2GDJA

Delta-62 rada recombinase in complex with amp-pnp and magnesium
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
260
structure length
237
Chain Sequence
GFKSGIDLLKQRSTVWKLSTSSSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEFLFYDEEAVSKGEVAQPKAVYIDTEGTFRPERIMQMAEHAGIDGQTVLDNTFVARAYNSDMQMLFAEKIEDLIQEGNNIKLVVIDSLTSTFRNEYGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVGHAATFRFFVRKGKGDKRVAKLYDSPHLPDAEAIFRITEKGIQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Rad51/RadA N-Terminal Domain Activates Nucleoprotein Filament ATPase Activity.
pubmed doi rcsb
source organism Methanococcus voltae
molecule tags Recombination
molecule keywords DNA repair and recombination protein radA
total genus 85
structure length 237
sequence length 260
ec nomenclature
pdb deposition date 2006-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gdjA00
3MWJA 4PX9A 1HQYE 4YMUA 1S9HA 5FPSA 1K5DA 2EFDB 4PQRA 5AUPB 4JBYA 4DCSA 3T5GA 1XBTA 3KJHA 3LXXA 4EPXA 1UBGA 3ND9A 1N6NA 1FP7A 1YKSA 2QP4A 5FTJA 4NCHA 1TX4B 3ZS9A 4DLTA 3KQHA 1OYWA 3AGPA 4WXPA 1AA9A 3OIUA 3QUSA 3GLHE 2ZTSA 1CR2A 1IXRC 1IHUA 3L0IB 3U7EB 1QRAA 1HV8A 5AUOB 2V55B 2LKDA 1DPFA 2J5XA 3U5ZB 4D82A 1XD9A 5TMPA 1KYIA 2QSZA 2WMNB 3PENA 1G7TA 2D3WA 1F2TA 2ODEA 2G77B 1IY0A 1ZJ6A 3A8TA 5EE1A 1BIFA 5DHFA 1QHHA 4YMVA 2RH5A 1SQ5A 3CZPA 2HUPA 4RD1A 5DIFA 3R20A 2OBMA 1M6NA 2QZ4A 1E2DA 4Z1MA 2XZLA 2A5GA 2VHTA 4MYTA 2FDCA 3CONA 4EJSC 4HSEA 2BV3A 4LJ5A 4XIGS 4Q9KA 2UVQA 1VECA 2VTKA 3CRW1 3QEOA 2QORA 3BBPA 2CVFA 4LJ4A 1OLOA 3QF4A 2J1LA 2BDTA 1ZRHA 4ITRC 4NDZA 4V0MA 3Q72A 2FMXA 2P5TB 3CNNA 2QPTA 4KAXA 1GRQA 4LHVA 4NYJQ 3SFZA 1A4RA 5CJ2A 4D81A 2Z43A 3KTAA 1EXMA 4L9WA 4JKYA 5GJWC 5AJWA 4ESVA 3T1OA 1UEJA 1GL6A 4LCBA 4NYMQ 4BLPA 4KJZA 1E2QA 1KTVA 1JEDA 1W0JA 4B43A 2OXCA 4ARZA 421PA 3KX2A 4Q4JA 2WWWA 1WF3A 1YZUA 3U7HB 4TYPA 3AF0A 2ZRBA 1XCMA 4BLTA 5KSZA 2JLZA 2CJWB 3B1VA 3X1WA 1BYUA 2VHJA 1Z6XA 1YZLA 1WA5A 2P65A 5TVKA 3OAAD 4RVCA 2XZPA 3B1YA 2VH5R 3I73A 4A0FA 1ZC3A 4IOKA 2DY1A 2VP2A 1Z28A 5JS7A 1JNYA 1A2BA 3U3MA 2PJRA 2CMKA 3WXMA 3CPJB 4QKQA 4PHGA 4Q7KA 1Z29A 5TY0A 2F55A 1LTQA 2VSXA 2W6ID 1CU1A 2IBMA 4TTRA 4KITB 3ZD7A 4Q7MB 2C99A 2OFWA 5FTMA 4DUGD 5DE3A 1XDBA 4A9AA 4KYIB 3ZS8A 3SJZA 2ZYUX 2JLSA 4QJ4A 4BFZA 4RZUA 1GP2A 4LZZA 1CULC 3BJIC 4OHZA 4X8LA 3RS4A 3HYTA 4NHOA 2RGAA 3DEFA 2QE7A 3CRRA 5CLLA 4GP7A 4EUNA 3WMGA 3QSYA 1M7HA 5K8LA 1BO6A 2WAYA 2WIBA 1QZXA 3TW4A 2ZUDA 5BYJA 1R0WA 3OFNA 5GADl 1G3RA 3DDCA 2OHFA 2QAGA 2YWGA 1IXSB 1CJMA 3BK7A 4IVQA 3IPYA 1KZ7B 5DH9A 1P9RA 2AR7A 1TEVA 3K70B 2FFAA 4MRRA 3CUEF 5CJPA 1ZMXA 2RHDA 3OIVA 1ELOA 3UPUA 2CCJA 2IX3A 4FIDA 2D62A 4PO9A 4MUAA 3RC8A 1X1RA 4OKSA 1MKYA 1P2TA 3QKSA 2NZ8A 1XF9A 2JLWA 2VHQA 2YNMA 3ECCA 3GLGB 2IF0A 1OV4A 3FHCB 1OT3A 4HLUC 1QG4A 4LJAA 1KOFA 2OG2A 4KHZA 2XSZA 4JIMA 1KO5A 4AY2A 1M2OB 1JQJC 4QRHA 3BORA 2ZJOA 4IOMA 3ZZ0A 1GSIA 2QM7A 4F93B 5B64A 2FFHA 2HT6A 1Z08A 2EW1A 1AKYA 1G9XA 2C96A 2RKOA 4Q1EA 5H8WA 3TVDA 4B33A 5C18A 1F2UB 2XXAB 1NIPA 4LYAA 1U9IA 4IDHA 2AKAB 5KU1A 2CDNA 1T5IA 3A1UA 5JJIA 2HT1A 3VX3A 2GAOA 4KODA 5FL3A 2RGBA 3DOEA 3I1FA 4L4UA 1CRQA 3WHKA 2GF9A 2PL3A 4MYHA 4KFSA 4DCVA 3VX4A 1II0A 1IY2A 3CH5A 3GJ7A 1D6JA 5AR1A 3L8YA 3B9PA 1S3SA 3N2IA 3TE6A 1Z6TA 1M7BA 4IEIA 4PHFA 1MRSA 2OBNA 5KUTA 1VPLA 2IS2A 4ABYA 1E79A 1G5RA 2Q3MA 3OE7A 4WZBE 2X2EA 4TTPA 1EFHA 5FFMA 1IN6A 3Q5DA 1X86B 2QN6A 2GKSA 1W44A 2F6RA 3BH6A 3HWSA 5LPNA 1OXVA 4WZ6A 5EXSA 1U94A 3AVQA 2ZUBA 3FHOA 3UMFA 2RGDA 2BCGY 3GPLA 1XTSA 4Q48A 1EFRA 3ADDA 3R9XA 4RJLA 4BFXA 2O5VA 3PEUA 3VR6A 3TH5A 1F2UA 3DL0A 3O8DA 2PH1A 3EIHA 5JI2E 1YZNA 1E98A 2ZSDA 4QC2A 3WYFA 2RGEA 1GAJA 2A7QA 4LPSA 4JLVA 2G88A 4DVGA 1XPUA 4X8HA 2IWHA 4TT3A 4A8JA 2QG6A 2JLXA 2ZSBA 1SZPA 2J7KA 3LRPA 2OCPA 2WBLC 3LBHA 4XD7D 4EJSA 3U44A 3SDZA 5FBQB 1ZM2A 5KNCA 3EPHA 3FFAA 3X2SA 1MH1A 2JA1A 3M4YA 3MG9A 2D4HA 4A4DA 1FQKA 2ZEJA 1T0HB 4FN5A 4Q18A 5JLJA 4E03A 3PJRA 2QPAA 1K5GA 5EZ5A 5B2ZA 1W0KA 3A58B 3TJZA 1NF3A 2O8FA 2FPMA 3VHLB 4JT2A 4FD2A 4ZCIA 2ZS9A 3E1SA 3TQFA 2ZI7A 1SHKA 2X1VA 2ZRHA 5BN3A 5L8VA 2GA8A 2ZI6A 1VMAA 4XTRA 4XOIA 4B3DA 2ZAOA 3EAQA 4OQLA 1TADA 5AJVB 1II8B 4HI0E 1WE2A 4TMVA 1XFAA 4NP6A 2J41A 4Q4AA 1T4GA 1GWNA 1T9HA 1UF9A 2YINC 5FUXA 1DO0A 1Z22A 1KNQA 3THWA 1VYTA 4AKGA 1JEEA 2ZRKA 3RS3A 5CIQA 4EDHA 5FBWB 4HATA 1R5NA 1E2KA 2BCJQ 5JJLA 1CS4C 3E2IA 4G5QA 2GEUA 1KKMA 2H7VA 4QOSA 1L4UA 3CZQA 4ZCLA 3DVLA 4UJ5A 1F6BA 2QP3A 1WDTA 2RMKA 3GJ6A 4DLUA 1XNJA 4F92B 4LHYA 3A1TA 4RFSB 3TNFA 1G17A 3RWMB 1G3IA 1KDRA 1PLJA 2AXNA 5FL7D 2GVZC 5FPHA 4B3XA 1J8MF 1E69A 3TUZC 4P31A 3U7FB 2Q9AA 2A3RA 1KK0A 2QM8A 1MR3F 4OL0A 3QNUA 4IW3B 4TLAA 2WHXA 3TK1A 2VP4A 1WMSA 1CBUA 4LBZA 3U3JA 3SZRA 2R2AA 3H84A 4JYCA 5FI1B 3AP2A 1P2SA 4PC7A 1AJEA 4PANA 1NG1A 4DLWA 1E2EA 2FNAA 3TUJC 2HEIA 2J7PA 4DB2A 2OILA 2WJIA 3QI2A 2R65A 3VKHA 3U3KA 2RAPA 3DMNA 4M1YA 2XX3A 4Q47A 4QL3A 4G5SA 1U0JA 1P9WA 3OIYA 2ZYVX 3EZ6A 4W5HA 4BWYA 2AKYA 2CLCX 2FSFA 4UXHA 3KTAB 2XEXA 4GFDA 1QHNA 4CEIB 1TF5A 2J46A 3FE2A 5TXGA 4JLKA 2ANBA 3K0EA 2HJGA 1Z0KA 1II8A 4H1VA 5B58C 3PEYA 1AZTA 5TV2A 1P7CA 3LH5A 1EFRD 1K6MA 4HAYA 