 5HK3A 1JJ2S 4C8QD 3M4YA 2KK4A 4M78C 1G3WA 1D3BA 3HRSA 4J6YA 3CCJT 4PJOE 5GAOp 5C0MA 1UGPB 1BKBA 4HCZA 1Q81C 3LX7A 3CCEA 4LDUA 4M77B 2E65A 1YJNA 1VQNT 2XK0A 5KCHA 4M7AE 2PVGB 2GFUA 2RJEA 4EMKA 4OGCA 3CC4A 5GANf 2LQ8A 2RHYA 2PUKB 3QPHA 2M16A 4C92C 4LDWA 5LJ5j 1Y7XA 3CCLT 1YITA 1G5VA 3JB9J 3GF5A 4M7DE 2K5FA 1BIAA 1MHNA 3M55A 2QA4T 2XKOC 3OY9A 2CKKA 2MAMA 2JTFA 3OBYA 4RMOA 4XTVA 3LYIA 4OB3B 4IUVA 3CCQT 1VQLA 4NOYA 3JCMc 2K4YA 4HCBA 2K5LA 3QJ6A 4RKUE 1BYMA 2RHIA 1PSFA 4M77E 1WNLA 1O9SA 3OBWA 1XQHA 3MEAA 3CCRT 3F70A 1M90C 5GAMf 4M7AG 2FL7A 2QQSA 1QP3A 4MDWA 2P4TA 3CCMA 2HQEA 3L2WA 1YJWA 1VQMT 2XG8D 3URGA 3CC7T 1M90U 3I56T 1QP2A 3QZ9B 4LD9K 4M7AA 5I2MA 4ME7A 3JRZA 4IUTA 4IUQA 3QZ5B 2EJ9A 3MP8A 2D6FA 1H3ZA 4RCBA 2R5MA 2QQ9A 3M54A 4F7UB 4Z02A 2K2VA 3CC2T 1TH7A 1U1TA 3EAEA 4M75B 4M7AD 2P0QA 3PMTA 1YJ9A 1YJWT 1JRIA 2ZPGB 2LT4A 1WGSA 3I55A 3JCMQ 2CYZB 3QKJA 5LJ5e 2O4XB 3A5ZB 5A0DA 1ZBXA 4JUVA 3A8MB 1VQ8A 4BDZA 4J7FA 4XAXB 2D0QB 2QEXA 3TEEA 1H641 2X4XA 4M78F 3CCST 2DIQA 2ZPFB 1KC8C 1Q86U 3SD4A 3M56A 3QYGB 3OYGA 3A8OB 3OYCA 4F7UE 1VQ9A 1QVFS 3OYEA 3G6EA 3JCMW 2XD0A 2YLCA 2LX9A 5LJ3h 5I2SA 4M75E 5GANg 2XIDA 5IT9E 2Y4XA 4C92F 1VQ7A 5DLOA 3HL8A 1VQ6T 4LD6A 3CMAA 2LT1A 4PL6A 4TVRA 2LTOA 4C8QB 3HRTA 4LDVA 1NPRA 4PNOA 4J83A 1ZHIA 4Y28E 4BUGA 5M9OA 3OYJA 5LJ3d 3G4SA 3WVDB 1M8VA 3OYKA 5FU6C 2EJGA 3CPWS 1XTDA 1RI0A 1D3BB 2EJFA 3RERA 3JAME 3NTIA 1M1KC 4B9XA 3GNFB 4ELZC 2K3XA 1PSEA 4F7UG 3G71A 3HFNA 3M58A 4MZMA 5CQYA 4M75G 3RMQA 1O75A 2VUBA 1DJ7B 2LQKA 5GAOn 2E5QA 3CD6T 4N0AA 3CCVT 4C8QE 1BI2A 4HA8A 2KQWA 5CKFA 3TCJA 1QVGA 1OI1A 2EYQA 2R5AA 4D6WA 2CZ0B 2IG0A 4OVAA 4JLIA 5GAN5 5GAN7 4HCCA 1AHJB 2CS7A 3R6OA 4EPCA 3OYBA 2E6NA 1XOVA 4FT2A 1K8AC 1I8FA 1KD1C 4EDUA 1KQ2A 2O4XA 3L42A 4X34A 3OYDA 3VYGA 3OS2A 4M75D 5C6SA 2XI9A 2VV5A 3SWNA 4R55A 3V7RA 3JB9H 1JB0E 1M5Q1 4C92E 5GAN6 1X01A 4PKCC 4J6WA 2BKDN 4CI0C 2OTJA 2NLUA 3UWNA 3H6ZA 5GMKh 5CO7A 1GXIE 3A8GB 5LJ3f 3QJYA 1Y07A 4RG8A 4EMHA 1K73C 1VQ5A 2V8IA 3OYLA 3KUFA 3OYIA 4E7JA 2JOYA 3L2UA 2KSSA 1V29B 1JJ2A 1BI1A 1MGQA 3LWIA 1VUBA 5HK0A 2XHCA 3TU4K 2RHXA 3INZA 3ER0A 3T9NA 2P0KA 3C94A 5GANj 4BE0A 4BE1A 2C06A 2VGMA 4L6V5 3P8BB 3HKSA 2IVWA 4V2SA 4C92G 2XU8A 3LW5E 5CR2A 3BDUA 4NL2A 4XTYA 2MWPA 3FLGA 1KHIA 2VGNA 3L2RA 1OZ3A 3MHXA 1M4ZA 2K5IA 2LRQA 4BACA 2PU9B 1Q82C 1G3TA 3DKMA 4HT8A 4BY6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI0 A;  1QVP A;  2GCX A;  2QQA A;  1FWZ A;  1BI2 A;  2LX9 A;  2K5F A;  3E19 A;  1U8R A;  2H3J A;  4O6J A;  2QQ9 A;  1BI1 A;  1FX7 A;  1G3Y A;  1BI3 A;  3HRT A;  1QW1 A;  3GLX A;  2K4Y A;  3HRU A;  2K5L A;  1BYM A;  1G3W A;  2QQB A;  3HRS A;  1G3S A;  1P92 A;  3MHX A;  5CVI A;  2K5I A;  1G3T A;  4O5V A; 
#chains in the Genus database with same CATH topology
 3OS0 A;  3N5B B;  3S3O A;  2V1Q A;  3H8Z A;  2EQJ A;  1LOJ A;  2RK2 A;  5GAM j;  2E10 A;  2M1H A;  3CME T;  1PRM C;  1W2B S;  1I4K 1;  4C92 D;  1JXM A;  1NEG A;  2PUO B;  3AT1 B;  2P4R A;  1YI2 T;  3M53 A;  2ED1 A;  2LCS A;  1AOJ A;  1UGR B;  2DX1 A;  2DXU A;  2LJ3 A;  1T3S A;  1IZ6 A;  1G83 A;  5GAO l;  1S72 Q;  4J6X A;  3MCA B;  5GJW B;  2AKK A;  3JV3 A;  2PZ1 A;  4IIM A;  5CIU A;  2QGF B;  4XU3 A;  3REA B;  4F14 A;  1NLP C;  1SHG A;  5GMK m;  1BK2 A;  4KUI A;  3VS1 A;  2QA4 A;  1V1C A;  5L23 A;  3LH5 A;  1TTH B;  1K4U S;  2HMA A;  2OJ2 A;  2YUQ A;  1KQS P;  1KC8 U;  4QKU A;  2E70 A;  1BB9 A;  1RAE B;  2PVO B;  3VS6 A;  2MI6 A;  1M2V A;  2DEQ A;  3JCM f;  2KVQ G;  2AZS A;  5GAN 3;  1HYO A;  4J9D A;  1X6O A;  1BCO A;  2ATC B;  3M59 A;  7AT1 B;  3GNG A;  2HL5 C;  4BD3 A;  2MCN A;  1VQO T;  1CKB A;  3FDR A;  1RAH B;  4LUE A;  5KYW A;  1M9S A;  2JM9 A;  2DKG A;  2A3L A;  1YIJ A;  3X20 B;  4ZGJ B;  4OB0 B;  4J5Y A;  1KD1 U;  2RK1 A;  3DB3 A;  1K8A U;  4J9I A;  1WLP B;  4M78 E;  1VQ6 A;  3PTA A;  2FZG B;  3J7A F;  1NJI C;  1N8R C;  1Y71 A;  2EIF A;  1GFC A;  4JS4 A;  2ZGW A;  4DQ2 A;  1I81 A;  4WF2 A;  3OSS C;  