2GDJA

Delta-62 rada recombinase in complex with amp-pnp and magnesium
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
260
structure length
237
Chain Sequence
b'GFKSGIDLLKQRSTVWKLSTSSSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEFLFYDEEAVSKGEVAQPKAVYIDTEGTFRPERIMQMAEHAGIDGQTVLDNTFVARAYNSDMQMLFAEKIEDLIQEGNNIKLVVIDSLTSTFRNEYGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVGHAATFRFFVRKGKGDKRVAKLYDSPHLPDAEAIFRITEKGIQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and recombination protein radA
publication title The Rad51/RadA N-Terminal Domain Activates Nucleoprotein Filament ATPase Activity.
pubmed doi rcsb
source organism Methanococcus voltae
molecule tags Recombination
total genus 85
structure length 237
sequence length 260
ec nomenclature
pdb deposition date 2006-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gdjA00
2QA5A 2Z6VA 2E87A 3AKCA 4FMCF 1E2FA 2CNWD 4D4MA 2J9RA 3LY5A 4RKFA 3PVSA 3RS0A 3ETLA 1OH8A 4HAXA 1UEIA 2E1RA 2QROA 5EUMA 4QBGB 2XX3A 1CR0A 5E7MA 3IBYA 1GKYA 2PZEA 3KB2A 4LBWA 5DHAA 4TMZA 4HAWA 2HEIA 5DE3A 3W5JA 3PQCA 3SJAA 3THYB 1FQJA 3HDTA 2OFXA 4DSTA 3K09C 3OESA 2CK3D 3VR4A 2KBFA 4QM6A 2GXQA 4KBGA 3F3YA 3FHTA 1QF9A 5AJVB 3MWYW 2ZYUX 5ELXA 1TEXA 4JVMA 4BFVA 1UEJA 5HKKD 4BFXA 4KO8A 3ICQB 3KXIA 5EQTA 2XAUA 5C4MA 1TMKA 1I4DD 4ILEA 3W3AA 2D4HA 4BLOA 5CIQA 2QE7D 3QXXA 2NG1A 2IUSA 4PXAA 5FOVA 3EARA 4PQFA 4NONA 2FDCA 1XNJA 3UG6A 5H8WA 1CBUA 2BMDA 1CTQA 4MRVA 1DBSA 5DH9A 3CF2A 4CW7A 3EPHA 4P4UA 3GLGB 3U44B 1K5DA 5DNYB 4FWTA 4LJ9A 1N6NA 2JLYA 1E2JA 2FNAA 1JR3D 1ESMA 5K8TA 1PJRA 4RFVA 1Z0FA 2NO0A 4PC6A 1M8PA 1F2TA 1TU3A 2ATXA 3CRRA 1IXZA 3TUZC 1Z63A 3BB3A 2RAPA 2O8EA 1W0JA 1KNQA 4DRZA 2AX4A 2R8RA 4F38A 2GTPA 2OZEA 3SFVA 4L8GA 5JHHB 3L0SA 1KZGB 1XTSA 1W49A 1AS0A 2PMDA 5KYKA 4LC0A 3A1WA 3B8HA 2HLDD 3MRSA 2VPPA 3LLMA 2D7DA 1COWD 3MLEA 5FI1B 4LHVA 4LV5B 2W0SA 1DAHA 