3LAWA 4NKRA 1RYHA 4XSHA 1VG0B 1E9FA 1X8KA 1KI6B 1D2EA 2NQ2C 4BEBA 4OHYA 4IOJA 1OFHA 4Y0AA 4NYIQ 2W2XA 3MWLA 3QKRB 1E2IA 1ZM3A 1Z63A 2X19A 3L2OB 4RD3A 2FJUA 1QHXA 2Z4SA 3OZXA 2A5JA 2Q9CA 1GITA 1N6KA 2GEDA 2XJ4A 3D3QA 2DFLA 3NDPA 3WRYC 5AJZA 2AK2A 2PX3A 2IUTA 3UANA 3PVSA 1T8TA 4I1OA 3ZZTA 2V4ZA 1XEFA 4OI0A 2BHRA 1ZNWA 3B6EA 2CL7X 2OV2A 3DKVA 4GI7A 4RKFA 5AK0A 3ADBA 3CX6A 4RCZA 4AYXA 2EVWX 3N70A 2IYTA 4TQ9A 1MO6A 2GCOA 5JRZA 1X1SA 4IHQA 3AF3A 3SYNA 1E9BA 4WZAE 3SC3A 4MUBA 3WHLA 1F48A 5HZHA 4JYBA 4RD4A 1HEIA 2P6NA 3MFYA 1XEWX 2WJYA 4YMSA 1G3UA 1G20E 1D9XA 2XTNA 1ZW6A 4ZIRA 2R62A 4ZDIA 2NTYC 3CRMA 3GEHA 3GD7A 4RZ3A 2B7BA 2REBA 3FKQA 1VG8A 4IDPA 2A2ZA 1AKEA 3SFVA 2QTFA 3H0KA 1Q1EA 1E1QD 1QHYA 4D80A 4MGKR 3VQTA 2QRZA 1G4AE 2VBCA 3CF6R 3QG1A 3AVVA 2OT3B 2ZJBA 1OH6A 3SYLA 2IW3A 5FOUA 1P6XA 2ZU0C 3TUIC 1EX6A 1GRRA 4C30A 4ERNA 4PHTA 2ATXA 2LWIA 4Z8XA 4PAMA 3RS0A 3WNDA 3VKGA 1FX0A 2YHSA 3Q85A 2ZSFA 1RYFA 4QGAA 2ZE5A 2QNRA 4PQFA 1UFQA 1TEXA 4DZZA 1LF5A 4JVSB 4JSYA 3VR2A 2FOLA 521PA 4Q1DA 5EE9A 3QG5A 4R2IA 4P4SA 5IHPA 1YZKA 3GLIB 1CJVC 2J0VA 1N2CE 4D4LA 4I4LA 4QJ3A 2CVHA 4E5UA 2P6RA 1KY3A 4LV8B 1P62B 2C9OA 2CBZA 3BH7A 5CM8B 2F1IA 3FKSA 4PSVA 4PC3A 5EZ6B 4BRUA 3W90A 4O2LA 1E96A 1R5OA 5FPKA 3I5YA 4JBXA 2ZRPA 1G7RA 3CB4A 1HT2E 1Y3AA 4TWZA 3CF2A 5JWHA 5B57C 2C9CA 5FR1A 3S1AA 1G6HA 1GM5A 2OEPA 5B30A 4P4UA 4M8NE 2N46A 4B74A 1Z06A 2J7PD 2GESA 2OCYC 4JLOA 4KFTA 4JLJA 1X8JA 3Q9LA 3QBVA 1N6IA 1P2UA 3EC2A 1M34E 2ZJ5A 5KDLA 1RVDA 1EX7A 2WWIA 4CW7A 4M9QA 3W3AA 4E09A 4H9GA 2D7DA 5EP1A 4DCTA 2AFIE 2WV9A 3ZQJA 2IWRA 3QXCA 1XCGB 5HPYB 3LLMA 1Q22A 2FZLA 4FI3C 4J0QA 1HA3A 3ZD6A 3BFKA 2G0NA 1NVXQ 2IK8A 3MUFA 3PITA 3EZ7A 4CZ2A 2BM1A 2A30A 5DI9A 2IA5A 1JB1A 1TQ4A 2IYUA 2C8VA 4W5WA 4JLDA 3ZIAA 3EPKA 4AURA 4V03A 1OHHA 4M21A 4FMCF 4GRAA 4DSUA 4JVLA 3GLIE 5KPJA 3P4XA 1JQLB 3O47A 4XH9B 4QNMA 1SHZA 3A4LA 1KI1A 4DLRA 1W36B 4Y0VA 4IFEA 2JAQA 4A6PA 2GNOA 2I3BA 4MGZR 4KLZA 2ZI9A 1PVOA 2H16A 2HXSA 3QXHA 3W5JA 4K8OA 1J8YF 3TSOA 1OPXA 1SVOA 3FMPB 4M9XA 4PC1A 1GZSA 5DI3B 3RS2A 4OI4A 3JVUA 2FN4A 2WJVA 2XXAA 4Q1FA 2PEYA 1CR0A 4PZLA 3K8YA 2HV8A 2ZXUA 1HURA 1X8LA 2GJKA 3EA0A 2WJJA 3C5HA 4LDJA 5DISB 3SJAA 2FFQA 2CK3A 2MMCA 2DWOA 2QEQA 3AP1A 2G1KA 2BEKA 4GMXA 4G0NA 4GZMA 2PMDA 4LYFA 3RS5A 5JEEA 1SVMA 3MRSA 1V43A 2VF7A 4LPKA 1IQPA 3CNLA 3I8SA 4PHHA 4C7OB 1YVDA 1HY3A 4ZDKA 3WP0A 2ZYTX 4LBWA 2H18A 2YJTD 3MJRA 4G5RA 4TYYA 2RGGA 2VQSA 4C0JA 4Z51A 2C77A 3QXXA 1J7KA 4DLSA 3C41J 1W0KD 3LFUA 4AI6A 1F60A 2ZAMA 4RD6A 4OJKA 4Q21A 2ORWA 3LW8A 3WBJA 4Q9LA 5DYGA 1OXXK 2BIFA 2OFOA 2C2HA 4G5GA 3F3YA 4PPNA 1OH5A 5JCZA 1XJCA 2H1LA 5KDDA 1SVIA 4MRSA 3AF2A 1W5SA 3SNHA 4C4PA 5EP3A 1DAHA 3VR4A 5L3VA 2C04A 1DTSA 1G19A 4O3MA 1VG9B 2ZS7A 2VHUA 2Z5FA 4PSKA 3LV8A 1KO8A 2WKPA 1G8GA 3DM9B 4DC9A 4EPRA 4BGDA 3EA5A 1N5IA 1HQCA 4LHZA 3D31A 2OO7A 1NJFA 4LGMA 5H1YA 4LOAA 4Q1AA 4JKIA 4M1OA 4N3NA 2C03A 3X1ZA 4HB2A 5FOXA 5EUMA 5CDFA 4URUR 5FBLB 3QKUA 4KXFB 3SR0A 3KZ1E 5ELXA 4EJSB 4XSGA 4IDOA 4C2TA 2IYXA 4TQAA 1O87A 2VSFA 4QHTA 3QVUA 2XOKD 5HTKA 821PA 1S8FA 3P1JA 4BUJA 3T35A 2VP5A 4BFYA 2ZPTX 1ZVQA 5CYPA 3SJBA 1Y63A 4CEJA 4MDFA 4NYJR 2JEOA 4JLPA 5JHGB 1SXJC 2XITA 1BOFA 4D4KA 1KMHB 1FZQA 2GCNA 1BS1A 1HUQA 1RPZA 4DXAA 2GJ8A 4B2LA 1YRBA 3GQBA 1OKKD 4M2LA 3MD0A 1FNNA 1GKUB 2A5YB 4MGIR 2JJ2A 3SN6A 3FHTA 4ON9A 4DSTA 3U3OA 3CO5A 3NC1C 1T8UA 4Q5IA 4RD2A 3OAAA 3K0CC 3AVXA 2EFHB 4PO8A 3AVYA 3UIEA 2R6FA 3RS7A 2HYIC 3VU9B 1FPMA 1GVNB 2BKUA 1H65A 2RHMA 3A37A 4YC7A 1NG9A 3RRMA 1ZM7A 3CR7A 4CDGA 4WW0A 1ZYUA 1FFHA 1Z6AA 1BYIA 1XD2A 3G82C 3Q7PA 2NG1A 2WKQA 2J0UA 1MABA 2ZU6A 3NG1A 1ZCBA 3B13B 2OXRA 1CJTC 3CM0A 5JMTA 5KHOC 3PUVA 3ZGXA 1E3MA 2ZJYA 1JJ7A 1NN3A 5GVRA 4UQOA 3U7GA 1T0JB 1UJ2A 1FP6A 2XJ9A 6Q21A 1DG3A 2O52A 3NDBB 3WRXC 2XSZD 4LJ8A 3MLEA 2BMFA 4IVPA 2O8CA 3IO5A 3W5IA 1D5CA 4FCTA 1N3BA 1D9ZA 2B92A 2BWJA 1WCV1 4MA4A 2HYDA 3WP1B 3B5JA 4OHVA 2WOJA 2WSMA 4HEJA 1KJWA 1QHHB 1FUUA 2WVJA 1P60A 4HYYA 4B44A 4OK5A 3GFOA 1G18A 1ZNYA 4TMXA 4ZPXA 3KDSE 2WICA 1W7AA 2WJHA 3IILA 3ZVLA 1RIFA 1U90A 5CK5A 2QRNA 2ZJAA 3K0AB 2G3YA 3FVQA 2QENA 1ZUIA 5KYKA 1TL7C 1TQDA 3EW9A 5E95A 5J40A 5UKDA 3T1TA 1YZGA 3AEZA 4ZIRB 2GHIA 2VPPA 5EP4A 5CB8A 2IHYA 2QQ0A 3FB4A 1J90A 2NOAA 4A2QA 5LB2A 2QAGB 1ZUNB 4IEEA 2Y8EA 1W5TA 2ZRNA 3G5UA 2YC4C 1H8HD 1U8YA 1ZP6A 4QHSA 4BLQA 3ZIAD 4NZYA 5F9HA 3A1WA 2QGZA 4QXAA 4PPGA 2J0UB 3NHAA 3EZ9A 1YZTA 1NLFA 4M9SA 2GXAA 1CLUA 4GP6A 1KSHA 4EKDA 3P27A 4D0NA 2UZ3A 1MV5A 3VTKA 3F5FA 1ANKA 3BFVA 4B3GA 4CVNA 4OI2A 4MRPA 1T91A 2IT1A 2GZDA 2ZI4A 3FMOB 2BBOA 2BMDA 1WB9A 3KQLA 4MRNA 3CX8A 2ZRJA 1R0XA 4IRUB 3U3RA 1XJQA 3H2YA 1Z6YA 1NMZA 2W0SA 1W49A 1AK2A 4A2PA 1OIVA 1DAFA 1SVWA 8OHMA 1R2QA 1NIJA 5GJVC 2DBYA 3NH6A 5E7JA 2PT7A 1J99A 2V6JA 4C7OA 4KYUA 2IYLD 5IDVA 1JALA 2WKRA 3AVPA 1YR7A 3P26A 3VMFA 1YR8A 4NONA 2PZGA 1LB1B 4D6PA 2Q9BA 4B76A 3HU2A 3NBFA 2NGRA 3RYTC 1E79D 1B23P 1OIXA 5TARA 4I1SA 2PCJA 1GKYA 2EFGA 5EE3A 4JLNA 4ASUD 1Z5ZA 4KBFA 3CWQA 4BFTA 4CEIA 2VO1A 2ORVA 2I4IA 1XCPA 5CITA 3BRWD 1JI0A 5EQTA 5EP2A 1ZM4A 2Z4RA 1ZM9A 1G1MA 4PXAA 1FMJA 2IXFA 3QEJA 2OLJA 4UNSA 1IN7A 1MRNA 3BOSA 4HLDA 4ZI2A 