1U1S A;  1ZUK A;  2BE7 D;  3QBY A;  3CCV A;  2ZPB B;  4M75 C;  2CSQ A;  3M0S A;  2HAX A;  1YFN A;  2WSF E;  3H0H A;  2M02 A;  1QMC A;  5ECA A;  4Y91 A;  3O8V A;  1Q81 U;  5DM7 R;  5KYN A;  4M78 A;  4XU2 A;  1Q82 U;  1AEY A;  1WXT A;  2DLP A;  2AHJ B;  2FYK A;  1S72 A;  4MDX A;  2CGH A;  4M77 F;  3I5R A;  3SB2 A;  2LDM A;  4ANJ A;  3CD6 Q;  2EYW A;  2H3J A;  1M2V B;  3C12 A;  3KBG A;  5GMK j;  2HBP A;  4E7K A;  4JZ3 A;  4QW2 A;  2I0N A;  4PJM A;  4RTV A;  2JUF A;  1R8O B;  2KYM A;  4EMG A;  1M90 U;  1OU9 A;  3LLR A;  4OB2 B;  3PVQ A;  4A4F A;  2C0O A;  4Q5W A;  4XU0 A;  3JB9 I;  2EQM A;  1HD3 A;  4OB1 B;  2CP6 A;  3UDC A;  3OYF A;  2LQW A;  5CVI A;  1ZQ1 A;  5KYW B;  2QAS A;  3OYN A;  2NUZ A;  3U23 A;  3MET A;  2V26 A;  4JJB A;  1U8R A;  4DBF A;  2KRN A;  3L1A A;  3I55 T;  4XTX A;  1ABQ A;  1QW1 A;  1PKS A;  2E5K A;  2LCL A;  1KJW A;  5IHN A;  4PJO G;  9ATC B;  1RAG B;  1VQK A;  1VYT A;  1D1B A;  3VRY A;  3OW2 A;  3CBO A;  4ZGD B;  2RI3 A;  5CAI A;  1IB8 A;  2MF2 A;  2CUB A;  1VQ7 T;  5I11 A;  3I5S A;  3V8L A;  4F17 A;  4M7D A;  1VQL Q;  3CCU Q;  2DK3 A;  1G3Y A;  2J7I A;  4C8Q F;  3HPW A;  4DOV A;  1UGQ B;  4Z8A A;  3RES A;  1YIJ T;  3G71 T;  2HQX A;  2DMO A;  1WHH A;  2RMO A;  4X9C A;  4PJN A;  3VS5 A;  2YUP A;  5GAN 8;  2WSE E;  2CRE A;  2GFA A;  4FIB A;  3DB4 A;  5IHK A;  2JVV A;  2BE9 B;  2DIG A;  5KYX A;  1KFZ A;  1NJI U;  1N8R U;  4ZTF A;  2F1L A;  2ROT A;  4FW1 A;  1IRE B;  2EGA A;  4J9B A;  2RB6 A;  1K73 R;  1VQ8 Q;  2X3X D;  5CKD A;  1X2Q A;  1VQ5 T;  2EPD A;  4HCK A;  1QVP A;  3A98 A;  2GCX A;  5GAN h;  4F7U A;  5CK9 A;  2K3Y A;  2RI2 A;  1D0X A;  2YRV A;  3CMA Q;  4M7A F;  1NE8 A;  3X26 B;  1XNI A;  2DO3 A;  3RMS A;  1WQ7 A;  3OYM A;  2FPF A;  1S72 T;  2OX7 A;  2ZPE B;  3UA6 A;  2KNB B;  1Z9Q A;  1WQW A;  2J05 A;  4N4H A;  1S1N A;  2CP3 A;  4M7A B;  1RL2 A;  5D6X A;  1GBQ A;  1SPK A;  1K9M R;  3MP1 A;  3THK A;  4O6J A;  1B3Q A;  4B6M A;  4RTY A;  2KT1 A;  1X6G A;  4M7D B;  1UGS B;  2DZ9 A;  4M78 C;  3CCJ T;  4PJO E;  2DF6 A;  2RNA A;  2GTJ A;  1UGP B;  2DRK A;  2L2P A;  2XK0 A;  5KCH A;  2CH4 W;  4OGC A;  1YWP A;  3JB9 J;  3GF5 A;  2K5F A;  5D7U A;  1KIK A;  2MAM A;  2JTF A;  4RMO A;  1VQL A;  4XTV A;  2H3E B;  1OPK A;  1K9A A;  4NOY A;  1QCF A;  2O31 A;  1D09 B;  5KYX B;  4RKU E;  3QJ6 A;  1BYM A;  3M0T A;  2EGC A;  2FL7 A;  2QQS A;  2KGT A;  3CCE Q;  1NEB A;  2HQH A;  3EHQ A;  1IGQ A;  1QP2 A;  2F2X A;  3QZ5 B;  3MP8 A;  2O9V A;  4RCB A;  4CC2 A;  3VS7 A;  4F7U B;  4Z02 A;  2K2V A;  1TH7 A;  2V1R A;  1IRX A;  2CYZ B;  2JJ9 A;  3A5Z B;  1VQ8 A;  4BDZ A;  2D0Q B;  2HZY A;  3CCM Q;  2O9S A;  2YWW A;  4HXJ A;  3A8O B;  3OYE A;  3EG9 A;  2LX9 A;  5LJ3 h;  5I2S A;  2YUN A;  5IT9 E;  4C92 F;  3CMA A;  4PL6 A;  4LDV A;  2KT8 A;  2E4H A;  3OYJ A;  3WVD B;  3D7S B;  4RTW A;  2EJF A;  1RAF B;  2QGG A;  3JAM E;  3NTI A;  4ELZ C;  3HFN A;  4MZM A;  4M75 G;  3RMQ A;  2QDL A;  3CD6 T;  5GAO n;  4N0A A;  3QWY A;  1M8M A;  2HL3 A;  2YT6 A;  2IG0 A;  2A08 A;  1WHJ A;  1TXQ A;  2CH4 A;  1FMW A;  1AHJ B;  3R6O A;  2LX7 A;  3OYB A;  2D8J A;  2E6N A;  4FT2 A;  1KQ2 A;  1U3O A;  3G4S Q;  2XI9 A;  1X01 A;  3H6Z A;  1UJY A;  3QJY A;  1Y07 A;  4RG8 A;  1K73 C;  3OYL A;  3L2U A;  2DFU A;  2O88 A;  3TU4 K;  2XHC A;  3ER0 A;  3T9N A;  1G8X A;  4BE0 A;  4BE1 A;  2C06 A;  3HKS A;  1T3L A;  4RTU A;  4V2S A;  4XTY A;  2VGN A;  1JU5 C;  3MHX A;  1M4Z A;  2K5I A;  1WFW A;  4BY6 B;  2X4Y A;  4LUD A;  4PFP A;  4PFO A;  1X27 A;  1OEB A;  1VQ4 Q;  4JRQ A;  3CCU T;  1H3H A;  1R0B G;  1M3B A;  4HT9 A;  2DD5 A;  4FU6 A;  1K9M C;  3E9F A;  1BBZ A;  2YHT A;  3NTK A;  1YHQ A;  2F5T X;  1HK9 A;  2FB7 A;  3JCM d;  4MZT A;  4C0D B;  1WIE A;  4NS5 A;  4OMF B;  3HP9 A;  5GAN e;  1BI0 A;  1NLO C;  5DLQ E;  3RIR A;  2XDB A;  2QK0 A;  3MEW A;  1HJD A;  2QXF A;  2Y90 A;  3JB9 G;  2CP5 A;  1M1G A;  2R58 A;  1UG1 A;  5I21 A;  3GPL A;  1VQ8 T;  2M0O