3UK6A 1OH5A 4FINA 4LV6A 3KKPA 1TQDA 2NPIA 3RS3A 3L8YA 4BQSA 1T6NA 4A92A 2YKGA 2H18A 1HTWA 3CBQA 2FGJA 4ITRC 2F43B 3LBIA 5EZ5A 3CR8A 1K8RA 2HDNB 2EFGA 1Z29A 1OXVA 4URWR 5E7IA 5LD2C 3IO3A 1W4RA 3EZ9A 2GCNA 8OHMA 1KAOA 2ZE6A 4C2UA 5LPNA 2A5DA 1A82A 4X8HA 2EU8A 3WP0A 1TADA 1I2MA 3I8SA 3K8YA 5FI0B 2BV3A 2QAGA 2Q6TA 3B85A 1M34E 4JMPA 1MO4A 2ZRPA 4MUBA 5FTLA 3THWA 4D26A 3RWOA 4A1FA 1Z0IA 2Q3FA 3CWZA 1IN8A 4YQFA 4A0RA 4IVPA 1II0A 3RRZA 4BASA 3QPVA 2JLQA 3CLVA 1OLOA 2H1LA 1T3SA 2ZIAA 2J59A 2V55B 4MRRA 4WIAA 3WYGA 4CIDA 2C03A 1NG9A 4LJ6A 4CEIB 2KSQA 2Z5FA 1E4YA 3CF0A 3QBTA 2VHTA 4D0NA 3LW8A 1L8QA 1YZUA 2WWWA 2MMGA 2EFEB 2ZYVX 1W47A 1Z07A 3QKRB 2FE4A 4LV8B 5DI9A 3H86A 3AVUA 4V0NA 3Q8XB 1N5LA 1RRPA 4AG6A 3QKSA 1DAMA 3ZIAA 4Z8XA 2O0KA 4B71A 3VR1A 2FN4A 4DCSA 4B3GA 2WV9A 4QGAA 1F2UB 3WRYC 4JT2A 5HCIA 1NMZA 1KO7A 2PLFA 4HAVA 4M1WA 3HPRA 3X1XA 4B6EA 2GAOA 3MGCA 3PEUA 1XEWX 1E0JA 4Z54A 5FBQB 1XX6A 3LAWA 4M21A 1VCOA 4Q4AB 3B1XA 4LYAA 4B2IA 4LRWA 4AD8A 3CX7A 1OT3A 3ZDQA 4C0AC 3WMEA 1NJGA 4M8NE 3R9IA 4LBVA 1JB1A 1XDBA 2VP6A 2GHIA 4PQYA 2WSSA 1W0JD 1IY0A 3E5HA 1TEVA 3W9YA 1AQUA 3K70D 1NVUQ 1DAKA 3UMRA 1K5GA 2UKDA 3TW4A 5J4HA 2R44A 1QG4A 5DI3A 1UBCA 1W0KA 4Z51A 3QEOA 1LF0A 2QG6A 1KY2A 4WVFA 2NO9A 3JZMA 4KBFA 3QXJA 4QNMA 2G6BA 2JASA 3B1YA 2ODWA 2OBMA 2VHCA 1OW3B 1KHTA 2GVZC 3VKWA 1EK0A 2IT1A 4JBXA 4QGFA 4GL2A 4Y0AA 4L9WA 1R6BX 2ZREA 4V0ME 1JJVA 4UXHA 1XXHE 4WAUA 1E2NA 1ZP6A 2VLIA 1SVIA 4FWIB 4M1TA 4DDUA 3U3OA 1VG1A 1ETUA 2BIFA 3TUIC 1W36D 2IX3A 1VKJA 1LS6A 2EFDB 1NLFA 4KCGA 4JLBA 4OQFA 4GOKA 1HV8A 2CJWA 5JI2E 4URVR 1OIXA 1EFUA 1S96A 1X86B 3NIBA 3SE0A 1YZLA 4AG5A 3X1WA 4RFSB 5JEDA 3Q5EA 4JKIA 4L5BA 4XSHA 2XNSA 1CR2A 1G41A 4WBSA 4MGZR 3RLFA 4BE7B 2WMOB 4C4PA 1EFHA 1LS1A 4B33A 3TMKA 4XSGA 5KDOA 1JBKA 3GPLA 4N3NA 5G40A 3WNCA 4QHYA 5FOUA 721PA 1D8TA 4IXMA 4JLNA 1KDRA 4FMBB 1UKEA 2H17A 4DKXA 4JSYA 2O8BA 5TVKA 3BH6A 1DEKA 