3R9IA 1S2MA 4RY2A 3RRNA 4MKGA 3UKDA 2VYFA 4OJQA 5JI3E 2JLVA 2AL7A 4D25A 4B47A 5K8UA 1TQ2A 4FMBB 2BJVA 1DADA 3K1JA 5AUQA 2YOFA 3U6BA 1KI3A 3VNVA 1R8QA 2NIPA 2P3SA 3HR7A 4WOPA 4UNNA 5F9FA 1HE1C 2NO6A 3W6NA 2IYWA 1KDTA 5BN5A 3AH8A 4I1VA 1U98A 1ZBDA 1XXHB 2E1RA 3B1WA 4C0BA 2VLIA 3REGA 1UDWA 1EFCA 2GBLC 4HAUA 1YR6A 1Z3IX 1KIMA 3U44B 2QBYB 4AKHA 1DBSA 5FH9A 3K53A 4TT3D 4BECA 1CXZA 4BRWA 4LWZA 2F1JA 3GFPA 4UNPA 1S1MA 3IHLA 4TMKA 5FOSA 5JHHB 2A9KA 1IXZA 1NBMD 4M22A 4NTZA 4HDQB 2GK7A 1KHTA 1LY1A 3A6PC 2REXB 2KJQA 2DB3A 1NP6A 1P75A 4FW9A 4M1TA 1N0UA 4Q66C 2QT1A 3R8FA 3ICQB 1G7CA 2JJ2D 1GTVA 4RCYA 3LDAA 1E9DA 1OKKA 4IDQA 4US1R 3AM1A 1KSFX 4KBGA 4BPBA 4HZUB 3K9GA 1R10A 1XMSA 3VR5A 2FF7A 1DAEA 3T61A 4Q00A 3SJCA 5DYIA 1VCOA 1NY6A 3TAUA 3THOA 3RAPR 4URYR 3DZDA 3TGPA 3IPXA 1SVSA 1G16A 1EFUA 2BBTA 3M1IA 4OHXA 4DLXA 3HR8A 2QAGC 3SS8A 5KDOA 4M53A 5J4VA 4NCJA 3VAAA 2RGCA 4C3ZA 4Q7JB 5F98A 4L9SA 1P73A 4RFSA 4A92A 2ZRGA 4N0EA 1FX0B 3NBZC 1U99A 1P72A 2GK6A 4I99A 5HZKA 2WJGA 4JLBA 3AVWA 1B0UA 1SXJA 3OHMA 2W00A 3UWKA 3R7WB 2XNDA 4QGFA 4Z1MD 1TF2A 1OXTA 1XEXB 4NYIR 4EIWA 4OQFA 2QAJA 1G3MA 2QTHA 5FOVA 3IGFA 4XVRA 4HLQB 2ZE7A 1EWQA 2H5EA 3VHXA 1KI7A 1U8ZA 4ESHA 3VNUA 3B60A 3P32A 1EESA 1KGDA 3Q8XB 4RSGA 1XZQA 3BWDD 5EJEA 1FTNA 4TL6A 2DWQA 3X1XA 5JS8A 1L7VC 4P0TA 1YE8A 4KSBA 1OH7A 3LW7A 4A82A 4YXWD 4F91B 4TLEA 5KNBA 1E94E 2H57A 2JGNA 4LBVA 2ZRMA 2ZVQX 5FL7A 4GSYA 4AC9A 1K8RA 3PUZA 1Z2CA 3LVRE 1G8YA 2DFKB 1KI2A 4DT1B 3O8BA 4HUQA 4AYTA 2ZREA 4QBIA 3EARA 5L3SA 4TMZA 2RGNA 2OE2A 1DO2A 2OFXA 5G53C 5C4GB 4EFMA 2XNSA 3EIQA 1N25A 2O8FB 1JAHA 1ONBA 2UZIR 3C7KA 3DO6A 1XRJA 1KAOA 3NEYA 2IS1A 4URZR 1OW3B 1E32A 4DHEA 2ZE8A 4K81B 4CT4B 1AS3A 4TYWA 2QA5A 3I92A 4B35A 3Q7QA 1XTIA 3RDPA 3UG6A 2WM9B 2JLUA 1YR9A 2ZQ5A 3HPRA 4POAA 4X8OA 1GRNA 1UADA 1WXQA 3U2QA 3EZFA 2KBEA 2HXYA 2NO7A 3GLFB 2GXUA 1ZAKA 2FSIA 1KMQA 4PPFA 1OH8A 4TMWA 1XD8A 3HJNA 1YRAA 2AHOA 1UPTA 2D2EA 2QUZA 2AD5A 2YV5A 2CCGA 3PXGA 3BIFA 1D2NA 4NPHA 4HAZA 2ZR0A 1OJLA 3WYGA 4G01B 5CLQA 5D3MB 1KJZA 3AGQA 1ZCAA 4US2R 1OIWA 1VG1A 3PIRA 4AIIA 4C0QC 1M7GA 3EZ2A 1W2HA 3W8RA 1MABB 1FMLA 1NI3A 3MWKA 4E07A 3THWB 3JZMA 4DLVA 1PZNA 4B3BA 1XTQA 2QQEA 3OEEA 4JJZA 1AGRA 2QMHA 4BEJA 4FWIB 4FXPA 4P4TA 4TZ0A 3LVQE 3RSLA 1UEIA 5K8TA 2JLRA 2BVNA 1E9CA 2FH5B 2B21A 2GXSA 2LCFA 3TRFA 4M1SA 4DCNA 3ZVRA 4OBEA 4XWKA 4C0AC 4DRZA 4NCIA 2JJ8A 3TBKA 1AQYA 4ASUA 3SHFA 5E7IA 4ZO4A 4MDEA 3LX5A 3LWNA 1Z07A 1KMHA 4JL8A 4ZCMA 2BEJA 4TSFD 4MYCA 1E0SA 2BM0A 4GL2A 1WP9A 4LC1A 1G8FA 2VEDA 2RCNA 1R0ZA 1KSJA 4RKEA 1XWIA 1GNQA 1E0JA 3AF4A 2H8KA 4QNRA 3B85A 1N5KA 3BERA 2RB4A 4OQMA 2IC5A 4R71A 3AKYA 1ZNXA 3KKMA 3RSOA 5KTYA 1DEKA 2ZI3A 3FWYA 1E9SA 4FINA 4KVGA 1W36D 1GUAA 4H1UA 2Q3FA 4ZKDA 4KCGA 4HZUA 4NYMR 4MGYR 1QHSA 3BC1A 3EC1A 1NMYA 3LA6A 3CNOA 2F3RA 3NH9A 4OHWA 2YC2C 2OSBA 4DSNA 1XTRA 2VP0A 3OESA 1AS2A 4JLAA 4UXJA 2JCSA 3BB3A 3I61A 1TAGA 2XTZA 4IJMA 2NPIA 4B71A 2Z83A 1G41A 3N5CA 1JJVA 4WIAA 4EPTA 1UKVY 3MJHA 1ESMA 3B2EA 2QROA 2HCBA 1NN5A 1Z0DA 2IEZA 3BD9A 3OEHD 2IYZA 2GCPA 3GFTA 3GJ4A 2AD1A 4A8JB 3QPUA 5BW8A 2CE2X 3TKLA 3GLHB 3QXJA 3TR0A 1NBMA 3AUXA 5FPYA 5TB5A 2CLSA 2CK3D 4RZXA 5IF9A 2ZS8A 5CK4A 3RNLA 5HKKD 3KQUA 1VDZA 1IBRA 3WMFA 1EG7A 1E0KA 3NTUA 2AK3A 1US8B 2EYQA 2V1XA 1G21E 2IF2A 2WAXA 3PR1A 4DEXA 2QE7D 3LD9A 5J4LA 1NVWQ 3L0PA 2J45A 4HDCA 1I4TD 3OF5A 3ZYCA 1LS6A 2HF8A 1QVAA 2OCBA 3D6TB 4NCNA 5E7MA 4W9MC 1AN0A 2QGNA 2ODWA 4KI0A 1ZINA 1JPJA 2IYRA 2JDIA 4IOLA 2G6BA 1WRBA 4IFBA 5LD2C 4M9ZA 1P61B 3REFA 4IDNA 4Z8YA 1E2NA 1NLYA 1C9KA 1EGAA 2MSDB 1BH2A 1COWD 3I32A 4PO1A 2P2LA 4OQXA 2CCKA 3IHWA 1JBKA 4Q4HB 3F0TA 2WPDA 4D4MA 1YJ5A 2EWVA 3C15C 1W46A 3OE7D 5KNDA 5J5CA 4Q4HA 4PZZA 3E70C 2XAUA 2D06A 1SXJD 5DO9A 5FR2A 2B7CA 5BYKA 1GILA 2X2FA 4HLUA 2ZVPX 2B8TA 2VHCA 3GEIA 3KJIA 3KUDA 3RANA 1U8AA 2HJVA 2ZRAA 4YONB 2TMKA 3EWAA 2FPKA 3LY5A 2IYYA 1D8TA 1N6RA 1VCNA 3O8RA 1ZIPA 3HPQA 1P2VA 3CPHA 1GL7A 5DNYB 3BB4A 4DUGA 2BMEA 1W1WA 4YXWA 3WNCA 1Z6GA 1M74A 1UKEA 3EG5A 4O25A 3TIFA 1JR3D 1LNZA 2CE7A 2KB0A 3ICEA 1TTTA 1MT0A 1SKYB 4R9UC 5J47A 3GLGA 1UKYA 1E2PA 1RJ9A 3SYKA 1D2MA 2E9SA 3QIAA 3SHWA 3TVTA 4BFSA 2EFCB 4IXNA 4S2EA 4Q9HA 1IY1A 1EFTA 5JFGA 4CEJB 3VFDA 3KKPA 1LF0A 4NCKA 2ERYA 4F38A 4WAUA 5G41A 3TLXA 3THYA 3WY9A 1LW7A 4BFVA 1UDXA 2ZRFA 3UATA 2JIZA 4Q4JB 3C8UA 5SZHB 1WBBA 3O8CA 2GTPA 2OESA 1XPRA 1GFIA 2R9VA 5E3HA 4LK2A 4F4IA 1L4YA 2F9LA 2V7QA 1KK1A 1Z47A 4F7WA 2Z0MA 1TU3A 5AWFC 2F3TA 1W2GA 2PJZA 3GMTA 3AKEA 2BBSA 1NLZA 4BZXA 4BZQA 1TPZA 3FTQA 2XTMA 1RRCA 2HLDA 4AWXA 1Q57A 2NO1A 4LYJA 3T06B 1DAIA 4EPYA 2PCLA 1U0LA 5CIWA 4DKXA 721PA 1G5TA 1XEXA 3FPAA 3I5XA 3K9NA 3KFVA 3L0OA 3AP3A 3SQWA 1SXJB 2XB4A 4KFUA 3B82A 1FL9A 2JASA 2PX0A 5J4HA 3SBDA 4GDFA 3OEED 3I72A 5KPDA 1YZQA 4A8JC 4B2IA 4XWOA 4II7A 1ETUA 2PBRA 2X77A 2UKDA 3I3SR 2WMOB 1TUEA 3P4YA 4B75A 1N5LA 1JXMA 1E2JA 3J81k 1NVUQ 1US8A 2EWWA 3NBYC 4RFVA 5HKKA 3T5DA 1UM8A 2B8WA 2CXXA 2WWHA 2YOGA 2ZM5A 3I4LA 1ODFA 3V4RA 1OXSC 1AM4D 1NL3A 4JT4A 3KXLA 1P9NA 1E99A 5JZVA 1GIAA 1KI4A 1KK2A 2VIIA 3QJYA 4KO8A 5IT5A 4JLMA 4O2RA 1RZ3A 1CTQA 1Q3TA 1L2TA 3VR1A 3HYRA 3BE4A 1LV7A 4LC0A 1KO7A 