A;  3UF4 A;  3CCQ A;  4HVU A;  2QAZ A;  3CPF A;  4PJO C;  5KE3 A;  2PVD B;  3CCR A;  2HCK A;  2WSC E;  3OW2 S;  2QG9 B;  2Y4Y A;  5A2Q E;  3OSV A;  4RTZ A;  3RKY A;  2RN8 A;  4N4G A;  1VQM A;  3CMA T;  3EFS A;  4LXC A;  3I56 A;  1IHW A;  3NTH A;  2DAQ A;  2CP7 A;  5IAY A;  1JJ2 P;  4B9W A;  2QA4 Q;  5GMK i;  2ZPI B;  4FM4 B;  2PQW A;  1AVZ C;  2RA2 A;  2RJD A;  5L8R E;  2KY9 A;  1WXU A;  2DRM A;  2X4W A;  5GAO q;  2CDT A;  4KT0 E;  3CCS A;  2E12 A;  1JO8 A;  4Y92 A;  2HD0 A;  4J9C A;  4E7S A;  2RQR A;  4JRP A;  2HBW A;  1BIB A;  4DA4 A;  2EW3 A;  2G3R A;  4ZNX A;  2ZPH B;  2M9U A;  1Q95 G;  1K73 U;  3EG3 A;  4BE2 A;  4LE9 A;  2E3I A;  1AT1 B;  2JW4 A;  2ED0 A;  1TSF A;  1VQ4 A;  1FMK A;  2H8H A;  4AFQ C;  4JLG A;  2AT1 B;  2HKQ B;  4M78 G;  1VYV A;  3VS2 A;  1GCQ C;  4AG2 C;  2EYX A;  5FRN A;  2O01 E;  4IUU A;  3CCE T;  3BW1 A;  1YJN T;  3UT1 A;  4JPB W;  1WHM A;  1M2O A;  4E6R A;  3MPU B;  4FYW B;  1Y0M A;  5LJ3 e;  2XDD A;  1RUW A;  2EKH A;  3MEU A;  3SEM A;  2K9G A;  2K6D A;  2V8J A;  5LJ5 d;  1K9M U;  3QUI A;  2CP2 A;  3CCV Q;  1F1B B;  3OMC A;  3EFO A;  2CP0 A;  3VJP A;  3CPW P;  3VRZ A;  3CCM T;  3H41 A;  2KYB A;  4A4G A;  5FU6 B;  4J8O A;  2HKN A;  2KXC A;  1WHG A;  1RAA B;  2EAY A;  3M9Q A;  5LJ3 g;  4OML A;  4KH1 B;  1RAD B;  3PT9 A;  3EFR A;  4AFZ C;  1N27 A;  1ZSZ A;  4M75 F;  4DEY A;  4NL3 A;  2D0N A;  1HXD A;  1GRI A;  3PGG A;  1IHV A;  3S3M A;  4GY5 A;  3TVT A;  5FRO A;  3S3N A;  4AG1 C;  4JDS A;  1VQ9 T;  4M7D G;  1AWJ A;  1LJO A;  4JRI A;  2QQA A;  1BCM A;  3J80 E;  4RCC A;  1GBR A;  2DET A;  4PJO D;  3OMG A;  3QDF A;  2EQI A;  1W1F A;  2E64 A;  1XJW B;  3G4S T;  1KG1 A;  4E2F B;  1M1K R;  1WHL A;  2VYT A;  2GQI A;  3X25 B;  1VQK Q;  4M77 A;  3TRE A;  2DYI A;  4ZGE B;  4DEX A;  5KE2 A;  4MMK A;  1YJW Q;  4E7H A;  2LC4 A;  5GAO r;  1R0C B;  3FIF A;  1MMG A;  2COY A;  2FVU A;  4A4H A;  2GGR A;  3VUZ A;  4IKF A;  1NZ9 A;  4FL6 A;  4HVV A;  1U06 A;  4ORZ A;  2OTL A;  1UHC A;  1K0S A;  1EX4 A;  4KUL A;  1B34 B;  3EFO B;  2E1H A;  3VS3 A;  1K0X A;  2QTV A;  4J7I A;  3VS0 A;  4A4E A;  2QEX Q;  4R0K A;  2DTH A;  2EKO A;  1VQ4 T;  1EFN A;  5FLX E;  1SEM A;  4P5N A;  2VKN A;  2F69 A;  3M4G A;  4EMK B;  2DJQ A;  2JT4 A;  3FB9 A;  1T0J A;  4R56 A;  1G2B A;  1UB4 A;  2MYS A;  4L59 A;  5EC7 A;  3CBM A;  1ACM B;  1ZSZ B;  1WX6 A;  4FSX A;  2X35 A;  4GBQ A;  1ZLM A;  3SDZ A;  5LL6 S;  4C5G A;  1X75 C;  2RHU A;  1KQS S;  5GAM h;  3JB9 F;  3ME9 A;  5KYU A;  3PFS A;  3EHR A;  1OZ2 A;  3OYH A;  4C8Q A;  2OAU A;  3BDL A;  2DTO A;  2HDA A;  5FU7 B;  3G7Z A;  1OV3 A;  1M27 C;  3M4Y A;  1G3W A;  4J6Y A;  4J9G A;  5GAO p;  4HCZ A;  1J3T A;  4M77 B;  2E65 A;  4M7A E;  3CC4 A;  3CXC P;  5GAN f;  2LQ8 A;  1W70 A;  2RHY A;  2PUK B;  3QPH A;  2M16 A;  2C0I A;  5LJ5 j;  1YIT A;  4M7D E;  1X43 A;  4J9F A;  1BIA A;  3M55 A;  2QA4 T;  2XKO C;  2A28 A;  4JJC A;  3JCM c;  3VS4 A;  2K5L A;  2EVR A;  1SKU B;  3OBW A;  1WNL A;  1SHF A;  1YJW A;  2MK5 A;  2XG8 D;  3URG A;  4QT7 A;  2KRO A;  2SEM A;  2DE0 X;  3QZ9 B;  4M7A A;  2GNC A;  1H3Z A;  2R5M A;  3M54 A;  5IXF A;  1YJ9 A;  1JRI A;  1QLY A;  1WGS A;  3QKJ A;  2O4X B;  5A0D A;  1WYX A;  2QEX A;  4M78 F;  1TUC A;  2JS0 A;  3M56 A;  3QYG B;  4OMN A;  3H0I A;  5KYU B;  3OYC A;  4F7U E;  3G6E A;  1IO6 A;  1JEG A;  2Y4X A;  2KXD A;  4LD6 A;  4PFZ A;  1VQ6 T;  2LT1 A;  3UA7 A;  4C8Q B;  2LTO A;  3HRT A;  1NPR A;  5M9O A;  3OYK A;  2EJG A;  1RI0 A;  2KI7 A;  5AT1 B;  1M1K C;  4B9X A;  5CQY A;  1O75 A;  1DJ7 B;  2LQK A;  2FO0 A;  3CCV T;  1M3C A;  3MKD A;  1I0C A;  2BTT A;  2KQW A;  2EYQ A;  1I1J A;  4OVA A;  1YCS B;  4OMQ A;  1Q7Y R;  4EPC A;  1XOV A;  3L42 A;  3OYD A;  4M75 D;  3SWN A;  1JB0 E;  2MIO A;  4C92 E;  4J6W A;  4J9E A;  2RF0 A;  3UWN A;  5GMK h;  1GXI E;  3A8G B;  5LJ3 f;  4EMH A;  4E7J A;  2JOY A;  1V29 B;  1JJ2 A;  1BI1 A;  3LWI A;  2SRC A;  2RHX A;  3INZ A;  2P0K A;  