2ZS8A 3WNBA 2W2XA 1Q20A 5AWFC 1VCMA 3R7WB 4A2PA 5B58C 5IT5A 5BYJA 1IXRC 3ZIAD 1XPUA 2OCYC 2FJUA 4H1UA 4LYJA 3CRMA 1KI7A 3IPXA 4X8MA 2ORVA 4IOKA 3VMFA 2V6JA 5CLQA 3SHWA 1W44A 5B2ZA 3OHMA 4Q9HA 3GFTA 1OYWA 1ZC4A 2YWHA 3PIRA 2WWYA 4B35A 2ZR0A 2ONJA 5E4FA 3FB4A 2EFCB 3ZZ0A 2XTMA 4TZ0A 4TL6A 1NY5A 3EASA 2ZPTX 1P2SA 2F1IA 5IDVA 3BOSA 1PUIA 3SC3A 1P2UA 1GDDA 1Z08A 4JLOA 3SOPA 5J47A 2FMXA 2IYVA 2WSSD 1Y3AA 1DVRA 4NDZA 4A8JB 1OFIA 4M53A 2G3YA 4Q1EA 3CH5A 1JAHA 2AWNA 3QPWA 3K09A 4IEIA 3IILA 1D6JA 3I3SR 4LHYA 3MWLA 3OF5A 1RIFA 1W0KD 2CEAA 3QVVA 2PL3A 4Q4JB 1WE2A 1OFTA 4M1OA 4O2LA 5BQ5A 3GLFB 2JJ1D 4IDOA 1RJ9B 4YONB 4EQ6B 3EC2A 2GDJA 3QBVA 5FPYA 2GCPA 3Q7PA 2ZI5A 2ZSEA 3IQXA 3VR6A 2HT1A 3S1AB 1KK3A 2FSGA 1FNNA 1XTJA 5JJLA 5F2EA 1E2IA 1C4OA 1W4CA 1II9A 3VR3A 2GESA 3R20A 4LI0A 5A4JA 4I1SA 1Q1EA 5C46F 5KU1A 4Q03A 4IVRA 2A78A 3NBYC 4V0MA 1XXHA 1KI1A 4EPVA 1T5LA 2AD1A 1P9NA 1P6XA 4JLKA 3LH5A 4D6PA 5FTKA 5L3QB 4DEXA 4ESHA 1N6PA 2ZS9A 1J8YF 1E2PA 3NH9A 1AS3A 1CJUC 3CRVA 1TU4A 3EZ6A 1OIVA 3T06B 2B8WA 3BORA 3PUVA 1JQLB 1G3RA 1W5TA 5EP1A 2ONKA 1VG8A 3UATA 3U7HB 4AKGA 4TQ9A 2Z0MA 1R10A 3A1TA 4KVGA 3VTKA 5BN3A 3K0FB 2IW3A 4TMXA 4E03A 3IKJA 3UMFA 4MDEA 4MKIA 1FP7A 2QSYA 4C7OB 4Q9LA 2G9NA 1QHYA 3CNOA 1GTVA 2HT6A 4Q4AA 1KGDA 4W7SA 3AH8A 2WIBA 4GSYA 4TLAA 1Z8FA 2RGEA 2ZE5A 4HAYA 5A0FA 1ZM3A 1KI4A 1CR4A 4IOLA 3MWKA 1CKEA 2W6IA 1U0JA 4B3BA 3RSOA 1HE8B 4NH0A 2NO6A 4MRNA 3DKPA 1T3LA 1G8PA 1JXOA 2J3EA 3LW7A 2BKUA 4POAA 1OH7A 3C8UA 2OILA 3K9NA 4OI2A 3RDPA 5KPDA 1BH2A 1NN5A 2IUTA 5AK0A 1N0UA 2FSFA 3SJBA 4ZDJA 1E2QA 1Z47A 3FHOA 5M04A 3PJRA 2Q3MA 4AKEA 1P3JA 1E96A 4BLQA 1D9ZA 3FE2A 3LRPA 4MA4A 3NC1C 4DWJA 4E07A 4TN1A 3AF4A 4P31A 4KFRA 4B2LA 5F3WB 1D5CA 3PITA 1G291 1WXQA 3NH6A 4DLZA 1QBKC 2WJHA 4A9AA 4B43A 1T3HA 3FYHA 4DBLC 1A2BA 1GITA 2FFAA 2NIPA 3L0IB 1E9FA 4NYMQ 4TL8A 4D25A 4KITB 2J0UB 521PA 2PJRA 4I1OA 1JEDA 4NCJA 4DCVA 2FU5C 