1S3GA 4K46A 2CNWD 4V0NA 1G7SA 2WSSA 3TAHA 3KJEA 2J3EA 1P4SA 1KKLA 1E4VA 2WWFA 3D7MA 3KKOA 4DDTA 1TNDA 1ZNZA 4PC6A 2EYUA 2YKGA 3IUYA 3IQWA 2XZOA 3MWYW 4ZV4A 5JWOA 2QMOA 1AQUA 2RGXA 3QQ5A 5JBQA 2IL1A 3NVAA 1QBKC 1R4AA 1Z0JA 4GNKA 3EWSA 3CKLA 2C9YA 4V0OA 2CHGA 1LVGA 2Q3HA 1W47A 2W6JA 3U60B 2AN9A 1S1CA 1VKJA 2NO0A 2QMEA 5A5GA 1R7RA 4QGGA 1KJYA 2PMKA 4V0ME 1N5JA 2WWXA 4M4SA 3TR5A 2O0JA 4OYHA 1A82A 4AD8A 2QT0A 5E4FA 2J59A 2I1QA 1NN1A 3AKCA 1KDPA 2R8RA 3SE0A 4A0GA 1GKIA 5M04A 3EASA 1SKQA 2W0MA 3ZVNA 4M1MA 2KSQA 1WBDA 3W8NA 2XOKA 4L5BA 2C95A 4IXMA 4OI1A 1G8PA 4R98A 3B1ZA 2DFNA 4Q01A 5GJBA 1ZD9A 3PG5A 4F4JA 1O3YA 4U7DA 4B6EA 1IN5A 3PEVA 3WBKA 1VYVA 4NBSA 2C5LA 2FGKA 4URXR 2MSEB 1A7JA 3IQXA 3C4JA 3IEUA 5C46F 5LB4A 1IONA 1Z0IA 4WVFA 2GVDC 3IIMA 4HDOB 1CEEA 1SULA 5DI3A 2DPXA 1L8QA 5CDFE 1Q44A 2OAQ1 3PUXA 4D4JA 2D74A 2FV8A 2FSHA 5CB6A 4A15A 3CPEA 4G1UC 2GETA 2ONJA 5JCPA 3IBGA 4A0HA 4YMTA 3DPUA 4QBHA 3WMEA 5L3RA 2V7QD 4TN1A 4DBLC 3MGCA 1G64A 4CF7A 1W4CA 2FEOA 2NZJA 4GBMA 3AQ4A 5SZJA 1OYYA 1PV4A 4Q7LA 1NVVR 4AKEA 3P20A 1DOAA 4IVRA 5L3SB 2CL0X 1OF1A 2F43B 1CR4A 5DSZA 5JEDA 1XZPA 2DHRA 3ZVMA 2HLDD 3C14C 5FBRB 3I8XA 3BS4A 2N42A 2WOOA 4IKEA 2O8DA 1H8HA 2H17A 3I62A 4X8MA 1E2FA 4QM6A 4DIDA 4NE2A 3DZ8A 4R2HA 1E9RA 2A78A 4B6FA 4NL4H 1FQJA 3MMPA 4DLYA 3M6AA 1KO1A 3CH4B 1FNMA 3K0CA 1G6OA 5J4YA 2F7SA 5AJXA 4A0RA 2QI9C 4Q4AB 3TSZA 2JATA 2R44A 4TL8A 1CRPA 4B3FX 2CEAA 1SVLA 2WIAA 4BASA 4TLDA 1E9EA 4B2PA 1BKDR 4P3YA 1G4UR 4U00A 2IS4A 4TMTA 1OFUX 2VRWA 3IKJA 4QBGB 4UKDA 1QG2A 2QSYA 1MO3A 4GZLA 3U4QA 1BMFA 1J2JA 2QMUA 2IEYA 3PFIA 3THYB 2QTVB 2ZRLA 1DARA 3CR8A 3LBNA 3W6PA 4V0KA 3EX7C 2H92A 4PFSA 5IK2A 3KQNA 2QBYA 3JVVA 1W48A 3D8BA 3UG7A 3K70D 3KKQA 1OSNA 1E2GA 4D0GA 1Q1QA 1Z0FA 2CNWA 2Z6VA 4WA7A 3A4NA 4MRVA 3QPVA 5JRJA 2AWOA 5BQ5A 1FOEB 1GG2A 1U81A 4ACAA 2F1RA 1Q1ZA 3X1YA 2BC9A 5TDHA 3X1DA 1KI6A 4Q1CA 2YZ2A 5A4JA 5EE0A 2BOVA 4MYUA 2NO9A 4M1WA 3KQKA 4CEHA 4D0LB 2KI5A 4JL5A 2JIZD 4DWJA 4PQYA 2V9PA 2D7CA 4A36A 1VHLA 4L16A 1R8SA 4AKIA 3PV0A 4QFMA 1PLLA 4MITA 3GLGE 1NKSA 4I81A 3L8ZA 2YVUA 3KXIA 2RGNC 4PAOA 2WPDD 3IO3A 1MOZA 2EQBA 2DYKA 3K09C 3SEAA 1VIYA 4NMMA 4QG7A 3U4QB 5G3ZA 5LDDC 3AVOA 1ZU4A 2FFBA 1GOTA 1XD2B 3KJGA 1T5LA 1YU9A 2R6AA 221PA 2W2VA 3LNCA 3UWOA 4TYNA 3GLFE 4LV5B 4HAXA 4Q9IA 4LSGA 3AVUA 1V5WA 1RRPA 3UK6A 4Q02A 3W9YA 2BMJA 2O8BA 1AGPA 2O0HA 1PLKA 1UKZA 1JECA 2J0QA 3W6OA 3OIWA 2IYSA 3KL4A 4P33A 4R7ZA 4TLCA 4C0SA 2YYZA 3T12A 2GZHA 5BWMA 4DCUA 5DN6D 3UMSA 1NY5A 1E1RD 1H8ED 5GVSA 3FYHA 2LKCA 1JR3E 5L3QA 2ZSEA 1KZGB 1KI9A 1C4OA 1E4YA 1W4BA 2A5FA 4HAVA 4QHYA 4ZKEA 4LV6A 2DFTA 4S35A 3PUYA 5C1BA 1OFIA 4UJ3A 1I4LD 3RWOA 4DDWA 2J87A 1QHGA 1SGWA 4N1AA 1IOZA 3K70C 4LHWA 1W0JD 2YWFA 1W36C 1KO4A 4WXRA 1YQTA 2G9NA 2PT5A 5KO2A 3ONWA 2CHQA 3FMIA 3RABA 4PR0A 5JECA 5FTKA 5KSYA 1S4QA 1FUKA 1XMIA 3NEJA 5EE5B 5JJKA 1OHHD 2JLQA 4XVUA 4GPTA 1G291 4M0LA 1G8HA 5F2EA 1F3OA 4N0DA 1N6LA 5LBIA 3K9HA 4EFNA 2O0KA 2L0XA 1E1QA 2OZEA 5HE9A 4B3CA 2ZROA 2O8EB 4MKHA 2XB2A 1E9AA 4TTQA 2DWPA 3LQQA 2FZ4A 2OBLA 5G3YA 2BKEA 4GT1A 3DMDA 1XXHA 2IYVA 2D2FA 1OB2A 1RJ9B 1KNXA 4BLSA 3QKRA 4W7SA 1X3SA 3GCGA 3IDQA 4LJ7A 2Q21A 621PA 2ANCA 2G0TA 1DE0A 3Q5EA 5EXXA 3MCAA 1PJRA 4JBWA 2ZRCA 3V00A 4EQ6B 5JWRA 2B6HA 1DELA 3CW2A 1Q20A 2O8CB 4JL6A 4NU0A 3ASYA 2V3CC 3CWZA 3IEVA 2PLRA 3H1TA 2GDJA 2GJSA 3QY0A 3RLFA 4YDSA 4BFWA 3QBTA 3B78A 1KSGA 3SI7A 2EU8A 1NSFA 1FW6A 1KI8A 2CL6X 5KOYA 2WWYA 3AUYA 3NC0C 5DLQC 2IXEA 4PAQA 1TMKA 1T3SA 2AFHE 5C2JB 2P5SA 4OK3A 2PZEA 1ZC4A 1DG1G 1PUIA 4DJTA 1Z8FA 1XMJA 3UXMA 3PUWA 4Q4LA 3ZDQA 3K0SA 4EAQA 3PCRB 1TQ6A 3AVTA 2GXQA 3FMFA 1II9A 3GEEA 3HU3A 3LQRA 3T1QA 2C98A 1HH4A 5FUVA 4F4CA 3R9WA 2Q6TA 1MO5A 4LY6A 2YOHA 3LX8A 1UAAA 4DDVA 1VCMA 3QF7A 4LX0A 4CT5A 5KSOA 2YWEA 4HUTA 1E2LA 1S96A 1JPNA 2CLDX 3QVVA 3OEHA 1CR1A 1IN8A 3ZH9B 1CIPA 2W6JD 2MSCB 2CJWA 4XD7A 3T34A 121PA 4B73A 2I1VB 4TYQA 4JVMA 1E6CA 3FGNA 2O8BB 4UNRA 2A5DA 2ZYWX 3NKVA 1R6BX 2JJ1D 1XTKA 4QJ5A 5D3QA 1RKBA 2ONKA 2WWGA 4JSTA 4LRWA 4YDHB 1TF7A 4HZIA 4BFUA 4FCVA 1E0AA 3U61B 5EXTA 3Q3JB 3M0EA 3QKTA 5G40A 5AUNB 3W3ZB 4QGHA 3K9LA 4US0R 1SXJE 3VU9A 4GOKA 4LHXA 5ANRB 2WZQA 2ATVA 1RRFA 2VF8A 4DT1A 2X8AA 2K5UA 5SZIA 5BXQC 2QU8A 3GJ3A 4YLGA 4Q1BA 3ADCA 1RRGA 1Q12A 2ZSAA 2ZE6A 2AXPA 3NIBA 4HAWA 1FTSA 1VHTA 3ETLA 4URVR 3ZJYA 4TSFA 1LS1A 1NKTA 1I4DD 3ADKA 2ODBA 1WQ1R 2FE4A 4I1UA 2IXGA 1OB5A 4TLBA 3KKNA 3HU1A 3N2EA 2QL6A 3A1SA 3C16C 4URWR 5HE8A 1IM2A 3RHFA 1U0HC 3QKSB 1F2TB 4KU4A 2GWHA 4EQ6A 1COWA 2R6CA 1LFDB 1RE0A 2V54A 3ND8A 4PZYA 5HR5A 5SZKB 4MKIA 2V1UA 2ZIAA 1I2MA 3QENA 3FFBA 2REOA 1CKEA 2KE5A 4A2WA 4GMDA 4XTCS 1XTJA 1XJ0A 3RRZA 3VR3A 4A1FA 3EPJA 1AIPA 3B1XA 4LUCA 3BFXA 2OLKA 3DHWC 3CF0A 1NN0A 3VKWA 2AX4A 5HCIA 1N0VC 3U6KA 3A4MA 1W4AA 3B7GA 1N6PA 4LYHA 5C4MA 1AS0A 1H8EA 3KFXA 1KY2A 4QBFA 5EUQB 2BBWA 1W4RA 3AF1A 3GLHA 4Q9JA 3KB2A 1NNEA 2QY9A 3FOZA 2J9RA 1T3LA 3UMRA 1ZU5A 2VP6A 3LLUA 4O0MA 2VA8A 1NSTA 4FMDF 1OFTA 1QHIA 2CHVA 3TMKA 4ZDWA 2DR3A 4HB4A 2ECKA 3C5CA 1XPOA 4ARZB 3GJ8A 4C0HA 4BE7B 3GJ5A 2ZJ2A 5FPTA 4XWAA 1CJKC 1TUIA 3HP1A 1KDOA 1GNRA 3ASZA 3K09A 3BXZA 3TW8B 1S0UA 3A1VA 