2GCXA

Solution structure of ferrous iron transport protein a (feoa) of klebsiella pneumoniae
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
75
structure length
75
Chain Sequence
MQFTPDSAWKITGFSRDISPAYRQKLLSLGMLPGSSFHVVRVAPLGDPVHIETRRVSLVLRKKDLALIELEAVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Ferrous Iron Transport Protein A (FeoA) of Klebsiella pneumoniae
rcsb
molecule keywords Ferrous iron transport protein A
molecule tags Transport protein
source organism Klebsiella pneumoniae
total genus 8
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gcxA01
4O5VA 1G3WA 1BI0A 1G3TA 1P92A 3HRUA 1QW1A 2K5LA 3HRTA 5CVIA 4O6JA 1G3YA 1U8RA 2QQ9A 1BI2A 1QVPA 3MHXA 1BI3A 2K4YA 2LX9A 2K5IA 1G3SA 3E19A 2QQBA 2QQAA 3HRSA 3GLXA 2GCXA 1BI1A 1FWZA 1FX7A 1BYMA 2H3JA 2K5FA
chains in the Genus database with same CATH superfamily
1E6GA 3WVDB 3RMSA 3UA6A 3VKIA 2RK1A 3ULRB 3CBMA 5D6XA 1O75A 1M90R 2OTLT 4DEXA 3E9GA 3VJPA 2R5AA 4FCYA 2RQUA 3L2UA 3G7ZA 1CKBA 2PTKA 3L2WA 4E6RA 5GAMd 1NZ9A 4PK4A 4RTYA 4HCZA 1MV0B 1NJIC 1UDLA 1Y7XA 2YUQA 5ECAA 3A98A 1VQOT 2H3JA 3S3MA 2YDLA 2CT4A 3VU3C 1Y96B 3HSBA 1NBEB 2EGEA 2YRVA 3OS1A 4K11A 1N9SA 3EFRA 5GANf 2NUPA 2X35A 3E19A 4OMMA 1HSQA 4KUDK 4M7AB 2DXCA 2E12A 3X25B 3LWIA 3QJYA 1N27A 2I0NA 4N4GA 1OYXA 2LJ3A 3PVQA 4IURA 4FYVB 3KXTA 3TU4K 4PJOE 4XTVA 2ZPIB 4GY5A 4QVZA 3PTAA 2DAQA 4M77F 1RABB 2KVQG 3OMGA 2HKNA 1WI7A 2E1HA 3UWNA 1G5VA 3LW5E 5GAN8 1UJYA 5CR2A 1GCQC 4ZTJA 2KRMA 2CT3A 3OBWA 2O9VA 4HT9A 1KC8U 4J9IA 2YUPA 4OMLA 4VUBA 5GAN6 5FU6B 3JB9F 3I5SA 2CH4W 2CSQA 4CC3A 1AZEA 1MUZA 5GAN7 4M7DA 4X9DA 3OMCA 5CKDA 2PNIA 3SWNA 3S6WA 5GAOq 5GANh 1RACB 2FPEA 1KQSS 5KYXA 2RO0A 3MP6A 2LX7A 2EQJA 1BI0A 5LJ5j 5HY6A 3M0UA 2DL4A 2EYXA 1M4ZA 3NTIA 2VB6A 1TG0A 1VQ6T 1XQHA 1N8RR 2GFAA 2DJQA 1DJ7B 5L23A 1MMAA 2RNAA 1B3QA 4B9WA 4IKFA 4KT0E 4ELYC 3OYIA 3QDFA 3QSUA 1UGQB 4HA8A 1K8AC 5GMKh 4M78C 2DA9A 1W2BA 4C8QA 1QLYA 3VS7A 2K4YA 2JVVA 4BUGA 2P84A 2ZPEB 5CAIA 4XU1A 1UG1A 3EHRA 4D6WA 1B7TA 4FYWB 5HK3A 2EJGA 2MMPA 2LQWA 2KXDA 5J39A 2EPDA 2AK5A 4RCBA 1KD1C 3EH2A 3CC7A 2HEQA 4F7UA 3QDRB 2DFUA 3RUXA 1Q7YC 2AKLA 1K1ZA 3SFMA 1VQ4Q 2QQ9A 2QG9B 2LQNA 4RMOA 3C95A 2HDAA 2RHXA 3NTHA 3IQLA 1YITQ 5LJ3d 1YWOA 1TTHB 4M77B 4HVVA 1VQ5A 2BZXA 5HK0A 1BIAA 3EFOB 2ZPHB 2OI3A 1VIFA 2GQVA 3BY7A 4JPBW 1C1AA 1S1NA 3JB9H 1AWWA 1T3SA 4C92G 4J9CA 1VQ8Q 4FSSA 2R58A 3QO3A 4BE0A 4OMNA 1VQMT 1ZUKA 3KUFA 4J7FA 1VQPA 2X4YA 1AEYA 1W2BP 3OYFA 1PNJA 4FT2A 4BE2A 2Y4XA 3PIOA 4O5VA 3PFSA 4BACA 2DKGA 2MIOA 1QVFA 4M75C 2DPPB 1ZA2B 1JB0E 5GAN3 2G3RA 4DA4A 1OU8A 1NEBA 1TUDA 4ZGEB 1VYVA 2ZCFB 1WJRA 1WYXA 5LJ5f 1K73R 1CSKA 2C0TA 3CXCA 3CCLA 3JCMP 1JQQA 2D0QB 2DZ9A 2ZPBB 1YIJA 4NS5A 2EBPA 1UB4A 2BZYA 3GNFB 4WCIA 4X34A 2DYIA 2P0KA 2QA4A 2DVJA 1M5Q1 4M7AC 1X2QA 1RAAB 2J7IA 2QEXA 1W1FA 2RK2A 5I2SA 2EAYA 3QWXX 3VUBA 2BTTA 1K76A 1Q86C 4JRIA 4JS4A 2H3EB 4II1A 5CKBA 5KYUB 2RHYA 3JCMd 4QKUA 5GAOr 2DD4A 2Z0WA 1S72A 2E70A 2RJFA 1X6GA 3FJ5A 1IXDA 2E41A 1TH7A 3OQ5A 4ZN3A 2V8IA 1WQ7A 1N8RC 3EFSA 3EGDA 1QVFP 4WF2A 4JRQA 2RHZA 3VS2A 1MNDA 2CUDA 2KEAA 3QHSA 1Q81U 5FU6C 5LJ5h 2A0FB 2DIQA 5CVIA 2MPXC 3CXCP 1H8KA 1WHHA 1G3SA 2O2OA 2RQWA 5FWBA 3HFNA 2V1RA 4QQDA 4AMCA 3KFVA 1WHLA 4LDVA 5GAN5 2ABLA 2BUDA 2DL8A 3CCSA 4RG8A 2V1QA 2E10A 3C4SA 2AZVA 1G3TA 1VQ4T 1B34B 1OI1A 1VA7A 3MP8A 2HL5C 3JAME 4Y28E 3TVTA 1OPKA 2K7AA 2QXFA 4QVDA 2OTJA 2YXYA 2DEUA 2CUBA 1K9MR 4E7SA 1VQ8T 1ZSZA 4IUQA 5FU7C 4PKCC 3I9QA 3RDVA 3CC7Q 1U06A 4N4HA 7AT1B 1AWXA 3GOXA 2M0YA 1SHFA 2HSEB 4HKEA 3TCJA 5LJ3g 4M7DC 1ZUUA 4FSXA 1BK2A 1BYMA 3JCMQ 4LDXA 2CZ7B 4DBHA 4J9FA 2VVKA 1VQ5Q 2KI7A 3OBYA 4WTOB 2LCLA 2JM8A 1CKAA 2LP5A 5CQYA 2EQIA 1BBZA 4KUIA 1JU5C 3URGA 3OW2A 4M78F 3MJXA 2L3QA 2QDYB 1SSHA 1KHIA 1KQ2A 1YNZA 5CKEA 2JUFA 2YT6A 3FEOA 4QQGA 2ESWA 1BIBA 1NEGA 1VQPQ 1NJIU 2HBPA 1U5SA 2CP2A 1VYTA 1K0SA 5CKFA 2EGAA 1X27A 4BDZA 1UGSB 3QZ9B 2IIMA 1U8RA 3RESA 3ZFJA 1LJOA 1ZSGA 2HMAA 1AWOA 3M0QA 4OB1B 3I55A 2WSFE 2PUKB 3L1AA 1WHKA 2DO3A 2H8HA 5DLOA 2YLBA 1VQ7A 2JS2A 2LMJA 4BE1A 3CEYA 1WHJA 2DX1A 1QVGA 4A4EA 4DEYA 3LYIA 4C5IA 4ZGDB 3DLLA 2RMOA 4OP0A 4IUPA 3M4YA 2JZ2A 4OB3B 4ESRA 3OW2S 3OW2P 2QA4Q 2EJFA 1WJSA 3TSWA 1YJWA 3SB2A 2YSQA 3JCMg 3JB9J 1G2BA 4BDYA 4XTUA 2HL3A 4M75F 5GAMe 1QCNA 1QWFA 3CC2A 2J05A 4IIOA 1M8VA 1RADB 2LQKA 1YWPA 3PE0A 1E6HA 4KULA 3CQTA 2JTFA 8ATCB 2RN8A 4E47A 1OZ2A 3JV3A 1JBMA 3LH5A 3QIIA 3V7RA 4C8QE 2NYSA 2X3XD 3VS3A 4A54A 1QVGS 3HPWA 1QVGP 2RB6A 4M7AF 4M78B 1M2VB 1WXUA 1HK9A 2EKOA 3VS6A 4QVCA 1WQWA 2KAFA 2DL5A 3CC7T 3GPLA 3EGXA 4ME7A 4C92E 4LD9K 2O4XA 4OF1A 4DBQA 1M30A 3JCMW 1OZ3A 1W4SA 4RG2A 1K9MC 2NUTB 1K8AU 1QWEA 4FYXB 5LJ3j 2VGMA 3EGUA 3RBBB 1M2OA 2VC8A 4M77D 3VV0A 3X24B 1VQ5T 4F17A 1YJ9A 1R77A 4JJNK 1SPKA 3E2UA 3MEVA 5M9OA 2CZ6B 1OEBA 2NLUA 1KD1U 2FZCB 3OS5A 3DKMA 2HAXA 4N0AA 1I5LA 4IUTA 1Q7YU 2KBTA 1I4K1 4PJOC 3H0IA 2DMOA 3JB9D 2CP6A 3WVEB 1VQPT 2BZ8A 1M90U 1WJQA 3QJ6A 4QT7A 3CMAQ 5FRNA 2FVUA 1QKWA 1D3BB 5EG2A 2EW3A 4YTLA 3TREA 2HD0A 2MYSA 2C0OA 4M75B 3NFCA 3RR6A 3CCMA 3C12A 3L2QA 4XQ3A 5GANe 1M9SA 4AFUC 5GMKm 3T9NA 2JW4A 1XJWB 3CCJA 3J81E 1NG2A 5CQXA 4EMKA 2KT8A 2A7YA 2IPOB 4M7AG 2QA4T 1UGPB 3I56A 1V29B 4M7DF 1YN8A 1HYOA 3HRSA 4J83A 2CP0A 3M0SA 1VQMQ 2KYBA 1ZSZC 1WXBA 1IREB 2ZAEA 3I55Q 3ER0A 5A2QE 2HQEA 3SD4A 2CP7A 1VQ7Q 4C5EA 3DLMA 5GMKe 3QWYA 1WHGA 3RKYA 2QGGA 4Y92A 4ZGJB 1YHQA 4LDWA 2K2MA 2RQVA 5DLQE 5J3BA 1UJ0A 1WX6A 2EFIA 3X28B 2P0QA 5LJ3f 5CO7A 1IZ6A 1YJWQ 3JB9I 1X6OA 1UECA 4XK8E 3CD6A 2CSIA 3QKJA 1Q86R 2EQUA 1YI2A 5IXFA 1IRXA 2NUPB 3M53A 3CC2Q 1M1KC 4F7UF 1N8RU 2LRQA 3CCST 2Y4YA 2F5TX 4PNOA 1TWBA 1ZA1B 3X26B 2MK5A 3S3NA 3CCVA 1TU0B 1PRMC 3JCMc 1PM3A 4RUGA 1TXQA 1MGQA 4J7IA 5IH2A 4MZMA 2OTJT 2F5KA 2SRCA 3CCEA 2LT4A 1X75C 4Z88A 2RQTA 2GGRA 2RJDA 2X4WA 1TOVA 2L2PA 3V8KA 5L8RE 2DYBA 5FU7B 2K9GA 5LJ3h 1MV3A 1QQJA 4CI0C 3VS4A 1N6AA 3CMAT 3NMZC 5KYNA 2AZSA 1IHVA 4J9DA 4DBFA 2O31A 3R6NA 3CCRA 3M9QA 4M7DB 3EG9A 3SWNB 4E7JA 1VQKA 5KE2A 1NPPA 3TQ7P 3PIPA 4R55A 5C6SA 5KYXB 1QW1A 2K3XA 2XKOC 4C92A 2R5MA 1HXDA 4M77G 5DY9A 3V7SA 2KXCA 1VYUA 4PFPA 5KYYA 2MCNA 3JCMf 1U3OA 2CZ0B 1OX8A 2FEIA 2JJ9A 3D7SB 1BU1A 2O01E 2K2VA 1IGQA 3NHNA 1N9RA 1NYFA 3G71A 3X20B 1H641 2FZKB 3EH1A 4E7IA 