3WRXC 3EPLA 3IUYA 4A6PA 5FBLB 1XZQA 4JLMA 3CNNA 2HYIC 1XU4A 4UKDA 3CW2A 1XD2A 1J99A 1P4SA 5JLJA 1NP6A 5EE5B 5KUTA 3TSOA 2REOA 1YVDA 2B7BA 2UZ3A 3B82A 4MITA 3TSWA 2F9LA 2QBYA 4TTRA 3E1SA 4IDHA 4DLSA 2P6UA 4GZMA 4L16A 4QBIA 4JVLA 1AZTA 4JVNA 1OV4A 1H8ED 1S3SA 1ZRHA 2FG5A 2RMKA 3O47A 4RCYA 4V03A 1JR3E 4TL7A 3ZYCA 1SQ5A 1E9AA 2ZXUA 1AK2A 3FTQA 2EQBA 3SS8A 4ZDKA 4M2LA 3LA6A 3QKUA 1GKUB 1ONBA 2O52A 2WBLC 1G19A 3U6KA 2QTFA 2DHRA 4WZBE 2F9MA 4Q21A 1E69A 4LWZA 3CX8A 3W8NA 4ARZA 3T34A 1GIAA 1U2RA 1IN5A 2KB0A 2ZI6A 3ZQJA 1JEEA 2DBYA 2QM8A 2ZRLA 2D62A 4QC2A 4DCTA 1ZUNB 3U2QA 1ZUIA 1SKYB 2KE5A 3W90A 3HP1A 4AWXA 2CCGA 1N6HA 2PMKA 1UBGA 3FVQA 5AUQA 3A4NA 4JYCA 4A15A 1II8A 3L82B 3VQTA 1T8TA 3U4QA 3AKDA 4ZKDA 2ZJYA 5GADl 2JEOA 1YR9A 1F2TB 3AF2A 5DLQC 3QG5A 5JJIA 2FWRA 2O8EB 4NL4H 2A5FA 1R0WA 2OE2A 4BFTA 4GOXA 4PZZA 3BERA 2W6ID 5AR1A 4M4SA 1HA3A 3SI7A 4G1UC 4HDOB 3VNVA 3ZVNA 2GXAA 4QG7A 4GI7A 2GJSA 3K70B 3ZQ6A 3NC0C 1VECA 3HR8A 3FGNA 4Q19A 3UWOA 2QEQA 2BJVA 5E95A 3WHLA 3OE7D 3QEJA 2N42A 2JIZA 3CRQA 5KNDA 1E1RA 1KY3A 2WWGA 4BZXA 4F4JA 5CB8A 4F91B 2HJVA 3P27A 3ZD7A 2JDIA 4V0KA 1G5TA 1U81A 3TUJC 4KJZA 3QXCA 4XWOA 1I2DA 3B9PA 3V9PA 5JMTA 4GP6A 5EJEA 1DO2A 3IO5A 2QSZA 2BCGY 1G8GA 1MO3A 1QHSA 2ZJAA 3S1AA 2CHQA 5KNCA 3TJZA 2REBA 4O25A 4URXR 4AURA 4EFLA 1NSTA 3OEHD 1S3GA 4BFWA 1SULA 1ZU4A 4LJ4A 2FOLA 3GJ5A 3U3KA 1VIYA 1OFUX 4KSCA 5JWRA 1W36B 2J0QA 4P4SA 2IA5A 1JPNA 2IWHA 5JRJA 2FPKA 1XPOA 3LVQE 1LV7A 1V5WA 1N6IA 2VO1A 3CZPA 1RYFA 2QAGB 1UKVY 4JZKA 1WB9A 3VR5A 1A4RA 1NMXA 1HQCA 4A0FA 1LY1A 4ZI2A 4P32A 5L3QA 1Q12A 2CCKA 4R2IA 1F6BA 1N5IA 3SYLA 4ACBA 3AF1A 5K8LA 4OQMA 4AK9A 4PHGA 5UKDA 2MSCB 5TXGA 1UPTA 2WSMA 5AJZA 4TWZA 2FV8A 3GJXC 3I5XA 5KTYA 5GJBA 1KDOA 1XMVA 3QXHA 4Q7MB 3RS4A 3D8BA 5EP2A 4PPGA 3HJNA 3OIVA 3ZVRA 2Q21A 2YHSA 1YR8A 1T9HA 2QPTA 4IRUB 5G3YA 5CB6A 1VTKA 3KKNA 1W7AA 2J5XA 4Q5IA 4YC7A 5J4VA 1HURA 2CVHA 5JI3E 