4KFRA 5IK2D 1A2KC 1I2DA 2PLFA 1E1RA 3IIKA 4L15A 1JXOA 2G1JA 3GLFA 1EWRA 1IN4A 1QDEA 1PUJA 2JDID 3T15A 3HDTA 3NHBA 2KBFA 2VSOA 1XEWY 4U02A 2W83A 4L8GA 5LD2B 1GL9B 1VCIA 3B8HA 4M1KA 4RD0A 4MH0R 3V4FA 4BQSA 4KSCA 2O8EA 4C9BA 1M8PA 4XJXA 1ZIOA 2ZETA 4PTLA 4U5XA 4DB4A 3MAAC 1DAMA 3GJXC 2NPFA 5FUYA 1IJEA 1JR3A 4LJ6A 4LI0A 2ODNA 4ACBA 3NWJA 4V0LA 4ILEA 2FSGA 2GRJA 3H86A 3SBEA 2GJAA 4JVNA 4TZ6A 1SVKA 1KAGA 1ZD1A 3EIEA 3T1VA 1G3QA 5J4KA 1ZUHA 2JLYA 4C0LA 4AG6A 1HE8B 1Q3HA 4RZ2A 3CX7A 4P32A 4HLCA 5IRCD 5FBVB 2V6IA 3QF4B 3RVBA 4PC2A 1Q21A 3B9QA 1R0YA 2GILA 1TU4A 1SKYE 4GOXA 4UXIA 5FTLA 2WTUA 4AG5A 3NXSA 4D26A 1VTKA 2GCOB 1IJFA 4FMCB 3DOFA 1C1YA 4MKFA 4AK9A 4P4SB 3GLIA 3TSWA 4JMPA 1N6OA 1G5PA 1XU4A 2ZUCA 3GJ0A 4B48A 1A1VA 5L3QB 3WNBA 5DN6A 5P21A 1RFLA 3IBYA 1Q0UA 2G83A 3AB3A 1P5ZB 5FTNA 1VIAA 5H70A 4DDUA 2HCJB 3EXAA 4C2UA 1NBME 5BN4A 3L82B 1S9DA 5FOWA 4B34A 4ZDJA 3R8CA 2FU5C 4HUQB 1XXHE 5H68A 2BJWA 3PQCA 3THXA 4Z54A 3CIOA 4FCWA 1UBCA 4KV9A 2GAAA 1U2RA 1IAQA 2QP9X 3S1AB 4ZI3A 4W5JA 1NMXA 2GZAA 4OQNA 2ZR7A 2EFEB 2VL7A 3KUCA 1NJGA 3ZQ6A 2E87A 4CGZA 1XX6A 2FA9A 2OAP1 2ZI5A 1GNPA 4FMDB 1AZSC 4BZPA 4DEYA 5CM9C 4BLOA 5CYOA 2FPLA 2V8OA 2P67A 5F3WB 2HF9A 5A0FA 2KWIA 2J0SA 2OUKA 4JZKA 2GJ9A 2ASEA 4KLNA 3A36A 5D3MA 1UBEA 1M1YE 2JJ1A 4Q03A 1GDDA 3R7WA 2ZRIA 1DAGA 1J70A 4G3XA 2IS6A 1ZD8A 4TQUS 4TL9A 1E2HA 1OXUA 4OK6A 5JSZB 1Z2AA 1X6VA 4QM7A 2W2TA 4PSAA 2PEZA 3QPWA 2O8DB 3L43A 4HB3A 2R6DA 1DS6A 4DLZA 1MO4A 4JS0A 1Q1BA 2DCUA 3RRYA 3RC3A 2ZANA 2ERXA 4LJ9A 3THXB 2P6UA 2F1HA 3H4MA 4NH0A 2F43A 5FI0B 3ZZUA 4EFLA 2AWNA 4Q19A 1OE0A 1N0WA 2FGJA 3LBIA 4V02A 5DGXA 3E5HA 3FKSD 3GP8A 5DHAA 4XVQA 5GJCA 1HT1E 3K0FA 4EPVA 1ESNA 4MQBA 1KK3A 4PPQA 4LJYA 4WBSA 4FWTA 4DSOA 1XMVA 3LXRA 3K0FB 4EPWA 1R5BA 1Z83A 2QPOA 3BAFA 2ZRDA 3NBXX 5K8IA 3JZAA 2F9MA 4E22A 3SQXA 2IYQA 3W34A 4B32A 3OFND 1QF9A 2WSSD 2OCAA 1U9IC 3IIJA 1DAKA 1T6NA 3G0HA 2P0EA 1QVRA 1JR6A 3PEWA 2ORIA 4C0KA 2ZR9A 1N6HA 3QXSA 3F8TA 5KSPA 4GOJA 3L0SA 5EXPA 4BLRA 2ZJ8A 1A5TA 2GEVA 4CYMA 1E2MA 2C78A 3KB1A 4DIEA 5JSZA 1F5NA 2Q0HA 3K0AA 3MSXA 3WYAA 3BGWA 3V9PA 4YQFA 5FUWA 4D2IA 1P3JA 2IHBA 1EK0A 5FOTA 2PZFA 3QE0A 1HYQA 2XNDD 2N1BA 3DKPA 3CRQA 5HCNA 4CEHB 2NMVA 2HDNB 4YMWA 3KXKA 2W6IA 2FWRA 2R6GA 1XB2A 1VYUA 2IUUA 1HTWA 4CRWB 4TL7A 2YWHA 3CLVA 2VP9A 1CF4A 2MMGA 2FX3A 1JAIA 3LO5A 4LBYA 1NRJB 3ZLJA 3TQCA 4KVAA 1UBFA 4HB0A 4UNQA 5AJYA 3FDIA 3SU8A 3AKDA 3BB1A 4G5OA 2FEMA 3EPLA 4CIDA 2GBLA 2GF0A 3CBQA 1RC8A 3DM5A 1T3HA 1RW4A 1NVVQ 3QOFA 1XP8A 3CRVA 4AYWA 2OM2A 2IUSA 2XGJA 3AV0B 2W58A 1CJUC 1YHNA 2SHKA 1Z0AA 1BMFD 3SOPA 2FG5A 4A6XA 3BH0A 4JJKA 2ZJZA 1DVRA 1CP2A 2ZITA
chains in the Genus database with same CATH superfamily
1JIXA 3MYYA 4FR2A 4PX9A 5B4UA 1S9HA 2ES4A 2P6PA 4BKOA 5MFZA 1DEOA 4EECA 2PBZA 4PQRA 2YWJA 3C5WP 3V7NA 5AUPB 1SBNE 2QLTA 4HQRA 3A04A 4JBYA 1C3XA 5LYJF 3LFTA 1IOWA 1BVRA 1TC1A 2HWUA 2C9ZA 2XYPA 3KJHA 1B0AA 4EPXA 1T15A 3U40A 3MTIA 3QHQA 3ND9A 1YKSA 2QP4A 4P35A 2E48A 4NCHA 1M83A 3KV3O 1TAHA 3SVTA 1OYWA 4NS4A 2FPPA 1FNBA 2R00A 4WXPA 3IVAA 4PZ0A 4WKGA 3OIUA 3QUSA 4J7CA 3WAGA 4GWKA 1CR2A 1IXRC 1U7TA 3DV2A 3HC7A 3L79A 1QRAA 3OOSA 3DBLA 3IV7A 4S1VA 3OOWA 5REQA 1H6BA 1DPFA 1R9MA 2DVMA 3DE6X 4DIBA 3U5ZB 1ULBA 4FGZA 1QGED 2TS1A 4RF5A 1BE8A 2XCTB 2YV3A 4OO3A 1ORWA 4EZEA 3FVTA 2CNLA 3I83A 5IKPA 4Q3OA 4E13A 2PPVA 4UAVA 3A8TA 5FQNA 4W8OA 5JDCA 5T6BA 1BIFA 4YRGA 5C8DA 2AG0A 2RH5A 4MVWA 3RAEC 2AJBA 3VI4B 3NIFB 4ATNA 2MSNA 4PN3A 3FH0A 5LNK6 1WDWB 2NX2A 1EK6A 2GX6A 1SD2A 1E2DA 3OCYA 3TBHA 2RH9B 4RADA 2OBXA 3B3GA 2A5GA 2FYTA 1QIIA 2AYXA 2VHTA 5KTOA 2FDCA 3HO1A 1O96A 2Y1WA 4PFKA 4D8YA 4EJSC 4ZOQI 4PXYA 4EB6B 2BV3A 4LJ5A 1T9GR 2C07A 4E6PA 4XIGS 4Q9KA 2UVQA 1F51E 1VECA 2AZTA 2IJGX 2V3WA 2VDVE 2VN8A 2VTKA 4K6CA 4DA0A 3BMCA 3Q6IA 2CBXA 3LGAA 4D5EA 3QF4A 4LFBB 2J1LA 1VE9A 4EHJA 1C9EA 5DGHA 5HP4A 3OCWA 2BF4A 4KAXA 1JWLA 1EXMA 1JHUA 3ACCA 2VQEB 1MC5A 1YBAA 4KTVE 4BLPA 2BKAA 4BV8A 3UHAA 4Q3KA 4ZTUB 1KTVA 1JEDA 3QYPA 4B43A 1R6XA 2PUVA 4R2KA 4Q4JA 4MV5A 3RKRA 2WE8A 3V1YA 5K3EA 2H5JA 1V47A 5BOSA 5KVAA 4BDTA 3CUWA 1Q7GA 2QLFA 4TYPA 3S44A 5AW4A 3REOA 1ZD5A 2W6MA 5DYWA 4M7WA 1XCMA 3GP3A 3AU9A 4TTSA 5HF5A 1T4CA 3S27A 2B9EA 4BLTA 1H2EA 4EY6A 2VHJA 1K7SN 3BTSA 3GARA 2WAMA 4DR3B 1KH3A 3S28A 1I2CA 2P65A 2XQIA 4P54A 3BXGA 2ESRA 1PI3A 4DAEA 5H3LA 1C0PA 3IAEA 1H4QA 3ZZNA 4CL0A 2E4ZA 1ZC3A 2R8BA 1XZFA 4OHKA 2DY1A 3T7AA 1OXKB 3N8HA 2PH7A 4HH3C 3UB3A 5JS7A 4MB2A 2Y1EA 1FFXA 1XQXA 2FZGA 4LC9A 5TY0A 1Z29A 3OCJA 2PUEA 2F55A 1LTQA 3H1FA 2J4CA 1OAKA 1QNFA 3ZD7A 2D1YA 1WWKA 4FFMA 4I3HA 3D8HA 2OFWA 3I58A 4CBVA 3PUIA 1WUTA 5DE3A 2XD9A 3ZS8A 3L6EA 2HX1A 4UMFA 3DJYA 4WESA 5JY1A 1LC3A 1AQIA 4QFDA 1O54A 2QM0A 4MUHA 4WK4B 4LXTA 1EVKA 1F6DA 3BJIC 1RI2A 5FKJA 5IN5A 3RKUA 3HYTA 5CNIA 3U4CA 3CNEA 2I8AA 3O31A 1KAHA 1M8GA 4GP7A 1RQPA 5ICGA 4RVUA 3BREA 3ISJA 2MIIA 1QHFA 3KE9A 5F7ZA 5FBZA 4UD6A 1NPYA 3ZLVA 4C5CA 2CLMB 3GPCA 4MNTA 1QZXA 1CEXA 3WWOA 1P9OA 1ISSA 1R0WA 4INJA 3UGTA 4UUNA 3K4HA 5LWHA 1NM5A 2PT9A 2QZZA 3BG5A 2W8ZA 3MJDA 2YWGA 1IXSB 2R1TA 3LP6A 4WNAA 3BFJA 2P6MA 1F1JA 1PJBA 1M1YA 3BK7A 4B6PA 2CFTA 3HJFA 3HN7A 3QVKA 