3C94 A;  5FWC A;  4L6V 5;  3P8B B;  4X1V A;  2IVW A;  2XU8 A;  1AWX A;  3LW5 E;  5CR2 A;  4NL2 A;  2MWP A;  3L2R A;  1X6B A;  3EH2 A;  1FYN A;  1RLP C;  4HT8 A;  2OAW A;  4C92 A;  1VQP A;  4ZN1 A;  3PIO A;  3SHW A;  4XK8 E;  2L89 A;  1LVK A;  2DD4 A;  4GLK A;  1QWF A;  2K79 A;  1C1A A;  4RG2 A;  1VQK T;  4DOW A;  4KBM B;  2ZZD A;  2O2O A;  3QYH B;  1Y57 A;  4FCY A;  3JSC A;  1ZUY A;  3MO8 A;  4PLL A;  1YJW T;  2X4J A;  4II1 A;  2AK5 A;  2NUT A;  1PC0 A;  2QI2 A;  1K1Z A;  1TUG B;  2GBQ A;  1RLQ C;  3OS1 A;  1LCK A;  3EG0 A;  1VQN A;  1VYU A;  3CQT A;  3HHT B;  4JJD A;  2CZ6 B;  1QVG P;  3CCL A;  3OYA A;  5IN1 A;  2JMC A;  5GAN 2;  2DVE A;  3KFV A;  1C6V X;  1AWO A;  3LGL A;  4PJJ A;  3ZBD A;  3NPF A;  1YHQ Q;  5GAM e;  3SWN B;  3REB B;  1Q86 R;  2PNI A;  4QQ6 A;  2IPO B;  3IQL A;  4PJL A;  3RKX A;  3JB9 D;  4M7A C;  2B8A A;  3NHN A;  4FW2 A;  4QQD A;  2AKL A;  2EQK A;  1B07 A;  1WA7 A;  4M7D C;  3CME Q;  3CPW A;  3M57 A;  3CCQ Q;  3RUX A;  2RD1 A;  3ULR B;  1M1K U;  2HSP A;  4JS5 A;  4LN2 A;  4EIK A;  2JXB A;  3CCR Q;  5GAM g;  5CKH A;  1N6A A;  3C4S A;  1T0H A;  4C92 B;  1VQM Q;  1E6G A;  2OI3 A;  3I56 Q;  4DBQ A;  1WI7 A;  2KAF A;  5CQX A;  4ZTJ A;  2VXF A;  3EG2 A;  2LJ1 A;  3PMI A;  3QO3 A;  3JCM P;  1KQS A;  2J06 A;  1P92 A;  1KHC A;  2NUT B;  2F2V A;  4PJO F;  4CC4 B;  2RI5 A;  3CCS Q;  2EFI A;  4ZN3 A;  2M0Y A;  1H92 A;  3JCM g;  4E47 A;  3JCM X;  3RDV A;  1C0M A;  2YSQ A;  1MV3 A;  2CT3 A;  4UC4 A;  2YXY A;  1PM3 A;  1OX8 A;  1Q7Y C;  3QDR B;  2RH2 A;  3HFO A;  3J81 E;  1WPY A;  1QVF P;  1GFD A;  3MEV A;  4VUB A;  4M78 D;  2R57 A;  4F16 A;  2QQR A;  3OYY A;  1VQL T;  1RAI B;  3VUB A;  1YCY A;  4XTW A;  4OF1 A;  4E7Z A;  2D9T A;  1M90 R;  1I07 A;  2AIR B;  1E6H A;  2HNI A;  4QQG A;  3JCM b;  3C95 A;  2DZC A;  4N4I A;  2BZY A;  4XTU A;  2KDS A;  4Z88 A;  3RNJ A;  1OPL A;  5GAN 4;  3QSU A;  3EH1 A;  2J6O A;  4A54 A;  3EG1 A;  2L3Q A;  2LJ0 A;  2VB6 A;  3E2U A;  2COZ A;  3ASK A;  1M1F A;  4XTZ A;  1NM7 A;  3CME A;  3OQ5 A;  3HRU A;  2GQV A;  1SF9 A;  1YI2 A;  5IH2 A;  3A8L B;  1N9S A;  2DNU A;  5GMK e;  1G3S A;  3X24 B;  3JCM V;  2VVK A;  4QVD A;  3ZEH A;  2Z0W A;  3X28 B;  5A0G A;  1YWO A;  2LQN A;  3OA6 A;  2W10 A;  4M77 G;  3P8D A;  2DJZ A;  4QVZ A;  2J6K A;  2COW A;  1JQQ A;  4M7D D;  1K76 A;  2QQB A;  4PK4 A;  2E41 A;  4BY6 C;  3CXC A;  3CBP A;  3V7C A;  1W2B P;  1Q86 C;  5J3B A;  2X9H A;  5KYY B;  4A4K A;  3V8K A;  2LP5 A;  3E9G A;  1MNE A;  1HSQ A;  3GLX A;  5DY9 A;  3I55 Q;  1UJ0 A;  2L3P A;  2DL5 A;  4C0D C;  4CRI A;  2RM4 A;  5EG2 A;  5LJ5 g;  1VQO A;  2EYZ A;  2QTX A;  2BUD A;  3GIB A;  2J6F A;  3FC3 A;  5AYF A;  2FG0 A;  1NG2 A;  4OMO A;  4N0A C;  3GOX A;  1NPP A;  3E19 A;  1VQ7 Q;  4F04 B;  5D6W A;  4M75 A;  3HSB A;  1PD0 A;  3RR6 A;  1ZA2 B;  2JNG A;  2OTL Q;  3DLL A;  1U5S A;  3QXE B;  1Q7Y U;  5GAN d;  1QQJ A;  1V76 A;  1G3T A;  5J39 A;  4DBH A;  4FSS A;  3LGF A;  1N9R A;  1W4S A;  4L5G A;  4C8Q G;  2F5K A;  2MPX C;  4O5V A;  4C5I A;  3G71 Q;  1AZG B;  4LNP A;  1ZUU A;  3S6W A;  2KR3 A;  2MMP A;  2LNV A;  2L8D A;  3HTR A;  1FX7 A;  3UPU A;  3FJP A;  1YHQ T;  2DPP B;  2L3R A;  5HK3 A;  1B34 A;  2JZ2 A;  1JJ2 S;  2X51 A;  1D3B A;  1Q81 C;  1BKB A;  4LDU A;  3EGX A;  2PVG B;  4AMC A;  2OTJ Q;  4EMK A;  3UAT A;  1VQ5 Q;  2DA9 A;  1X69 A;  3A1P A;  4KRT A;  4LDW A;  1Y7X A;  2RQW A;  2JM8 A;  1TWB A;  1MHN A;  4OMM A;  3OY9 A;  2CKK A;  3OBY A;  3CCQ T;  2NWM A;  4OB3 B;  1OQK A;  1ARK A;  2ABL A;  2RHI A;  4M77 E;  1O9S A;  1PRL C;  1XQH A;  1UE9 A;  3CCR T;  3F70 A;  1M90 C;  5GAM f;  1TG0 A;  4M7A G;  1QP3 A;  2P4T A;  1SRM A;  3L2W A;  2DYB A;  1VQM T;  2ZAE A;  3I56 T;  3CC4 Q;  4LD9 K;  1WXB A;  4IIO A;  5I2M A;  4ME7 A;  4IUT A;  1YIT Q;  2EJ9 A;  2CUD A;  2D6F A;  2QQ9 A;  4M75 B;  2P0Q A;  3PMT A;  2ZPG B;  3I55 A;  3JCM Q;  1ZBX A;  2JTE A;  1MUZ A;  4XAX B;  1OOT A;  1H64 1;  