1YHNA 3H84A 2O8FA 3QKSB 4GMXA 3I73A 3IIKA 2OV2A 2VTKA 1OYYA 1SVWA 1TUIA 1EWRA 2VRWA 1NIJA 1S4QA 3SEAA 3LBNA 3LO5A 3OAAA 1UDWA 1EX7A 2ZRDA 4TQUS 3P26A 1U94A 1JI0A 2IYRA 4U02A 1P73A 2DY1A 4M1KA 1G7SA 4HUQA 2HLDA 3PCRB 1M1YE 1MABA 2W0MA 3QY0A 2Y8EA 2VF8A 4UQOA 4IFBA 2WKPA 4JJKA 4KHZA 5KDLA 2P65A 1LW7A 2VP5A 1RYHA 2XB2A 1ZD1A 4FXPA 2QTHA 2VHUA 5L3VA 2R9VA 2VHQA 1W4BA 1E4VA 1KK2A 4QKQA 2FF7A 1VCNA 4JT4A 1VYTA 3H4MA 2GNOA 3SJCA 4P3YA 1VG0B 5DI3B 4FMDB 4QRHA 5EXPA 1E1RD 4KVAA 3KKMA 1HT1E 1YZNA 2C77A 2FZ4A 2JDID 3GP8A 1R2QA 2NGRA 3QVUA 4IVQA 5FUWA 2BMEA 4PAOA 3DEFA 3BRWD 3UMSA 2VP9A 1XEXA 3QXSA 2A7QA 3ZS8A 5D3MA 3Q5DA 2V4ZA 5LBIA 1Z6GA 4QOSA 1NG1A 3QPUA 621PA 2J0VA 1KAGA 3RS2A 1HE1C 3X1ZA 2WVJA 1ZCAA 4NBSA 1W2GA 1R8SA 1PLLA 1AKEA 3SNHA 4M9XA 1ZM7A 1NKSA 2WWHA 1D2MA 3U7EB 3CONA 3K9HA 2QTVB 3T1VA 2CJWB 4QFMA 5SZKB 1Q21A 3BWDD 2GCOA 1G7RA 3TK1A 2ERXA 1DG1G 2JGNA 4WW0A 1VYVA 4RZUA 1ZNXA 1OFHA 1E6CA 4C2TA 2DWPA 1A5TA 4BRUA 2XEXA 4WZAE 2AK2A 2WOOA 2JAQA 4LHWA 4JJZA 3GLHA 5FL7A 1NN3A 4FCTA 4MRPA 3X2SA 3CH4B 4DLVA 2QZ4A 1GUAA 2GEDA 3DMNA 4ZCLA 4FN5A 4C30A 2ZU0C 2LWIA 2N46A 3D6TB 2O8BB 2G1KA 2ANCA 5FBVB 4ZIRB 1VDZA 2YV5A 1EFTA 2J7KA 1Y63A 3X1YA 4D4LA 4MUAA 2NOAA 3OAAD 1KTVA 1S9HA 3FOZA 1FOEB 2CE7A 4M9ZA 3LV8A 4EUNA 4HDQB 3PV0A 3JZAA 3P20A 1H65A 1FPMA 1MO5A 4I1VA 3RANA 5FBRB 1XFAA 1X8KA 2V7QD 1J8MF 3F8TA 5JFGA 1BS1A 1JQJC 3V00A 2IYLD 4A4DA 1Z83A 1ZMXA 1GWNA 2ZRIA 1R5NA 4KV9A 2AWOA 4BLSA 4CEJA 1CEEA 1X1SA 1N6LA 2FSIA 1EGAA 5J4KA 3LBHA 2ZTSA 2D2FA 1O3YA 3NHAA 1M7BA 2ZR9A 4F7WA 4TL9A 3KDSE 4B3CA 3VNUA 1KJWA 2G0TA 4XIGS 4UJ3A 5FR2A 3KJEA 5LDDC 2R2AA 4G5QA 4TYWA 3GFPA 3ECCA 2R65A 3CR7A 4BFZA 3BFVA 1G17A 5FOWA 3Q7QA 1R0XA 2QY9A 3LVRE 1XJ0A 4EDHA 4QM7A 1MKYA 3WMFA 2P5TB 2P67A 3RC8A 3EPJA 4DB2A 1ZNYA 3GJ8A 4WXRA 4D2IA 2HCJB 4DDTA 5HTKA 3Q85A 1Q22A 2XJ4A 3A8TA 1Z6XA 1G7TA 3A36A 1IXSB 4CF7A 1RFLA 3F5FA 1RW4A 1XXHB 4US2R 