5DH9A 3FD8A 3HB9A 2AR7A 1TEVA 2L82A 3K70B 4I8IA 1UANA 3A05A 3GAMA 1YRHA 1R6UA 2RHDA 3ITDA 4UBLA 5DBGA 3OTIA 4JKOA 2CCJA 1GDTA 2RKWA 2XCOA 4RELA 4HN2A 2NZWA 5FBKA 3G9TA 5EJ9A 2IIBA 1XCLA 3LT5A 1LRLA 1MKYA 1N77A 3HFRA 3QKSA 3HP7A 2JLWA 3A6DA 1TVCA 3GLGB 1RTKA 3X2EA 3L93A 1IXYA 16PKA 4QAJA 4RKRA 4DLKA 5BRJA 4G07A 1QG4A 4TMFA 4DR5B 4KSYA 2UAGA 4Y2PA 4B09A 1KOFA 4E5SA 2BMVA 1V4VA 4KHZA 1PT6A 3ORFA 4LJKA 4MV7A 1B8OA 3OT5A 4YP7A 4AY2A 4J0JA 3IOBA 4GBJA 3QUTA 2JFUA 4YJGA 1GR1A 1LLCA 1WXIA 2C20A 1GSIA 3CKYA 4W99A 4WK6A 1G20A 2ZB4A 2CUKA 3RVMA 1RVV1 1DRWA 4FTWA 5LLDA 1UKAA 2JJYA 4JHLA 1G9SA 4CMGA 2COEA 3BZWA 4RZSA 1JVSA 1ESEA 1EVLA 1U6IA 3MJ4A 5H8WA 2BFFB 3X1MA 1YJ8A 4D6YA 1MFZA 4IDHA 2VVTA 2AKAB 1PJ4A 2GD0A 1TFRA 1E9VA 3LCUA 3OUZA 2NSDA 2HT1A 3VX3A 2HIAA 5IYZB 1QE3A 4KODA 5CGZA 5HKLA 3SQWA 4RHFA 3W77A 4AAYA 2DWUA 3F46A 2NU6B 4L4UA 1CRQA 1JF8A 3ZKWA 1FS5A 1Q7CA 1OLUA 3FN4A 1B41A 1WCXA 3E5MA 3X2FA 2VT7A 4C21A 4DY4A 4N65A 1IY2A 1JG4A 1QANA 3CH5A 4KQJA 3A6FA 1YC2A 2ZOSA 4LJLA 5B5SA 2Y93A 1UOEA 5AR1A 2UXDB 3DZFA 2P6OA 2CMHA 1GPKA 3CH7A 4D4GA 1VBMA 3UHPA 3QEAZ 2D5AA 3NWBA 1BA3A 4E46A 2HCFA 3BIJA 5EYPB 1FLNA 2OHHA 3HBLA 2WWRA 1USUA 2PA3A 5C1DA 5KWVA 3VPSA 1FFEA 4D9HA 2X2EA 2H48A 4C89A 1IN6A 1JDUA 2FW0A 4BLUA 1OJ7A 2VBGA 1OXVA 2ZUBA 1ESZA 3E81A 2GZRA 4Q48A 1X0XA 3H2GA 4ZYVA 4YP5A 3UTCA 1H6DA 2Z2YA 1HX7A 2CNOA 1Z12A 3FROA 4KQ6A 2AR9A 4P5PA 4HMPA 4MGEA 3PEUA 5DU2A 3TH5A 4M98A 3DL0A 3LUGA 2IITA 4I50B 5AT1A 5C3UA 1WMEA 3KEOA 4QC2A 3V48A 3GWZA 3I04M 2QZSA 8ADHA 1GAJA 1VL2A 1XCJA 4N5IX 3QUCA 1M34A 1WMBA 1AUOA 5AW1A 4RY0A 1JVNA 1H3NA 1QRDA 3E9ZA 5AD1A 4TKVA 1ZRMA 3Q7IA 5CJJA 4XR9A 2ZSBA 1SZPA 4KGVA 1N5RA 4RXMA 4X3CA 4BO4A 4YUYA 5JZSA 2EW8A 3LP8A 3L7AA 2OCPA 2OMEA 2WBLC 2YVQA 4IIEA 1ZH4A 5BMOA 3ZWMA 2XMPA 3CQ9A 5LUAA 3U44A 2G70A 4PWZA 3WLFA 3F5MA 2EW2A 5CB4F 1DWQA 4OQEA 5TGZA 4MI9A 5KNCA 3W2GA 2OD7A 1MH1A 3NAMA 5IKXA 5HJ7A 1KETA 1CLEA 1MJGM 1O03A 4Q18A 1J8QA 4KDCA 3W6ZA 4E03A 5JAHA 4WZBB 4PYJA 2FPSA 1M2NA 1JG1A 2VSQA 3D8SA 2FK7A 5KNBH 2FPMA 2AMVA 3NVMB 5KMGB 3P2JA 4S1NA 2QVZX 4JT2A 3HU5A 4PZDA 4ZCIA 7YASA 2ZS9A 5D85A 3TQFA 3SY8A 4TMYA 4DA9A 4UOEA 2C42A 2Y9PB 2CUTA 2X8JA 1WCIB 3IELA 1X7ZB 1HM5A 2YS7A 1IHDA 1BAPA 2FOIA 2VJNA 2XF2A 1Z2NX 1Z75A 5CVVA 4HGQA 3Q6NA 1DJQA 4XE5A 4OQLA 1TADA 4HI0E 3P9PA 2PWBA 4TMVA 1YDEA 4UEWA 2PR7A 3QLTA 3R9KA 4DBZA 1NJ8A 2E82A 4KQWA 3J81A 1NDQA 1RBZA 1YRWA 2J41A 3OH8A 3RHZA 3JPYA 1GWNA 1M2HA 3GHHA 3WJAA 5IJ0B 3THRA 1DO0A 1Z22A 1KNQA 3ZWQA 3KZCA 2HDHA 3THWA 2VTBA 2ZRKA 3WB9A 5CIQA 4AKGA 3MINA 4EDHA 5JIBA 2O5EA 1WZEA 1KY5A 2N9UA 1NATA 1KZHA 5EKSA 3FHJA 4G5QA 4NAVA 1KKMA 2GN8A 4Q12A 4QWWA 5EPUA 4YQEA 2Z3ZA 4ZEVA 2PRYA 4GMFA 2PQMA 4FR0A 1VMIA 3QLUA 7ABPA 1V6AA 3O90A 1CS0B 3GFBA 4WECA 4YRLA 3ECSA 2H6EA 5FB3A 5ILGA 3COJA 4ZCLA 1L5QA 1T0BA 5GM1A 1F6BA 2QP3A 4MPRA 3IJ5A 3VSBA 1A71A 3A1TA 4H35A 5SY9A 1PEKE 1G17A 3BWEA 2LE0A 1KDRA 1L4HA 2AXNA 3DYVA 1XVVA 2VF5X 1E69A 4B3XA 4ALJA 4YJ3F 3TUZC 2R4TA 2LXNA 2Q9AA 3K1AA 1KK0A 3TI9A 1KP9A 1N7JA 2QR5A 2X4LA 2I3DA 4H7PA 4OQYA 1XVTA 4XQEA 1XU7A 2OHJA 3EULA 5FLKA 5IC4A 1XZIA 4LBZA 1CNEA 3D9QX 3H84A 2JFFA 3DMYA 2H4XA 3LSTA 4MUFA 2XQGA 5ED4A 3AP2A 1P2SA 2J48A 2VT2A 4ZT5A 3Q10A 1NG1A 1Q19A 4Q3NA 4Q24A 2XCQA 2BGTA 4B3HA 2VDMB 4WEQA 5DWDA 4EK9A 2HEIA 2J7PA 2B8JA 3FLEA 3M34A 3C48A 3T4XA 3EXEB 2EBUA 1PT7A 3QI2A 4ZFNA 5IKMA 3HXOA 3QX8A 4G1CA 4U7PB 5CT6A 1UCFA 2HMVA 4XFDA 4F2GA 4FU0A 2RAPA 4M1YA 4KRGA 1HPLA 4QQ8A 3NBQA 5BWBA 1NR1A 1RXEA 2DUNA 3E7FA 1EE9A 4G5SA 2WYWA 3EZ6A 4PVCA 5FJJA 3W4JA 2AKYA 2XF8A 2X14A 3OZFA 3JAWA 4XDGA 3KTAB 1NXTA 1EQAA 4G41A 5BV7A 3HS3A 2BFEB 1TK9A 3RB8A 4RLHA 4E08A 1LPMA 4EVQA 5E4YA 1QHNA 3QMWA 2J46A 3FE2A 5TXGA 2BZGA 3NIWA 3UBMA 4JLKA 4MLPA 3AG5A 4AS1A 3K0EA 5EJ4A 2DHDA 3DL4A 1U2PA 4G5YA 3CEJA 4JYPA 4KXLA 2UVPB 1NW8A 3M1YA 2O57A 1O2DA 2PUDA 4NBWA 3O9MA 1OYVA 3OJWA 1K6MA 4HAYA 2W4IA 3NHJA 2XUGA 3WLTA 3CSDA 4K05A 1N2ZA 2G25A 1RYHA 4ND8B 4U0KA 1FP1D 1VG0B 2I6XA 2VDNB 3NHZA 4XSHA 1U7HA 5LYYA 4PIMA 3WKAA 1X8KA 2QTAA 4LF9B 4P4LA 1JIKA 1HI9A 1FIUA 2O2DA 1D2EA 1T1IA 4AMGA 4HRVA 2RHHA 1FF9A 3PVZA 1N1MA 1D07A 4G1FA 3EFEA 2C94A 3C1AA 1XQ6A 2W2XA 3QKRB 4ID9A 4XIYA 1WX1A 3SSMA 4JP8A 2GBPA 3LIPA 3L2OB 3G0CA 3JQ6A 2PO7A 5HEKA 1XAJA 3D6FA 1EPUA 2W4MA 3VC1A 3OZXA 3NNDA 2PRIA 2A5JA 2Y0CA 2EF0A 4LOIA 5DP1A 4E32A 3NDPA 4CKBA 3DJFA 2ZATA 3I1IA 4GSLA 4IO1A 3IDSA 2AK2A 4ID3A 5C37A 4MAAA 3ANXA 5JR3A 4AZ3B 4MJ7A 4LQLA 1V2GA 1T8TA 3KCNA 4UBIA 5AK4A 5H9VA 5AVYA 4I1OA 2BR3A 4M36A 3AJ8A 3B6EA 4RKFA 5LMCA 2OV2A 5LOVA 5AK0A 1DHTA 4EI8A 3C8MA 4RM2A 2AG1A 3ADBA 4AYXA 2EVWX 1CUXA 4G89A 3SVZA 1GZDA 4BV2A 3EVGA 1U04A 2WJZB 1G6Q1 4P82A 5BVGB 3VKVA 1X1SA 4CCWA 1UT8A 4BNXA 2JC3A 3AF3A 2OY0A 3BK1A 3HJBA 3Q6MA 4LFCB 1OTXA 4IMRA 4JOBA 5HZHA 2YASA 2V59A 4H15A 1O4VA 1UFOA 2WJYA 1G3UA 5ESXA 4UU8A 1KIFA 3B6KA 2VDRB 3TW0A 1WHTB 2EBWA 3GEHA 4B6GA 3SDSA 3C1OA 2REBA 3FKQA 1K7YA 3NUGA 4RZ3A 3R7LA 4E5VA 3ELWA 4L5CA 1EFKA 3SFVA 1E1QD 5AJHA 2XHEA 3QG1A 2OV4A 4KQIA 4E2XA 3ZZ1A 1P6XA 4QEKA 4U6QA 4NV3A 4URHA 4ZO9A 3QPAA 1CWUA 1PF7E 2EKBA 1D2AA 2NV0A 3NHFA 1K89A 4PLTA 1O89A 1RWMA 