2GDDA

Human beta ii tryptase with inhibitor cra-27592
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human beta II tryptase with inhibitor CRA-27592
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tryptase beta-2
total genus 51
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gddA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gddA01
3SNCA 2XCNA 1JIMA 2BX4A 4DIHH 1W8BH 1D3DB 2GZ7A 3NKKA 1Y5AT 1GJCB 2XBVA 1THRH 4RKOB 4Y8XA 2FLBH 4X1QU 2FYQA 1QJ7B 2AMDA 1O2NA 1OWEA 1V2NT 1V2MT 1BRUP 1LHDH 4FUJA 2CF8H 3A89A 3KQDA 1Z1JA 1HAPH 4Y76A 1MCVA 3BTQE 2GX4A 1RIWC 3BEFB 1RS0A 2A0QB 1KY9A 2VIVA 4K1TA 1BA8B 4LXBH 3URDA 4X2XA 3RMNH 1D6WA 1W0ZU 1Y3VA 1NM6A 2GCTB 1CE5A 3GISB 1GJ4H 1JMOH 3VB3A 2A5AA 1IQIA 1ELCA 2TPIZ 4MPWA 1LPKB 1HYLA 1QY6A 2FTMA 1T4UH 3UUZA 3KF2A 3AW1A 2GZ9A 4NA7A 1T7CA 5A8XA 3EYDA 3EGKH 1C5UA 2V3OH 3M3TA 1Z7KA 2ANWA 3GY5A 1GBFA 1BCUH 1EZXC 2BTCE 2BVXH 2CHAC 1ZPZA 3ZVFA 1SGFA 2JH6D 4YOGA 2PSYA 4JYVH 2VIOA 1EX3A 4CH2B 1GWAA 4Y8YA 3QZRA 1Y5UT 1G2LA 2K1QA 3EA9A 3NXPA 1VITH 4MQAA 2GDEH 4FUGA 2BDAA 4XE4A 4Y7BA 3RC5A 2BY6X 1SGTA 3KQEA 4K1SA 4ZHLU 1XUJA 4ABHA 1XUFA 2ZTYA 1W13U 1YLCA 2SFAA 1NY22 5JPMH 1W12U 2ZGXH 3GCOA 1EAIA 1HRTH 1WTGH 1L4ZA 1QBNA 6GCHF 1SC8U 5EW1H 3A7WA 4K8YA 1IQJA 1VJ9U 4U01A 3VB4A 5F8TA 1UMAH 3A88A 4ZKSU 4XBBA 4E7NA 1ELEE 5PTPA 3QN7A 5A0CA 2FOHA 2CMYA 1MTUA 2V6NA 2W3IA 2H6MA 4ABEA 4X0WU 1RTKA 2Y82A 2J2UA 3PLKA 1GBKA 3SBKA 2QXJA 1D3PB 2W5EA 3KQBA 4XOJA 3MU0A 3UREA 2IJOB 1ZHRA 1ANCA 4K60A 3VB5A 1C1NA 2ZKSA 2HWLB 2C3SA 2P3FH 3A81A 1F0RA 3B23B 1HXFH 5EQQA 1GVZA 5C5OA 1BZXE 1FAKH 5E8EH 1MZDA 2BDGA 1P2IA 2PGBB 1O5EH 4FU7A 1AWHB 2JH0D 1AKSB 4X6MA 2BY8X 5DKMA 2Z7FE 2PTNA 3ZYEA 3KNXA 4IW4E 1Q3XA 3TK6A 1A5IA 3RXVA 4ABBA 4MNWA 4JK5A 1KXBA 2ZU3A 4I32A 2BY5X 4PROA 3PM3A 1K2I1 4KGAA 4ZHMU 5E2PA 2VIWA 4GLYA 4X2WA 1ETTH 1G3DA 4KTUA 2ZGJA 3BTHE 1W10U 3LGWA 4BTUB 1OX1A 2JETC 5A0AE 4Q7YA 1QFKH 4JMYA 1FY8E 1A5HA 3N7OA 1CBWB 1O5AB 3HKIB 5T6FA 3E8LA 4R8TB 4U30A 3RXIA 3A8AA 1LHGH 3O8DA 4NIVA 1ZSLA 1A0HB 2OQUA 1HXEH 3OSYA 2WPLS 1AFQB 2PKSC 2OC8A 2O8TA 4NSYA 2FO9A 3SNDA 1M9UA 3F68H 4LK4A 2H9HA 3RU4D 3VB6A 2P8OB 3F1SB 4SGAE 4AFUA 1Z6EA 1MD7A 1Y3UA 3TNTA 3RMLH 1CA8B 3RXEA 1PPBH 3ZVBA 3ZZBA 4B76A 3DUXH 1EB1H 1WCZA 1Y3WA 4ZXXH 3TLOA 1F92A 2C8ZB 1EJAA 1ZHPA 3FP8E 3C1KA 1NS3A 3K6ZA 1GMCG 2PTCE 3GCHC 3GDSA 1BBRK 3S9BA 2ZQ2A 1GI7B 5EQRA 3AVZA 4X1PU 4Y79A 5IYTA 2FLRH 1S6HA 1K1OA 1DE7H 3R0FA 3HGNA 2ZI2H 2SGPE 1PQ7A 1P2KA 2AIQA 2BXTH 1FUJA 4CHAB 1YF4A 1QQ4A 1TAWA 5AFYH 5DPAA 1C2DA 3HK3B 3SV9A 3TU7H 1GJAB 3ZVGA 2YOLA 1IQLA 1HUTH 4UDWH 1UTKA 1EJMA 1HFDA 1PPEE 1SGCA 1BTXA 4B1TA 5A0BA 5HM2A 2VINA 1DVAH 4GVUA 3F9FA 1P8VC 4AFZA 3W95A 3R3GB 1CGJE 3S7HB 1W11U 2PLXA 2R0LA 2BOKA 5FCKA 3T28A 1AWFH 3MO3A 1IAUA 2D2DA 2BDBA 5JBBS 1SHHB 2UUYA 4YLUA 1KLTA 4YT6H 4AG1A 1GJDB 2NU2E 1AFQC 8LPRA 2W3KA 1SMFE 5H4IB 1FMGA 1KDQA 3Q3KA 1J9CH 1P3CA 2HALA 2QA9E 1SBWA 1EAXA 3RLYH 5ABWA 4H6TA 2RA3A 1PPFE 1TABE 1K1JA 1C1VH 3SO3A 2G00A 3P8GA 1P02A 1DANH 2ZFTA 1YCPM 1IHTH 1O3GA 4WMFA 1N1LA 1TPSA 2BD2A 3JZ2B 1QL9A 1ELAA 1UJ1A 1DY8A 3H5CB 3P92A 1C9TA 3BG8A 4A6LA 1QIXB 1TGBA 3RXGA 1MH0A 3T2NA 2F9PA 3SQEE 1RIWB 1G30B 1C5PA 5FAHA 1K1MA 3QWCH 1O2SA 1DWDH 3M3SA 1KLJH 4FUFA 2AEIH 1TQ0B 1TBZH 1UVOA 2XBWA 3SUEA 2XYAA 1TNKA 1YC0A 1TPAE 2XRCA 3MI4A 4LZ4B 4YOJA 4GHQA 1WUNH 5G4BA 1GHAG 1DLEA 3LGTA 3MU4A 3TJUA 1TMBH 1ESAA 4HGCA 2GV7A 3SN8A 3FVFB 3LONA 1AB9B 4Q80A 1C2IA 1GBJA 1JXPA 3RMMH 3M5LA 3PMHB 5DG6A 1DXPA 4WMEA 3RXTA 2DE8A 1E38B 2H9EH 1ZTLA 3SOSA 2Z9LA 4YESB 2Y81A 2ILNA 4D7FA 1GBTA 1GCTC 3SJ9A 3QX5H 4X6OA 3SW2B 1NFXA 1WU1A 2OUAA 4H4FA 1GI1A 3MMGA 3BIUH 5JBTA 1GGDC 2H5CA 3ZZDA 2TGPZ 2R2WU 1MBQA 1O32A 2KAIB 1UTMA 2WPJS 2I6QA 1DPOA 3SGQE 1SG8B 2Y5GA 4I8KA 4UFEH 1MD8A 3F9EA 1YPHE 2ZEBA 2ZGBH 1DY9A 1SGQE 3CS7A 1O2TA 2ZO3H 5FXLA 3EQ0H 1MTVA 4WF8A 1V2WT 4JZFH 1AVWA 5DP6A 3SJOA 2Z9IA 3U8RH 1PPZA 1S85A 3KGPA 1CVWH 1GBCA 4Y0ZE 3RXJA 5C5NA 1SLWB 3TNSA 1FZZA 1ELFA 1G32B 3O8RA 4H6SB 1O37A 1QB1A 2OXSA 1QA0A 3GYLB 1HAIH 1L0ZA 1BBRE 3BSQA 7GCHF 2PUXB 1EZUC 3DFLA 1GI9B 4O03A 1D9IA 2B5TB 2BDIA 4IMZA 4WH8A 3UFAA 3RXPA 3KHVA 5J4SA 2GDDA 1BTPA 4DVAU 4X1SU 3M7QA 2ZQ1A 1EZQA 8GCHF 4AFQA 1P0SH 2BY9X 3GY8A 2VVVA 1NU7B 1DSTA 3VGCC 4TWYA 4FUIA 5T3HA 3BTWE 4X8VH 1XUGA 5A2MH 3TGIE 3PTBA 3B8JA 5JBCS 1AUTC 6CHAC 1FJSA 2IN2A 1GHZA 3U69H 2F9BH 3PO1B 1G37A 4WY3A 1GMCF 4AB8A 1BTZA 2FI4E 2XCFA 1CT2E 1SFIA 4CREA 1ZGVA 1EOJA 1BTHH 1GHBF 1H9IE 1E34B 4BAQB 1TX8A 2TGDA 3QGNB 1WBGB 1ZJDA 3BN9A 4NWKA 1BB0B 1AGJA 1AUJA 1EB2A 1UK4A 2J94A 4E05H 8ESTE 9ESTA 4AOQA 2ZP0H 1LKBA 1TRMA 3VEQB 4UFDH 1TPOA 1FY5A 4Y11E 3SJIA 3MH6A 1C1RA 1YPHC 1TFXA 3PMJA 1HAVB 1QHRB 1JBUH 3UQVA 5L6NH 3LDXH 1W2KH 1S83A 3A7YA 1O2MA 2C8WB 4Y8ZA 1YYY1 1QQUA 2AGIX 1ELVA 1O2WA 1CA0C 3GY2A 2EI7A 3LJJA 1BJVA 3STIA 1GHWH 3VXEH 4ABDA 1HAOH 3SGAE 1C5NH 1QRZA 1YPGH 3LH1A 1ELGA 4LZ1H 2VJ1A 5L30H 3A85A 3RMOH 2VWOA 3V13A 1MUEB 1JOUB 3T29A 3P70B 1C4V2 1UVSH 2VH0A 1V2ST 2V3HH 2VGCC 1ANDA 1NRPH 1ZMLA 1O38A 2PKAA 3E6PH 2O8MA 4INHA 4MPUA 4OS6A 