4HB3A 4GNKA 4JLVA 1U8ZA 5FR1A 4MKGA 3G5UA 3T5GA 1WF3A 1IBRA 3C16C 3NKVA 1FL9A 3SBEA 821PA 4BFSA 3DOFA 1KI6B 2RGGA 5KSOA 3DKVA 1T91A 2XOKA 4O3MA 4O0MA 1NLYA 2ZR7A 5J4LA 3T1TA 2FPMA 1XCMA 1E2EA 1P5ZB 3T1OA 1XJQA 5FL7D 2XTNA 4MH0R 1KNXA 1TF7A 4NP6A 1OB2A 3AVQA 2RGDA 1OB5A 3FKQA 2DFTA 2RCNA 4IDQA 4RSGA 5FOTA 1ZINA 2QMHA 2FFQA 4MKHA 2V9PA 1WA5A 3TQCA 4KODA 2ZUCA 4J0QA 4Q1BA 1WDTA 2GKSA 4NCNA 2PJZA 4Z1MA 4TMVA 4RD3A 4PR0A 5LD2B 1IOZA 3AP2A 1IN4A 2ZJ8A 3EC1A 1KK1A 3NTUA 3PEYA 3NBZC 4Q7KA 4KFTA 3FHCB 1AJEA 1KI8A 1N2CE 2OFOA 3KTAB 1OH6A 4PX9A 1SXJC 2D06A 5AJYA 4X8LA 5DSZA 1E9RA 3NBFA 3GEEA 1R4AA 4DLWA 5FPHA 5J40A 2REXB 1E2KA 2JJ1A 1Z2AA 2WPDA 5CLLA 2XXAA 4KU4A 4OQXA 3B9QA 1NLZA 3VKHA 1UFQA 2H57A 1LVGA 1IJEA 4B3DA 3MUFA 3B1WA 3M1IA 1MR3F 3DHWC 4XVUA 2BC9A 1KO4A 2ZSDA 5KO2A 2LCFA 1YE8A 4LJ8A 1A1VA 1E0AA 4HATA 1D2EA 1Q3HA 1E9BA 2OCBA 4PFSA 2QNRA 2PX0A 1IJFA 2X77A 3K0EA 1UKYA 3TW8B 3K9LA 3LFUA 4A2QA 4JS0A 2XB4A 1XMIA 2FA9A 4GZLA 3O8CA 3K0SA 2IF0A 2RGAA 4I81A 4NCIA 3RSLA 1K6MA 2YJTD 3DZDA 1TF5A 3IBGA 4TYYA 5SZHB 5TARA 1XD2B 3TVDA 1XTQA 1NVVR 2R6CA 1DARA 1KMQA 1Z5ZA 1KO8A 2QBYB 1E2MA 3KQLA 4AI6A 1D2NA 1G5PA 3BB1A 2NO7A 2IK8A 3P4YA 1GG2A 3I32A 2WM9B 2A30A 1XCPA 3N2EA 4XTRA 3AGPA 1DAIA 1MH1A 1IM2A 2FFBA 4KYUA 1IQPA 2KBEA 2ZAOA 1KO5A 1OIWA 2PCJA 1PLKA 3FMFA 3THXA 4LHZA 1A2KC 5B57C 2EW1A 2ZRKA 1TAGA 2AXPA 2CMKA 1OHHA 1TNDA 4ZIRA 1DOAA 5IF9A 3A4MA 2WWIA 3REFA 4ARZB 4EPYA 3VU9A 2CLSA 1AN0A 2XOKD 3LX5A 1LTQA 3SQXA 2EFHB 3AVVA 1WP9A 4F4IA 1G3UA 4IKEA 3A4LA 3FMIA 3SBDA 3NG1A 1KI2A 3GLIE 1ESNA 3T12A 2WJIA 4CRWB 2VBCA 1J7KA 2IUUA 5JJKA 2Z43A 1P7CA 2JCSA 1UBFA 2CLCX 4LC1A 1II8B 2B7CA 2BEKA 3LX8A 4C0KA 4F92B 3U4QB 1XPRA 2XSZD 2AHOA 3PENA 4L4UA 2IYTA 2WJYA 5SZJA 2ZVQX 4Z1MD 4B6FA 2ZI3A 2ZITA 3GMTA 4YDSA 1VPLA 5FTNA 2ZRFA 1NL3A 1U8YA 4XH9B 2X19A 2F3TA 3K0AA 3VR2A 5HR5A 1YQTA 4AIIA 2DWOA 1YKSA 2EWVA 2YZ2A 1E9DA 1HQYE 1P72A 