1TECE 2LWIA 3D8TA 2ZBDA 3H9EO 4O29A 1FX0A 4PAMA 1TLLA 1VB3A 4EUKA 2YHSA 3Q85A 2J9XB 3PI6A 4RFLA 3FFXA 2ZAIA 6YASA 1QP4A 4PQFA 4HMOA 1UFQA 4N5DA 4YAWA 1I7PA 3ZHUA 3WR5A 4AQ7A 5EZYF 2ZT7A 3ZHYA 1L8OA 4Q1DA 4AROA 3O92A 3P5BA 1Y8RA 5CURA 3FTEA 2R1VB 3OHPA 2XBUA 3A28A 3DKIA 2FN9A 1TKCA 3LL7A 3WZLA 5KVVA 4QJ3A 4PBTA 2CVHA 1Y80A 4R84A 5H83A 4HDSA 1P62B 4PRLA 4FYMA 1YGYA 3KXPA 2F1IA 2XV1A 2X9QA 3FKSA 5EZ6B 4YP9A 2H52A 3W90A 4IX9A 5LBTA 1E3TA 3KT0A 1FC0A 4GMKA 4IIXA 1NLMA 1ZZGA 4IIFA 3E9QA 3UJAA 4EA8A 4JJEA 2ZRPA 1HT2E 4PGAA 1SUFA 1WU7A 5JWHA 5B57C 4ZGBA 2C9CA 3S1AA 1G6HA 4NVRA 4KRFA 1JBQA 1OASA 3AFOA 1PDVA 1ULAA 4PS1A 4M8NE 4ARVA 5AM5A 1TZJA 1N2EA 4K9DA 2N46A 2OKCA 1Z06A 1B00A 1BXRB 4GUAA 4KFTA 4JLJA 1P2UA 4HWRA 4ZO6A 3W1EA 3NZEA 4AS2A 1B76A 4EQZA 2H1OA 1JDSA 2PVPA 1EBBA 3GUHA 3HKBA 4QU8A 5EP1A 3SWWA 3HXMA 4XA8A 2D7DA 5DTQA 3PD1A 2C4MA 1YK1A 5FI3A 4J0DA 3QXCA 2IWRA 1Q22A 4FI3C 4I2VA 3AJAA 1HA3A 1A9QA 1NJSA 2WP0A 3HJTA 1XTBA 3NCTA 5JXGA 2C7GA 3E9NA 4F5YA 1PD1A 5TQ0B 3GLFE 3AI3A 3E8SA 4MMYB 2P9FA 4GOLD 4BKQA 1QWSA 1SBQA 3W06A 2D0DA 3JQQA 2A30A 2QL5A 5DI9A 2QYHA 3QLJA 2YZKA 1A8SA 1Z5VA 2C8VA 2IYUA 4H7DA 1Q14A 1L5SA 2HXGA 4Z3DA 1L5YA 4TROA 5T4FA 3GLIE 2PYIA 3P4XA 4UC0A 3O47A 1G2OA 2D0OB 1QORA 3NHWA 4P3NA 1MT3A 1DJPA 1SHZA 1XZJA 2YZ7A 3A4LA 4QNMA 1ZH6A 4HEA1 4A6PA 4WZZA 4EGJA 5A1JA 1NKVA 1ODLA 4RA9A 4ZZ3A 4AM8A 3T3MB 2IOHA 5F1YA 4D98A 4DS3A 1RI4A 2BSXA 2XDQA 3NHRA 3QXHA 5FCDA 3UT5A 1J8YF 4CMCA 2PO5A 3OQVA 1PJ3A 3KYDB 1ES9A 4L07A 1X9IA 2Q50A 5ENVA 4NFLA 1D6MA 2IZOA 2VT3A 3RS2A 5IG2A 4OAPA 2H65A 5EMNA 1IBMB 2HMTA 3GDWA 4LNHA 4JJFA 4PZLA 2WD7A 1UR5A 2HV8A 1BNCA 4QELA 3L4BA 2ZAYA 2VRCA 4MUYA 4EB0A 4I9NA 1MCZA 1ZUD1 4LYFA 2WSYB 5KVCA 4AF8A 2H2AA 3ANLA 3ZHXA 5ALWA 1MP0A 4HDKA 4TKVB 4LPKA 3V97A 5CAEA 1IQPA 1DIBA 5K6TA 1JIIA 1SUBA 5J59A 3NEPX 5HZGA 3A2MA 4KIGA 4HVLA 2QXTA 3K6RA 4ZDKA 4LBWA 2W11A 2F90A 3LPLA 4G5RA 4R5HA 4D0RA 2IYPA 3RVRA 5AKYA 3H11B 2VQSA 1Q0ZA 3ZNPA 2OXTA 2N75A 2C77A 4C0JA 5LQAA 5LP6F 4KPYA 2YCLA 4DLSA 2IPOA 2ZAMA 4PGFA 2YXBA 2YDXA 4Q21A 5L7TA 1EZZA 3LUHA 1K8ZB 4OREX 3RYCB 3WBJA 3G79A 3ABZA 4L4XA 5DYGA 4F9FA 2BIFA 3RG8A 3F3YA 4EHFA 4K6OA 2FQ1A 4OUKX 5DDIP 4ZRDA 3MERA 3QW4B 3FZQA 5EVJA 5HIAA 5EIBC 3SNHA 1FLDA 5EP3A 2ACKA 2WSIA 2ZP1A 5EVCA 4OHCA 3TPCA 1I51A 2R6JA 3ZEIA 3SIRA 1QGDA 5EKXA 5E6UB 2Z5FA 3OZIA 2WKPA 3LWBA 4GKJB 3DM9B 4DC9A 4BGDA 1DKLA 1N5IA 1POXA 1RZRA 3PCTA 4LHZA 4L2IA 5BT9A 3UENA 2VK2A 3S2EA 4S05A 2PUCA 4ZVSA 4LGMA 2PFGA 1VB5A 5H1YA 1HDRA 4Q1AA 2FK8A 3H2ZA 3QPBA 4JKIA 4KDFA 4M1OA 1ADYA 1V5GA 2EZTA 2ZIXB 4J3JA 1L5LA 1KAQA 1KYXA 1DDIA 1L5VA 2C03A 2P9QA 3IVCA 4NHEA 4AN0A 4CKYA 3SLGA 5JPDA 3D4LA 2XYVA 5DYYA 5CDFA 4F4DA 4YIHA 5L40A 3SR0A 3KZ1E 3RRXA 1SUCA 1DQRA 5EWLB 4L74A 4IDOA 1SD1A 2IYXA 4JQSA 4QHTA 1O96B 4EOGA 3QVUA 3ZI7A 5CFMA 5HTKA 1ML3A 1NPTO 3OLXA 4MQ6A 3VZQA 3P9SA 1TMYA 1JJFA 4NRDA 3VI3B 1FU8A 1N7GA 1HTTA 1YCHA 2JHFA 2CLIB 2ZPTX 2OZPA 3K9BA 1RT9A 3MN1A 3HR4A 5DTMA 3SJBA 4CEJA 1XJWA 2JEOA 3JARB 5IKEA 1ADGA 1GPLA 3N7TA 2IKQA 1IYZA 1SXJC 2XITA 5BW6B 2B8EA 4QU9A 2G17A 3T5TA 4CFYA 4HAIA 3L4EA 3MB8A 2NN3C 4HYEA 1KMNA 4D4HA 3RUPA 2YV4A 3OZAA 1N33B 5H7XA 1EX1A 1VKOA 3PSAA 1X7DA 2I6TA 2JJ2A 2WHPB 4GQAA 5REQB 4M8KA 4ON9A 4BWVA 3FHTA 1S01A 3CO5A 3NC1C 3EIXA 3TTYA 5EWMA 1V5FA 5FUBA 4O2AB 1Y3BE 3V8EA 1GZVA 3Q88A 3K0CC 4CLEA 8MHTA 3TZLA 4YAIA 1OZFA 5A5VA 2V9ZA 2DEUA 3OQBA 1ZSNA 1WBJB 1VC2A 3ITNA 2C2KA 2R6FA 4A5SA 3FNRA 2A9JA 4HXYA 3JQ9C 1QUEA 2H51A 4CQLB 1GVNB 1AKQA 1HT0A 2JB9A 3DWGA 1OLUB 3KYDA 3LLCA 4YC7A 5GZ3A 3HK2A 4O4LB 1NV8A 1UJNA 4MI3A 3RRMA 4CDGA 1PTJA 2OMKA 4WW0A 1LBHA 2WT4A 3I5UA 1CHDA 1Z17A 1BYIA 4RIGA 3G82C 5A0TA 4QBTA 4E4TA 2E1PA 1O6ZA 2J0UA 4ND3A 3PTLA 1ZCBA 3EUEA 2CLLB 3RU7A 2OXRA 4JMLA 5ARBA 1Y1PA 2VYND 3T4EA 3PUVA 4FLMA 4C7VA 1ADFA 2YHAA 3IALA 4G65A 1D2GA 4DL9A 4YS6A 3WL7A 4UQOA 1T0JB 4XR4A 1FY2A 4IIJB 3TSCA 4KE7A 4EB6A 1ADJA 4AQDA 3MF4A 1UP4A 3FMVA 3KM0A 1C8VB 4UPEA 3KNZA 1SM4A 1U0RA 4LJ8A 1B6TA 3CVXA 2WD8A 5CCXA 5D87A 2GPSA 1TKBA 5BUCA 3OO0A 3SSOA 3DF7A 2QN8A 4I55B 2PL1A 1RAAA 2EBFX 3WP1B 3BMOA 3OF2A 3TQOA 1E2UA 1YUBA 3ET5A 2FMKA 4HYYA 4CGYA 3UJ9A 1BOOA 3GFOA 2P30A 3RHTA 4IHKA 1UBKS 4IG4A 1IULA 2NT4A 1W7AA 2WJHA 3C87A 3BXEA 3WGMA 1WXHA 2EG5A 2H08A 1RBQA 3K0KA 4U63A 4C7XA 2ZUEA 3UMJA 2WKWA 1RYNA 3HCBA 4N7BA 3AOGA 5CK5A 2ZJAA 1NQTA 3K0AB 4D3XA 5ICCA 3MMNA 1ZUIA 1G2QA 4YRRA 5KYKA 3PNYA 1TYEB 5J40A 4J2OA 3FCXA 3VJKA 5HJ2A 1GG9A 2HZBA 1HMPA 1M1NA 4EVSA 1J90A 1NOKA 4A2QA 1BG6A 3FTPA 1RRMA 1ZUNB 4F2DA 4ENVA 3KD3A 3UYKA 1GTJ1 1HZZC 3NT5A 3VPBA 1WXGA 5IAEA 2AE1A 2WFMA 2R1UA 4ND7A 1NT4A 3A1WA 4OLFA 4QDOA 4YAUA 5F9HA 2J0UB 4KR0A 3IIEA 4RKWA 5KWJA 4X64B 1U2GC 3EZ9A 3EGCA 2QE6A 4M9SA 2GXAA 2XWJI 5B4VA 1XZMA 4CV3A 2O1XA 2IXBA 4D0NA 4A36A 4P7BA 1HNZB 2UZ3A 4WKNA 2GVNA 1QTNA 1MV5A 3DWEX 2A4KA 2G28A 3F5FA 3L7MA 3VTKA 3CS3A 4MRPA 2IT1A 2QRVB 4MEJA 4LTNA 2ZI4A 2ZYGA 1JMVA 2HMUA 4OAQA 4DMRA 2PSEA 2BMDA 5EJFA 2ZRJA 3U3RA 3L4KA 1RWNA 3DDOA 1NMZA 3F7NA 4JUFA 1JR4A 1CUEA 1P17A 4RWZA 4J8PA 1QPGA 3LHSA 4A2PA 1DG9A 1VJCA 5EWJA 4ZCSA 1U2QA 1XZCA 4MVJH 1SVWA 4PYRA 4JY7A 5DW3A 4ZQHA 4ZWNA 