3CCJ Q;  2X4X A;  3CCS T;  1QWE A;  2DIQ A;  2M51 A;  2ZPF B;  3M0P A;  1Q86 U;  3JCM W;  4M4Z A;  1MV0 B;  2XID A;  3PE0 A;  4RTX A;  2PTK A;  1VQ7 A;  5IXB A;  2YRC A;  3HL8 A;  4PNO A;  1UEC A;  4AT1 B;  1YJ9 Q;  1GCP A;  3GBQ A;  5LJ3 d;  1M8V A;  5FU6 C;  3CPW S;  1XTD A;  1D3B B;  3RER A;  3PVL A;  1WHK A;  4F7U G;  3GNF B;  3G71 A;  3M58 A;  3EGX B;  2VUB A;  4RUG A;  4Z89 A;  4C8Q E;  1BI2 A;  3G6E Q;  3TCJ A;  5CKF A;  1A0N B;  1QVG A;  1OI1 A;  1AD5 A;  4HCC A;  1RI9 A;  4KGZ B;  1I8F A;  4EDU A;  2O4X A;  4KH0 B;  4X34 A;  4FYV B;  3VYG A;  3OS2 A;  3ZL7 C;  3V7R A;  3JB9 H;  1M5Q 1;  4PKC C;  1MND A;  2OTJ A;  2NLU A;  5CO7 A;  1VQ5 A;  2QYZ A;  4RTT A;  3KUF A;  3OYI A;  5GJV B;  2KSS A;  2EBP A;  1MMD A;  2AZV A;  1VUB A;  2D8H A;  5HK0 A;  4CC7 A;  2RQT A;  5GAN j;  2FRY A;  2VGM A;  4C92 G;  2ESW A;  1IGU A;  2P84 A;  1SRL A;  3FLG A;  1SSH A;  2KRM A;  2YUO A;  1E7O A;  1OZ3 A;  2PU9 B;  2A36 A;  1VIF A;  4KGV B;  2L5Q A;  2P0P A;  1WZO A;  1I5L A;  3Q1J A;  3MP6 A;  1Y96 A;  1LPL A;  3JCM h;  2K3B A;  4ELY C;  4J9H A;  5D6Y A;  4DBR A;  1YP5 A;  2DBK A;  4C5H A;  3FEO A;  1FXX A;  1PWT A;  3M0U A;  3CEY A;  1JBM A;  2K7A A;  3EGU A;  3SFM A;  3CCJ A;  1WDX A;  1D1C A;  2DL7 A;  4D8K A;  4EMK C;  3V7S A;  4JRK A;  1VQP Q;  3RKW A;  2ZCF B;  3M0R A;  4OGE A;  1UEB A;  2CZ1 B;  4MML A;  2XIC A;  4JJN K;  3LH0 A;  3WXM B;  4HKE A;  5HY6 A;  5J26 A;  1D0Z A;  4A63 B;  4WTO B;  5LJ5 f;  1ZSZ C;  2YDL A;  1CKA A;  1TUD A;  3R6N A;  1VOM A;  2LCC A;  2QDY B;  4FYY B;  1QVF A;  3BY7 A;  1WJQ A;  2KRS A;  2MWO A;  1KQ1 A;  3DLM A;  4CC3 A;  1VQN Q;  3FJ5 A;  2OTL T;  2EQU A;  3CCL Q;  4A53 A;  2E6Z A;  5FU7 C;  4BI8 B;  5KH6 A;  2IIM A;  3NFC A;  3ZFJ A;  1NBE B;  1N5Z A;  2F2W A;  4K11 A;  3AHU A;  4M78 B;  1OYX A;  3VU3 C;  4M77 C;  2LMJ A;  2RHZ A;  1KK7 A;  2JN0 A;  2VXE A;  3CC7 Q;  3CXC S;  1AZE A;  1AWW A;  2VC8 A;  1SG5 A;  2RPN A;  1Y96 B;  1QCO A;  5LJ3 j;  4BDY A;  2KMT A;  3QHS A;  3VV0 A;  2L0A A;  2CZ7 B;  4BI3 A;  3CC2 Q;  2NUP A;  2OTJ T;  2FPE A;  4HVW A;  3KXT A;  5HKC A;  1YNZ A;  2YRD A;  2CSI A;  4MZP A;  4C0F A;  2FHD A;  2K2M A;  3QII A;  2EWN A;  1ZBJ A;  2A7Y A;  3NMZ C;  1FWZ A;  2DBM A;  3GP8 A;  3CD6 A;  1QKX A;  1EZZ B;  4LDY A;  1VIE A;  4C0Z A;  4YTL A;  4X9D A;  2VAS A;  1UDL A;  1R77 A;  5HCK A;  5GMK l;  4M7D F;  2DL3 A;  4BB7 A;  2DVJ A;  2JTM A;  5LJ5 h;  1YBY A;  3L2Q A;  3CC4 T;  2DER A;  2RO0 A;  3VKI A;  1YIT T;  2DL8 A;  2FPD A;  2FEI A;  1W2B A;  1VA7 A;  5IHI A;  2DXB A;  4C8Q C;  1BI3 A;  4E7I A;  4ATO A;  1UFF A;  2DXT A;  4FT4 A;  1EIF A;  4C0G A;  1SSF A;  1UTI A;  2K57 A;  2RQU A;  3OS5 A;  1BU1 A;  2ROL A;  4OMP A;  4E7L A;  3CCU A;  1YJ9 T;  2VWF A;  4F7U F;  3A8H B;  2FZC B;  3MJX A;  4XU1 A;  4JZ4 A;  3E1S A;  1KC8 R;  3PNW C;  2QEX T;  2NUP B;  3RBB B;  4PJO A;  1ABO A;  1YJN Q;  2E3H A;  2KE9 A;  3P8H A;  5CKB A;  2BIV A;  1PG5 B;  3G6E T;  4QVC A;  2V8K A;  1UHF A;  3TSW A;  3CC7 A;  2I2L A;  3I9Q A;  2WAC A;  2CT4 A;  4IUR A;  1B7T A;  5CCA A;  1YI2 Q;  3CC2 A;  4PLI A;  2RJF A;  1WJS A;  1Z9Z A;  2L3S A;  2GF7 A;  2GTO A;  2FRW A;  1GL5 A;  3L2V A;  3M5A A;  8AT1 B;  4KGX B;  2A37 A;  3VYH B;  1WJR A;  4M77 D;  3OB9 A;  1QCN A;  3JCM e;  1KD1 R;  1K8A R;  2DXC A;  5FRM A;  5A0L A;  1PCX A;  5KCO A;  2DM1 A;  3EGD A;  1IXD A;  1YN8 A;  2YLB A;  5GAO m;  3PIP A;  4AFS C;  5CKE A;  2FZK B;  2RJC A;  3LWH A;  1VQ9 Q;  2BZX A;  4IUP A;  3L2Z A;  1GCQ A;  2EGE A;  2ENM A;  1NYF A;  4XQ3 A;  2DTI A;  1Q81 R;  1QVG S;  3I35 A;  1OU8 A;  5FWB A;  1Q82 R;  4C5E A;  3OW2 P;  1FMV A;  4LDX A;  3SWN C;  1UUE A;  5FW9 A;  1VQO Q;  1VQP T;  1MMN A;  4PJO B;  4WCI A;  1X2K A;  3G1J A;  4OP0 A;  2KEA A;  3JCM J;  1MMA A;  3C0C A;  4BI4 A;  3TQ7 P;  5KYY A;  2XDP A;  3FRN A;  3QG1 A;  3V8J A;  3WVE B;  5GAM d;  1ZSG A;  2ECZ A;  2LVM A;  4KUD K;  1LNX A;  4C8Q