3RDZA 5I25A 3VXFH 2F9OA 1C5LH 3RC4A 1HB0B 1LVBA 3GY3A 3SNAA 3BEUA 1ZTKA 2ZNKH 3PB1E 1C5VA 3UNQA 2EEKA 2OC0A 3QDZB 2ZCHP 3EDXB 1XM1A 3NK8A 1ZGIA 5FPSA 1GDNA 2BQWB 1LMWB 5FPTA 4X8UH 4BTIB 1O35A 2IPHA 3Q3XA 3D65E 1LHCH 4Z6AH 1DSUA 2QAAA 3BTEE 3H7OA 1UTLM 1EAWA 3QUMP 2ZU4A 3W94A 1WSSH 3BTME 2Q1JA 1CHGA 2VVCA 4ZKNU 1Q31A 1Z71A 3RM2H 1SQAA 2WINI 1JRTA 3BTDE 1VCQA 1PQ8A 2Y7ZA 3OY6U 1C1UH 1C5TA 2JKHA 2NWNA 2STBE 4YLQH 1FPCH 1S82A 1GMDF 1BRCE 1V2LT 3A8BA 3ATMA 3MNBA 4OS5A 1PPGE 4CRDA 1GJ8B 2ANYA 3E16B 4ZKOU 1SPJA 2HLCA 1LPGB 3TH3H 1Z6JH 1G9IE 4I31A 3A7ZA 5GIBA 1GJBB 3SV8A 2UUFB 1O3OA 2EC9H 5EU8A 2FM2A 2VU8E 2FOMB 1HLTH 1LVOA 1O39A 3ZZ7A 1PQAA 4I8LA 5A8YA 6ESTA 4D8NA 1XKBC 2WV5A 1QJ1B 4XSKU 4ZROA 3ZZ6A 2Z6BD 3ZV9A 4UFFH 1GDUA 1CQQA 4VGCC 1Z1IA 2Y7XA 1G3BA 3MWIU 2PKAB 2G81E 4TPIZ 3A87A 4ZXYH 2GT7A 1A7SA 2XXLA 1IQFA 1OYTH 1QB6A 4Y6DA 2STAE 2P93A 1DXWA 1J14A 1QL8A 3SV6A 3ATIA 2HVXA 1ESBA 2V35A 3GY4A 1A4WH 3SUDA 1KYNA 2Z94A 4CRBA 1UVUH 2SNWA 4YM9A 1LHFH 4I8HA 1YKTA 2ZZUH 1KLIH 3V12A 4MNYA 3MU5A 1GI3A 2UWOA 1PYTD 1CHOG 1SFQB 1ELTA 1F0SA 1S81A 1TLDA 1QNJA 2AERH 1O5GH 3ZZCA 3MO9A 5FBIA 1AN1E 4WJG2 1OP8A 2FYRA 1CT4E 2A4QA 1GHBG 2ZHEH 3MH4A 4ZH8A 2ZGCA 2XC4A 1DICA 3QLPH 3P6ZB 2CV3A 1C1WH 2BHGA 2GKVE 2M5TA 2OLGA 2BD7A 1GJ5H 1GJ6A 3LGIA 1P12E 2BVSH 2JETB 2ZDAH 3OYPA 2H9TH 3LGYA 1ACBE 4MPXA 1N8OB 4LOYH 1GBBA 5FX5A 1GBIA 3KCGH 4Q7XA 4GAWA 1GVLA 3VGCB 2YNAA 1XVOA 2FMJA 1G3EA 2FIRH 3ZZ5A 1AE5A 1QA7A 1A3BH 3EA7A 3VFEA 4BXSA 1DWEH 1QL7A 2GGVB 5C67A 2OP9A 1YPLH 2DUCA 1C5OH 3UPEA 1T4VH 1VCWA 4OS4A 2HNTC 3BF6H 2VIQA 1NRNH 1O34A 2JH5D 5GCHG 4KTCA 1N6XA 1SSXA 3H7TA 1GBHA 2A45B 1GL1A 4K5ZA 3RXRA 1NRQH 3LKWA 3BV9B 2AYWA 3M61U 4MPVA 3SU0A 1T32A 1TNLA 4JYUH 3S9CA 2Z3DA 4NSVA 1L4DA 3MYWA 2AS9A 4F4OC 1MTNB 1ZRKA 2FPZA 2UWPA 1TPPA 2FP7B 3SU2A 4X1RU 2R0KA 3FFGA 3KEEA 4NIWA 2FODA 1A1RA 2FX4A 2ZPSA 4OS2A 2OBQA 2ZDMA 3DD2H 1V6DA 1DDJA 1BHXB 1SL3A 1P11E 3GCNA 2TGAA 3MU8A 1S0RA 4XBDA 1S6FA 3SJ8A 4A7IB 1AY6H 1XKAC 2EI6A 5JYIA 2C93B 2FESH 4IC6A 1HJ9A 1G36A 3SU6A 3S7KB 2XBYA 1GI8B 3P8NA 3PYHA 3I77A 3LJOA 4UD9H 2WYJA 3RXDA 2FOGA 2H1UA 1TNGA 1O2ZA 3RXHA 1A0LA 4ISIH 5DP3A 4JZDH 4BXWA 3SNBA 1JIRA 1SR5C 1ID5H 1WTHD 5AVDA 4DJZB 1C1PA 3E1XB 4WXVA 1P9UA 3ODDA 2BLVA 2A7JA 5TCCA 1J16A 1MBMA 4KELA 1K21H 5DP4A 4I8JA 1UTJA 4BAKB 1HAYB 5FBEA 2FI5E 1V2VT 4IMQA 3SZNA 1P2MA 4JZIA 3A83A 5E0HA 3MO6A 2QXGA 1TQ7B 4FVBA 3CENA 1XXDA 1WOFA 2A31A 5DP7A 7LPRA 1MAXA 3EA8A 5F6MA 2GP9B 1O31A 1O5CB 2BX3A 3ODFA 3P17H 4WWYA 1SGYE 1SQOA 4ZAEA 2G8TA 2ZU1A 1ZMJA 2G51A 3LGUA 4TY6A 3LC5A 3ZVAA 1SGRE 2WV4A 2Y5HA 1O2JA 1S5SA 1BMMH 1UHBA 1KXFA 2FS9A 2FS8A 4K8BA 1OOKB 1GI2A 1HAXB 2O8LA 3MNCA 4U2WA 4HFPB 2PW8H 4YT7H 1BITA 1CU1A 3HKJB 2QY0B 1P2NA 3TK9A 3ATWA 1KDQB 1E35B 4Y10E 4D76A 1FN6A 3SV2H 1GHYH 1AFEH 2DE9A 1TIOA 2WPIS 2FWWA 3UTUH 4YO9A 3TH2H 1ELDE 2WPMS 1ZPCA 1GI0A 2TRMA 1SGNE 4WMDA 3L3TA 1C1OA 1O2RA 5HGGA 2PV9B 1EKBB 1GGDB 1DT2A 2BLWA 1BDAA 2F91A 4IS5A 2HNTE 1AD8H 2Z9JA 1D6RA 2Z3CA 4CRCA 1GHAF 1QURH 1RTLA 2ZCLP 3OY5U 2CHAB 2G55A 5CHAC 4I8GA 2ZHDA 2AGEX 2ODQA 2A7HA 1DS2E 1GL0E 3SGBE 2R3YA 3GOVB 3UR6A 1AI8H 1Z8RA 4WXIA 2A5KA 1PJPA 2XNIA 3ZVDA 2C4FH 1IQNA 3VB7A 1AMHA 2FOAA 3SV7A 2VWMA 2J38A 1BRAA 1W14U 2O9QA 2G52A 2ZFPH 2THFB 3E0PB 1FV9A 1H1BA 3NWUA 4DW2U 3SHCH 4CBOA 1KXDA 1TGSZ 1P3EA 2VIDA 1O5FH 4NA9H 4MNXA 2GZ8A 1B7XB 1EPTC 2TIOA 2QV1A 3UNRA 2PSXA 3ZZ8A 1LTOA 4B2BA 5C3NA 2SGEE 2A2QH 1YGCH 1KXCA 4H42U 1C2EA 2J95A 3O8CA 4RKJB 2RG3A 1XUKA 3DFJA 1AQ7A 1CGHA 1UTOA 1EP6A 4X6PA 5GDSH 1Y59T 1DITH 3GDVA 1GMHF 3ZVCA 1WQSA 2OBOA 5BPEA 1ZTJA 2OC1A 4DGJA 2R9PA 4I7YH 4NGAH 3Q00A 1O3EA 2BZ6H 1S0QA 1OP0A 2XTTB 1OS8A 1YPEH 3A84A 3RLWH 1K28D 2D26C 1QBOA 2ZPQA 1SGDE 4CH8B 2ZF0H 2SGDE 2HGTH 3BEIB 5F8XA 1KIGH 1ELBA 1P9SA 1T8OA 1TOMH 3T25A 1O2KA 1GI6A 1Q2WA 2TBSA 1HDTH 5K7RA 1O3LA 4ISHH 1ESTA 3RXQA 4A92A 4YTAA 3ZZ9A 3L33A 1XUHA 2ZPRA 1UTPA 1TRNA 1BIOA 2PR3A 2UUJB 1TOCB 2I6SA 3BG4C 1BMLA 4XDEA 1IQMA 2Y6TA 1C1TA 2VIPA 5EGMA 1P2QA 1W0YH 3UOUA 1CO7E 1V2JT 2NU1E 3SI3H 4HTCH 1V2KT 5E0GA 2AH4X 2AMPA 2TGTA 4MNVA 1O3MA 1FY4A 4JCNA 5GXPA 4JYTA 1YP9A 1GVKB 1U6QA 4FXGH 1F7ZA 1SLXB 1AO5A 1ZRBA 4TWWA 3RXCA 2XW9A 5EOKA 4INLA 2P8OC 1N8OC 1O2GH 1BHXF 2ODYB 4I33A 3RXSA 3F9GA 1GG6B 4GUXA 4GSOA 1MMJN 5AHGH 1HV7A 2ALVA 3BTTE 1Y8TA 4K2YA 4NIYA 1C1MA 1FXYA 4X8SH 1TRYA 1O3BA 3VPKA 1ETRH 2OTVA 2NU0E 3KN2A 3OU0A 2YNBA 1Z8JB 4X6NA 3PWBA 2C90B 3MFJA 1EOLA 2OINA 1XUIA 2ZECA 1K1NA 2WPHS 3A7XA 3LC3A 1BQYA 2VH6A 4BTTB 1NTPA 4DCDA 1TGCA 4CHAC 1YM0A 2ZDVH 3K9XB 1SOZA 3M5NA 2BDYA 3KIDU 1HAVA 1EAUA 3AAVA 4AG2A 1EASA 1IQEA 3GCHB 4AZ2B 2AMQA 1O3NA 3K2UA 4THNH 4ABFA 1NU9A 1C4Y2 1WQVH 2ZU5A 1ORFA 3IWMA 3V7TA 1TNHA 3GCTG 5DGJA 4JK6A 3PO1C 1EUFA 1SGIB 2XBXA 1LQDB 1BT7A 2BD3A 1LVYA 4M7GA 2AGGX 1FY3A 1C2LA 5ESTE 1AVXA 3QO6A 3FZZA 4BAOB 4JZEH 3QZQA 4ZHAA 1THSH 1A46H 1RXPA 5T6DA 1RD3B 1MQ6A 4TYDA 5LGOA 1O2XA 1C2FA 1KSNA 4R0IA 4X8TH 1IQGA 3SU1A 1ZZZA 3D62A 1P06A 3Q3YA 3TGJE 6CHAB 6GCHG 1AZ8A 2ZFQH 1UHBB 1QCPA 5JDUB 3A7TA 1XX9A 4ESTE 1BUIA 4NWLA 1UVTH 2P59A 1SLUB 