2KMTA 3JB9G 1D1CA 3SDZA 2DXBA 1C6VX 1KSWA 3M56A 1K4US 5CKHA 1UGRB 3I55T 2DM1A 2MWOA 3AT1B 1W2BS 3OYDA 2SEMA 1VQ7T 3CCMQ 3GIBA 2J6KA 4F7UB 3P8BB 3EG1A 5LJ5e 2VV5A 2VYTA 2ECZA 3OY9A 3LWHA 1RUWA 3CCJQ 3H8ZA 1LOJA 1K73U 2VUBA 4PJOF 5A0GA 4JZ4A 2AT1B 1VQNA 2P4RA 4E7KA 2QQAA 3I56Q 4BB7A 2EJ9A 3OYNA 3INZA 3JCMh 1YJWT 5AYFA 3OYJA 2QGFB 3M4GA 4CC4B 4XTWA 3HP9A 3M58A 3CMEA 3QG1A 1PHTA 4DQ2A 3CC2T 1OV3A 3FIFA 3JSCA 3FB9A 2DF6A 2KK4A 1YHQQ 1K9AA 4A4GA 2NWMA 4OMFB 2QK0A 4ATOA 3OYMA 1QCFA 2BKDN 1GRIA 2FL7A 4E7LA 3H9NA 4AFQC 2KT1A 2X9HA 2QASA 5A0DA 1Q82R 1WDXA 5GAN4 4EPCA 1PCXA 4M78D 2F1LA 2MI6A 3LGFA 3SEMA 4CC2A 3CD6Q 4J9BA 1YI2Q 1QVFS 3VS5A 1FX7A 1KC8C 1UHCA 2LCSA 1V1CA 3NTKA 2CP5A 1D0YA 2RJCA 1Y57A 1UHFA 3REBB 4FU6A 3GP8A 3CXCS 3OYHA 1GBQA 5GMKl 1M3BA 3VRZA 1I8FA 4A4KA 2HBWA 1YJ9T 2ROLA 1Y0MA 4PJJA 2E5QA 5GAOn 3FDRA 2A36A 1D0XA 2L3PA 3G6EA 4JJBA 4LDYA 4BD3A 3CCEQ 3CCUA 4XU3A 1XNIA 3A8OB 4ZTFA 2KSSA 2L3RA 1Q95G 2K6DA 4PJOG 2V8JA 3BFMA 4IUVA 1F1BB 3QPHA 2FRYA 1FXXA 4E7HA 2XDDA 4PJOB 1FWZA 3MPUB 2YHTA 3MO8A 5FRMA 2COWA 3EGDB 4RTVA 3G4SA 2QAZA 3RKXA 1D1AA 3CCRQ 2EYQA 2BIVA 4R56A 1VQKQ 2RM4A 1PG5B 2IG0A 1VQ9A 1LPLA 4OMQA 2DZCA 4EMGA 2K5IA 2EYZA 4M75D 3M54A 4V2SA 1U1TA 3QZ5B 5FROA 3CC4A 3CCMT 5FW9A 3SWNC 1BI1A 3EG2A 3HL8A 4RTUA 2L0AA 3CCJT 4J9GA 1UTIA 2EGCA 4A63B 1KK7A 2L8DA 3OYCA 2JMAA 2J06A 2YRCA 4O6JA 3G71Q 3I56T 2DTIA 4F14A 2E4HA 4M7AD 1SSFA 4J8OA 1GCQA 2FZGB 3NGPA 1I07A 1T0JA 3FRNA 1UE9A 2EIFA 1RI0A 4D8DA 3OS0A 4JRKA 3CPWA 4RTXA 3AHUA 1ZSZB 5I2MA 2YLCA 5DM7R 4MZPA 1UEBA 5IN1A 2KGTA 4C8QC 5GAOp 1KG1A 1X01A 3HHTB 4XU0A 4M4ZA 1YHQT 2OJ2A 1UUEA 2RD1A 3VS0A 4NL2A 1KHCA 3LX7A 3L2RA 2QQRA 2OAUA 1GFCA 1YP5A 5A0LA 4HVWA 1D09B 4C92C 3H41A 4MZTA 3MEUA 4LE9A 3CCLQ 2KRNA 3CD6T 1YIJQ 2EQKA 1YI2T 1PC0A 4E7ZA 3CMEQ 3QBYA 1Q82C 1NLPC 4KH0B 4BY6B 3JCMb 2QEXQ 2ED0A 5IHNA 3HTRA 1RAEB 2PVOB 2VASA 1QCOA 2XDPA 4L5GA 2YUOA 3OS2A 1M2VA 1LNXA 1GXIE 3CPWP 3A8MB 3OSVA 1S72Q 2CP3A 2DTHA 2FRWA 3ZL7C 2JTEA 3THKA 3E9FA 2D6FA 3CCET 1XOVA 3META 2PVGB 2WACA 2B86A 2KE9A 2D0NA 1SF9A 1ZLMA 5D7UA 4DBRA 4M78G 2LNVA 4D8KA 4M77E 3JCMJ 5KYWA 2EWNA 4ZNXA 3CPFA 1AT1B 2X3WD 1M1KR 3OYEA 3L2ZA 4RKUE 2MWPA 6AT1B 2LVMA 1N5ZA 1Q81C 3NPFA 3EG0A 3CCRT 4M7DD 1WLPB 5IAYA 1V76A 4X1VA 3JCMV 5HKCA 2E6ZA 1VQKT 1PRLC 1H92A 3CCSQ 8AT1B 1NYGA 4PJMA 3G6EQ 1OULA 3VRYA 2DIGA 3L2VA 2KNBB 1HD3A 3ME9A 4PL6A 4PLIA 3VYGA 5CIUA 4DOWA 4FW2A 3LLRA 1PKTA 1GFDA 4A53A 1PWTA 2OTJQ 2PVDB 3LH0A 3BE3A 1G3WA 4J5YA 2VGNA 3HRUA 2COZA 3G71T 3G4SQ 1OU9A 1WNLA 2CDTA 1I5OB 3CBPA 2FPDA 3UDCA 2XDBA 1VQLA 1SEMA 2LT1A 2DL7A 3A5ZB 1JXOA 1VQ9Q 2XHCA 1OOTA 2RPNA 1IHWA 4RCCA 3GBQA 3CC4Q 4AFSC 1B07A 1Y96A 1PD0A 4MDWA 3OYGA 1R0BG 1P92A 2ED1A 3EGXB 1YBYA 2M0OA 4XAXB 1QMCA 2QQSA 1YITA 2O4XB 2IVWA 2RA2A 4M75G 4C5GA 2LCCA 4QQ6A 3A8HB 2RQRA 1QVPA 4M7AA 1KIKA 1VQNT 4TVRA 2RJEA 2Y90A 2CREA 2WSEE 2E65A 1SRLA 1YCYA 2DRMA 3CCLT 1TSFA 2KRSA 1YIJT 3MP1A 3QUIA 2HCKA 3E1SA 1FMVA 4LXCA 5LL6S 3CMET 1M27C 3RMQA 1MHNA 3OSSC 4XTZA 1ZHIA 2J6OA 2QEXT 1PKSA 3OYLA 2ZPGB 3GLXA 4J9EA 2LQ8A 3GNGA 3RERA 2CYZB 2PQWA 3ASKA 2JM9A 2JTMA 2YUNA 2LNHB 1TS9A 2E5KA 2X4JA 1S72T 2KYMA 4KRTA 3VYHB 5GJVB 5LJ3e 1I1JA 1KQSA 2FHDA 2I2LA 3H6ZA 1EX4A 3UATA 2DETA 5FLXE 2PUOB 2MF2A 1MNEA 3OYBA 1AZGB 2XK0A 4AG1C 1Q86U 2A08A 2ZGWA 3OYKA 1RAHB 2HSPA 2K5LA 4A4FA 3OB9A 4C8QF 2O9SA 2D8JA 4EMKB 1J3TA 4PJLA 4RTWA 4L6V5 1ZBXA 3I35A 4BY6C 1H3ZA 4B9XA 1O9SA 1VIEA 1WFWA 4J6XA 4E2FB 5D6YA 3A8LB 4XU2A 5KCHA 3G6ET 4ANJA 2XD0A 4FT4A 3CCUT 2A37A 2VXFA 1WPYA 4C92F 1M3AA 3M57A 4RTZA 3CCQA 5KCOA 1T0HA 1KC8R 2J6FA 3TSZA 4PJOD 3EHQA 1XTDA 4JJDA 3M0PA 1YFNA 3BDUA 1VUBA 1BCOA 1LCKA 2JS0A 3F70A 1KQSP 3G4ST 2QDLA 3C0CA 3PNWC 1FMWA 2RI3A 2E6NA 1EFNA 1JXMA 1SKUB 1JO8A 4LUEA 2R57A 2LJ0A 3G1JA 1WXTA 2M51A 3HKSA 4OGEA 2P4TA 1VQ9T 4F16A 3OYYA 1G83A 1WGSA 3M55A 4M77A 3PGGA 4M7DG 3CC4T 3EFOA 4BI3A 5FWCA 5GAOm 1ARKA 3M5AA 2FG0A 2W0ZA 2P0PA 2JT4A 3ZEHA 1AHJB 1D1BA 3U23A 3JCMe 1MMGA 5GANd 1Y07A 1YJ9Q 1IB8A 3H0HA 2D1XA 1R0CB 4HT8A 4ZN1A 2RF0A 2XU8A 3KBGA 4KGXB 4EIKA 4CRIA 1VQLQ 1UGVA 2NUZA 1H3HA 1JEGA 1JJ2A 4P5NA 2GFUA 3FC3A 2DD5A 2LJ1A 1G8XA 3P8DA 1QP3A 1KQ1A 2AKKA 5I22A 2JNGA 1ZQ1A 3V8LA 4C8QG 4AFZC 1FYNA 1X2KA 2VKNA 3S3OA 3M59A 4C8QB 4FIBA 1M90C 5GJWB 4IUUA 3OA6A 3OYAA 3TEEA 1YJNA 2QI2A 1C0MA 4F7UG 2YRDA 4MDXA 4L59A 3MKDA 4B6MA 2F2WA 3EG9B 4OMOA 2VWFA 3L42A 2K57A 3FLGA 1YCSB 1E7OA 4MMLA 2ATCB 4Y91A 3MEWA 3UF4A 4C92B 3QYGB 5GAMg 4JZ3A 2DRKA 3VUZA 1WZOA 2DVEA 2JMCA 1WHMA 4JUVA 5KYYB 4JS5A 3WXMB 1WIEA 2XI9A 2PZ1A 5KYUA 2AHJB 4LNPA 3A8GB 2ENMA 4JDSA 4N0AC 1JJ2S 2DNUA 1JJ2P 4AG2C 2K79A 4M78E 4JLGA 2OTLA 1NPRA 1MMNA 2DTOA 1ZUYA 1BI2A 4LN2A 2GTJA 1Y71A 2X51A 1GL5A 4DOVA 4GBQA 3H0FA 2L89A 4OGCA 1X69A 1UFFA 4FM4B 2M9UA 5CCAA 1Q82U 3PMTA 1VQOA 3UA7A 3DB4A 2E64A 1X43A 2DLPA 3RNJA 2OX7A 1M3CA 4OB0B 2KR3A 3PVLA 4EDUA 1W6XA 2GF7A 1D0ZA 2M16A 3QXEB 3EAEA 2DBKA 2QTVA 2MOXA 4OMPA 2CGHA 4JRPA 4OB2B 1PSFA 1T3LA 2K3YA 3MEAA 1B34A 2G6FX 1IGUA 1GBRA 4EMKC 4PFZA 3BDLA 3M0TA 3R6OA 1WA7A 3V7CA 2KY9A 1PSEA 9ATCB 5IXBA 4PJOA 3DB3A 2JN0A 2KQWA 2JXBA 3CCQQ 3CCVQ 4HXJA 2JOYA 1MMDA 1JRIA 3FJPA 2MAMA 1M8MA 5KH6A 4M75E 2EYYA 5I11A 1AWJA 3JCMX 2DE0X 1VQLT 5J26A 3EG3A 4PLLA 1K9MU 1Q81R 4GLKA 1AD5A 1RI9A 2GTOA 2V8KA 4NOYA 1NLOC 2CH4A 1TUCA 1ABOA 1M1FA 5GANg 4HCKA 3C94A 2K3BA 1U1SA 3PT9A 1OX9A 4LDUA 4AT1B 1TUGB 3O5ZA 2V26A 3HRTA 1YITT 2YWWA 4MMKA 5LJ5d 1VQ6A 1ZBJA 4M7AE 5IHKA 3RIRA 3PMIA 2RHUA 3A1PA 4J9HA 2AIRB 2E3HA 4C0ZA 1GCPA 3LGLA 3J80E 4UC4A 2COYA 4LD6A 3O8VA 4IIMA 2KDSA 4C0DB 3JRZA 2DILA 5EC7A 3MCAB 4ELZC 2FB7A 5GAMj 5AT1B 2RI2A 4Z8AA 3CMAA 3P8HA 2QQBA 5D6WA 4BI8B 4C0GA 2FYKA 3BW1A 5KE3A 2KROA 2X4XA 2K5FA 2M1HA 2QTXA 1YJNQ 1SRMA 1EZZB 3Q1JA 1ABQA 2LDMA 4M77C 4J6WA 1SHGA 1HJDA 4N4IA 2DXUA 3J7AF 2BE9B 1R8OB 4HCCA 2C0IA 1BB9A 1NE8A 2C06A 1OPLA 1VQNQ 4KGVB 5HCKA 1Z9ZA 1KFZA 1K73C 2GNCA 1NJIR 3MHXA 5GAOl 2OTLQ 1VQMA 3RKWA 2QYZA 4F04B 2HKQB 2RI5A 1RAIB 5IHIA 2BE7D 2DXTA 1RAFB 1SG5A 2RHIA 1IO6A 3M0RA 1VQOQ 1KJWA 4Z02A 1M1GA 4J6YA 3QYHB 3REAB 5GAN2 3CCQT 3N5BB 4M78A 4EMHA 3CCVT 3CPWS 3CBOA 1Z9QA 4M7DE 2DEQA 1NM7A 2CZ1B 4HCBA 2ZZDA 2EVRA 4Q5WA 1AOJA 4C0FA 1AVZC 1M1KU 1I81A 4XTYA 2F2VA 4PJNA 2NUTA 5CK9A 2DJZA 3VS1A 2VXEA 2EQMA 3UT1A 1A0NB 3GF5A 2DERA 2O88A 1RL2A 4C5HA 2A28A 4ORZA 2L5QA 2GQIA 3SHWA 5GANj 1VOMA 4KBMB 5I21A 4PFOA 2WSCE 2CKKA 3I5RA 5GAMf 4JJCA 2DL3A 2EYWA 4JLIA 2A3LA 2XG8D 2PU9B 4Z89A 1FMKA 3HFOA 2FO0A 2FPFA 1K0XA 3CCUQ 2LZ6B 2LX9A 1I0CA 2L3SA 1RAGB 4GLMA 3UPUA 2DK3A 2OAWA 4F7UE 1RLQC 1ZX6A 2ROTA 4FL6A 2F2XA 4FYYB 2ZPFB 4X9CA 2XICA 1D3BA 2XMFA 1W70A 3ZBDA 5GMKj 2LTOA 5LJ5g 1G3YA 1LVKA 2LC4A 1QKXA 4M75A 4C8QD 4R0KA 5KYWB 1VQ6Q 1X6BA 2HQHA 1ACMB 1OQKA 4KH1B 2B8AA 1YJNT 2GCXA 4QW2A 4A4HA 1QP2A 1K8AR 2E3IA 2HNIA 2W10A 4OVAA 4FW1A 2EKHA 2D8HA 1BKBA 2HQXA 2F69A 5GMKi 1VQ4A 4CC7A 5IT9E 4RTTA 4NL3A 4BI4A 4C92D 5GAMh 1BI3A 5C0MA 1KD1R 4KGZB 2CS7A 2DBMA 3V8JA 1PD1A 1EIFA 4HVUA 4LUDA 4XTXA 2RH2A 4C0DC 1Q7YR 1BCMA 2HZYA 2GBQA 2M02A 2XIDA 1RLPC 1VQ8A 2D9TA