D;  2XMF A;  2KK4 A;  1ZA1 B;  2D1X A;  3HRS A;  1OUL A;  5C0M A;  1RAB B;  3LX7 A;  3CCE A;  2HSE B;  1YJN A;  1VQN T;  2GFU A;  2RJE A;  1CSK A;  2HEQ A;  4C92 C;  3CCL T;  1G5V A;  3BE3 A;  1M3A A;  3EG9 B;  2C0T A;  3LYI A;  4IUV A;  2K4Y A;  4HCB A;  1PSF A;  3EGD B;  4D8D A;  1UGV A;  2G6F X;  3MEA A;  1TS9 A;  3CCM A;  4MDW A;  3O5Z A;  2HQE A;  3H9N A;  1M30 A;  3CC7 T;  2DIL A;  1KSW A;  1OX9 A;  2EYY A;  3JRZ A;  4IUQ A;  1D1A A;  5I22 A;  1RAC B;  3CC2 T;  1U1T A;  3EAE A;  4M7A D;  6AT1 B;  2LT4 A;  2KBT A;  4AFU C;  5LJ5 e;  3M0Q A;  4JUV A;  3A8M B;  2BZ8 A;  4J7F A;  3TEE A;  1W6X A;  1KC8 C;  3SD4 A;  3OYG A;  2LNH B;  1I5O B;  1ZX6 A;  1VQ9 A;  1QVF S;  2XD0 A;  1H8K A;  2B86 A;  1D0Y A;  2YLC A;  2DL4 A;  5GAN g;  4M75 E;  3H0F A;  5DLO A;  2W0Z A;  4TVR A;  1NJI R;  2MOX A;  1N8R R;  2JMA A;  4FYX B;  1PHT A;  2DEU A;  4J83 A;  1ZHI A;  4Y28 E;  4BUG A;  3G4S A;  2NYS A;  4ESR A;  2K3X A;  1PSE A;  2E5Q A;  2JS2 A;  1TOV A;  4HA8 A;  1NYG A;  1PD1 A;  2R5A A;  4D6W A;  2CZ0 B;  4JLI A;  5GAN 5;  5GAN 7;  2CS7 A;  8ATC B;  2A0F B;  1KD1 C;  1K8A C;  1PNJ A;  5C6S A;  2VV5 A;  4R55 A;  1JXO A;  5GAN 6;  2BKD N;  4CI0 C;  1PKT A;  1YIJ Q;  3NGP A;  4GLM A;  2V8I A;  1QKW A;  3QWX X;  1MGQ A;  1VQ6 Q;  2RQV A;  2X3W D;  2LZ6 B;  3BDU A;  1TU0 B;  1KHI A;  3TSZ A;  2LRQ A;  4BAC A;  1Q82 C;  3BFM A;  3DKM A; 
#chains in the Genus database with same CATH homology
 2X4Y A;  1VIF A;  4C92 A;  1VQP A;  4ZN1 A;  3PIO A;  3N5B B;  3OS0 A;  3S3O A;  2L5Q A;  2P0P A;  4JRQ A;  3H8Z A;  2EQJ A;  1I5L A;  3Q1J A;  4XK8 E;  1LOJ A;  2L89 A;  2RK2 A;  3CCU T;  3MP6 A;  2DD4 A;  5GAM j;  4GLK A;  2E10 A;  1Y96 A;  2M1H A;  3CME T;  1W2B S;  3JCM h;  1I4K 1;  4ELY C;  4C92 D;  2PUO B;  4RG2 A;  1YI2 T;  5D6Y A;  1VQK T;  4HT9 A;  2DD5 A;  4DOW A;  4KBM B;  4FU6 A;  2ZZD A;  4C5H A;  3E9F A;  3QYH B;  3FEO A;  2YHT A;  3M53 A;  1K9M C;  1FXX A;  3JSC A;  3NTK A;  1YHQ A;  3MO8 A;  4PLL A;  2F5T X;  1UGR B;  1HK9 A;  2DXU A;  2X4J A;  2FB7 A;  3CEY A;  3JCM d;  1JBM A;  4MZT A;  4C0D B;  3SFM A;  4II1 A;  1IZ6 A;  4NS5 A;  5GAO l;  2QI2 A;  3CCJ A;  4J6X A;  3MCA B;  4OMF B;  4EMK C;  3HP9 A;  3V7S A;  1BI0 A;  5GAN e;  4JRK A;  3OS1 A;  5DLQ E;  1VQN A;  3RKW A;  3RIR A;  2XDB A;  5CIU A;  2ZCF B;  3HHT B;  4OGE A;  1UEB A;  4XU3 A;  2CZ1 B;  3MEW A;  2CZ6 B;  2QXF A;  2XIC A;  2Y90 A;  4MML A;  3CCL A;  3OYA A;  5GMK m;  3JB9 G;  5IN1 A;  4JJN K;  3LH0 A;  3WXM B;  4HKE A;  5GAN 2;  1M1G A;  4KUI A;  2DVE A;  5HY6 A;  2QA4 A;  5J26 A;  2R58 A;  5I21 A;  3GPL A;  1VQ8 T;  2M0O A;  3LGL A;  3CCQ A;  5LJ5 f;  3ZBD A;  1KC8 U;  2LCC A;  3CPF A;  5GAM e;  2QDY B;  2E70 A;  4PJO C;  1QVF A;  5KE3 A;  3SWN B;  2PVD B;  3CCR A;  2WSC E;  3OW2 S;  3BY7 A;  4QQ6 A;  1WJQ A;  2Y4Y A;  5A2Q E;  3OSV A;  2MWO A;  1KQ1 A;  2PVO B;  3RKY A;  4N4G A;  3DLM A;  3RKX A;  3JB9 D;  1VQM A;  3CMA T;  2B8A A;  3EFS A;  2MI6 A;  4M7A C;  2DEQ A;  3JCM f;  4QQD A;  2EQK A;  3I56 A;  2OTL T;  2EQU A;  3NTH A;  2KVQ G;  5GAN 3;  4A53 A;  2DAQ A;  2E6Z A;  4M7D C;  5FU7 C;  4BI8 B;  5IAY A;  1X6O A;  4B9W A;  3M59 A;  5KH6 A;  3CPW A;  5GMK i;  3M57 A;  2ZPI B;  3NFC A;  3GNG A;  4FM4 B;  3ZFJ A;  2PQW A;  2RA2 A;  4BD3 A;  3RUX A;  2RJD A;  1VQO T;  2RD1 A;  1M1K U;  5L8R E;  3FDR A;  3AHU A;  4M78 B;  4JS5 A;  1OYX A;  2KY9 A;  3VU3 C;  4M77 C;  2RHZ A;  1M9S A;  2DKG A;  2A3L A;  2X4W A;  5GAM g;  5GAO q;  1YIJ A;  2JN0 A;  3X20 B;  4KT0 E;  3CCS A;  5CKH A;  1N6A A;  2E12 A;  3C4S A;  4C92 B;  2VXE A;  2HD0 A;  3CXC S;  4ZGJ B;  4OB0 B;  4J5Y A;  2VC8 A;  2RK1 A;  3DB3 A;  1K8A U;  1KD1 U;  2KAF A;  5CQX A;  1Y96 B;  2VXF A;  4ZTJ A;  4JRP A;  4M78 E;  5LJ3 j;  1BIB A;  4BDY A;  1VQ6 A;  2KMT A;  3QHS A;  3PMI A;  3VV0 A;  2CZ7 B;  4BI3 A;  3PTA A;  3QO3 A;  4DA4 A;  2G3R A;  3JCM P;  3J7A F;  1KQS A;  2ZPH B;  2M9U A;  1NJI C;  