1TMTH 1TALA 4E7RG 1FONA 1TNIA 3PLPA 3TJOA 3RP2A 1O36A 1YCPK 1O3HA 1UCYE 4B2AA 1ANEA 1OKXA 1HPGA 1HCGA 3U1IB 2A4RA 2FEQH 4ABGA 1TGNA 3AAUA 1AU8A 1C5XB 1C5WB 2QN5T 4WH6A 3UR9A 1FIWA 1B5GH 1L2EA 2ZU2A 5DP8A 1Z8IB 1NT1A 1W7XH 4X2VA 2SNVA 3SQHE 1BBRH 5EPYA 2QXHA 3WY8A 4AFSA 4BNRA 4YOIA 2OC7A 2V0BA 2GVFA 2W26A 2D1JA 1SGPE 1RRKA 1A2CH 2QCYA 2C8YB 1NO9H 3STJA 3U98H 4CRFA 1A0JA 1WYKA 2P95A 3UY9A 3FP7E 4UE7H 3MTYA 1HAHH 3V0XA 4FUCA 3ZZAA 1L1GA 2BXUH 2CGAA 4J2YB 2KAIA 4CR9A 1EPTB 1SGFG 3RXFA 4XFQA 5LPFA 3KL6A 1T8LA 2J34A 1C5QA 1GBAA 1TONA 5JB9S 1UO6A 1O3JA 2PFEA 4A1VA 3E91A 2A4OA 2A32A 4KKDA 3A8DA 4NFFA 2HPQH 2BVRH 3CP7A 4MVNA 2R2MB 2EA3A 4CR5A 1LVMA 3MH5A 3F9HA 2GD4B 3HGPA 3E3TA 2ZFSA 4GCHF 4RSPA 1K22H 1THPB 5GJ4B 4K69A 2BD4A 4AORA 1NRRH 1OWKA 1HNEE 1EP5A 1HJAC 4Q2KA 1O2YA 4AGJA 1S84A 3RM0H 3BG4B 1ZSJA 2A1DB 7GCHG 1NZQH 1H8IH 1MU8B 3M7TA 4B75A 2G4TA 2FX6A 3LGVA 1CT0E 2H2ZA 3PMBB 2WUCA 1O30A 2HNTF 1MKXH 3OTJE 3O8BA 3M36A 4X2YA 4AYVB 1GCDA 1OWHA 1A3EH 3QGJA 1C5SA 1P09A 2OD3B 4A5TS 1BTWA 1EZSC 1K1PA 4U32A 3EAJA 4X1NU 1HAGE 1GG6C 1DUEA 2O8UA 1MU6B 1OWJA 2BDHA 3UQOA 1SGEE 1VZQH 1FI8A 3UIRA 1C1SA 4ABIA 1PQ5A 3RXMA 3T27A 2LPRA 2FOCA 4FU9A 1AIXH 5A8ZA 1TA2A 1EPTA 1NESE 1O2OA 4QT8C 2RDLA 5CHAB 1L1NA 2ZHWH 2ZDNA 3LU9B 1NC6A 4ZKRU 4HI3A 2A7CA 2FOEA 2FI3E 3SORA 4ASHA 1C2HA 4Q7ZA 2VB0A 1LDTT 1BMNH 1A5GH 2QGRA 3HK6B 2IOTA 1QRXA 2Q6FA 4UONA 1Z8GA 1DOJA 3Q77A 4A1TA 3P95A 2RA0A 3SUGA 1BTYA 2OQ5A 4Y71A 1O5DH 1BOQA 1OWDA 1CGIE 2VWLA 3E90B 1G2MA 1YPKH 4B2CA 2ZTZA 1C2MA 1LPZB 1A61H 2ZC9H 3PMAB 1QB9A 3NPSA 2ANKH 5DO4H 4D9RA 5HYOA 3ZVEA 2G5VA 3A82A 1O3KA 3T5FH 2BMGB 1P57B 2BD9A 1G3CA 1XXFA 1MKWH 5LH8A 1TX6A 2BY7X 1P04A 1NPMA 1O33A 1VITF 2ALPA 4BAMB 3FZDA 4A1XA 4FUBA 1O2UA 2GV6A 5C2ZA 2BZAA 4GCHG 1OYQA 1HJAB 2GCTC 5LPEA 1LCYA 3ZV8A 1AVGH 4B74A 3NUMA 1UCYK 5FCRA 1GJ7B 1FAXA 2ZWLH 3BTGE 3ELAH 1LHEH 5HM9A 1QRWA 1GBEA 1O2PA 3IITA 2GT8A 4Y0YE 2ESTE 1NFYA 1TMUH 1HAZB 1MKXK 4D7GA 2F9NA 1IHSH 2ZFFH 1V2RT 4O3TA 1V2PT 1UTNA 3P8FA 2ODPA 1V3XA 3URCA 4TPYA 4F49A 2FOFA 5FX6A 3G01A 1O3AA 3GDUA 3GY7A 3PWCA 1QTFA 1T8NA 3UNSA 1EQ9A 1SVPA 1YPJH 2Q6GA 4IN1A 3S0NA 3SI4H 3FP6E 4ABAA 1E36B 1O3DA 4MDSA 1GI5A 2FXRA 2GCHF 1TYNA 4KP0A 5GWZA 2ZTXA 2C8XB 1O0DH 8KME2 1VITG 4NA8A 3IG6B 1C9PA 1W3CA 1VR1H 2Z3EA 2WUBA 1N6YA 1RJXB 2GMTC 3GCTF 1IQHA 1V2UT 2HRVA 3U1JB 3RXLA 2F3CE 1JRSA 3ATKA 2PUQH 4Y7AA 1P2JA 2A2XH 4K3JA 3D49H 3NZIA 1GBMA 2PHBA 4FUEA 1PPHE 1O2LA 1TBQH 3UWIA 4VGCB 1F5RA 3QK1A 2ZA5A 3RC6A 1C5YB 1EJNA 2GCHG 1H9HE 3HATH 1Y3YA 1AHTH 1FQ3A 2AFQB 3SJKA 1E37B 3ZZ3A 2F9VA 3S9AA 1LQEA 3RXUA 3P8OA 1O2VA 4CRGA 3GYMA 2CJIA 3FAOA 2P3UB 1RGQA 2ZGHA 3GY6A 2Y80A 2VNTA 3RXBA 1ARBA 2BDCA 1DLKB 3SU4A 1P03A 1YLDA 5JBAS 1GI4A 3BTKE 4RN6A 1D4PB 1SB1H 1MZAA 1AKSA 4IN2A 5F8ZA 2Q6DA 3K6YA 1KTTB 3MOCA 5AFZH 2LNCA 3M5MA 5E2OA 2ZIQH 3BIVH 1C2GA 5EXMA 4NFEA 3LOXA 4FU8A 1O2QA 4FUDA 3UOPA 4DIIH 4E06H 2ULLA 1XVMA 5C1YA 3TK5A 5HXFA 2QF3A 5SGAE 2GMTB 5F03A 1C5ZB 1J8AA 1K1IA 3FANA 2SGQE 3UWJH 1V2QT 4WVPE 1ZPBA 1F5LA 1FLEE 4HZHA 5EPNA 1NRSH 2A5IA 1RFNA 2BYAX 5DP5A 4NZLA 3SNEA 4MLFB 1EXFA 3ZYDA 4GHTA 4INKA 1YCPH 2B0FA 1RTFB 1FN8A 4ZMAH 3RXAA 3V3MA 1F2SE 1C2KA 1MCTA 1SLVB 2FTLE 2HOBA 2ZHQH 2HPPH 1NFWA 4NG9H 1ABJH 1IQKA 1MTSA 1CHOF 2ZG0H 1GHXH 1QJ6B 4JZ1A 5TCAA 1W7GH 2NU3E 3SUFA 5LPRA 1C2JA 3OX7U 3PLBA 1D3QB 2XWBI 1LKAA 5TJXA 5L2ZH 2O8WA 2F9UA 1TX7A 2BLOA 2WYGA 4DY7B 3SU3A 2BD8A 3PROA 2BOHB 2J92A 7ESTE 1ETSH 1K9OE 5GCHF 1MTNC 1OWIA 1GCTB 1C1QA 3RU4E 4BAHB 2SGAA 2CF9H 3MNSA 1BMAA 1UCYH 4AX9H 1PPCE 1JWTA 3U8TH 1L1JA 1TBRH 1H9LB 1H8DH 2ZDKA 5K0HA 2ZFRH 1X7AC 4CRAA 1SQTA 4CBNA 4UFGH 1ZR0A 4BOHA 1GBDA 4OGXA 2XC5A 1DUAA 3SHAH 5DK1A 3U9AH 3NCLA 2ASUB 4IC5A 2OCVB 1V2TT 3A80A 1HGTH 1ZJKA 4NZQA 2BLQA 1DX5M 3EE0B 2P16A 4ZUHA 1P2OA 2Z9KA 1DFPA 1ZLRA 2B7DH 3ESTA 4AYYB 5EXLA 5HMAA 2B8OH 1O3IA 5CMXH 1P10A 4OS1A 2CXVA 1TNJA 3K65B 1DWCH 5T6GA 2R3UA 1UTQA 5C1UA 2RCEA 3RU4T 3BTFE 1HIAB 1C5MD 2VWNA 3MNXA 1DWBH 2UWLA 3TJNA 4FVDA 1QGFA 3AASA 3DA9B 5AF9H 2J4IA 2AIPA 2G5NA 1ZOMA 1AZZA 5EG4A 3MH7A 2ZCKP 7KMEH 1MKWK 1FNIA 5GPIB 3TGKE 4UEHH 1TWXB 1B0EA 1GMHG 3S69A 3PV4A 2QF0A 4MG3A 1H4WA 3M5OA 1ZMNA 1GMDG 2P94A 4B71A 5IDKA 1IOEA 3GICB 2FZZA 5EW2H 4DG4A 2ZDLA 4GPGA 1TGTA 4AN7A 1D3TB 2Z9GA 3QTOH 3L6PA 3ZZ4A 3B9FH 3F6UH 2EI8A 1O2IA 1P05A 1BTUA 3D23A 4TY7A 2BD5A 5J4QA 2D8WA 3DHKH 2Y5FA 3C27B 2G4UA 1GPZA 1KXEA 1MQ5A 3JZ1B 3LT3A 1HJ8A 1TB6H 1VGCC 3LPRA 2XWAA 2QIQA 2XC0A 1SOTA 1VJAU 3M7UA 4MTBA 1FY1A 4J1YA 2ANMH 4ISLA 1NN6A 3A8CA 4IGDA 2PWXA 3T62A 1F0UA 1GDQA 5L2YH 1KTSB 1ABIH 1ARCA 1AE8H 3I78A 1E0FD 1UK2A 3KQCA 1C5RA 4O97A 1MTWA 3U8OH 1T31A 3A7VA 3TVJB 3DT0H 4YZUA 1ZSKA 2PGQB 4BANB 1YBWA 4D9QA 1CBWC 2VVUA 1EATA 3LH3A 1ZYOA 4ISOA 3PTNA 5ESBA 2J9NA 2FDAA 3TIUA 4ABJA 3M37A 2VGCB 3TH4H 1AB9C 1VGCB 2P3TB 2SGFE 2H5DA 1ANBA 4XBCA 3TITA 3TJVA 1O2HA 4NIXA 1O3PB 4NCYA 5C20A 3RXOA 1C4U2 4AB9A 5CE1A 4K1EA 1TE0A 5EODA 3HPTB 1FIZA 1PYTC 1Y5BT 1J17T 2QXIA 1QR3E 1INCA 1TA6A 2NU4E 1LO6A 3RXKA 1F0TA 9LPRA 1F5KU 3A86A 1Y3XA 2GTBA 1NFUA 1QBVH 3AW0A 1UVPA 6LPRA 3QTVH 1T8MA 1ZHMA 3MU1A 3RUOA 3ATLA 3T26A 5B6OA 1V2OT 2PKSB 4SGBE 4DURA 1GJ9B 3M3VA 2WPKS 1OSSA 1UK3A 1WAYB 4O9VA 1XMNB 4KTSA 2BM2A 5C1XA 3ITIA 1MAYA 2UUKB 2ZHFH 3M35A 1NROH 3Q76A 2BB4A 3E0NB 1SI5H 1CSOE 1DM4B 1KXAA 1BRBE 1OXGA 1YPMH 2BQ7B 5BRRE 3I29A 1O5BB 1P01A 8GCHG 2QYIA 4OGYA 2BQ6B 1PFXC 4FUHA 5DJ7A 4B73A 4Z0KA 5ETXA 2FOBA 2W7UA 4O3UA 1K1LA 3MHWU 1GBLA 4OS7A 3TPIZ 4AGKA 2CN0H 1B0FA 5EXNA 1FDPA 3SU5A 5DP9A 5E0JA 1GHVH 5JB8S 1BJUA 3CS0A 2B9LA 4DOQA 1J15A 5A09A 1SHYA 1WV7H 4DT7B 1OPHB 2QC2A 5EQSA 5I46H 1HBTH 3LIWA 4IBLH 5FPYA 3ENSB 4ISNA 1OP2A 1VCPA 1O3CA 1CA0B 1HIAA 1O3FA 1FPHH 5FHTA 2W7SA 2F83A 2A4GA