chains in the Genus database with same CATH topology
3CEYA 3JCMe 5GANd 3NTKA 1Y07A 3WVDB 4A4EA 1QVGA 3RMSA 3LYIA 3VKIA 2RJCA 2RK1A 4C5IA 3CBMA 4ZGDB 5D6XA 1O75A 3DLLA 4HT8A 2OTLT 4FU6A 4OP0A 3GP8A 4ZN1A 3E9GA 2XU8A 3KBGA 3CXCS 4IUPA 3VJPA 2R5AA 3M4YA 3OYHA 2JZ2A 3L2UA 3G7ZA 3L2WA 4OB3B 4CRIA 5GMKl 5GAMd 1NZ9A 3OW2S 1JJ2A 4P5NA 4HCZA 1I8FA 2GFUA 4A4KA 3FC3A 1YJ9T 1QVGS 1NJIC 1Y7XA 2E5QA 2EJFA 5GAOn 2DD5A 1WJSA 3FDRA 3P8DA 2H3JA 1VQOT 3S3MA 1QP3A 1KQ1A 3VU3C 1YJWA 3G6EA 3SB2A 4LDYA 4BD3A 1Y96B 3JCMg 2JNGA 3CCUA 1ZQ1A 3HSBA 4XU3A 1XNIA 2YRVA 3A8OB 3V8LA 4C8QG 4ZTFA 3JB9J 2KSSA 4BDYA 2L3RA 4XTUA 3OS1A 4M75F 4PJOG 2V8JA 5GAMe 1N9SA 3BFMA 4IUVA 3EFRA 3S3OA 3CC2A 3QPHA 5GANf 3M59A 4C8QB 4FIBA 1M90C 1M8VA 2X35A 1FXXA 3E19A 4IUUA 4E7HA 2XDDA 2LQKA 3OA6A 4KUDK 4PJOB 3OYAA 4M7AB 2DXCA 4KULA 2E12A 3TEEA 1YJNA 1FWZA 2QI2A 2JTFA 3X25B 2YHTA 3MO8A 4F7UG 3LWIA 5FRMA 3QJYA 4MDXA 1N27A 3G4SA 4N4GA 1OYXA 1OZ2A 4IURA 4L59A 4E47A 1JBMA 3RKXA 3KXTA 3TU4K 2EYQA 3QIIA 3L42A 3V7RA 2BIVA 4R56A 4C8QE 2K57A 3FLGA 2RM4A 4PJOE 2IG0A 4MMLA 4XTVA 2ZPIB 4GY5A 4Y91A 3MEWA 4QVZA 2DAQA 3HPWA 4M77F 4A54A 2KVQG 2RB6A 4C92B 3PTAA 3QYGB 1VQ9A 4M7AF 2DZCA 3OMGA 4EMGA 2K5IA 4M75D 4M78B 5GAMg 3M54A 4V2SA 3VUZA 1U1TA 3QZ5B 2E1HA 2DVEA 5FROA 3UWNA 1G5VA 3CC4A 3LW5E 4JUVA 4JS5A 5GAN8 1HK9A 3CCMT 5CR2A 3SWNC 3WXMB 2EKOA 1BI1A 2XI9A 4QVCA 1WQWA 4ZTJA 3OBWA 2KAFA 3HL8A 3CC7T 4HT9A 2AHJB 3GPLA 3A8GB 3CCJT 1KC8U 4JDSA 4ME7A 4N0AC 1JJ2S 4C92E 4LD9K 2O4XA 4OF1A 3JCMW 4M78E 4VUBA 5GAN6 1OZ3A 1W4SA 4JLGA 4RG2A 2L8DA 1NPRA 5FU6B 3OYCA 1K9MC 2OTLA 1K8AU 4O6JA 2DTOA 3JB9F 1BI2A 5LJ3j 2VGMA 3I56T 1Y71A 2DTIA 4DOVA 2VC8A 4M77D 3VV0A 2L89A 4OGCA 3X24B 5GAN7 4M7AD 4M7DA 4X9DA 3OMCA 1VQ5T 1YJ9A 4JJNK 1SSFA 4J8OA 4FM4B 3SWNA 3S6WA 5CKDA 2M9UA 5CCAA 5GAOq 1Q82U 3PMTA 5GANh 1VQOA 3FRNA 1VQ8A 2EIFA 1RI0A 3MEVA 3OS0A 5M9OA 1KQSS 2CZ6B 2RO0A 3DB4A 2NLUA 3MP6A 2E64A 2EQJA 4JRKA 3CPWA 1BI0A 1KD1U 3OS5A 3AHUA 3DKMA 5I2MA 2YLCA 5DM7R 4N0AA 2HAXA 4MZPA 5HY6A 5LJ5j 1I5LA 1UEBA 5IN1A 1M4ZA 3NTIA 4OB0B 4IUTA 1VQ6T 4C8QC 5GAOp 1XQHA 1KG1A 1Q7YU 1X01A 1I4K1 4PJOC 2GFAA 3HHTB 4EDUA 1DJ7B 2GF7A 4XU0A 1YHQT 2M16A 3QXEB 3EAEA 3JB9D 3WVEB 2RD1A 1VQPT 4B9WA 4IKFA 2CGHA 1WJQA 4JRPA 4OB2B 1M90U 4KT0E 4NL2A 1PSFA 2K3YA 3MEAA 3QJ6A 1KHCA 3LX7A 4ELYC 3L2RA 1B34A 5FRNA 2QQRA 2OAUA 2FVUA 3OYIA 3QSUA 1UGQB 4EMKC 5A0LA 4HA8A 1K8AC 4C92C 1D3BB 3BDLA 5EG2A 4MZTA 5GMKh 3MEUA 3R6OA 4M78C 1W2BA 3V7CA 4YTLA 4C8QA 2KY9A 3TREA 3CD6T 1PSEA 4PJOA 3DB3A 2EQKA 2K4YA 2HD0A 2JN0A 2JVVA 4BUGA 2KQWA 1YI2T 4M75B 3NFCA 2ZPEB 5CAIA 3QBYA 4XU1A 1Q82C 4D6WA 3CCMA 5HK3A 2JOYA 4BY6B 2EJGA 2MMPA 3C12A 3JCMb 3L2QA 4XQ3A 5J39A 4RCBA 5GANe 1M9SA 1KD1C 5GMKm 1JRIA 3T9NA 3CC7A 4F7UA 3FJPA 3QDRB 3CCJA 2MAMA 3J81E 5CQXA 5KH6A 4EMKA 2PVOB 3RUXA 4M75E 1Q7YC 3JCMX 2XDPA 4L5GA 3SFMA 1VQLT 2A7YA 5J26A 3OS2A 2QQ9A 4PLLA 1LNXA 4M7AG 1GXIE 2QA4T 1K9MU 3A8MB 4RMOA 1UGPB 4GLKA 3C95A 2RHXA 1V29B 3NTHA 3OSVA 3I56A 2DTHA 5LJ3d 4M7DF 2V8KA 3HRSA 4J83A 4M77B 4NOYA 3E9FA 1VQ5A 5HK0A 2D6FA 3CCET 1BIAA 1XOVA 2ZPHB 3META 2PVGB 1IREB 2WACA 1VIFA 2GQVA 3BY7A 3ER0A 5A2QE 1M1FA 2HQEA 5GANg 3C94A 3SD4A 3JB9H 1U1SA 3PT9A 4LDUA 4C92G 4C5EA 3DLMA 5GMKe 3HRTA 3RKYA 4M78G 2LNVA 4MMKA 5LJ5d 2R58A 1YITT 4M77E 1VQ6A 3JCMJ 2EWNA 3QO3A 4ZGJB 4M7AE 3CPFA 4BE0A 3RIRA 3PMIA 2RHUA 1VQMT 3OYEA 1YHQA 3KUFA 3L2ZA 4LDWA 2MWPA 4RKUE 4C0ZA 4J7FA 5DLQE 1VQPA 2LVMA 2X4YA 5J3BA 3LGLA 3J80E 1Q81C 3OYFA 2EFIA 4M7DD 3CCRT 4UC4A 5IAYA 4LD6A 3O8VA 3JCMV 5HKCA 2E6ZA 4FT2A 4BE2A 1VQKT 3X28B 2Y4XA 3PIOA 4O5VA 2KDSA 2P0QA 4C0DB 5LJ3f 3JRZA 5CO7A 1IZ6A 3PFSA 4BACA 2DKGA 3MCAB 3JB9I 4ELZC 1X6OA 1QVFA 2FB7A 4M75C 2DIGA 4XK8E 5GAMj 2DPPB 2RI2A 3L2VA 3CD6A 1JB0E 3QKJA 5GAN3 2G3RA 3ME9A 4DA4A 2EQUA 1YI2A 3CMAA 3P8HA 2QQBA 4PL6A 4PLIA 3VYGA 4ZGEB 3M53A 2ZCFB 5CIUA 1WJRA 5D6WA 4BI8B 4C0GA 4DOWA 5LJ5f 2FYKA 1M1KC 4F7UF 1N8RU 3BW1A 3LLRA 2LRQA 5KE3A 3CXCA 2X4XA 4A53A 3CCST 2K5FA 2M1HA 2QTXA 3CCLA 2PVDB 2D0QB 2Y4YA 1G3WA 3LH0A 2F5TX 2DZ9A 4J5YA 4PNOA 3JCMP 2VGNA 3HRUA 2ZPBB 3X26B 4NS5A 3G71T 1YIJA 1UB4A 3S3NA 1WNLA 3GNFB 3Q1JA 3CBPA 4X34A 2LDMA 3UDCA 2XDBA 1VQLA 2P0KA 3CCVA 2LT1A 2QA4A 4M77C 1M5Q1 4J6WA 3JCMc 4M7AC 3A5ZB 2QEXA 4N4IA 2RK2A 1MGQA 5I2SA 2DXUA 3J7AF 2EAYA 4J7IA 1R8OB 2XHCA 3VUBA 4HCCA 4MZMA 2OTJT 2F5KA 4RCCA 2LT4A 3CCEA 1X75C 1Q86C 1NE8A 4JRIA 4JS4A 2C06A 4II1A 1Y96A 5CKBA 4MDWA 3OYGA 2RHYA 1P92A 3JCMd 2RJDA 2X4WA 5GAOr 1K73C 1YBYA 2DD4A 2M0OA 4XAXB 3V8KA 2E70A 2QQSA 2RJFA 2O4XB 2IVWA 2RA2A 5L8RE 1YITA 2E41A 4M75G 5FU7B 4C5GA 2LCCA 1TH7A 3A8HB 4QQ6A 1QVPA 3MHXA 5LJ3h 5GAOl 3OQ5A 1VQMA 4CI0C 4M7AA 3RKWA 4ZN3A 1N6AA 3CMAT 1VQNT 2RI5A 2V8IA 1WQ7A 1N8RC 3EFSA 4TVRA 2DXTA 4WF2A 4JRQA 3CCRA 3M9QA 2RHZA 2RJEA 4M7DB 2Y90A 3QHSA 3SWNB 4E7JA 1Q81U 1VQKA 2WSEE 2E65A 5KE2A 1NPPA 1YCYA 3CCLT 5FU6C 2RHIA 4R55A 5C6SA 3PIPA 1QW1A 5LJ5h 4Z02A 2K3XA 1YIJT 2XKOC 2DIQA 1M1GA 3MP1A 4J6YA 3QUIA 3QYHB 3E1SA 5CVIA 4C92A 5LL6S 5GAN2 2R5MA 3CCQT 1HXDA 3CMET 3N5BB 4M78A 4M77G 4EMHA 3CCVT 3RMQA 3CPWS 3CBOA 1MHNA 3OSSC 5DY9A 4M7DE 3V7SA 4XTZA 1ZHIA 2DEQA 1G3SA 3JCMf 2CZ1B 2QEXT 4HCBA 2CZ0B 2ZZDA 3OYLA 1S72A 3HFNA 2ZPGB 3GLXA 4Q5WA 2LQ8A 4QQDA 3GNGA 3RERA 4LDVA 2CYZB 4C0FA 5GAN5 2PQWA 2BUDA 3CCSA 3ASKA 4RG8A 2E10A 2O01E 2K2VA 3C4SA 1M1KU 1I81A 2JTMA 4XTYA 1G3TA 1VQ4T 1B34B 1VQ7A 1N9RA 3G71A 1OI1A 5CK9A 3X20B 2DJZA 4BE1A 1H641 3MP8A 2X4JA 