2OTJ T;  1N8R C;  1Y71 A;  1K73 U;  2EIF A;  3KXT A;  1P92 A;  1KHC A;  4JS4 A;  4BE2 A;  5HKC A;  2ZGW A;  4DQ2 A;  4MZP A;  4C0F A;  4PJO F;  1I81 A;  2FHD A;  2RI5 A;  3QII A;  2EWN A;  4WF2 A;  2A7Y A;  1VQ4 A;  1FWZ A;  2EFI A;  3OSS C;  3GP8 A;  3CD6 A;  1U1S A;  4ZN3 A;  3QBY A;  4LDY A;  4JLG A;  4M78 G;  3CCV A;  2ZPB B;  1VIE A;  3JCM g;  4C0Z A;  4M75 C;  4YTL A;  4X9D A;  2HAX A;  2WSF E;  5GMK l;  5FRN A;  4Y91 A;  2O01 E;  4IUU A;  3O8V A;  1Q81 U;  4E47 A;  5DM7 R;  4M7D F;  3JCM X;  4UC4 A;  4M78 A;  4XU2 A;  4BB7 A;  1Q82 U;  3CCE T;  3BW1 A;  2JTM A;  1YJN T;  3UT1 A;  5LJ5 h;  1YBY A;  1Q7Y C;  3L2Q A;  3CC4 T;  3QDR B;  2AHJ B;  2RH2 A;  3HFO A;  2FYK A;  2RO0 A;  1WPY A;  3VKI A;  3J81 E;  1YIT T;  1S72 A;  3MEV A;  4MDX A;  2CGH A;  4M77 F;  4VUB A;  5LJ3 e;  4M78 D;  2XDD A;  1W2B A;  2R57 A;  3MEU A;  2QQR A;  3SB2 A;  3OYY A;  1VQL T;  2V8J A;  2LDM A;  5LJ5 d;  2DXB A;  1YCY A;  2H3J A;  3VUB A;  3C12 A;  3KBG A;  3QUI A;  4C8Q C;  5GMK j;  4XTW A;  2HBP A;  4E7K A;  1K9M U;  4OF1 A;  2D9T A;  4QW2 A;  1BI3 A;  3OMC A;  4E7I A;  4ATO A;  2JUF A;  1R8O B;  2HNI A;  4QQG A;  2DXT A;  4FT4 A;  3VJP A;  4EMG A;  1EIF A;  3LLR A;  4C0G A;  3JCM b;  4OB2 B;  1SSF A;  3C95 A;  2DZC A;  3CCM T;  4N4I A;  4A4F A;  4Q5W A;  4XTU A;  4XU0 A;  3JB9 I;  4A4G A;  2EQM A;  2KDS A;  5FU6 B;  3OYF A;  4OB1 B;  3UDC A;  2K57 A;  4J8O A;  5CVI A;  1ZQ1 A;  3OS5 A;  5GAN 4;  3QSU A;  3OYN A;  4A54 A;  3MET A;  2EAY A;  3M9Q A;  1U8R A;  5LJ3 g;  4E7L A;  3CCU A;  3PT9 A;  1YJ9 T;  3L1A A;  3I55 T;  4XTX A;  1QW1 A;  1M1F A;  2LCL A;  3ASK A;  4XTZ A;  4PJO G;  3A8H B;  3EFR A;  4F7U F;  3CME A;  3OQ5 A;  1N27 A;  3HRU A;  2GQV A;  4XU1 A;  4M75 F;  3E1S A;  4NL3 A;  1YI2 A;  1HXD A;  3PNW C;  2QEX T;  1VQK A;  3A8L B;  3OW2 A;  3PGG A;  1N9S A;  3S3M A;  4GY5 A;  3CBO A;  5FRO A;  4PJO A;  5GMK e;  1G3S A;  3X24 B;  4ZGD B;  3S3N A;  2RI3 A;  3JCM V;  5CKB A;  3P8H A;  5CAI A;  4JDS A;  1VQ9 T;  2BIV A;  4M7D G;  3G6E T;  2MF2 A;  4QVD A;  1LJO A;  4JRI A;  3ZEH A;  3X28 B;  5A0G A;  2QQA A;  1VQ7 T;  3J80 E;  4RCC A;  4QVC A;  2V8K A;  4PJO D;  3OMG A;  3CC7 A;  2I2L A;  3V8L A;  3OA6 A;  4M7D A;  2WAC A;  2DK3 A;  4M77 G;  2E64 A;  1G3Y A;  3P8D A;  4IUR A;  3G4S T;  2DJZ A;  4QVZ A;  1KG1 A;  4C8Q F;  3HPW A;  4DOV A;  5CCA A;  2VYT A;  3X25 B;  1UGQ B;  3CC2 A;  4M7D D;  4PLI A;  2QQB A;  3RES A;  4M77 A;  2RJF A;  3G71 T;  3TRE A;  1WJS A;  2HQX A;  5KE2 A;  4ZGE B;  1YIJ T;  2GF7 A;  2E41 A;  4MMK A;  3L2V A;  4BY6 C;  3M5A A;  3CXC A;  4E7H A;  2LC4 A;  4X9C A;  5GAO r;  3VYH B;  5GAN 8;  1WJR A;  3CBP A;  2WSE E;  3FIF A;  4M77 D;  3OB9 A;  3V7C A;  3JCM e;  2DXC A;  5J3B A;  1Q86 C;  2FVU A;  5FRM A;  2GFA A;  4FIB A;  4A4K A;  4A4H A;  3V8K A;  3VUZ A;  4IKF A;  1NZ9 A;  3E9G A;  3DB4 A;  4FL6 A;  2JVV A;  5A0L A;  2DIG A;  2OTL A;  3GLX A;  5DY9 A;  1NJI U;  5KCO A;  1N8R U;  4ZTF A;  4KUL A;  2YLB A;  1B34 B;  5GAO m;  2E1H A;  4C0D C;  1IRE B;  4J7I A;  2RB6 A;  3PIP A;  4CRI A;  2RM4 A;  5EG2 A;  4A4E A;  5CKD A;  5LJ5 g;  1VQO A;  2QTX A;  2DTH A;  2EKO A;  5CKE A;  1VQ4 T;  1VQ5 T;  2BUD A;  3GIB A;  5FLX E;  4P5N A;  1QVP A;  2RJC A;  5AYF A;  3M4G A;  2F69 A;  4EMK B;  3FC3 A;  3LWH A;  2GCX A;  4N0A C;  5GAN h;  3GOX A;  3FB9 A;  4IUP A;  1NPP A;  3E19 A;  4F7U A;  5CK9 A;  2K3Y A;  2RI2 A;  3L2Z A;  2YRV A;  5D6W A;  4M75 A;  4R56 A;  1NE8 A;  1UB4 A;  3HSB A;  4M7A F;  3X26 B;  4XQ3 A;  2DTI A;  1XNI A;  2JNG A;  4L59 A;  1QVG S;  3DLL A;  2DO3 A;  3QXE B;  3RMS A;  1Q7Y U;  1WQ7 A;  3CBM A;  5GAN d;  3OYM A;  3BFM A;  1S72 T;  4FSX A;  2ZPE B;  2X35 A;  5J39 A;  4C5E A;  3SDZ A;  5LL6 S;  4C5G A;  1X75 C;  4LDX A;  3SWN C;  2RHU A;  1VQP T;  3LGF A;  1N9R A;  1W4S A;  4L5G A;  4C8Q G;  5GAM h;  2F5K A;  4C5I A;  3ME9 A;  4O5V A;  1WQW A;  1KQS S;  4OP0 A;  3JB9 F;  4PJO B;  