chains in the Genus database with same CATH superfamily
3SNCA 2XCNA 1JIMA 2BX4A 4DIHH 1W8BH 1D3DB 2GZ7A 3NKKA 3WWBA 1Y5AT 1GJCB 2XBVA 1THRH 4RKOB 4Y8XA 2FLBH 4X1QU 2FYQA 1QJ7B 2AMDA 2IJD1 3OAAD 1O2NA 1OWEA 1V2NT 1V2MT 1BRUP 1LHDH 4FUJA 2CF8H 3A89A 3KQDA 1Z1JA 1HAPH 4Y76A 1MCVA 3BTQE 3OEHD 2GX4A 1RIWC 3BEFB 1RS0A 2A0QB 1KY9A 2VIVA 4K1TA 1BA8B 4LXBH 3URDA 4X2XA 3RMNH 1D6WA 1W0ZU 1Y3VA 1NM6A 2GCTB 1CE5A 3GISB 1GJ4H 1JMOH 5KGOA 3VB3A 2YMSB 2A5AA 1IQIA 1ELCA 2TPIZ 4MPWA 1LPKB 1HYLA 1QY6A 2FTMA 1T4UH 3UUZA 3KF2A 3AW1A 2GZ9A 4NA7A 1T7CA 5A8XA 3EYDA 3OE7D 3EGKH 1C5UA 2HLDD 2V3OH 3M3TA 2RFKC 1Z7KA 2ANWA 3GY5A 1GBFA 1BCUH 1EZXC 2BTCE 2BVXH 2CHAC 1ZPZA 3ZVFA 1SGFA 2JH6D 4YOGA 2PSYA 4JYVH 2VIOA 1EX3A 4CH2B 1GWAA 4Y8YA 3QZRA 1Y5UT 1G2LA 2K1QA 2QF5A 3EA9A 3NXPA 1VITH 4MQAA 2GDEH 4FUGA 2BDAA 4XE4A 4Y7BA 3RC5A 4YXWD 2BY6X 1SGTA 3KQEA 4K1SA 4ZHLU 1XUJA 4ABHA 1XUFA 3FKSD 2ZTYA 1W13U 1YLCA 2IPQX 2SFAA 1NY22 2WSSD 5JPMH 1W12U 2ZGXH 3GCOA 1EAIA 1HRTH 1WTGH 1L4ZA 1QBNA 6GCHF 1SC8U 5EW1H 3A7WA 4K8YA 1IQJA 1WXRA 1VJ9U 4U01A 3VB4A 3FO8D 1UMAH 3A88A 5F8TA 4ZKSU 4XBBA 4E7NA 1ELEE 5PTPA 3QN7A 5A0CA 2FOHA 2CMYA 1MTUA 2V6NA 2W3IA 2H6MA 4ABEA 4X0WU 1RTKA 2Y82A 2JDID 2J2UA 3PLKA 1GBKA 3SBKA 2QXJA 1D3PB 2W5EA 4OM9A 3KQBA 4XOJA 3MU0A 3UREA 2IJOB 1ZHRA 1ANCA 4K60A 3VB5A 1C1NA 2ZKSA 2HWLB 2C3SA 2P3FH 3A81A 1F0RA 3B23B 1HXFH 5EQQA 1GVZA 5C5OA 1BZXE 1FAKH 2XNDD 5E8EH 1MZDA 2BDGA 1P2IA 2PGBB 1O5EH 4FU7A 1AWHB 2JH0D 1AKSB 4X6MA 2BY8X 5DKMA 2Z7FE 5EJZA 2PTNA 3ZYEA 3KNXA 4IW4E 1Q3XA 2WPDD 3TK6A 1A5IA 3RXVA 4ABBA 4MNWA 4JK5A 1KXBA 2ZU3A 4I32A 2BY5X 4PROA 3PM3A 1K2I1 4KGAA 4ZHMU 5E2PA 2VIWA 4GLYA 4X2WA 1ETTH 1G3DA 4KTUA 2ZGJA 1E79D 3BTHE 3FOAA 1W10U 3LGWA 4BTUB 1OX1A 2JETC 5A0AE 4Q7YA 1QFKH 4JMYA 1FY8E 1A5HA 3N7OA 1CBWB 1O5AB 3HKIB 5T6FA 2V3MA 3E8LA 4R8TB 4U30A 3RXIA 4XD7D 3A8AA 1LHGH 3O8DA 4NIVA 1ZSLA 1A0HB 2OQUA 1HXEH 3OSYA 2WPLS 1AFQB 2PKSC 2OC8A 2O8TA 4NSYA 2FO9A 3SNDA 1M9UA 3F68H 4LK4A 2H9HA 3RU4D 3VB6A 2P8OB 4ACAA 3F1SB 4SGAE 4AFUA 1Z6EA 1MD7A 1Y3UA 3TNTA 3RMLH 1CA8B 3RXEA 1PPBH 3ZVBA 3ZZBA 4B76A 3DUXH 1EB1H 1WCZA 1Y3WA 4ZXXH 3TLOA 1F92A 2C8ZB 1EJAA 1ZHPA 3FP8E 3C1KA 1NS3A 3K6ZA 1GMCG 2PTCE 3GCHC 3GDSA 3KQ5A 1BBRK 3S9BA 2ZQ2A 1GI7B 5EQRA 3AVZA 3N99A 4X1PU 4Y79A 5IYTA 2FLRH 1S6HA 1K1OA 1DE7H 3R0FA 3HGNA 2ZI2H 2SGPE 1PQ7A 1P2KA 2AIQA 2BXTH 1FUJA 4CHAB 1YF4A 1QQ4A 1TAWA 5AFYH 5DPAA 1C2DA 3HK3B 3SV9A 3TU7H 1GJAB 3ZVGA 2YOLA 1IQLA 1HUTH 4UDWH 1UTKA 1EJMA 1HFDA 1PPEE 1SGCA 1BTXA 4B1TA 5A0BA 5HM2A 1DVAH 2VINA 4GVUA 3F9FA 1P8VC 4AFZA 3W95A 3R3GB 1CGJE 3S7HB 1W11U 2PLXA 2R0LA 2BOKA 5FCKA 3T28A 1AWFH 3MO3A 1IAUA 2D2DA 2BDBA 5JBBS 1SHHB 2UUYA 4YLUA 1KLTA 4YT6H 4AG1A 1GJDB 2NU2E 1AFQC 8LPRA 2W3KA 1SMFE 5H4IB 1FMGA 1KDQA 3Q3KA 1J9CH 1P3CA 2HALA 2QA9E 1SBWA 1EAXA 3RLYH 5ABWA 4H6TA 2RA3A 1PPFE 1TABE 1K1JA 1C1VH 3SO3A 2G00A 3P8GA 1P02A 1DANH 2ZFTA 1YCPM 1IHTH 1O3GA 3KYFA 4WMFA 1N1LA 1TPSA 2BD2A 3JZ2B 1QL9A 1ELAA 1UJ1A 1DY8A 3H5CB 3P92A 1C9TA 3F0PA 3BG8A 3OFND 4A6LA 1QIXB 1TGBA 4F55A 3RXGA 1MH0A 3T2NA 2F9PA 3SQEE 1RIWB 1G30B 1C5PA 5FAHA 1K1MA 3QWCH 1O2SA 1DWDH 3M3SA 1KLJH 4FUFA 2AEIH 1TQ0B 1TBZH 1UVOA 2XBWA 3SUEA 1YC0A 1TNKA 2XYAA 1TPAE 2XRCA 3MI4A 4LZ4B 2J5UA 4YOJA 4GHQA 1WUNH 2EY4C 5G4BA 1GHAG 1DLEA 3LGTA 3MU4A 3TJUA 1TMBH 1ESAA 4HGCA 2GV7A 3SN8A 3FVFB 3LONA 1AB9B 4Q80A 1C2IA 1GBJA 1JXPA 3RMMH 3M5LA 3PMHB 5DG6A 1DXPA 4WMEA 3RXTA 2DE8A 1E38B 2H9EH 1ZTLA 3SOSA 2Z9LA 4YESB 2Y81A 2ILNA 4D7FA 1GBTA 1GCTC 3SJ9A 3QX5H 1S6LA 4X6OA 3SW2B 1NFXA 1WU1A 2OUAA 4H4FA 1GI1A 3MMGA 3BIUH 5JBTA 1GGDC 2H5CA 3ZZDA 2TGPZ 4Q4LA 2R2WU 1MBQA 1O32A 2KAIB 1UTMA 2WPJS 2I6QA 1DPOA 3SGQE 1SG8B 2Y5GA 4I8KA 4UFEH 1MD8A 3F9EA 1YPHE 2ZEBA 2ZGBH 1DY9A 1SGQE 3CS7A 1O2TA 2ZO3H 5FXLA 3EQ0H 1MTVA 4WF8A 1V2WT 4JZFH 1AVWA 5DP6A 3SJOA 2Z9IA 3U8RH 4ACBA 1PPZA 1S85A 3KGPA 1CVWH 1GBCA 4Y0ZE 2RDEA 3RXJA 5C5NA 1SLWB 3TNSA 1FZZA 1ELFA 1G32B 3O8RA 4H6SB 1O37A 1QB1A 2OXSA 1QA0A 3GYLB 1HAIH 1L0ZA 1BBRE 3BSQA 7GCHF 2PUXB 1EZUC 3DFLA 1GI9B 4O03A 1D9IA 2B5TB 2BDIA 4IMZA 4WH8A 3UFAA 3RXPA 2L6OA 3KHVA 5J4SA 2GDDA 1BTPA 4DVAU 4X1SU 3M7QA 2ZQ1A 1EZQA 2JIZD 8GCHF 4AFQA 1P0SH 2BY9X 3GY8A 2VVVA 1NU7B 1DSTA 3VGCC 4TWYA 4FUIA 5T3HA 3BTWE 4X8VH 1XUGA 5A2MH 3TGIE 3PTBA 3B8JA 5JBCS 5KECA 1AUTC 6CHAC 1FJSA 2IN2A 1GHZA 3U69H 2F9BH 3PO1B 1G37A 4WY3A 1GMCF 4AB8A 1BTZA 4AC9A 2FI4E 2XCFA 1SQRA 1CT2E 1SFIA 4CREA 1ZGVA 1EOJA 