1S72T 2VXEA 3JAME 4E7IA 2KMTA 4Y28E 3JB9G 2EQMA 3SDZA 3UT1A 2DXBA 3VYHB 5LJ3e 3M56A 1KQSA 2FHDA 3GF5A 5CKHA 2I2LA 1UGRB 3H6ZA 2QXFA 4QVDA 3I55T 2OTJA 1RL2A 5FLXE 2MWOA 4C5HA 1W2BS 2PUOB 2MF2A 2L5QA 3OYDA 5GANj 4KBMB 1VQ7T 3OYBA 5I21A 1VQ8T 2WSCE 2XK0A 1Q86U 2CKKA 5GAMf 3GIBA 2ZGWA 4IUQA 5FU7C 4PKCC 4F7UB 3OYKA 3P8BB 4JLIA 2A3LA 5LJ5e 2VV5A 2VYTA 2XG8D 2K5LA 2PU9B 3OY9A 3LWHA 4A4FA 3OB9A 3HFOA 4C8QF 3H8ZA 4EMKB 1LOJA 1K73U 4N4HA 2VUBA 4PJOF 5A0GA 3GOXA 4L6V5 1ZBXA 2LX9A 4BY6C 4HKEA 1H3ZA 3TCJA 4B9XA 5LJ3g 4M7DC 1O9SA 1VIEA 1VQNA 4E7KA 2QQAA 3UPUA 2DK3A 4F7UE 4BB7A 4FSXA 2EJ9A 3OYNA 1BYMA 3JCMQ 4LDXA 2CZ7B 4FL6A 4J6XA 3INZA 5D6YA 3JCMh 2ZPFB 3A8LB 4XU2A 1YJWT 4X9CA 5KCHA 2XICA 3OBYA 5AYFA 3G6ET 2LCLA 1D3BA 3OYJA 4FT4A 3M4GA 5CQYA 3CCUT 2XD0A 4XTWA 2VXFA 1WPYA 4C92F 3M57A 3ZBDA 5GMKj 3HP9A 4KUIA 3M58A 3URGA 3OW2A 4M78F 2LTOA 5LJ5g 1G3YA 3CCQA 3CMEA 3QG1A 2QDYB 5KCOA 2LC4A 4M75A 1KHIA 4C8QD 4DQ2A 3CC2T 1KQ2A 3FIFA 3JSCA 4PJOD 3FB9A 1XTDA 5CKEA 2JUFA 2B8AA 2KK4A 3FEOA 1YJNT 2GCXA 3BDUA 1VUBA 4QQGA 4QW2A 4A4HA 1QP2A 1BIBA 4A4GA 2HNIA 3F70A 1NJIU 4OMFB 3G4ST 3PNWC 4OVAA 4ATOA 3OYMA 2RI3A 1BKBA 2HBPA 2F69A 2HQXA 5GMKi 2E6NA 1VQ4A 2BKDN 4E7LA 2FL7A 2R57A 5CKFA 5IT9E 4BDZA 1UGSB 3QZ9B 4NL3A 4BI4A 5A0DA 1U8RA 3HKSA 4OGEA 3RESA 3ZFJA 2P4TA 4C92D 1LJOA 4EPCA 5GAMh 5GAN4 1VQ9T 1BI3A 3OYYA 4M78D 5C0MA 1WGSA 2MI6A 3M55A 3LGFA 4M77A 3PGGA 4M7DG 2CS7A 4OB1B 3CC4T 3V8JA 1EIFA 3I55A 2WSFE 4BI3A 2PUKB 3L1AA 5GAOm 3M5AA 1QVFS 2DO3A 1FX7A 1KC8C 2P0PA 2RH2A 4XTXA 4C0DC 2YLBA 5DLOA 3ZEHA 2XIDA 1AHJB 2D9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5V A;  1G3W A;  1BI0 A;  1G3T A;  1P92 A;  3HRU A;  1QW1 A;  2K5L A;  3HRT A;  5CVI A;  4O6J A;  1G3Y A;  1U8R A;  2QQ9 A;  1BI2 A;  1QVP A;  3MHX A;  1BI3 A;  2K4Y A;  2LX9 A;  2K5I A;  1G3S A;  3E19 A;  2QQB A;  2QQA A;  3HRS A;  3GLX A;  2GCX A;  1BI1 A;  1FWZ A;  1FX7 A;  1BYM A;  2H3J A;  2K5F A; 
#chains in the Genus database with same CATH topology
 1E6G A;  3WVD B;  3RMS A;  3UA6 A;  3VKI A;  2RK1 A;  3ULR B;  3CBM A;  5D6X A;  1O75 A;  1M90 R;  2OTL T;  4DEX A;  3E9G A;  3VJP A;  2R5A A;  4FCY A;  2RQU A;  3L2U A;  3G7Z A;  1CKB A;  2PTK A;  3L2W A;  4E6R A;  5GAM d;  1NZ9 A;  4PK4 A;  4RTY A;  4HCZ A;  1MV0 B;  1NJI C;  1UDL A;  1Y7X A;  2YUQ A;  5ECA A;  3A98 A;  1VQO T;  2H3J A;  3S3M A;  2YDL A;  2CT4 A;  3VU3 C;  1Y96 B;  3HSB A;  1NBE B;  2EGE A;  2YRV A;  3OS1 A;  4K11 A;  1N9S A;  3EFR A;  5GAN f;  2NUP A;  2X35 A;  3E19 A;  4OMM A;  1HSQ A;  4KUD K;  4M7A B;  2DXC A;  2E12 A;  3X25 B;  3LWI A;  3QJY A;  1N27 A;  2I0N A;  4N4G A;  1OYX A;  2LJ3 A;  3PVQ A;  4IUR A;  4FYV B;  3KXT A;  3TU4 K;  4PJO E;  4XTV A;  2ZPI B;  4GY5 A;  4QVZ A;  3PTA A;  2DAQ A;  4M77 F;  1RAB B;  2KVQ G;  3OMG A;  2HKN A;  1WI7 A;  2E1H A;  3UWN A;  1G5V A;  3LW5 E;  5GAN 8;  1UJY A;  5CR2 A;  1GCQ C;  4ZTJ A;  2KRM A;  2CT3 A;  3OBW A;  2O9V A;  4HT9 A;  1KC8 U;  4J9I A;  2YUP A;  4OML A;  4VUB A;  5GAN 6;  5FU6 B;  3JB9 F;  3I5S A;  2CH4 W;  2CSQ A;  4CC3 A;  1AZE A;  1MUZ A;  5GAN 7;  4M7D A;  4X9D A;  3OMC A;  5CKD A;  2PNI A;  3SWN A;  3S6W A;  5GAO q;  5GAN h;  1RAC B;  2FPE A;  1KQS S;  5KYX A;  2RO0 A;  3MP6 A;  2LX7 A;  2EQJ A;  1BI0 A;  5LJ5 j;  5HY6 A;  3M0U A;  2DL4 A;  2EYX A;  1M4Z A;  3NTI A;  2VB6 A;  1TG0 A;  1VQ6 T;  1XQH A;  1N8R R;  2GFA A;  2DJQ A;  1DJ7 B;  5L23 A;  1MMA A;  2RNA A;  1B3Q A;  4B9W A;  4IKF A;  4KT0 E;  4ELY C;  3OYI A;  3QDF A;  3QSU A;  1UGQ B;  4HA8 A;  1K8A C;  5GMK h;  4M78 C;  2DA9 A;  1W2B A;  4C8Q A;  1QLY A;  3VS7 A;  2K4Y A;  2JVV A;  4BUG A;  2P84 A;  2ZPE B;  5CAI A;  4XU1 A;  1UG1 A;  3EHR A;  4D6W A;  1B7T A;  4FYW B;  5HK3 A;  2EJG A;  2MMP A;  2LQW A;  2KXD A;  5J39 A;  2EPD A;  2AK5 A;  4RCB A;  1KD1 C;  3EH2 A;  3CC7 A;  2HEQ A;  4F7U A;  3QDR B;  2DFU A;  3RUX A;  1Q7Y C;  2AKL A;  1K1Z A;  3SFM A;  1VQ4 Q;  2QQ9 A;  2QG9 B;  2LQN A;  4RMO A;  3C95 A;  2HDA A;  2RHX A;  3NTH A;  3IQL A;  1YIT Q;  5LJ3 d;  1YWO A;  1TTH B;  4M77 B;  4HVV A;  1VQ5 A;  2BZX A;  5HK0 A;  1BIA A;  3EFO B;  2ZPH B;  2OI3 A;  1VIF A;  2GQV A;  3BY7 A;  4JPB W;  1C1A A;  1S1N A;  3JB9 H;  1AWW A;  1T3S A;  4C92 G;  4J9C A;  1VQ8 Q;  4FSS A;  2R58 A;  3QO3 A;  4BE0 A;  4OMN A;  1VQM T;  1ZUK A;  3KUF A;  4J7F A;  1VQP A;  2X4Y A;  1AEY A;  1W2B P;  3OYF A;  1PNJ A;  4FT2 A;  4BE2 A;  2Y4X A;  3PIO A;  4O5V A;  3PFS A;  4BAC A;  2DKG A;  2MIO A;  1QVF A;  4M75 C;  2DPP B;  1ZA2 B;  1JB0 E;  5GAN 3;  2G3R A;  4DA4 A;  1OU8 A;  1NEB A;  1TUD A;  4ZGE B;  1VYV A;  2ZCF B;  1WJR A;  1WYX A;  5LJ5 f;  1K73 R;  1CSK A;  2C0T A;  3CXC A;  3CCL A;  3JCM P;  1JQQ A;  2D0Q B;  2DZ9 A;  2ZPB B;  1YIJ A;  4NS5 A;  2EBP A;  1UB4 A;  2BZY A;  3GNF B;  4WCI A;  4X34 A;  2DYI A;  2P0K A;  2QA4 A;  2DVJ A;  1M5Q 1;  4M7A C;  1X2Q A;  1RAA B;  2J7I A;  2QEX A;  1W1F A;  2RK2 A;  5I2S A;  2EAY A;  3QWX X;  3VUB A;  2BTT A;  1K76 A;  1Q86 C;  4JRI A;  4JS4 A;  2H3E B;  4II1 A;  5CKB A;  5KYU B;  2RHY A;  3JCM d;  4QKU A;  5GAO r;  2DD4 A;  2Z0W A;  1S72 A;  2E70 A;  2RJF A;  1X6G A;  3FJ5 A;  1IXD A;  2E41 A;  1TH7 A;  3OQ5 A;  4ZN3 A;  2V8I A;  1WQ7 A;  1N8R C;  3EFS A;  3EGD A;  1QVF P;  4WF2 A;  4JRQ A;  2RHZ A;  3VS2 A;  1MND A;  2CUD A;  2KEA A;  3QHS A;  1Q81 U;  5FU6 C;  5LJ5 h;  2A0F B;  2DIQ A;  5CVI A;  2MPX C;  3CXC P;  1H8K A;  1WHH A;  1G3S A;  2O2O A;  2RQW A;  5FWB A;  3HFN A;  2V1R A;  4QQD A;  4AMC A;  3KFV A;  1WHL A;  4LDV A;  5GAN 5;  2ABL A;  2BUD A;  2DL8 A;  3CCS A;  4RG8 A;  2V1Q A;  2E10 A;  3C4S A;  2AZV A;  1G3T A;  1VQ4 T;  1B34 B;  1OI1 A;  1VA7 A;  3MP8 A;  2HL5 C;  3JAM E;  4Y28 E;  3TVT A;  1OPK A;  2K7A A;  2QXF A;  4QVD A;  2OTJ A;  2YXY A;  2DEU A;  2CUB A;  1K9M R;  4E7S A;  1VQ8 T;  1ZSZ A;  4IUQ A;  5FU7 C;  4PKC C;  3I9Q A;  3RDV A;  3CC7 Q;  1U06 A;  4N4H A;  7AT1 B;  1AWX A;  3GOX A;  2M0Y A;  1SHF A;  2HSE B;  4HKE A;  3TCJ A;  5LJ3 g;  4M7D C;  1ZUU A;  4FSX A;  1BK2 A;  1BYM A;  3JCM Q;  4LDX A;  2CZ7 B;  4DBH A;  4J9F A;  2VVK A;  1VQ5 Q;  2KI7 A;  3OBY A;  4WTO B;  2LCL A;  2JM8 A;  1CKA A;  2LP5 A;  5CQY A;  