2WHPA 8OHMA 4C7KA 3T5AA 4LF8B 2DBYA 5K6AA 4PZAA 2PT7A 2CFCA 3G7NA 1J99A 2V6JA 1DKPA 3AEXA 2XQFA 3HVIA 2HMWA 3SC2A 1TJYA 2E5WA 3DDZX 4IAOA 1JALA 5IDVA 3S5UA 3DH0A 1YR7A 5AVJA 1EFLA 1VLVA 4IDCA 1Y9EA 4D9KA 3FDZA 4M0MA 1Y1SA 2Y0BA 4R3WA 2CDCA 4FHGA 3L06A 2FY8A 1ISRA 1B0PA 3ZK8A 1TKRA 4G9EA 3KFLA 4K8RB 4DM3A 3N2KB 1KAEA 4CF6A 3BTVA 3E9YA 2Z5VA 2B1QA 4GVXA 4IYJA 1ACMA 2VO1A 2HQ1A 5A71A 4BFTA 4UMEA 4CEIA 1U9JA 2H31A 2K7ZA 1ZZEA 4L28A 5LFAA 2VHZA 3HI6A 1N3YA 4WD3A 3B1JA 3BRWD 3EEYA 5CITA 4K0KB 4X41A 1M33A 1C80A 1PNVA 1W88B 1XDUA 4R1MA 1A0OA 4XYGA 1RBYA 5EP2A 5EQTA 5HW0A 5ADVA 4N76A 1G1MA 1U28A 5EAIA 1IN7A 3IB3A 4ZI2A 1JU4A 1S2MA 3RRNA 3RM3A 2JLVA 5JI3E 3H9GA 4PZ9A 3TPFA 3UJCA 1T6ZA 1J0DA 1MFPA 1C1DB 2BJVA 4RQAA 4P8RA 3QFSA 1DADA 5F9FA 1KI3A 2IHZA 1R8QA 2C8KA 4KE8A 3FRHA 2AQKA 3ANTA 4I1VA 4NCBA 1XUOA 3B1WA 4C0BA 3C98A 2PUWA 4WJZA 4V0RA 2QV0A 2GBLC 4HAUA 4L8WB 3CVVA 5IDXA 1YR6A 4DJAA 4EY8A 3LIIA 1QRTA 4YWHA 2AT1A 4LKRA 3G9ZA 3K53A 2IY9A 2UVPA 4QPNA 4TT3D 1RM5A 4ARUA 5C32A 5CH5A 1JYSA 3PJGA 4LWZA 5EHZA 4TVOA 3ZDDA 1CIJA 4RZQA 3IHLA 2OUIA 2P0YA 2QRLA 3M82A 4TMKA 3R74A 2I71A 2OYCA 2D5BA 1ZI9A 1JP7A 2B1GA 5F5XA 4L73A 4DMLA 5LNK1 1V25A 1V6CA 4XM0A 4V0QA 2VDPB 3C2QA 5K3SA 2Q0QA 4G8CA 1YJXA 1M2EA 1P75A 3LY7A 4FW9A 4M1TA 4Q66C 1P77A 5AJUA 4UOZA 3ICQB 2B1JA 4CHTA 2QPLA 4BATA 1QO9A 1AKTA 2Z3VA 3LDAA 3ZUPA 1OKKA 4KFCA 4IDQA 3K30A 4US1R 5DYNA 4XPIA 2GBIA 1R10A 4BAZA 1YGPA 2ODQA 2PKQP 3TW6A 5LOVB 4CTNA 3TAUA 1UBTS 1IPHA 2E55A 1GU7A 1WB5A 2FSUA 1T1JA 2XXBA 4URYR 3RAPR 2CV0A 3ROKA 3IPXA 2I54A 2J5QA 3F67A 3KEFA 4MGHA 4YX9A 2RI1A 5E8JA 5DNDA 3FCUB 2PZJA 3NRCA 5KDOA 1RM4A 3FUWA 3QFHA 3UCFA 2AEEA 2C2WA 4DABA 4C3ZA 3ZIDA 3QV2A 4NBKA 5AK5A 1ZDMA 1JLHA 4AJLA 4L9SA 1U0OC 2VNJA 1P73A 4K26A 1MG0A 1YRYE 2X1MA 4N0EA 1BXGB 3RS0A 1FX0B 4K2AA 3FBTA 3ZDEA 3I45A 3IA7A 1TQ8A 5KBYA 3IAS6 4B83A 5HZKA 3B52X 4QDZA 4WFIA 1GKKA 2WUGA 1HFEL 4F60A 4ZN6A 1KORA 4JI3B 3RIEA 1TUBA 1NI4A 2B35A 1TF2A 3RYHA 1Y9ZA 4N9WA 2HDWA 2Z6QA 3STWA 2F3SA 3DDSA 1G3MA 3ZH2A 3IGFA 1XDZA 4YACA 4HLQB 3R3XA 1S2NA 4DMUB 1EWQA 1PJCA 2BEWA 3VHXA 1R4NB 3R7BA 1KEEA 1KQOA 3VNUA 3BMNB 3B60A 2P5UA 2MR6A 2QWXA 4R40A 1FTNA 4P0TA 4RE5A 3LUAA 8LDHA 4ENWA 4B5LA 4M0PA 3LW7A 4ZVTA 4DUYB 1LD3A 4Y3UA 4TLEA 1GA1A 1XZHA 2I78A 2ZRMA 2ZVQX 5IHXA 4Y1EA 3WKEA 1PK8A 3PUZA 1J09A 2DFKB 3EIOA 4YRCA 3O8BA 4HUQA 5F1OA 4YHHB 4B3SB 1KVSA 4AYTA 1EFDN 3EARA 2BFDA 2BHLA 3I42A 2C0PA 4EFMA 4XCXA 2I3ZA 1KIAA 2IXAA 2G06A 3R44A 3WIUA 1O77A 3KQQA 3EQ8A 4FFRA 4HWOA 3DO6A 3VR4H 3VO1A 4DKXA 2IS1A 1PR3A 4IJ6A 4URZR 1ISJA 4DHEA 2ZE8A 4K81B 1QV6A 1AS3A 4QTYA 1YHYA 2XLCA 3OLCX 4IMJB 4DYHA 1PT5A 1WVIA 3IULA 3EOBI 1WD7A 1GRNA 2YJGA 2HXYA 4IILA 2NO7A 1JKXA 3D5QA 2GXUA 1ZAKA 2FSIA 3TAXA 2QN1A 4XFJA 2EGUA 4Z7OB 1OH8A 5HDBB 1XD8A 3ZE1B 2AHOA 3OQMA 2DPLA 2QUZA 3TW8A 4EKGA 2NXCA 1ESCA 3N6XA 2VTBB 2QUAA 4RK0A 4DSZA 8ATCA 4ROTA 4ZZ2A 3WYGA 1DOZA 1N2CB 1H4VB 1KJZA 2BLNA 2P2DA 4FYHA 1M5UA 1H1LA 3QX7A 4M6WB 1SXGA 1ZCAA 2DTXA 2J08A 2Z1MA 1OIWA 4C0QC 3T3OA 5HM8A 3EZ2A 1W2HA 3D0QA 3W8RA 5TMBA 1FMLA 1NI3A 4JROA 1T13A 1PS8A 5ALFA 3ESAA 5DX8A 2ZIFA 3DDUA 2HPHA 3OEEA 4X20B 4X9XA 2NSJA 3R40A 4BBPA 4I4TB 2LDXA 1AGRA 2QMHA 3SS7X 4FWIB 5IP5A 4BEJA 2XVYA 4ND6A 1U0EA 4P4TA 3SHOA 2I91A 3RSLA 4X3PA 1BCRA 1UIRA 1H2WA 2CV1A 5IVPA 2NP6A 2FH5B 2C5GA 2LCFA 3GT0A 3BL8A 2SKDA 3AR4A 3PGVA 2GARA 4JUCA 1DIHA 4F4FA 4MIKA 3R7FA 4X63A 2JAXA 5DKFA 3KVOA 4GYJA 5TT0A 2PXXA 4ASUA 2I03A 2CZCA 3G5MA 4WCFA 1NT2A 1Z07A 1EFVB 3PQFA 4K1XA 5CIYA 4WNCA 1OILA 4MW2A 4MYCA 2VK1A 3RO7A 4LVCA 1B3RA 1R0RE 4X97A 2Q2WA 1G8FA 3KKLA 4BMZA 5E9JA 3Q8MA 1JFFB 1BDIA 1LSUA 2EJBA 1NHGA 4BNFA 5LM3A 2IOFA 4OHFA 2C83A 3BERA 2IV7A 2B98A 2QX6A 3I04A 3DWIA 2GLTA 4ENUA 3RSOA 5HG0A 2PL9A 4OX9Y 4R2MA 1XP5A 1DEKA 1RYMA 1BEUB 1Z8NA 3HB1A 2AX3A 4CM8A 3P2IA 2BE9A 3N2ZB 5EGNA 4LGYA 2OBYA 4Y98A 5I7WA 1QHSA 1JNXX 1VJTA 3BC1A 2OO5A 2X3UA 5CXSA 2F3RA 3SQDA 1F8GA 3QPCA 1XTRA 2PS9A 3OESA 1NWHA 5JD5A 2QG4A 3I61A 3BB3A 2W2MA 3PDCA 5BUQA 5E0KB 1UC9A 1TAGA 2XTZA 3HDYA 3CUVA 3UMCA 1RCTE 3DC2A 4WMLA 3RI3A 4CMEA 2FR8A 5AI8A 1C4WA 1JH9A 2QLLA 1XVLA 2QROA 3WIEA 4FT4A 1R6AA 5KOJB 5LQNA 1NN5A 4E7OA 4JT9A 7MDHA 1D4ZA 4DCMA 5DK4A 2GCPA 2K4MA 2VNKA 1UQTA 4A8JB 1QRSA 3QPUA 4BVHA 4R41A 2CE2X 2X5JO 1ODIA 1P8AA 1K7FB 1NBMA 2J9YB 1FVXA 5FPYA 4ZV9A 3T3GA 1V1JA 2MTBA 1DX6A 4EQ6B 2X8JB 5IF9A 4GEGA 3RNLA 1TIBA 3KQUA 1Y3HA 3S1SA 3WMFA 1EG7A 2FWNA 4DB2A 1US8B 2OORC 3TOZA 5J4LA 1NVWQ 3E3OA 3PLNA 4Q39A 1EP1B 4B7ZA 2F62A 2HKIA 2J45A 4HDCA 1Q17A 4PYLA 2JH9A 3EMKA 1MB0A 4W8GA 1QK4A 5DHPA 4UEQA 2FN8A 4YA6A 1KC1A 4NCNA 5EKDA 1Y82A 3G85A 4OHMA 1AN0A 2YBDA 4UU0A 2CBGA 4MRMB 5ULLA 2ODWA 4PHCA 4OIMA 2OSVA 4BNMA 2OVFA 5BMVA 2MT9A 5A04A 3FI0A 3GCZA 3S68A 4EYEA 3ZQUA 2GB4A 3DFZA 5EIFA 3BIXA 5FA5A 5T7BA 4G4SP 4Z8YA 3WLRA 4M7RA 5JCJD 2Y1XA 2O06A 1C9KA 4OXXA 3RC7A 1EHCA 4GNRA 1COWD 4A5OA 5ALZA 2VH1A 4R2WA 5BUZA 1FYFA 6CHYA 2QAIA 5F1PA 3LLVA 2J4FA 3F0TA 1AX9A 2HWXA 2WPDA 3BE5A 5JALA 2EWVA 1EWTA 3OE7D 2H1WA 3GFVA 4U9HS 4AXBA 2CNNA 3E70C 1NVEA 3A7DA 1WNFA 2UZ0A 3Q3HA 3O9VA 1N36B 1GILA 2P4HX 5MGNA 3NYRA 3KJZA 3CVYA 3KUDA 3RANA