1BTHH 1H8HD 1GHBF 2V7QD 1H9IE 1E34B 4BAQB 1TX8A 2TGDA 3QGNB 1WBGB 1ZJDA 3BN9A 2OK5A 4NWKA 1BB0B 4TT3D 1AGJA 1AUJA 1EB2A 1UK4A 2J94A 4E05H 8ESTE 9ESTA 4AOQA 2ZP0H 1LKBA 1TRMA 3VEQB 2YMSC 4UFDH 1TPOA 1FY5A 4Y11E 3SJIA 3MH6A 2HVYB 1C1RA 1YPHC 1TFXA 3PMJA 1HAVB 1QHRB 1JBUH 3UQVA 5L6NH 3LDXH 1W2KH 1S83A 3A7YA 1O2MA 2C8WB 4Y8ZA 1YYY1 1QQUA 2AGIX 1ELVA 1O2WA 1CA0C 3GY2A 2EI7A 3LJJA 1BJVA 3STIA 1GHWH 3VXEH 4ABDA 1HAOH 3SGAE 1C5NH 1QRZA 1YPGH 3LH1A 3MQKC 1ELGA 3NRLA 2VJ1A 5L30H 4LZ1H 3A85A 3RMOH 2VWOA 3V13A 1MUEB 1JOUB 3T29A 3P70B 1C4V2 1UVSH 2VH0A 1V2ST 2V3HH 2VGCC 1ANDA 1NRPH 1ZMLA 1O38A 2PKAA 3E6PH 2O8MA 4INHA 4MPUA 2JJ1D 4OS6A 3RDZA 5I25A 1KMHB 3VXFH 2F9OA 1C5LH 3RC4A 1HB0B 1LVBA 3GY3A 3SNAA 3BEUA 1ZTKA 2ZNKH 3PB1E 1C5VA 3UNQA 2EEKA 2OC0A 3QDZB 2ZCHP 3EDXB 1XM1A 3NK8A 1ZGIA 5FPSA 1GDNA 2BQWB 2LP6A 1LMWB 5FPTA 4X8UH 4BTIB 1O35A 2IPHA 3Q3XA 3D65E 1LHCH 4Z6AH 1DSUA 2QAAA 3BTEE 3H7OA 1UTLM 1EAWA 3VG8A 3SZEA 3QUMP 2ZU4A 3W94A 1WSSH 3BTME 2Q1JA 1CHGA 2VVCA 4ZKNU 1Q31A 1Z71A 3RM2H 1SQAA 2WINI 1JRTA 3BTDE 1VCQA 1PQ8A 2XOKD 2Y7ZA 3OY6U 1C1UH 1C5TA 2JKHA 2NWNA 2STBE 4YLQH 3PRBA 1FPCH 1S82A 1GMDF 1BRCE 1V2LT 3A8BA 3ATMA 3MNBA 4OS5A 1PPGE 4CRDA 1GJ8B 2ANYA 5IK2D 3E16B 4ZKOU 1SPJA 2HLCA 1LPGB 3TH3H 1Z6JH 1G9IE 4I31A 3A7ZA 5GIBA 1GJBB 3SV8A 2UUFB 1O3OA 2EC9H 5EU8A 2FM2A 2VU8E 2FOMB 1HLTH 1LVOA 1O39A 3ZZ7A 1PQAA 4I8LA 5A8YA 6ESTA 4D8NA 1XKBC 2WV5A 1QJ1B 4XSKU 4ZROA 3ZZ6A 2Z6BD 3ZV9A 4UFFH 1GDUA 1CQQA 4VGCC 1Z1IA 2Y7XA 1G3BA 3MWIU 2PKAB 2G81E 4TPIZ 3A87A 4ZXYH 2GT7A 1A7SA 2XXLA 1IQFA 1OYTH 1QB6A 4Y6DA 2STAE 2P93A 1DXWA 1J14A 1QL8A 3SV6A 3ATIA 2HVXA 1ESBA 2V35A 3GY4A 1A4WH 3SUDA 1KYNA 2Z94A 4CRBA 1UVUH 2SNWA 4YM9A 3H09A 1LHFH 4I8HA 1YKTA 2ZZUH 1YWUA 1KLIH 3V12A 4MNYA 3MU5A 1GI3A 2UWOA 1PYTD 1CHOG 1SFQB 1ELTA 1F0SA 1S81A 1TLDA 4FOUC 3SYJA 1QNJA 2AERH 1O5GH 3ZZCA 3MO9A 5FBIA 1AN1E 4WJG2 1OP8A 2FYRA 1CT4E 2A4QA 1GHBG 2ZHEH 3MH4A 4ZH8A 2ZGCA 2XC4A 1DICA 3QLPH 3KYGA 3P6ZB 2CV3A 1C1WH 2BHGA 2GKVE 2M5TA 2OLGA 2BD7A 3UB0A 1GJ5H 1GJ6A 3LGIA 1P12E 2BVSH 2JETB 2ZDAH 3OYPA 2H9TH 3LGYA 2K0QA 1ACBE 4MPXA 1N8OB 4LOYH 1GBBA 5FX5A 1GBIA 3KCGH 4Q7XA 2QE7D 4GAWA 1GVLA 3VGCB 5DN6D 2YNAA 1XVOA 2FMJA 1G3EA 2FIRH 3ZZ5A 1AE5A 1QA7A 1A3BH 3EA7A 3VFEA 4BXSA 1DWEH 1QL7A 2GGVB 5C67A 2OP9A 1YPLH 2DUCA 1C5OH 3UPEA 1T4VH 1VCWA 2J98A 4OS4A 2HNTC 3BF6H 2VIQA 1NRNH 1O34A 2JH5D 5GCHG 4KTCA 1N6XA 1SSXA 3H7TA 1GBHA 2A45B 1GL1A 4K5ZA 3RXRA 1NRQH 3LKWA 3BV9B 2AYWA 3M61U 4MPVA 3SU0A 1T32A 1TNLA 4JYUH 3S9CA 2Z3DA 4NSVA 1L4DA 3MYWA 2AS9A 4F4OC 1MTNB 1ZRKA 2FPZA 1K0HA 2UWPA 1TPPA 2FP7B 3SU2A 4X1RU 3OTPA 2R0KA 3FFGA 3KEEA 4NIWA 2FODA 1A1RA 2FX4A 2ZPSA 4OS2A 2OBQA 2ZDMA 3DD2H 1V6DA 1DDJA 1BHXB 1SL3A 1P11E 3GCNA 2TGAA 3MU8A 1S0RA 4XBDA 1S6FA 3SJ8A 4A7IB 1AY6H 1XKAC 2EI6A 5JYIA 2C93B 2FESH 4IC6A 1HJ9A 1G36A 3SU6A 3S7KB 2XBYA 1GI8B 3P8NA 3PYHA 2VBCA 3I77A 3LJOA 4UD9H 2WYJA 3RXDA 2FOGA 2H1UA 1TNGA 1O2ZA 3RXHA 1A0LA 4ISIH 5DP3A 4JZDH 4BXWA 3SNBA 1JIRA 4B6FA 1SR5C 1ID5H 5HIYA 1WTHD 5AVDA 4DJZB 1C1PA 3E1XB 4WXVA 1P9UA 3ODDA 2BLVA 2A7JA 5TCCA 1J16A 1MBMA 4KELA 1K21H 5DP4A 4I8JA 1UTJA 4BAKB 1HAYB 5FBEA 2FI5E 1V2VT 4IMQA 3SZNA 3OEED 1P2MA 4JZIA 3A83A 5E0HA 3MO6A 2QXGA 1TQ7B 5C0UA 4FVBA 3CENA 1XXDA 1WOFA 2A31A 5DP7A 7LPRA 1MAXA 3EA8A 5F6MA 2GP9B 2L74A 1O31A 1O5CB 2BX3A 3ODFA 3P17H 4WWYA 1SGYE 1SQOA 4ZAEA 2G8TA 2ZU1A 1ZMJA 2G51A 3LGUA 4TY6A 3LC5A 3ZVAA 1SGRE 5KEDA 2WV4A 2Y5HA 1O2JA 1S5SA 1BMMH 5EJLA 1UHBA 1KXFA 2FS9A 2FS8A 4K8BA 1OOKB 1GI2A 1HAXB 2O8LA 3MNCA 4U2WA 4HFPB 2PW8H 4YT7H 1BITA 1CU1A 3HKJB 2QY0B 1P2NA 3TK9A 3ATWA 1KDQB 1E35B 4Y10E 4D76A 1FN6A 3SV2H 1GHYH 1AFEH 2DE9A 1TIOA 2WPIS 2FWWA 3UTUH 4YO9A 3TH2H 1ELDE 2WPMS 1ZPCA 1GI0A 2TRMA 5FL7D 1SGNE 4WMDA 3L3TA 1C1OA 1O2RA 5HGGA 2PV9B 1EKBB 1GGDB 1DT2A 2BLWA 1BDAA 2F91A 4IS5A 2HNTE 1AD8H 2Z9JA 1D6RA 2Z3CA 4CRCA 1GHAF 1QURH 1RTLA 2ZCLP 3OY5U 2CHAB 2G55A 5CHAC 4I8GA 2ZHDA 2AGEX 2ODQA 2A7HA 1DS2E 1GL0E 3SGBE 2R3YA 3GOVB 3UR6A 1AI8H 1Z8RA 4WXIA 2A5KA 1PJPA 2XNIA 3ZVDA 2C4FH 1FX0B 3DSOA 1IQNA 3VB7A 1AMHA 2FOAA 3SV7A 2VWMA 2J38A 1BRAA 1W14U 2O9QA 2G52A 4DT4A 2ZFPH 2THFB 3E0PB 3F2GA 1FV9A 1H1BA 3NWUA 4DW2U 3SHCH 4CBOA 1KXDA 1TGSZ 1P3EA 2VIDA 1O5FH 4NA9H 4MNXA 2GZ8A 1B7XB 1EPTC 2TIOA 2QV1A 3UNRA 1QZ8A 2PSXA 3ZZ8A 1MABB 1LTOA 4B2BA 5C3NA 2SGEE 2A2QH 1YGCH 2AHME 1KXCA 4H42U 1C2EA 2J95A 3FN8A 3O8CA 4RKJB 3WWFA 2RG3A 1XUKA 3DFJA 1AQ7A 1CGHA 1UTOA 1EP6A 4X6PA 5GDSH 1Y59T 1DITH 3GDVA 4RT1A 1GMHF 3ZVCA 1WQSA 2OBOA 5BPEA 1ZTJA 2OC1A 2K8IA 4DGJA 2R9PA 4I7YH 4NGAH 3Q00A 1O3EA 2BZ6H 1S0QA 1OP0A 2XTTB 1OS8A 1YPEH 3A84A 3RLWH 1K28D 2D26C 2J97A 1QBOA 2ZPQA 1SGDE 4CH8B 2ZF0H 2SGDE 2HGTH 3BEIB 5F8XA 1KIGH 1ELBA 1P9SA 1T8OA 1TOMH 3T25A 1O2KA 1GI6A 1Q2WA 2TBSA 1HDTH 5K7RA 1O3LA 4ISHH 1ESTA 3RXQA 4A92A 2YMSD 4YTAA 3ZZ9A 3L33A 1XUHA 2ZPRA 1UTPA 1TRNA 1BIOA 2PR3A 2UUJB 3F2HA 1TOCB 2I6SA 3BG4C 1BMLA 4XDEA 1IQMA 2Y6TA 1C1TA 2VIPA 5EGMA 1P2QA 1W0YH 3UOUA 1CO7E 1V2JT 2NU1E 3SI3H 4HTCH 1V2KT 5E0GA 2AH4X 2AMPA 2TGTA 4MNVA 1O3MA 2LELA 3F0OA 1FY4A 4JCNA 5GXPA 4JYTA 1YP9A 