2EQI A;  1BBZ A;  4KUI A;  1JU5 C;  3URG A;  3OW2 A;  4M78 F;  3MJX A;  2L3Q A;  2QDY B;  1SSH A;  1KHI A;  1KQ2 A;  1YNZ A;  5CKE A;  2JUF A;  2YT6 A;  3FEO A;  4QQG A;  2ESW A;  1BIB A;  1NEG A;  1VQP Q;  1NJI U;  2HBP A;  1U5S A;  2CP2 A;  1VYT A;  1K0S A;  5CKF A;  2EGA A;  1X27 A;  4BDZ A;  1UGS B;  3QZ9 B;  2IIM A;  1U8R A;  3RES A;  3ZFJ A;  1LJO A;  1ZSG A;  2HMA A;  1AWO A;  3M0Q A;  4OB1 B;  3I55 A;  2WSF E;  2PUK B;  3L1A A;  1WHK A;  2DO3 A;  2H8H A;  5DLO A;  2YLB A;  1VQ7 A;  2JS2 A;  2LMJ A;  4BE1 A;  3CEY A;  1WHJ A;  2DX1 A;  1QVG A;  4A4E A;  4DEY A;  3LYI A;  4C5I A;  4ZGD B;  3DLL A;  2RMO A;  4OP0 A;  4IUP A;  3M4Y A;  2JZ2 A;  4OB3 B;  4ESR A;  3OW2 S;  3OW2 P;  2QA4 Q;  2EJF A;  1WJS A;  3TSW A;  1YJW A;  3SB2 A;  2YSQ A;  3JCM g;  3JB9 J;  1G2B A;  4BDY A;  4XTU A;  2HL3 A;  4M75 F;  5GAM e;  1QCN A;  1QWF A;  3CC2 A;  2J05 A;  4IIO A;  1M8V A;  1RAD B;  2LQK A;  1YWP A;  3PE0 A;  1E6H A;  4KUL A;  3CQT A;  2JTF A;  8ATC B;  2RN8 A;  4E47 A;  1OZ2 A;  3JV3 A;  1JBM A;  3LH5 A;  3QII A;  3V7R A;  4C8Q E;  2NYS A;  2X3X D;  3VS3 A;  4A54 A;  1QVG S;  3HPW A;  1QVG P;  2RB6 A;  4M7A F;  4M78 B;  1M2V B;  1WXU A;  1HK9 A;  2EKO A;  3VS6 A;  4QVC A;  1WQW A;  2KAF A;  2DL5 A;  3CC7 T;  3GPL A;  3EGX A;  4ME7 A;  4C92 E;  4LD9 K;  2O4X A;  4OF1 A;  4DBQ A;  1M30 A;  3JCM W;  1OZ3 A;  1W4S A;  4RG2 A;  1K9M C;  2NUT B;  1K8A U;  1QWE A;  4FYX B;  5LJ3 j;  2VGM A;  3EGU A;  3RBB B;  1M2O A;  2VC8 A;  4M77 D;  3VV0 A;  3X24 B;  1VQ5 T;  4F17 A;  1YJ9 A;  1R77 A;  4JJN K;  1SPK A;  3E2U A;  3MEV A;  5M9O A;  2CZ6 B;  1OEB A;  2NLU A;  1KD1 U;  2FZC B;  3OS5 A;  3DKM A;  2HAX A;  4N0A A;  1I5L A;  4IUT A;  1Q7Y U;  2KBT A;  1I4K 1;  4PJO C;  3H0I A;  2DMO A;  3JB9 D;  2CP6 A;  3WVE B;  1VQP T;  2BZ8 A;  1M90 U;  1WJQ A;  3QJ6 A;  4QT7 A;  3CMA Q;  5FRN A;  2FVU A;  1QKW A;  1D3B B;  5EG2 A;  2EW3 A;  4YTL A;  3TRE A;  2HD0 A;  2MYS A;  2C0O A;  4M75 B;  3NFC A;  3RR6 A;  3CCM A;  3C12 A;  3L2Q A;  4XQ3 A;  5GAN e;  1M9S A;  4AFU C;  5GMK m;  3T9N A;  2JW4 A;  1XJW B;  3CCJ A;  3J81 E;  1NG2 A;  5CQX A;  4EMK A;  2KT8 A;  2A7Y A;  2IPO B;  4M7A G;  2QA4 T;  1UGP B;  3I56 A;  1V29 B;  4M7D F;  1YN8 A;  1HYO A;  3HRS A;  4J83 A;  2CP0 A;  3M0S A;  1VQM Q;  2KYB A;  1ZSZ C;  1WXB A;  1IRE B;  2ZAE A;  3I55 Q;  3ER0 A;  5A2Q E;  2HQE A;  3SD4 A;  2CP7 A;  1VQ7 Q;  4C5E A;  3DLM A;  5GMK e;  3QWY A;  1WHG A;  3RKY A;  2QGG A;  4Y92 A;  4ZGJ B;  1YHQ A;  4LDW A;  2K2M A;  2RQV A;  5DLQ E;  5J3B A;  1UJ0 A;  1WX6 A;  2EFI A;  3X28 B;  2P0Q A;  5LJ3 f;  5CO7 A;  1IZ6 A;  1YJW Q;  3JB9 I;  1X6O A;  1UEC A;  4XK8 E;  3CD6 A;  2CSI A;  3QKJ A;  1Q86 R;  2EQU A;  1YI2 A;  5IXF A;  1IRX A;  2NUP B;  3M53 A;  3CC2 Q;  1M1K C;  4F7U F;  1N8R U;  2LRQ A;  3CCS T;  2Y4Y A;  2F5T X;  4PNO A;  1TWB A;  1ZA1 B;  3X26 B;  2MK5 A;  3S3N A;  3CCV A;  1TU0 B;  1PRM C;  3JCM c;  1PM3 A;  4RUG A;  1TXQ A;  1MGQ A;  4J7I A;  5IH2 A;  4MZM A;  2OTJ T;  2F5K A;  2SRC A;  3CCE A;  2LT4 A;  1X75 C;  4Z88 A;  2RQT A;  2GGR A;  2RJD A;  2X4W A;  1TOV A;  2L2P A;  3V8K A;  5L8R E;  2DYB A;  5FU7 B;  2K9G A;  5LJ3 h;  1MV3 A;  1QQJ A;  4CI0 C;  3VS4 A;  1N6A A;  3CMA T;  3NMZ C;  5KYN A;  2AZS A;  1IHV A;  4J9D A;  4DBF A;  2O31 A;  3R6N A;  3CCR A;  3M9Q A;  4M7D B;  3EG9 A;  3SWN B;  4E7J A;  1VQK A;  5KE2 A;  1NPP A;  3TQ7 P;  3PIP A;  4R55 A;  5C6S A;  5KYX B;  1QW1 A;  2K3X A;  2XKO C;  4C92 A;  2R5M A;  1HXD A;  4M77 G;  5DY9 A;  3V7S A;  2KXC A;  1VYU A;  4PFP A;  5KYY A;  2MCN A;  3JCM f;  1U3O A;  2CZ0 B;  1OX8 A;  2FEI A;  2JJ9 A;  3D7S B;  1BU1 A;  2O01 E;  2K2V A;  1IGQ A;  3NHN A;  1N9R A;  1NYF A;  3G71 A;  3X20 B;  1H64 1;  2FZK B;  3EH1 A;  4E7I A;  2KMT A;  3JB9 G;  1D1C A;  3SDZ A;  2DXB A;  1C6V X;  1KSW A;  3M56 A;  1K4U S;  5CKH A;  1UGR B;  3I55 T;  2DM1 A;  2MWO A;  3AT1 B;  1W2B S;  3OYD A;  2SEM A;  1VQ7 T;  3CCM Q;  3GIB A;  2J6K A;  4F7U B;  3P8B B;  3EG1 A;  5LJ5 e;  2VV5 A;  2VYT A;  2ECZ A;  3OY9 A;  3LWH A;  1RUW A;  3CCJ Q;  3H8Z A;  1LOJ A;  1K73 U;  2VUB A;  4PJO F;  5A0G A;  4JZ4 A;  2AT1 B;  1VQN A;  2P4R A;  4E7K A;  2QQA A;  3I56 Q;  4BB7 A;  2EJ9 A;  3OYN A;  3INZ A;  3JCM h;  1YJW T;  5AYF A;  3OYJ A;  2QGF B;  3M4G A;  4CC4 B;  4XTW A;  3HP9 A;  3M58 A;  3CME A;  3QG1 A;  1PHT A;  4DQ2 A;  3CC2 T;  1OV3 A;  3FIF A;  3JSC A;  3FB9 A;  2DF6 A;  2KK4 A;  1YHQ Q;  1K9A A;  4A4G A;  2NWM A;  4OMF B;  2QK0 A;  4ATO A;  3OYM A;  1QCF A;  2BKD N;  1GRI A;  2FL7 A;  4E7L A;  3H9N A;  4AFQ C;  2KT1 A;  2X9H A;  2QAS A;  5A0D A;  1Q82 R;  1WDX A;  5GAN 4;  4EPC A;  1PCX A;  4M78 D;  2F1L A;  2MI6 A;  3LGF A;  3SEM A;  4CC2 A;  3CD6 Q;  4J9B A;  1YI2 Q;  1QVF S;  3VS5 A;  1FX7 A;  1KC8 C;  1UHC A;  2LCS A;  1V1C A;  3NTK A;  2CP5 A;  1D0Y A;  2RJC A;  1Y57 A;  1UHF A;  3REB B;  4FU6 A;  3GP8 A;  3CXC S;  3OYH A;  1GBQ A;  5GMK l;  1M3B A;  3VRZ A;  1I8F A;  4A4K A;  2HBW A;  1YJ9 T;  2ROL A;  1Y0M A;  4PJJ A;  2E5Q A;  5GAO n;  3FDR A;  2A36 A;  1D0X A;  2L3P A;  3G6E A;  4JJB A;  4LDY A;  4BD3 A;  3CCE Q;  3CCU A;  4XU3 A;  1XNI A;  3A8O B;  4ZTF A;  2KSS A;  2L3R A;  1Q95 G;  2K6D A;  4PJO G;  2V8J A;  3BFM A;  4IUV A;  1F1B B;  3QPH A;  2FRY A;  1FXX A;  4E7H A;  2XDD A;  4PJO B;  1FWZ A;  3MPU B;  2YHT A;  3MO8 A;  5FRM A;  2COW A;  3EGD B;  4RTV A;  3G4S A;  2QAZ A;  3RKX A;  1D1A A;  3CCR Q;  2EYQ A;  2BIV A;  4R56 A;  1VQK Q;  2RM4 A;  1PG5 B;  2IG0 A;  1VQ9 A;  1LPL A;  4OMQ A;  2DZC A;  4EMG A;  2K5I A;  2EYZ A;  4M75 D;  3M54 A;  4V2S A;  1U1T A;  3QZ5 B;  5FRO A;  3CC4 A;  3CCM T;  5FW9 A;  3SWN C;  1BI1 A;  3EG2 A;  3HL8 A;  4RTU A;  2L0A A;  3CCJ T;  4J9G A;  1UTI A;  2EGC A;  4A63 B;  1KK7 A;  2L8D A;  3OYC A;  2JMA A;  2J06 A;  2YRC A;  4O6J A;  3G71 Q;  3I56 T;  2DTI A;  4F14 A;  2E4H A;  4M7A D;  1SSF A;  4J8O A;  1GCQ A;  2FZG B;  3NGP A;  1I07 A;  1T0J A;  3FRN A;  1UE9 A;  2EIF A;  1RI0 A;  4D8D A;  3OS0 A;  4JRK A;  3CPW A;  4RTX A;  3AHU A;  1ZSZ B;  5I2M A;  2YLC A;  5DM7 R;  4MZP A;  1UEB A;  5IN1 A;  2KGT A;  4C8Q C;  5GAO p;  1KG1 A;  1X01 A;  3HHT