3PFS A;  3JCM J;  4N4H A;  4BI4 A;  3S6W A;  4M7A B;  1RL2 A;  5D6X A;  2MMP A;  1OZ2 A;  2LNV A;  2L8D A;  2XDP A;  3FRN A;  3MP1 A;  2OAU A;  3BDL A;  4C8Q A;  3OYH A;  4O6J A;  3QG1 A;  3V8J A;  2DTO A;  3WVE B;  5GAM d;  1FX7 A;  4M7D B;  2LVM A;  1UGS B;  3FJP A;  5FU7 B;  3UPU A;  1YHQ T;  2DPP B;  4KUD K;  1LNX A;  2L3R A;  2DZ9 A;  1B34 A;  3G7Z A;  2JZ2 A;  5HK3 A;  1JJ2 S;  4C8Q D;  3M4Y A;  2KK4 A;  4M78 C;  1G3W A;  1D3B A;  3HRS A;  4J6Y A;  3CCJ T;  4PJO E;  5GAO p;  5C0M A;  1UGP B;  1BKB A;  4HCZ A;  1Q81 C;  3LX7 A;  3CCE A;  4LDU A;  4M77 B;  2E65 A;  1YJN A;  1VQN T;  2XK0 A;  5KCH A;  4M7A E;  2PVG B;  2GFU A;  2RJE A;  4EMK A;  4OGC A;  3CC4 A;  5GAN f;  2LQ8 A;  2RHY A;  2PUK B;  3QPH A;  2M16 A;  4C92 C;  4LDW A;  5LJ5 j;  1Y7X A;  3CCL T;  1YIT A;  1G5V A;  3JB9 J;  3GF5 A;  4M7D E;  2K5F A;  1BIA A;  1MHN A;  3M55 A;  2QA4 T;  2XKO C;  3OY9 A;  2CKK A;  2MAM A;  2JTF A;  3OBY A;  4RMO A;  4XTV A;  3LYI A;  4OB3 B;  4IUV A;  3CCQ T;  1VQL A;  4NOY A;  3JCM c;  2K4Y A;  4HCB A;  2K5L A;  3QJ6 A;  4RKU E;  1BYM A;  2RHI A;  1PSF A;  4M77 E;  1WNL A;  1O9S A;  3OBW A;  1XQH A;  3MEA A;  3CCR T;  3F70 A;  1M90 C;  5GAM f;  4M7A G;  2FL7 A;  2QQS A;  1QP3 A;  4MDW A;  2P4T A;  3CCM A;  2HQE A;  3L2W A;  1YJW A;  1VQM T;  2XG8 D;  3URG A;  3CC7 T;  1M90 U;  3I56 T;  1QP2 A;  3QZ9 B;  4LD9 K;  4M7A A;  5I2M A;  4ME7 A;  3JRZ A;  4IUT A;  4IUQ A;  3QZ5 B;  2EJ9 A;  3MP8 A;  2D6F A;  1H3Z A;  4RCB A;  2R5M A;  2QQ9 A;  3M54 A;  4F7U B;  4Z02 A;  2K2V A;  3CC2 T;  1TH7 A;  1U1T A;  3EAE A;  4M75 B;  4M7A D;  2P0Q A;  3PMT A;  1YJ9 A;  1YJW T;  1JRI A;  2ZPG B;  2LT4 A;  1WGS A;  3I55 A;  3JCM Q;  2CYZ B;  3QKJ A;  5LJ5 e;  2O4X B;  3A5Z B;  5A0D A;  1ZBX A;  4JUV A;  3A8M B;  1VQ8 A;  4BDZ A;  4J7F A;  4XAX B;  2D0Q B;  2QEX A;  3TEE A;  1H64 1;  2X4X A;  4M78 F;  3CCS T;  2DIQ A;  2ZPF B;  1KC8 C;  1Q86 U;  3SD4 A;  3M56 A;  3QYG B;  3OYG A;  3A8O B;  3OYC A;  4F7U E;  1VQ9 A;  1QVF S;  3OYE A;  3G6E A;  3JCM W;  2XD0 A;  2YLC A;  2LX9 A;  5LJ3 h;  5I2S A;  4M75 E;  5GAN g;  2XID A;  5IT9 E;  2Y4X A;  4C92 F;  1VQ7 A;  5DLO A;  3HL8 A;  1VQ6 T;  4LD6 A;  3CMA A;  2LT1 A;  4PL6 A;  4TVR A;  2LTO A;  4C8Q B;  3HRT A;  4LDV A;  1NPR A;  4PNO A;  4J83 A;  1ZHI A;  4Y28 E;  4BUG A;  5M9O A;  3OYJ A;  5LJ3 d;  3G4S A;  3WVD B;  1M8V A;  3OYK A;  5FU6 C;  2EJG A;  3CPW S;  1XTD A;  1RI0 A;  1D3B B;  2EJF A;  3RER A;  3JAM E;  3NTI A;  1M1K C;  4B9X A;  3GNF B;  4ELZ C;  2K3X A;  1PSE A;  4F7U G;  3G71 A;  3HFN A;  3M58 A;  4MZM A;  5CQY A;  4M75 G;  3RMQ A;  1O75 A;  2VUB A;  1DJ7 B;  2LQK A;  5GAO n;  2E5Q A;  3CD6 T;  4N0A A;  3CCV T;  4C8Q E;  1BI2 A;  4HA8 A;  2KQW A;  5CKF A;  3TCJ A;  1QVG A;  1OI1 A;  2EYQ A;  2R5A A;  4D6W A;  2CZ0 B;  2IG0 A;  4OVA A;  4JLI A;  5GAN 5;  5GAN 7;  4HCC A;  1AHJ B;  2CS7 A;  3R6O A;  4EPC A;  3OYB A;  2E6N A;  1XOV A;  4FT2 A;  1K8A C;  1I8F A;  1KD1 C;  4EDU A;  1KQ2 A;  2O4X A;  3L42 A;  4X34 A;  3OYD A;  3VYG A;  3OS2 A;  4M75 D;  5C6S A;  2XI9 A;  2VV5 A;  3SWN A;  4R55 A;  3V7R A;  3JB9 H;  1JB0 E;  1M5Q 1;  4C92 E;  5GAN 6;  1X01 A;  4PKC C;  4J6W A;  2BKD N;  4CI0 C;  2OTJ A;  2NLU A;  3UWN A;  3H6Z A;  5GMK h;  5CO7 A;  1GXI E;  3A8G B;  5LJ3 f;  3QJY A;  1Y07 A;  4RG8 A;  4EMH A;  1K73 C;  1VQ5 A;  2V8I A;  3OYL A;  3KUF A;  3OYI A;  4E7J A;  2JOY A;  3L2U A;  2KSS A;  1V29 B;  1JJ2 A;  1BI1 A;  1MGQ A;  3LWI A;  1VUB A;  5HK0 A;  2XHC A;  3TU4 K;  2RHX A;  3INZ A;  3ER0 A;  3T9N A;  2P0K A;  3C94 A;  5GAN j;  4BE0 A;  4BE1 A;  2C06 A;  2VGM A;  4L6V 5;  3P8B B;  3HKS A;  2IVW A;  4V2S A;  4C92 G;  2XU8 A;  3LW5 E;  5CR2 A;  3BDU A;  4NL2 A;  4XTY A;  2MWP A;  3FLG A;  1KHI A;  2VGN A;  3L2R A;  1OZ3 A;  3MHX A;  1M4Z A;  2K5I A;  2LRQ A;  4BAC A;  2PU9 B;  1Q82 C;  1G3T A;  3DKM A;  4HT8 A;  4BY6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...