1GVKB 1U6QA 4FXGH 1F7ZA 1SLXB 2GJGA 1AO5A 1ZRBA 4TWWA 3RXCA 2XW9A 5EOKA 4INLA 2P8OC 1N8OC 3PV5A 3PRDA 1O2GH 1BHXF 2ODYB 4I33A 3RXSA 3F9GA 1GG6B 4GUXA 4GSOA 1MMJN 5AHGH 1HV7A 2ALVA 3BTTE 1Y8TA 4K2YA 4NIYA 1C1MA 1FXYA 4X8SH 1TRYA 1O3BA 3VPKA 1ETRH 2OTVA 2NU0E 3KN2A 3OU0A 2YNBA 1Z8JB 4X6NA 1NBME 3PWBA 2C90B 3MFJA 1EOLA 2OINA 1XUIA 2ZECA 1K1NA 2WPHS 3A7XA 3LC3A 3UAIC 1BQYA 2VH6A 4BTTB 1NTPA 4DCDA 1TGCA 4CHAC 1YM0A 3ZIAD 2ZDVH 3K9XB 1SOZA 3M5NA 2BDYA 5C94A 3KIDU 1HAVA 1EAUA 3AAVA 3F3BA 4AG2A 1EASA 1IQEA 3GCHB 4P02A 4AZ2B 2AMQA 1O3NA 3K2UA 4THNH 4ABFA 1NU9A 1C4Y2 1WQVH 2ZU5A 1ORFA 3IWMA 3V7TA 1TNHA 3GCTG 5DGJA 4JK6A 3PO1C 1EUFA 1SGIB 2XBXA 1LQDB 1BT7A 2BD3A 1LVYA 4M7GA 5F53A 2AGGX 1FY3A 1C2LA 5ESTE 1AVXA 3QO6A 3FZZA 4BAOB 4JZEH 3QZQA 4ZHAA 1THSH 1A46H 1RXPA 5T6DA 1RD3B 1MQ6A 4TYDA 5LGOA 1O2XA 1C2FA 1KSNA 4R0IA 4X8TH 4FETA 1IQGA 3SU1A 1OHHD 1ZZZA 3D62A 1P06A 3Q3YA 3TGJE 6CHAB 6GCHG 1AZ8A 5B6LA 2ZFQH 3WW7A 1UHBB 1QCPA 5JDUB 3A7TA 1XX9A 4ESTE 1BUIA 4NWLA 1UVTH 2P59A 1SLUB 1TMTH 1TALA 4E7RG 1FONA 1TNIA 3PLPA 3TJOA 3RP2A 1O36A 1YCPK 1O3HA 1UCYE 4B2AA 1ANEA 1OKXA 1HPGA 1HCGA 3U1IB 2A4RA 2FEQH 4ABGA 1TGNA 3AAUA 1AU8A 1C5XB 1C5WB 2QN5T 4WH6A 3UR9A 1FIWA 4F48B 1B5GH 1L2EA 2ZU2A 4XRNA 4ASUD 5DP8A 1Z8IB 1NT1A 5T1VA 1W7XH 4X2VA 2SNVA 3SQHE 1BBRH 5EPYA 2QXHA 3WY8A 4AFSA 4BNRA 4YOIA 2OC7A 3AK5A 2V0BA 2GVFA 2W26A 2D1JA 1SGPE 1RRKA 1A2CH 2QCYA 2C8YB 1NO9H 5C17A 3STJA 3U98H 4CRFA 1A0JA 1WYKA 2P95A 3UY9A 3FP7E 4UE7H 3MTYA 1HAHH 3V0XA 4FUCA 3ZZAA 1L1GA 2BXUH 2CGAA 4J2YB 2KAIA 4CR9A 1COWD 1EPTB 1SGFG 3RXFA 4XFQA 5LPFA 3KL6A 5DSFA 1T8LA 2J34A 1C5QA 1GBAA 1TONA 5JB9S 1UO6A 1O3JA 2PFEA 4A1VA 3E91A 2A4OA 2A32A 4KKDA 3A8DA 4NFFA 4B6EA 4P00A 2HPQH 2BVRH 3CP7A 4MVNA 2R2MB 2EA3A 4CR5A 1LVMA 3MH5A 3F9HA 2GD4B 3HGPA 3E3TA 4I86A 2ZFSA 5C0TA 4GCHF 4RSPA 1K22H 1THPB 3DSGA 3EE7A 5GJ4B 4K69A 2BD4A 1EFRD 4AORA 1NRRH 1OWKA 1HNEE 1EP5A 1HJAC 4Q2KA 1O2YA 4AGJA 1S84A 3RM0H 3BG4B 1ZSJA 2A1DB 7GCHG 1NZQH 1H8IH 2CK3D 1MU8B 3M7TA 4B75A 2G4TA 2FX6A 3LGVA 4TSFD 1CT0E 2H2ZA 3PMBB 2WUCA 1O30A 2HNTF 1MKXH 3OTJE 3O8BA 3M36A 4X2YA 4AYVB 1GCDA 1OWHA 1A3EH 3QGJA 1C5SA 1P09A 2OD3B 1YLNA 3F2FA 4A5TS 1BTWA 1EZSC 1K1PA 4U32A 3EAJA 4X1NU 2EQNA 1HAGE 1GG6C 1NBMD 1DUEA 2O8UA 1MU6B 1OWJA 2BDHA 3UQOA 1W0JD 1SGEE 1VZQH 1FI8A 2PP6A 3UIRA 1C1SA 4ABIA 1PQ5A 3RXMA 2F4LA 3T27A 2LPRA 2FOCA 4FU9A 1AIXH 5A8ZA 1TA2A 1EPTA 1NESE 1O2OA 4QT8C 2RDLA 5CHAB 1L1NA 2ZHWH 2ZDNA 3LU9B 1NC6A 4ZKRU 4HI3A 2A7CA 5CHBA 2FOEA 4HG6A 2FI3E 3SORA 4ASHA 1C2HA 2W6JD 4Q7ZA 2VB0A 1LDTT 1BMNH 1A5GH 2QGRA 3HK6B 2JJ2D 2IOTA 1QRXA 2Q6FA 4UONA 1SKYE 1Z8GA 4Z1MD 1DOJA 3Q77A 4A1TA 3P95A 2RA0A 3SUGA 1BTYA 2OQ5A 4Y71A 1O5DH 1BOQA 5EJ1A 1OWDA 1CGIE 2VWLA 3E90B 1G2MA 1YPKH 4B2CA 2ZTZA 1C2MA 1LPZB 1A61H 2ZC9H 3PMAB 1QB9A 3NPSA 2ANKH 5DO4H 4D9RA 5HYOA 3ZVEA 2G5VA 3A82A 1O3KA 3GS9A 3T5FH 2BMGB 1P57B 2BD9A 1G3CA 1XXFA 1MKWH 5LH8A 1TX6A 4RI0A 2BY7X 1P04A 1NPMA 1O33A 1VITF 2ALPA 4BAMB 3FZDA 4A1XA 4FUBA 1O2UA 2GV6A 5C2ZA 2BZAA 4GCHG 1OYQA 1HJAB 3N7DA 2GCTC 2QF4A 5LPEA 1LCYA 3ZV8A 1AVGH 4B74A 3NUMA 1UCYK 5FCRA 1GJ7B 5HIZA 1FAXA 2ZWLH 3BTGE 3ELAH 1LHEH 5HM9A 1QRWA 3CNRA 1GBEA 1O2PA 2KM0A 3IITA 2GT8A 4Y0YE 1H8ED 2ESTE 1NFYA 1TMUH 1HAZB 1MKXK 4D7GA 2F9NA 1IHSH 2ZFFH 1V2RT 4O3TA 1V2PT 1UTNA 3P8FA 2ODPA 1V3XA 3URCA 4ZCNA 4TPYA 4F49A 2FOFA 5FX6A 3G01A 1O3AA 3GDUA 3GY7A 3PWCA 1QTFA 1T8NA 3UNSA 1EQ9A 1SVPA 1YPJH 2KX4A 4IN1A 2Q6GA 3S0NA 3SI4H 3FP6E 4ABAA 1E36B 1O3DA 4MDSA 1GI5A 2FXRA 2GCHF 1TYNA 4KP0A 5GWZA 2ZTXA 2C8XB 1O0DH 8KME2 1VITG 4NA8A 3IG6B 1C9PA 1W3CA 2WV9A 1VR1H 2Z3EA 2WUBA 2KR7A 1N6YA 1RJXB 2GMTC 3GCTF 1IQHA 1V2UT 2HRVA 3U1JB 3RXLA 2F3CE 1JRSA 3ATKA 2PUQH 4Y7AA 1P2JA 2A2XH 1UW7A 4K3JA 3D49H 3NZIA 1GBMA 2PHBA 4FUEA 1PPHE 1O2LA 1TBQH 3UWIA 4VGCB 1F5RA 3QK1A 2ZA5A 3RC6A 1C5YB 1EJNA 2GCHG 1H9HE 3HATH 1Y3YA 1AHTH 1FQ3A 2AFQB 3SJKA 1E37B 3ZZ3A 2F9VA 3W1EA 3S9AA 1LQEA 3RXUA 5HKKD 3P8OA 1O2VA 4CRGA 3GYMA 2CJIA 3DSPA 3FAOA 2P3UB 1RGQA 2WHXA 2ZGHA 3GY6A 2Y80A 2VNTA 3RXBA 1ARBA 2BDCA 1DLKB 3SU4A 1P03A 1YLDA 5JBAS 1GI4A 3BTKE 4RN6A 1D4PB 1SB1H 1MZAA 1AKSA 4IN2A 5F8ZA 2Q6DA 3K6YA 1KTTB 3MOCA 5AFZH 2LNCA 3M5MA 5E2OA 2ZIQH 3BIVH 1C2GA 5EXMA 4NFEA 3LOXA 4FU8A 3DCLA 1O2QA 4FUDA 3UOPA 4DIIH 4E06H 2ULLA 1XVMA 5C1YA 3TK5A 5HXFA 2QF3A 5SGAE 2GMTB 5F03A 1E1QD 1C5ZB 1J8AA 1K1IA 3FANA 2SGQE 3UWJH 1V2QT 4WVPE 1ZPBA 1F5LA 1FLEE 4HZHA 5EPNA 1NRSH 2A5IA 1RFNA 2BYAX 5DP5A 4NZLA 3SNEA 4MLFB 1EXFA 3ZYDA 4GHTA 4INKA 1YCPH 2B0FA 1RTFB 1FN8A 4ZMAH 3RXAA 3V3MA 1F2SE 1C2KA 1MCTA 1SLVB 2FTLE 2HOBA 2ZHQH 2HPPH 1NFWA 4NG9H 1ABJH 1IQKA 1WDIA 1MTSA 2M2AA 1CHOF 2ZG0H 1GHXH 1QJ6B 4JZ1A 5TCAA 1W7GH 2NU3E 3SUFA 5LPRA 1C2JA 3OX7U 3PLBA 1D3QB 2XWBI 1LKAA 5TJXA 5L2ZH 2O8WA 2F9UA 1TX7A 2BLOA 2WYGA 4DY7B 3SU3A 2BD8A 3PROA 1W0KD 2BOHB 2J92A 7ESTE 1ETSH 1K9OE 5GCHF 1MTNC 1OWIA 1GCTB 1C1QA 3RU4E 4BAHB 2SGAA 2CF9H 1YY3A 3MNSA 1BMAA 1UCYH 4AX9H 1PPCE 1JWTA 3U8TH 1L1JA 1TBRH 1H9LB 1H8DH 2ZDKA 5K0HA 2ZFRH 1X7AC 4CRAA 1SQTA 4CBNA 4UFGH 1ZR0A 4BOHA 1GBDA 4OGXA 2W6ID 2XC5A 2KFWA 1DUAA 