B;  4XU0 A;  4M4Z A;  1YHQ T;  2OJ2 A;  1UUE A;  2RD1 A;  3VS0 A;  4NL2 A;  1KHC A;  3LX7 A;  3L2R A;  2QQR A;  2OAU A;  1GFC A;  1YP5 A;  5A0L A;  4HVW A;  1D09 B;  4C92 C;  3H41 A;  4MZT A;  3MEU A;  4LE9 A;  3CCL Q;  2KRN A;  3CD6 T;  1YIJ Q;  2EQK A;  1YI2 T;  1PC0 A;  4E7Z A;  3CME Q;  3QBY A;  1Q82 C;  1NLP C;  4KH0 B;  4BY6 B;  3JCM b;  2QEX Q;  2ED0 A;  5IHN A;  3HTR A;  1RAE B;  2PVO B;  2VAS A;  1QCO A;  2XDP A;  4L5G A;  2YUO A;  3OS2 A;  1M2V A;  1LNX A;  1GXI E;  3CPW P;  3A8M B;  3OSV A;  1S72 Q;  2CP3 A;  2DTH A;  2FRW A;  3ZL7 C;  2JTE A;  3THK A;  3E9F A;  2D6F A;  3CCE T;  1XOV A;  3MET A;  2PVG B;  2WAC A;  2B86 A;  2KE9 A;  2D0N A;  1SF9 A;  1ZLM A;  5D7U A;  4DBR A;  4M78 G;  2LNV A;  4D8K A;  4M77 E;  3JCM J;  5KYW A;  2EWN A;  4ZNX A;  3CPF A;  1AT1 B;  2X3W D;  1M1K R;  3OYE A;  3L2Z A;  4RKU E;  2MWP A;  6AT1 B;  2LVM A;  1N5Z A;  1Q81 C;  3NPF A;  3EG0 A;  3CCR T;  4M7D D;  1WLP B;  5IAY A;  1V76 A;  4X1V A;  3JCM V;  5HKC A;  2E6Z A;  1VQK T;  1PRL C;  1H92 A;  3CCS Q;  8AT1 B;  1NYG A;  4PJM A;  3G6E Q;  1OUL A;  3VRY A;  2DIG A;  3L2V A;  2KNB B;  1HD3 A;  3ME9 A;  4PL6 A;  4PLI A;  3VYG A;  5CIU A;  4DOW A;  4FW2 A;  3LLR A;  1PKT A;  1GFD A;  4A53 A;  1PWT A;  2OTJ Q;  2PVD B;  3LH0 A;  3BE3 A;  1G3W A;  4J5Y A;  2VGN A;  3HRU A;  2COZ A;  3G71 T;  3G4S Q;  1OU9 A;  1WNL A;  2CDT A;  1I5O B;  3CBP A;  2FPD A;  3UDC A;  2XDB A;  1VQL A;  1SEM A;  2LT1 A;  2DL7 A;  3A5Z B;  1JXO A;  1VQ9 Q;  2XHC A;  1OOT A;  2RPN A;  1IHW A;  4RCC A;  3GBQ A;  3CC4 Q;  4AFS C;  1B07 A;  1Y96 A;  1PD0 A;  4MDW A;  3OYG A;  1R0B G;  1P92 A;  2ED1 A;  3EGX B;  1YBY A;  2M0O A;  4XAX B;  1QMC A;  2QQS A;  1YIT A;  2O4X B;  2IVW A;  2RA2 A;  4M75 G;  4C5G A;  2LCC A;  4QQ6 A;  3A8H B;  2RQR A;  1QVP A;  4M7A A;  1KIK A;  1VQN T;  4TVR A;  2RJE A;  2Y90 A;  2CRE A;  2WSE E;  2E65 A;  1SRL A;  1YCY A;  2DRM A;  3CCL T;  1TSF A;  2KRS A;  1YIJ T;  3MP1 A;  3QUI A;  2HCK A;  3E1S A;  1FMV A;  4LXC A;  5LL6 S;  3CME T;  1M27 C;  3RMQ A;  1MHN A;  3OSS C;  4XTZ A;  1ZHI A;  2J6O A;  2QEX T;  1PKS A;  3OYL A;  2ZPG B;  3GLX A;  4J9E A;  2LQ8 A;  3GNG A;  3RER A;  2CYZ B;  2PQW A;  3ASK A;  2JM9 A;  2JTM A;  2YUN A;  2LNH B;  1TS9 A;  2E5K A;  2X4J A;  1S72 T;  2KYM A;  4KRT A;  3VYH B;  5GJV B;  5LJ3 e;  1I1J A;  1KQS A;  2FHD A;  2I2L A;  3H6Z A;  1EX4 A;  3UAT A;  2DET A;  5FLX E;  2PUO B;  2MF2 A;  1MNE A;  3OYB A;  1AZG B;  2XK0 A;  4AG1 C;  1Q86 U;  2A08 A;  2ZGW A;  3OYK A;  1RAH B;  2HSP A;  2K5L A;  4A4F A;  3OB9 A;  4C8Q F;  2O9S A;  2D8J A;  4EMK B;  1J3T A;  4PJL A;  4RTW A;  4L6V 5;  1ZBX A;  3I35 A;  4BY6 C;  1H3Z A;  4B9X A;  1O9S A;  1VIE A;  1WFW A;  4J6X A;  4E2F B;  5D6Y A;  3A8L B;  4XU2 A;  5KCH A;  3G6E T;  4ANJ A;  2XD0 A;  4FT4 A;  3CCU T;  2A37 A;  2VXF A;  1WPY A;  4C92 F;  1M3A A;  3M57 A;  4RTZ A;  3CCQ A;  5KCO A;  1T0H A;  1KC8 R;  2J6F A;  3TSZ A;  4PJO D;  3EHQ A;  1XTD A;  4JJD A;  3M0P A;  1YFN A;  3BDU A;  1VUB A;  1BCO A;  1LCK A;  2JS0 A;  3F70 A;  1KQS P;  3G4S T;  2QDL A;  3C0C A;  3PNW C;  1FMW A;  2RI3 A;  2E6N A;  1EFN A;  1JXM A;  1SKU B;  1JO8 A;  4LUE A;  2R57 A;  2LJ0 A;  3G1J A;  1WXT A;  2M51 A;  3HKS A;  4OGE A;  2P4T A;  1VQ9 T;  4F16 A;  3OYY A;  1G83 A;  1WGS A;  3M55 A;  4M77 A;  3PGG A;  4M7D G;  3CC4 T;  3EFO A;  4BI3 A;  5FWC A;  5GAO m;  1ARK A;  3M5A A;  2FG0 A;  2W0Z A;  2P0P A;  2JT4 A;  3ZEH A;  1AHJ B;  1D1B A;  3U23 A;  3JCM e;  1MMG A;  5GAN d;  1Y07 A;  1YJ9 Q;  1IB8 A;  3H0H A;  2D1X A;  1R0C B;  4HT8 A;  4ZN1 A;  2RF0 A;  2XU8 A;  3KBG A;  4KGX B;  4EIK A;  4CRI A;  1VQL Q;  1UGV A;  2NUZ A;  1H3H A;  1JEG A;  1JJ2 A;  4P5N A;  2GFU A;  3FC3 A;  2DD5 A;  2LJ1 A;  1G8X A;  3P8D A;  1QP3 A;  1KQ1 A;  2AKK A;  5I22 A;  2JNG A;  1ZQ1 A;  3V8L A;  4C8Q G;  4AFZ C;  1FYN A;  1X2K A;  2VKN A;  3S3O A;  3M59 A;  4C8Q B;  4FIB A;  1M90 C;  5GJW B;  4IUU A;  3OA6 A;  3OYA A;  3TEE A;  1YJN A;  2QI2 A;  1C0M A;  4F7U G;  2YRD A;  4MDX A;  4L59 A;  3MKD A;  4B6M A;  2F2W A;  3EG9 B;  4OMO A;  2VWF A;  3L42 A;  2K57 A;  3FLG A;  1YCS B;  1E7O A;  4MML A;  2ATC B;  4Y91 A;  3MEW A;  3UF4 A;  4C92 B;  3QYG B;  5GAM g;  4JZ3 A;  2DRK A;  3VUZ A;  1WZO A;  2DVE A;  2JMC A;  1WHM A;  4JUV A;  5KYY B;  4JS5 A;  3WXM B;  1WIE A;  2XI9 A;  2PZ1 A;  5KYU A;  2AHJ B;  4LNP A;  3A8G B;  2ENM A;  4JDS A;  4N0A C;  1JJ2 S;  2DNU A;  1JJ2 P;  4AG2 C;  2K79 A;  4M78 E;  4JLG A;  2OTL A;  1NPR A;  1MMN A;  2DTO A;  1ZUY A;  1BI2 A;  4LN2 A;  2GTJ A;  1Y71 A;  2X51 A;  1GL5 A;  4DOV A;  4GBQ A;  3H0F A;  2L89 A;  4OGC A;  1X69 A;  1UFF A;  4FM4 B;  2M9U A;  5CCA A;  1Q82 U;  3PMT A;  1VQO A;  3UA7 A;  3DB4 A;  2E64 A;  1X43 A;  2DLP A;  3RNJ A;  2OX7 A;  1M3C A;  4OB0 B;  2KR3 A;  3PVL A;  4EDU A;  1W6X A;  2GF7 A;  1D0Z A;  2M16 A;  3QXE B;  3EAE A;  2DBK A;  2QTV A;  2MOX A;  4OMP A;  2CGH A;  4JRP A;  4OB2 B;  1PSF A;  1T3L A;  2K3Y A;  3MEA A;  1B34 A;  2G6F X;  1IGU A;  1GBR A;  4EMK C;  4PFZ A;  3BDL A;  3M0T A;  3R6O A;  1WA7 A;  3V7C A;  2KY9 A;  1PSE A;  9ATC B;  5IXB A;  4PJO A;  3DB3 A;  2JN0 A;  2KQW A;  2JXB A;  3CCQ Q;  3CCV Q;  4HXJ A;  2JOY A;  1MMD A;  1JRI A;  3FJP A;  2MAM A;  1M8M A;  5KH6 A;  4M75 E;  2EYY A;  5I11 A;  1AWJ A;  3JCM X;  2DE0 X;  1VQL T;  5J26 A;  3EG3 A;  4PLL A;  1K9M U;  1Q81 R;  4GLK A;  1AD5 A;  1RI9 A;  2GTO A;  2V8K A;  4NOY A;  1NLO C;  2CH4 A;  1TUC A;  1ABO A;  1M1F A;  5GAN g;  4HCK A;  3C94 A;  2K3B A;  1U1S A;  3PT9 A;  1OX9 A;  4LDU A;  4AT1 B;  1TUG B;  3O5Z A;  2V26 A;  3HRT A;  1YIT T;  2YWW A;  4MMK A;  5LJ5 d;  1VQ6 A;  1ZBJ A;  4M7A E;  5IHK A;  3RIR A;  3PMI A;  2RHU A;  3A1P A;  4J9H A;  2AIR B;  2E3H A;  4C0Z A;  1GCP A;  3LGL A;  3J80 E;  4UC4 A;  2COY A;  4LD6 A;  3O8V A;  4IIM A;  2KDS A;  4C0D B;  3JRZ A;  2DIL A;  5EC7 A;  3MCA B;  4ELZ C;  2FB7 A;  5GAM j;  5AT1 B;  2RI2 A;  4Z8A A;  3CMA A;  3P8H A;  2QQB A;  5D6W A;  4BI8 B;  4C0G A;  2FYK A;  3BW1 A;  5KE3 A;  2KRO A;  2X4X A;  2K5F A;  2M1H A;  2QTX A;  1YJN Q;  1SRM A;  1EZZ B;  3Q1J A;  1ABQ A;  2LDM A;  4M77 C;  4J6W A;  