3SHAH 5DK1A 3U9AH 3NCLA 2ASUB 4IC5A 2OCVB 1V2TT 3A80A 1HGTH 1ZJKA 4NZQA 2BLQA 1DX5M 3EE0B 2P16A 4ZUHA 1P2OA 5CDFE 2Z9KA 1DFPA 1ZLRA 2B7DH 3ESTA 4AYYB 5EXLA 5HMAA 2B8OH 1O3IA 5CMXH 1P10A 4OS1A 2CXVA 1TNJA 3K65B 3U28C 1DWCH 5T6GA 2R3UA 1UTQA 5C1UA 2RCEA 3RU4T 3BTFE 1HIAB 1C5MD 2VWNA 3MNXA 4RT0A 1DWBH 2UWLA 3TJNA 4FVDA 1QGFA 3AASA 3DA9B 5AF9H 2J4IA 2AIPA 2G5NA 1ZOMA 1AZZA 5EG4A 3MH7A 2KCAA 2ZCKP 1MKWK 5GNDA 7KMEH 1FNIA 5GPIB 3TGKE 4UEHH 1TWXB 1B0EA 1GMHG 1E1RD 3S69A 3PV4A 2QF0A 4MG3A 2J98B 1H4WA 3M5OA 1ZMNA 1GMDG 2P94A 5EIYA 4B71A 5IDKA 1IOEA 3GICB 2FZZA 5EW2H 4DG4A 2ZDLA 4GPGA 1TGTA 4AN7A 1D3TB 2Z9GA 3QTOH 3L6PA 3ZZ4A 3B9FH 3F6UH 2EI8A 1O2IA 1P05A 1BTUA 3D23A 4TY7A 2BD5A 5J4QA 2D8WA 2KCYA 3DHKH 2Y5FA 3C27B 2KZ4A 2G4UA 1GPZA 1KXEA 1MQ5A 3JZ1B 3LT3A 1HJ8A 1TB6H 1VGCC 3LPRA 2XWAA 2QIQA 2XC0A 1SOTA 1VJAU 3M7UA 4MTBA 1FY1A 4J1YA 2ANMH 4ISLA 1NN6A 3A8CA 4IGDA 2PWXA 3T62A 1F0UA 1GDQA 5L2YH 1KTSB 1ABIH 1ARCA 1AE8H 3I78A 2F43B 1E0FD 1UK2A 3KQCA 1C5RA 1VKYA 4O97A 1MTWA 3U8OH 1T31A 3A7VA 3TVJB 3DT0H 4YZUA 1ZSKA 2PGQB 4BANB 4M9FA 1YBWA 4D9QA 1CBWC 2VVUA 1EATA 3LH3A 1ZYOA 4ISOA 3PTNA 5ESBA 2J9NA 2FDAA 3TIUA 4ABJA 3M37A 2VGCB 3TH4H 1AB9C 1VGCB 2P3TB 2SGFE 2H5DA 1ANBA 4XBCA 3TITA 3TJVA 1O2HA 4NIXA 1O3PB 4NCYA 5C20A 3RXOA 1C4U2 4AB9A 5CE1A 3PV2A 4K1EA 1TE0A 5EODA 3HPTB 1FIZA 1PYTC 1Y5BT 1BMFD 1J17T 2QXIA 1QR3E 1INCA 1TA6A 2NU4E 1LO6A 3RXKA 1F0TA 9LPRA 1F5KU 3A86A 1Y3XA 2GTBA 1NFUA 1QBVH 3AW0A 1UVPA 6LPRA 3QTVH 1T8MA 1ZHMA 3MU1A 3RUOA 3ATLA 3T26A 5B6OA 1V2OT 2PKSB 4SGBE 4DURA 1GJ9B 3M3VA 2WPKS 4Q63A 1OSSA 1UK3A 1WAYB 4O9VA 1XMNB 4KTSA 2BM2A 5C1XA 3ITIA 1MAYA 2UUKB 2ZHFH 3M35A 1NROH 3Q76A 2BB4A 3E0NB 1SI5H 1CSOE 1DM4B 1KXAA 1BRBE 1OXGA 2KCOA 1YPMH 2BQ7B 5BRRE 2WZQA 2KCPA 3I29A 1O5BB 1P01A 8GCHG 2QYIA 4OGYA 2BQ6B 1PFXC 4FUHA 5DJ7A 4B73A 4Z0KA 5ETXA 2FOBA 2W7UA 4O3UA 1K1LA 3MHWU 1GBLA 4OS7A 3TPIZ 4AGKA 2CN0H 1B0FA 5EXNA 1FDPA 3SU5A 5DP9A 5E0JA 1GHVH 5JB8S 1BJUA 3CS0A 2B9LA 4DOQA 1J15A 5A09A 1SHYA 1WV7H 4DT7B 1OPHB 2QC2A 5EQSA 5I46H 1HBTH 3LIWA 4IBLH 5FPYA 3ENSB 4ISNA 1OP2A 1VCPA 1O3CA 1CA0B 1HIAA 1O3FA 1FPHH 5FHTA 2W7SA 2F83A 3N7EA 2A4GA
chains in the Genus database with same CATH topology
3SNCA 2XCNA 1JIMA 2BX4A 4DIHH 1W8BH 1D3DB 2GZ7A 3NKKA 1Y5AT 1GJCB 2XBVA 1THRH 4RKOB 4Y8XA 2FLBH 4X1QU 2FYQA 1QJ7B 2AMDA 1O2NA 1OWEA 1V2NT 1V2MT 1BRUP 1LHDH 4FUJA 2CF8H 3A89A 3KQDA 1Z1JA 1HAPH 4Y76A 1MCVA 3BTQE 2GX4A 1RIWC 3BEFB 1RS0A 2A0QB 1KY9A 2VIVA 4K1TA 1BA8B 4LXBH 3URDA 4X2XA 3RMNH 1D6WA 1W0ZU 1Y3VA 1NM6A 2GCTB 1CE5A 3GISB 1GJ4H 1JMOH 3VB3A 2A5AA 1IQIA 1ELCA 2TPIZ 4MPWA 1LPKB 1HYLA 1QY6A 2FTMA 1T4UH 3UUZA 3KF2A 3AW1A 2GZ9A 4NA7A 1T7CA 5A8XA 3EYDA 3EGKH 1C5UA 2V3OH 3M3TA 1Z7KA 2ANWA 3GY5A 1GBFA 1BCUH 1EZXC 2BTCE 2BVXH 2CHAC 1ZPZA 3ZVFA 1SGFA 2JH6D 4YOGA 2PSYA 4JYVH 2VIOA 1EX3A 4CH2B 1GWAA 4Y8YA 3QZRA 1Y5UT 1G2LA 2K1QA 3EA9A 3NXPA 1VITH 4MQAA 2GDEH 4FUGA 2BDAA 4XE4A 4Y7BA 3RC5A 2BY6X 1SGTA 3KQEA 4K1SA 4ZHLU 1XUJA 4ABHA 1XUFA 2ZTYA 1W13U 1YLCA 2SFAA 1NY22 5JPMH 1W12U 2ZGXH 3GCOA 1EAIA 1HRTH 1WTGH 1L4ZA 1QBNA 6GCHF 1SC8U 5EW1H 3A7WA 4K8YA 1IQJA 1VJ9U 4U01A 3VB4A 5F8TA 1UMAH 3A88A 4ZKSU 4XBBA 4E7NA 1ELEE 5PTPA 3QN7A 5A0CA 2FOHA 2CMYA 1MTUA 2V6NA 2W3IA 2H6MA 4ABEA 4X0WU 1RTKA 2Y82A 2J2UA 3PLKA 1GBKA 3SBKA 2QXJA 1D3PB 2W5EA 3KQBA 4XOJA 3MU0A 3UREA 2IJOB 1ZHRA 1ANCA 4K60A 3VB5A 1C1NA 2ZKSA 2HWLB 2C3SA 2P3FH 3A81A 1F0RA 3B23B 1HXFH 5EQQA 1GVZA 5C5OA 1BZXE 1FAKH 5E8EH 1MZDA 2BDGA 1P2IA 2PGBB 1O5EH 4FU7A 1AWHB 2JH0D 1AKSB 4X6MA 2BY8X 5DKMA 2Z7FE 2PTNA 3ZYEA 3KNXA 4IW4E 1Q3XA 3TK6A 1A5IA 3RXVA 4ABBA 4MNWA 4JK5A 1KXBA 2ZU3A 4I32A 2BY5X 4PROA 3PM3A 1K2I1 4KGAA 4ZHMU 5E2PA 2VIWA 4GLYA 4X2WA 1ETTH 1G3DA 4KTUA 2ZGJA 3BTHE 1W10U 3LGWA 4BTUB 1OX1A 2JETC 5A0AE 4Q7YA 1QFKH 4JMYA 1FY8E 1A5HA 3N7OA 1CBWB 1O5AB 3HKIB 5T6FA 3E8LA 4R8TB 4U30A 3RXIA 3A8AA 1LHGH 3O8DA 4NIVA 1ZSLA 1A0HB 2OQUA 1HXEH 3OSYA 2WPLS 1AFQB 2PKSC 2OC8A 2O8TA 4NSYA 2FO9A 3SNDA 1M9UA 3F68H 4LK4A 2H9HA 3RU4D 3VB6A 2P8OB 3F1SB 4SGAE 4AFUA 1Z6EA 1MD7A 1Y3UA 3TNTA 3RMLH 1CA8B 3RXEA 1PPBH 3ZVBA 3ZZBA 4B76A 3DUXH 1EB1H 1WCZA 1Y3WA 4ZXXH 3TLOA 1F92A 2C8ZB 1EJAA 1ZHPA 3FP8E 3C1KA 1NS3A 3K6ZA 1GMCG 2PTCE 3GCHC 3GDSA 1BBRK 3S9BA 2ZQ2A 1GI7B 5EQRA 3AVZA 4X1PU 4Y79A 5IYTA 2FLRH 1S6HA 1K1OA 1DE7H 3R0FA 3HGNA 2ZI2H 2SGPE 1PQ7A 1P2KA 2AIQA 2BXTH 1FUJA 4CHAB 1YF4A 1QQ4A 1TAWA 5AFYH 5DPAA 1C2DA 3HK3B 3SV9A 3TU7H 1GJAB 3ZVGA 2YOLA 1IQLA 1HUTH 4UDWH 1UTKA 1EJMA 1HFDA 1PPEE 1SGCA 1BTXA 4B1TA 5A0BA 5HM2A 2VINA 1DVAH 4GVUA 3F9FA 1P8VC 4AFZA 3W95A 3R3GB 1CGJE 3S7HB 1W11U 2PLXA 2R0LA 2BOKA 5FCKA 3T28A 1AWFH 3MO3A 1IAUA 2D2DA 2BDBA 5JBBS 1SHHB 2UUYA 4YLUA 1KLTA 4YT6H 4AG1A 1GJDB 2NU2E 1AFQC 8LPRA 2W3KA 1SMFE 5H4IB 1FMGA 1KDQA 3Q3KA 1J9CH 1P3CA 2HALA 2QA9E 1SBWA 1EAXA 3RLYH 5ABWA 4H6TA 2RA3A 1PPFE 1TABE 1K1JA 1C1VH 3SO3A 2G00A 3P8GA 1P02A 1DANH 2ZFTA 1YCPM 1IHTH 1O3GA 4WMFA 1N1LA 1TPSA 2BD2A 3JZ2B 1QL9A 1ELAA 1UJ1A 1DY8A 3H5CB 3P92A 1C9TA 3BG8A 4A6LA 1QIXB 1TGBA 3RXGA 1MH0A 3T2NA 2F9PA 3SQEE 1RIWB 1G30B 1C5PA 5FAHA 1K1MA 3QWCH 1O2SA 1DWDH 3M3SA 1KLJH 4FUFA 2AEIH 1TQ0B 1TBZH 1UVOA 2XBWA 3SUEA 2XYAA 1TNKA 1YC0A 1TPAE 2XRCA 3MI4A 4LZ4B 4YOJA 4GHQA 1WUNH 5G4BA 1GHAG 1DLEA 3LGTA 3MU4A 3TJUA 1TMBH 1ESAA 4HGCA 2GV7A 3SN8A 3FVFB 3LONA 1AB9B 4Q80A 1C2IA 1GBJA 1JXPA 3RMMH 3M5LA 3PMHB 5DG6A 1DXPA 4WMEA 3RXTA 2DE8A 1E38B 2H9EH 1ZTLA 3SOSA 2Z9LA 4YESB 2Y81A 2ILNA 4D7FA 1GBTA 1GCTC 3SJ9A 3QX5H 4X6OA 3SW2B 1NFXA 1WU1A 2OUAA 4H4FA 1GI1A 3MMGA 3BIUH 5JBTA 1GGDC 2H5CA 3ZZDA 2TGPZ 2R2WU 1MBQA 1O32A 2KAIB 1UTMA 2WPJS 2I6QA 1DPOA 3SGQE 1SG8B 2Y5GA 4I8KA 4UFEH 1MD8A 3F9EA 1YPHE 2ZEBA 2ZGBH 1DY9A 1SGQE 3CS7A 1O2TA 2ZO3H 5FXLA 3EQ0H 1MTVA 4WF8A 1V2WT 4JZFH 1AVWA 5DP6A 3SJOA 2Z9IA 3U8RH 1PPZA 1S85A 3KGPA 1CVWH 1GBCA 4Y0ZE 3RXJA 5C5NA 1SLWB 3TNSA 1FZZA 1ELFA 1G32B 3O8RA 4H6SB 1O37A 1QB1A 2OXSA 1QA0A 3GYLB 1HAIH 1L0ZA 1BBRE 3BSQA 7GCHF 2PUXB 1EZUC 3DFLA 1GI9B 4O03A 1D9IA 2B5TB 2BDIA 4IMZA 4WH8A 3UFAA 3RXPA 3KHVA 5J4SA 2GDDA 1BTPA 4DVAU 4X1SU 3M7QA 2ZQ1A 1EZQA 8GCHF 4AFQA 1P0SH 2BY9X 3GY8A 2VVVA 1NU7B 1DSTA 3VGCC 4TWYA 4FUIA 5T3HA 3BTWE 4X8VH 1XUGA 5A2MH 3TGIE 3PTBA 3B8JA 5JBCS 1AUTC 6CHAC 1FJSA 2IN2A 1GHZA 3U69H 2F9BH 3PO1B 1G37A 4WY3A 1GMCF 4AB8A 1BTZA 2FI4E 2XCFA 1CT2E 1SFIA 4CREA 1ZGVA 1EOJA 1BTHH 1GHBF 1H9IE 1E34B 4BAQB 1TX8A 2TGDA 3QGNB 1WBGB 1ZJDA 3BN9A 4NWKA 1BB0B 1AGJA 1AUJA 1EB2A 1UK4A 2J94A 4E05H 8ESTE 9ESTA 4AOQA 2ZP0H 1LKBA 1TRMA 3VEQB 4UFDH 1TPOA 1FY5A 4Y11E 3SJIA 3MH6A 1C1RA 1YPHC 1TFXA 3PMJA 1HAVB 1QHRB 1JBUH 3UQVA 5L6NH 3LDXH 1W2KH 1S83A 3A7YA 1O2MA 2C8WB 4Y8ZA 1YYY1 1QQUA 2AGIX 1ELVA 1O2WA 1CA0C 3GY2A 2EI7A 3LJJA 1BJVA 3STIA 1GHWH 3VXEH 4ABDA 1HAOH 3SGAE 1C5NH 1QRZA 1YPGH 3LH1A 1ELGA 4LZ1H 2VJ1A 5L30H 3A85A 3RMOH 2VWOA 3V13A 1MUEB 1JOUB 3T29A 3P70B 1C4V2 1UVSH 2VH0A 1V2ST 2V3HH 2VGCC 1ANDA 1NRPH 1ZMLA 1O38A 2PKAA 3E6PH 2O8MA 4INHA 4MPUA 4OS6A 3RDZA 5I25A 3VXFH 2F9OA 1C5LH 3RC4A 1HB0B 1LVBA 3GY3A 3SNAA 3BEUA 1ZTKA 2ZNKH 3PB1E 1C5VA 3UNQA 2EEKA 2OC0A 3QDZB 2ZCHP 3EDXB 1XM1A 3NK8A 1ZGIA 5FPSA 1GDNA 2BQWB 1LMWB 5FPTA 4X8UH 4BTIB 1O35A 2IPHA 3Q3XA 3D65E 1LHCH 4Z6AH 1DSUA 2QAAA 3BTEE 3H7OA 1UTLM 1EAWA 3QUMP 2ZU4A 3W94A 1WSSH 3BTME 2Q1JA 1CHGA 2VVCA 4ZKNU 1Q31A 1Z71A 3RM2H 1SQAA 2WINI 1JRTA 3BTDE 1VCQA 1PQ8A 2Y7ZA 3OY6U 1C1UH 1C5TA 2JKHA 2NWNA 2STBE 4YLQH 1FPCH 1S82A 1GMDF 1BRCE 1V2LT 3A8BA 3ATMA 3MNBA 4OS5A 1PPGE 4CRDA 1GJ8B 2ANYA 3E16B 4ZKOU 1SPJA 2HLCA 1LPGB 3TH3H 1Z6JH 1G9IE 4I31A 3A7ZA 5GIBA 1GJBB 3SV8A 2UUFB 1O3OA 2EC9H 5EU8A 2FM2A 2VU8E 2FOMB 1HLTH 1LVOA 1O39A 3ZZ7A 1PQAA 4I8LA 5A8YA 6ESTA 4D8NA 1XKBC 2WV5A 1QJ1B 4XSKU 4ZROA 3ZZ6A 2Z6BD 3ZV9A 4UFFH 1GDUA 1CQQA 4VGCC 1Z1IA 2Y7XA 1G3BA 3MWIU 2PKAB 2G81E 4TPIZ 3A87A 4ZXYH 2GT7A 1A7SA 2XXLA 1IQFA 1OYTH 1QB6A 4Y6DA 2STAE 2P93A 1DXWA 1J14A 1QL8A 3SV6A 3ATIA 2HVXA 1ESBA 2V35A 3GY4A 1A4WH 3SUDA 1KYNA 2Z94A 4CRBA 1UVUH 2SNWA 4YM9A 1LHFH 4I8HA 1YKTA 2ZZUH 1KLIH 3V12A 4MNYA 3MU5A 1GI3A 2UWOA 1PYTD 1CHOG 1SFQB 1ELTA 1F0SA 1S81A 1TLDA 1QNJA 2AERH 1O5GH 3ZZCA 3MO9A 5FBIA 1AN1E 4WJG2 1OP8A 2FYRA 1CT4E 2A4QA 1GHBG 2ZHEH 3MH4A 4ZH8A 2ZGCA 2XC4A 1DICA 3QLPH 3P6ZB 2CV3A 1C1WH 2BHGA 2GKVE 2M5TA 2OLGA 2BD7A 1GJ5H 1GJ6A 3LGIA 1P12E 2BVSH 2JETB 2ZDAH 3OYPA 2H9TH 3LGYA 1ACBE 4MPXA 1N8OB 4LOYH 1GBBA 5FX5A 1GBIA 3KCGH 4Q7XA 4GAWA 1GVLA 3VGCB 2YNAA 1XVOA 2FMJA 1G3EA 2FIRH 3ZZ5A 1AE5A 1QA7A 1A3BH 3EA7A 3VFEA 4BXSA 1DWEH 1QL7A 2GGVB 5C67A 2OP9A 1YPLH 2DUCA 1C5OH 3UPEA 1T4VH 1VCWA 4OS4A 2HNTC 3BF6H 2VIQA 1NRNH 1O34A 2JH5D 5GCHG 4KTCA 1N6XA 1SSXA 3H7TA 1GBHA 2A45B 1GL1A 4K5ZA 3RXRA 1NRQH 3LKWA 3BV9B 2AYWA 3M61U 4MPVA 3SU0A 1T32A 1TNLA 4JYUH 3S9CA 2Z3DA 4NSVA 1L4DA 3MYWA 2AS9A 4F4OC 1MTNB 1ZRKA 2FPZA 2UWPA 1TPPA 2FP7B 3SU2A 4X1RU 2R0KA 3FFGA 3KEEA 4NIWA 2FODA 1A1RA 2FX4A 2ZPSA 4OS2A 2OBQA 2ZDMA 3DD2H 1V6DA 1DDJA 1BHXB 1SL3A 1P11E 3GCNA 2TGAA 3MU8A 1S0RA 4XBDA 1S6FA 3SJ8A 4A7IB 1AY6H 1XKAC 2EI6A 5JYIA 2C93B 2FESH 4IC6A 1HJ9A 1G36A 3SU6A 3S7KB 2XBYA 1GI8B 3P8NA 3PYHA 3I77A 3LJOA 4UD9H 2WYJA 3RXDA 2FOGA 2H1UA 1TNGA 1O2ZA 3RXHA 1A0LA 4ISIH 5DP3A 4JZDH 4BXWA 3SNBA 1JIRA 1SR5C 1ID5H 1WTHD 5AVDA 4DJZB 1C1PA 3E1XB 4WXVA 1P9UA 3ODDA 2BLVA 2A7JA 5TCCA 1J16A 1MBMA 4KELA 1K21H 5DP4A 4I8JA 1UTJA 4BAKB 1HAYB 5FBEA 2FI5E 1V2VT 4IMQA 3SZNA 1P2MA 4JZIA 3A83A 5E0HA 3MO6A 2QXGA 1TQ7B 4FVBA 3CENA 1XXDA 1WOFA 2A31A 5DP7A 7LPRA 1MAXA 3EA8A 5F6MA 2GP9B 1O31A 1O5CB 2BX3A 3ODFA 3P17H 4WWYA 1SGYE 1SQOA 4ZAEA 2G8TA 2ZU1A 1ZMJA 2G51A 3LGUA 4TY6A 3LC5A 3ZVAA 1SGRE 2WV4A 2Y5HA 1O2JA 1S5SA 1BMMH 1UHBA 1KXFA 2FS9A 2FS8A 4K8BA 1OOKB 1GI2A 1HAXB 2O8LA 3MNCA 4U2WA 4HFPB 2PW8H 4YT7H 1BITA 1CU1A 3HKJB 2QY0B 1P2NA 3TK9A 3ATWA 1KDQB 1E35B 4Y10E 4D76A 1FN6A 3SV2H 1GHYH 1AFEH 2DE9A 1TIOA 2WPIS 2FWWA 3UTUH 4YO9A 3TH2H 1ELDE 2WPMS 1ZPCA 1GI0A 2TRMA 1SGNE 4WMDA 3L3TA 1C1OA 1O2RA 5HGGA 2PV9B 1EKBB 1GGDB 1DT2A 2BLWA 1BDAA 2F91A 4IS5A 2HNTE 1AD8H 2Z9JA 1D6RA 2Z3CA 4CRCA 1GHAF 1QURH 1RTLA 2ZCLP 3OY5U 2CHAB 2G55A 5CHAC 4I8GA 2ZHDA 2AGEX 2ODQA 2A7HA 1DS2E 1GL0E 3SGBE 2R3YA 3GOVB 3UR6A 1AI8H 1Z8RA 4WXIA 2A5KA 1PJPA 2XNIA 3ZVDA 2C4FH 1IQNA 3VB7A 1AMHA 2FOAA 3SV7A 2VWMA