1SHG A;  1HJD A;  4N4I A;  2DXU A;  3J7A F;  2BE9 B;  1R8O B;  4HCC A;  2C0I A;  1BB9 A;  1NE8 A;  2C06 A;  1OPL A;  1VQN Q;  4KGV B;  5HCK A;  1Z9Z A;  1KFZ A;  1K73 C;  2GNC A;  1NJI R;  3MHX A;  5GAO l;  2OTL Q;  1VQM A;  3RKW A;  2QYZ A;  4F04 B;  2HKQ B;  2RI5 A;  1RAI B;  5IHI A;  2BE7 D;  2DXT A;  1RAF B;  1SG5 A;  2RHI A;  1IO6 A;  3M0R A;  1VQO Q;  1KJW A;  4Z02 A;  1M1G A;  4J6Y A;  3QYH B;  3REA B;  5GAN 2;  3CCQ T;  3N5B B;  4M78 A;  4EMH A;  3CCV T;  3CPW S;  3CBO A;  1Z9Q A;  4M7D E;  2DEQ A;  1NM7 A;  2CZ1 B;  4HCB A;  2ZZD A;  2EVR A;  4Q5W A;  1AOJ A;  4C0F A;  1AVZ C;  1M1K U;  1I81 A;  4XTY A;  2F2V A;  4PJN A;  2NUT A;  5CK9 A;  2DJZ A;  3VS1 A;  2VXE A;  2EQM A;  3UT1 A;  1A0N B;  3GF5 A;  2DER A;  2O88 A;  1RL2 A;  4C5H A;  2A28 A;  4ORZ A;  2L5Q A;  2GQI A;  3SHW A;  5GAN j;  1VOM A;  4KBM B;  5I21 A;  4PFO A;  2WSC E;  2CKK A;  3I5R A;  5GAM f;  4JJC A;  2DL3 A;  2EYW A;  4JLI A;  2A3L A;  2XG8 D;  2PU9 B;  4Z89 A;  1FMK A;  3HFO A;  2FO0 A;  2FPF A;  1K0X A;  3CCU Q;  2LZ6 B;  2LX9 A;  1I0C A;  2L3S A;  1RAG B;  4GLM A;  3UPU A;  2DK3 A;  2OAW A;  4F7U E;  1RLQ C;  1ZX6 A;  2ROT A;  4FL6 A;  2F2X A;  4FYY B;  2ZPF B;  4X9C A;  2XIC A;  1D3B A;  2XMF A;  1W70 A;  3ZBD A;  5GMK j;  2LTO A;  5LJ5 g;  1G3Y A;  1LVK A;  2LC4 A;  1QKX A;  4M75 A;  4C8Q D;  4R0K A;  5KYW B;  1VQ6 Q;  1X6B A;  2HQH A;  1ACM B;  1OQK A;  4KH1 B;  2B8A A;  1YJN T;  2GCX A;  4QW2 A;  4A4H A;  1QP2 A;  1K8A R;  2E3I A;  2HNI A;  2W10 A;  4OVA A;  4FW1 A;  2EKH A;  2D8H A;  1BKB A;  2HQX A;  2F69 A;  5GMK i;  1VQ4 A;  4CC7 A;  5IT9 E;  4RTT A;  4NL3 A;  4BI4 A;  4C92 D;  5GAM h;  1BI3 A;  5C0M A;  1KD1 R;  4KGZ B;  2CS7 A;  2DBM A;  3V8J A;  1PD1 A;  1EIF A;  4HVU A;  4LUD A;  4XTX A;  2RH2 A;  4C0D C;  1Q7Y R;  1BCM A;  2HZY A;  2GBQ A;  2M02 A;  2XID A;  1RLP C;  1VQ8 A;  2D9T A; 
#chains in the Genus database with same CATH homology
 3CEY A;  3JCM e;  5GAN d;  3NTK A;  1Y07 A;  3WVD B;  4A4E A;  1QVG A;  3RMS A;  3LYI A;  3VKI A;  2RJC A;  2RK1 A;  4C5I A;  3CBM A;  4ZGD B;  5D6X A;  1O75 A;  3DLL A;  4HT8 A;  2OTL T;  4FU6 A;  4OP0 A;  3GP8 A;  4ZN1 A;  3E9G A;  2XU8 A;  3KBG A;  3CXC S;  4IUP A;  3VJP A;  2R5A A;  3M4Y A;  3OYH A;  2JZ2 A;  3L2U A;  3G7Z A;  3L2W A;  4OB3 B;  4CRI A;  5GMK l;  5GAM d;  1NZ9 A;  3OW2 S;  1JJ2 A;  4P5N A;  4HCZ A;  1I8F A;  2GFU A;  4A4K A;  3FC3 A;  1YJ9 T;  1QVG S;  1NJI C;  1Y7X A;  2E5Q A;  2EJF A;  5GAO n;  2DD5 A;  1WJS A;  3FDR A;  3P8D A;  2H3J A;  1VQO T;  3S3M A;  1QP3 A;  1KQ1 A;  3VU3 C;  1YJW A;  3G6E A;  3SB2 A;  4LDY A;  4BD3 A;  1Y96 B;  3JCM g;  2JNG A;  3CCU A;  1ZQ1 A;  3HSB A;  4XU3 A;  1XNI A;  2YRV A;  3A8O B;  3V8L A;  4C8Q G;  4ZTF A;  3JB9 J;  2KSS A;  4BDY A;  2L3R A;  4XTU A;  3OS1 A;  4M75 F;  4PJO G;  2V8J A;  5GAM e;  1N9S A;  3BFM A;  4IUV A;  3EFR A;  3S3O A;  3CC2 A;  3QPH A;  5GAN f;  3M59 A;  4C8Q B;  4FIB A;  1M90 C;  1M8V A;  2X35 A;  1FXX A;  3E19 A;  4IUU A;  4E7H A;  2XDD A;  2LQK A;  3OA6 A;  4KUD K;  4PJO B;  3OYA A;  4M7A B;  2DXC A;  4KUL A;  2E12 A;  3TEE A;  1YJN A;  1FWZ A;  2QI2 A;  2JTF A;  3X25 B;  2YHT A;  3MO8 A;  4F7U G;  3LWI A;  5FRM A;  3QJY A;  4MDX A;  1N27 A;  3G4S A;  4N4G A;  1OYX A;  1OZ2 A;  4IUR A;  4L59 A;  4E47 A;  1JBM A;  3RKX A;  3KXT A;  3TU4 K;  2EYQ A;  3QII A;  3L42 A;  3V7R A;  2BIV A;  4R56 A;  4C8Q E;  2K57 A;  3FLG A;  2RM4 A;  4PJO E;  2IG0 A;  4MML A;  4XTV A;  2ZPI B;  4GY5 A;  4Y91 A;  3MEW A;  4QVZ A;  2DAQ A;  3HPW A;  4M77 F;  4A54 A;  2KVQ G;  2RB6 A;  4C92 B;  3PTA A;  3QYG B;  1VQ9 A;  4M7A F;  2DZC A;  3OMG A;  4EMG A;  2K5I A;  4M75 D;  4M78 B;  5GAM g;  3M54 A;  4V2S A;  3VUZ A;  1U1T A;  3QZ5 B;  2E1H A;  2DVE A;  5FRO A;  3UWN A;  1G5V A;  3CC4 A;  3LW5 E;  4JUV A;  4JS5 A;  5GAN 8;  1HK9 A;  3CCM T;  5CR2 A;  3SWN C;  3WXM B;  2EKO A;  1BI1 A;  2XI9 A;  4QVC A;  1WQW A;  4ZTJ A;  3OBW A;  2KAF A;  3HL8 A;  3CC7 T;  4HT9 A;  2AHJ B;  3GPL A;  3A8G B;  3CCJ T;  1KC8 U;  4JDS A;  4ME7 A;  4N0A C;  1JJ2 S;  4C92 E;  4LD9 K;  2O4X A;  4OF1 A;  3JCM W;  4M78 E;  4VUB A;  5GAN 6;  1OZ3 A;  1W4S A;  4JLG A;  4RG2 A;  2L8D A;  1NPR A;  5FU6 B;  3OYC A;  1K9M C;  2OTL A;  1K8A U;  4O6J A;  2DTO A;  3JB9 F;  1BI2 A;  5LJ3 j;  2VGM A;  3I56 T;  1Y71 A;  2DTI A;  4DOV A;  2VC8 A;  4M77 D;  3VV0 A;  2L89 A;  4OGC A;  3X24 B;  5GAN 7;  4M7A D;  4M7D A;  4X9D A;  3OMC A;  1VQ5 T;  1YJ9 A;  4JJN K;  1SSF A;  4J8O A;  4FM4 B;  3SWN A;  3S6W A;  5CKD A;  2M9U A;  5CCA A;  5GAO q;  1Q82 U;  3PMT A;  5GAN h;  1VQO A;  3FRN A;  1VQ8 A;  2EIF A;  1RI0 A;  3MEV A;  3OS0 A;  5M9O A;  1KQS S;  2CZ6 B;  2RO0 A;  3DB4 A;  2NLU A;  3MP6 A;  2E64 A;  2EQJ A;  4JRK A;  3CPW A;  1BI0 A;  1KD1 U;  3OS5 A;  3AHU A;  3DKM A;  5I2M A;  2YLC A;  5DM7 R;  4N0A A;  2HAX A;  4MZP A;  5HY6 A;  5LJ5 j;  1I5L A;  1UEB A;  5IN1 A;  1M4Z A;  3NTI A;  4OB0 B;  4IUT A;  1VQ6 T;  4C8Q C;  5GAO p;  1XQH A;  1KG1 A;  1Q7Y U;  1X01 A;  1I4K 1;  4PJO C;  2GFA A;  3HHT B;  4EDU A;  1DJ7 B;  2GF7 A;  4XU0 A;  1YHQ T;  2M16 A;  3QXE B;  3EAE A;  3JB9 D;  3WVE B;  2RD1 A;  1VQP T;  4B9W A;  4IKF A;  2CGH A;  1WJQ A;  4JRP A;  4OB2 B;  1M90 U;  4KT0 E;  4NL2 A;  1PSF A;  2K3Y A;  3MEA A;  3QJ6 A;  1KHC A;  3LX7 A;  4ELY C;  3L2R A;  1B34 A;  5FRN A;  2QQR A;  2OAU A;  2FVU A;  3OYI A;  3QSU A;  1UGQ B;  4EMK C;  5A0L A;  4HA8 A;  1K8A C;  4C92 C;  1D3B B;  3BDL A;  5EG2 A;  4MZT A;  5GMK h;  3MEU A;  3R6O A;  4M78 C;  1W2B A;  3V7C A;  4YTL A;  4C8Q A;  2KY9 A;  3TRE A;  3CD6 T;  1PSE A;  4PJO A;  3DB3 A;  2EQK A;  2K4Y A;  2HD0 A;  2JN0 A;  2JVV A;  4BUG A;  2KQW A;  1YI2 T;  4M75 B;  3NFC A;  2ZPE B;  5CAI A;  3QBY A;  4XU1 A;  1Q82 C;  4D6W A;  3CCM A;  5HK3 A;  2JOY A;  4BY6 B;  2EJG A;  2MMP A;  3C12 A;  3JCM b;  3L2Q A;  4XQ3 A;  5J39 A;  4RCB A;  5GAN e;  1M9S A;  1KD1 C;  5GMK m;  1JRI A;  3T9N A;  3CC7 A;  4F7U A;  3FJP A;  3QDR B;  3CCJ A;  2MAM A;  3J81 E;  5CQX A;  5KH6 A;  4EMK A;  2PVO B;  3RUX A;  4M75 E;  1Q7Y C;  3JCM X;  2XDP A;  4L5G A;  3SFM A;  1VQL T;  2A7Y A;  5J26 A;  3OS2 A;  2QQ9 A;  4PLL A;  1LNX A;  4M7A G;  1GXI E;  2QA4 T;  1K9M U;  3A8M B;  4RMO A;  1UGP B;  4GLK A;  3C95 A;  2RHX A;  1V29 B;  3NTH A;  3OSV A;  3I56 A;  2DTH A;  5LJ3 d;  4M7D F;  2V8K A;  3HRS A;  4J83 A;  4M77 B;  4NOY A;  3E9F A;  1VQ5 A;  5HK0 A;  2D6F A;  3CCE T;  1BIA A;  1XOV A;  2ZPH B;  3MET A;  2PVG B;  1IRE B;  2WAC A;  1VIF A;  2GQV A;  3BY7 A;  3ER0 A;  5A2Q E;  1M1F A;  2HQE A;  5GAN g;  3C94 A;  3SD4 A;  3JB9 H;  1U1S A;  3PT9 A;  4LDU A;  4C92 G;  4C5E A;  3DLM A;  5GMK e;  3HRT A;  3RKY A;  4M78 G;  2LNV A;  4MMK A;  5LJ5 d;  2R58 A;  1YIT T;  4M77 E;  1VQ6 A;  3JCM J;  2EWN A;  3QO3 A;  4ZGJ B;  4M7A E;  3CPF A;  4BE0 A;  3RIR A;  3PMI A;  2RHU A;  1VQM T;  3OYE A;  1YHQ A;  3KUF A;  3L2Z A;  4LDW A;  2MWP A;  4RKU E;  4C0Z A;  4J7F A;  5DLQ E;  1VQP A;  2LVM A;  2X4Y A;  5J3B A;  3LGL A;  3J80 E;  1Q81 C;  3OYF A;  2EFI A;  4M7D D;  3CCR T;  4UC4 A;  5IAY A;  4LD6 A;  3O8V A;  3JCM V;  5HKC A;  2E6Z A;  4FT2 A;  4BE2 A;  1VQK T;  3X28 B;  2Y4X A;  3PIO A;  4O5V A;  2KDS A;  2P0Q A;  4C0D B;  5LJ3 f;  3JRZ A;  5CO7 A;  1IZ6 A;  3PFS A;  4BAC A;  2DKG A;  3MCA B;  3JB9 I;  4ELZ C;  1X6O A;  1QVF A;  2FB7 A;  4M75 C;  2DIG A;  4XK8 E;  5GAM j;  2DPP B;  2RI2 A;  3L2V A;  3CD6 A;  1JB0 E;  3QKJ A;  5GAN 3;  2G3R A;  3ME9 A;  4DA4 A;  2EQU A;  1YI2 A;  3CMA A;  3P8H A;  2QQB A;  4PL6 A;  4PLI A;  3VYG A;  4ZGE B;  3M53 A;  2ZCF B;  5CIU A;  1WJR A;  5D6W A;  4BI8 B;  4C0G A;  4DOW A;  5LJ5 f;  2FYK A;  1M1K C;  4F7U F;  1N8R U;  3BW1 A;  3LLR A;  2LRQ A;  5KE3 A;  3CXC A;  2X4X A;  4A53 A;  3CCS T;  2K5F A;  2M1H A;  2QTX A;  3CCL A;  2PVD B;  2D0Q B;  2Y4Y A;  1G3W A;  3LH0 A;  2F5T X;  2DZ9 A;  4J5Y A;  4PNO A;  3JCM P;  2VGN A;  3HRU A;  2ZPB B;  3X26 B;  4NS5 A;  3G71 T;  1YIJ A;  1UB4 A;  3S3N A;  1WNL A;  3GNF B;  3Q1J A;  3CBP A;  4X34 A;  2LDM A;  3UDC A;  2XDB A;  1VQL A;  2P0K A;  3CCV A;  2LT1 A;  2QA4 A;  4M77 C;  1M5Q 1;  4J6W A;  3JCM c;  4M7A C;  3A5Z B;  2QEX A;  4N4I A;  2RK2 A;  1MGQ A;  5I2S A;  2DXU A;  3J7A F;  2EAY A;  4J7I A;  1R8O B;  2XHC A;  3VUB A;  4HCC A;  4MZM A;  2OTJ T;  2F5K A;  4RCC A;  2LT4 A;  3CCE A;  1X75 C;  1Q86 C;  1NE8 A;  4JRI A;  4JS4 A;  2C06 A;  4II1 A;  1Y96 A;  5CKB A;  4MDW A;  3OYG A;  2RHY A;  1P92 A;  3JCM d;  2RJD A;  2X4W A;  5GAO r;  1K73 C;  1YBY A;  2DD4 A;  2M0O A;  4XAX B;  3V8K A;  2E70 A;  2QQS A;  2RJF A;  2O4X B;  2IVW A;  2RA2 A;  5L8R E;  1YIT A;  2E41 A;  4M75 G;  5FU7 B;  4C5G A;  2LCC A;  1TH7 A;  3A8H B;  4QQ6 A;  1QVP A;  3MHX A;  5LJ3 h;  5GAO l;  3OQ5 A;  1VQM A;  4CI0 C;  4M7A A;  3RKW A;  4ZN3 A;  1N6A A;  3CMA T;  1VQN T;  2RI5 A;  2V8I A;  1WQ7 A;  1N8R C;  3EFS A;  4TVR A;  2DXT A;  4WF2 A;  4JRQ A;  3CCR A;  3M9Q A;  2RHZ A;  2RJE A;  4M7D B;  2Y90 A;  3QHS A;  3SWN B;  4E7J A;  1Q81 U;  1VQK A;  2WSE E;  2E65 A;  5KE2 A;  1NPP A;  1YCY A;  3CCL T;  5FU6 C;  2RHI A;  4R55 A;  5C6S A;  3PIP A;  1QW1 A;  5LJ5 h;  4Z02 A;  2K3X A;  1YIJ T;  2XKO C;  2DIQ A;  1M1G A;  3MP1 A;  4J6Y A;  3QUI A;  3QYH B;  3E1S A;  5CVI A;  4C92 A;  5LL6 S;  5GAN 2;  2R5M A;  3CCQ T;  1HXD A;  3CME T;  3N5B B;  4M78 A;  4M77 G;  4EMH A;  3CCV T;  3RMQ A;  3CPW S;  3CBO A;  1MHN A;  3OSS C;  5DY9 A;  4M7D E;  3V7S A;  4XTZ A;  1ZHI A;  2DEQ A;  1G3S A;  3JCM f;  2CZ1 B;  2QEX T;  4HCB A;  2CZ0 B;  2ZZD A;  3OYL A;  1S72 A;  3HFN A;  2ZPG B;  3GLX A;  4Q5W A;  2LQ8 A;  4QQD A;  3GNG A;  3RER A;  4LDV A;  2CYZ B;  4C0F A;  5GAN 5;  2PQW A;  2BUD A;  3CCS A;  3ASK A;  4RG8 A;  2E10 A;  2O01 E;  2K2V A;  3C4S A;  1M1K U;  1I81 A;  2JTM A;  4XTY A;  1G3T A;  1VQ4 T;  1B34 B;  1VQ7 A;  1N9R A;  3G71 A;  1OI1 A;  5CK9 A;  3X20 B;  2DJZ A;  4BE1 A;  1H64 1;  3MP8 A;  2X4J A;  1S72 T;  2VXE A;  3JAM E;  4E7I A;  2KMT A;  4Y28 E;  3JB9 G;  2EQM A;  3SDZ A;  3UT1 A;  2DXB A;  3VYH B;  5LJ3 e;  3M56 A;  1KQS A;  2FHD A;  3GF5 A;  5CKH A;  2I2L A;  1UGR B;  3H6Z A;  2QXF A;  4QVD A;  3I55 T;  2OTJ A;  1RL2 A;  5FLX E;  2MWO A;  4C5H A;  1W2B S;  2PUO B;  2MF2 A;  2L5Q A;  3OYD A;  5GAN j;  4KBM B;  1VQ7 T;  3OYB A;  5I21 A;  1VQ8 T;  2WSC E;  2XK0 A;  1Q86 U;  2CKK A;  5GAM f;  3GIB A;  2ZGW A;  4IUQ A;  5FU7 C;  4PKC C;  4F7U B;  3OYK A;  3P8B B;  4JLI A;  2A3L A;  5LJ5 e;  2VV5 A;  2VYT A;  2XG8 D;  2K5L A;  2PU9 B;  3OY9 A;  3LWH A;  4A4F A;  3OB9 A;  3HFO A;  4C8Q F;  3H8Z A;  4EMK B;  1LOJ A;  1K73 U;  4N4H A;  2VUB A;  4PJO F;  5A0G A;  3GOX A;  4L6V 5;  1ZBX A;  2LX9 A;  4BY6 C;  4HKE A;  1H3Z A;  3TCJ A;  4B9X A;  5LJ3 g;  4M7D C;  1O9S A;  1VIE A;  1VQN A;  4E7K A;  2QQA A;  3UPU A;  2DK3 A;  4F7U E;  4BB7 A;  4FSX A;  2EJ9 A;  3OYN A;  1BYM A;  3JCM Q;  4LDX A;  2CZ7 B;  4FL6 A;  4J6X A;  3INZ A;  5D6Y A;  3JCM h;  2ZPF B;  3A8L B;  4XU2 A;  1YJW T;  4X9C A;  5KCH A;  2XIC A;  3OBY A;  5AYF A;  3G6E T;  2LCL A;  1D3B A;  3OYJ A;  4FT4 A;  3M4G A;  5CQY A;  3CCU T;  2XD0 A;  4XTW A;  2VXF A;  1WPY A;  4C92 F;  3M57 A;  3ZBD A;  5GMK j;  3HP9 A;  4KUI A;  3M58 A;  3URG A;  3OW2 A;  4M78 F;  2LTO A;  5LJ5 g;  1G3Y A;  3CCQ A;  3CME A;  3QG1 A;  2QDY B;  5KCO A;  2LC4 A;  4M75 A;  1KHI A;  4C8Q D;  4DQ2 A;  3CC2 T;  1KQ2 A;  3FIF A;  3JSC A;  4PJO D;  3FB9 A;  1XTD A;  5CKE A;  2JUF A;  2B8A A;  2KK4 A;  3FEO A;  1YJN T;  2GCX A;  3BDU A;  1VUB A;  4QQG A;  4QW2 A;  4A4H A;  1QP2 A;  1BIB A;  4A4G A;  2HNI A;  3F70 A;  1NJI U;  4OMF B;  3G4S T;  3PNW C;  4OVA A;  4ATO A;  3OYM A;  2RI3 A;  1BKB A;  2HBP A;  2F69 A;  2HQX A;  5GMK i;  2E6N A;  1VQ4 A;  2BKD N;  4E7L A;  2FL7 A;  2R57 A;  5CKF A;  5IT9 E;  4BDZ A;  1UGS B;  3QZ9 B;  4NL3 A;  4BI4 A;  5A0D A;  1U8R A;  3HKS A;  4OGE A;  3RES A;  3ZFJ A;  2P4T A;  4C92 D;  1LJO A;  4EPC A;  5GAM h;  5GAN 4;  1VQ9 T;  1BI3 A;  3OYY A;  4M78 D;  5C0M A;  1WGS A;  2MI6 A;  3M55 A;  3LGF A;  4M77 A;  3PGG A;  4M7D G;  2CS7 A;  4OB1 B;  3CC4 T;  3V8J A;  1EIF A;  3I55 A;  2WSF E;  4BI3 A;  2PUK B;  3L1A A;  5GAO m;  3M5A A;  1QVF S;  2DO3 A;  1FX7 A;  1KC8 C;  2P0P A;  2RH2 A;  4XTX A;  4C0D C;  2YLB A;  5DLO A;  3ZEH A;  2XID A;  1AHJ B;  2D9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...