5JWOA 1ZW6A 4HSEA 3UG7A 4N1AA 2ZRAA 4Q47A 3SU8A 1P61B 4MQBA 4DZZA 4EPTA 2WPDD 4Y0VA 5CM8B 4GMDA 5TDHA 4H1VA 3A1SA 4TTPA 5HZHA 1CR1A 2A5YB 2MSEB 2UVQA 4EIWA 1CRPA 1FUKA 3Q3JB 2Z4RA 4RD2A 4DSUA 2BM1A 1SZPA 1AKYA 3PUWA 4XTCS 2ZRMA 5KDDA 3HWSA 1H8EA 2BMJA 4KLZA 4P4SB 4M22A 4YMTA 3U7GA 1RE0A 3X1DA 4A6XA 4OI4A 2GBLC 2IXFA 4IJMA 4NZYA 5K8UA 3CPJB 2H8KA 1S2MA 1MRSA 1GL7A 1CLUA 3BXZA 2ZANA 1M74A 1YRAA 1FUUA 2WWFA 1SXJE 1U99A 4B3FX 4XWAA 4Q9IA 1GRNA 4C3ZA 4OI0A 4P0TA 4XD7D 1KI6A 1IAQA 4RZ2A 1RRFA 4RD1A 3RRMA 2C9OA 2C2HA 5KNBA 1B23P 2QT0A 1G21E 3B78A 4JYBA 3ZVMA 3BC1A 1GRRA 3A6PC 3PUYA 1PV4A 1GM5A 1HEIA 2EVWX 3NDPA 1OPXA 1XTRA 2XNDA 4GPTA 1JAIA 1P2TA 3EAQA 2ZU6A 3EIEA 2F55A 1KYIA 4IHQA 2Z83A 1G4AE 4MGKR 1S0UA 5FFMA 2F3RA 1JNYA 1ZD9A 5BXQC 3BB4A 2OXRA 2WAXA 2GXSA 4LY6A 1J2JA 1OHHD 1QHHA 5BW8A 2O8FB 4QBHA 1NVVQ 1Z6AA 2VYFA 4B48A 2ODEA 1ELOA 4HI0E 2DFKB 1W2HA 4MYTA 2FX3A 4M1YA 4OBEA 4RZ3A 1XEFA 3QQ5A 3AUXA 5L8VA 2QU8A 4NE2A 1CJKC 1DE0A 4HUQB 4DVGA 3KTAA 4EFNA 3OE7A 1MABB 2FSHA 1JECA 1NVXQ 2BM0A 4P33A 3RWMB 3UANA 4DB4A 1X6VA 3ZS9A 1Q57A 3CWQA 3GLIA 5GJVC 1NNEA 2OUKA 3LXRA 4RJLA 4URZR 4FW9A 5EE9A 4FCVA 4S2EA 5CM9C 5BN5A 4NU0A 3SYKA 4XOIA 5AUNB 4KXFB 3W5IA 2ECKA 1E1QA 3FDIA 5D3QA 1KSGA 5JHGB 2HCBA 2ZS7A 3KQUA 2ERYA 4UJ5A 3VHXA 3OEHA 3AKEA 5KSZA 4LCBA 3B60A 2C5LA 5C2JB 2G0NA 1P2VA 1SVOA 4ZCMA 4D82A 4XVQA 2C98A 4Q1FA 3AF3A 3WNDA 1WBBA 1G8HA 3BFXA 4PPQA 2ZRHA 1SGWA 3R9XA 1MOZA 1T4GA 2OO7A 3IHWA 4Z8YA 4M1MA 4R98A 3RRNA 1XEXB 2OCPA 2JLXA 3RVBA 5D3MB 3AV0B 4OK6A 1TQ2A 1FP6A 3K9GA 4C0BA 4QJ5A 5F9FA 1UDXA 2G88A 2XZLA 4QGHA 1DTSA 3O8RA 4LJ5A 2EYUA 2KI5A 2ZI4A 2Q0HA 1G9XA 3KX2A 3CRW1 3KJGA 3MFYA 2ZE7A 2BBSA 3THOA 5JCZA 2CL7X 2V1XA 4PTLA 3N70A 3O8BA 3L2OB 4FIDA 2H7VA 2QM7A 4V0LA 4DDVA 1YZGA 2GCOB 4EPWA 1QHGA 3CO5A 2GVDC 2OEPA 2PZGA 3FFBA 2OG2A 2RHMA 3NWJA 4YMWA 2XZOA 3ADDA 1TF2A 4I99A 2F1RA 1XB2A 1M2OB 3OZXA 4B73A 1EXMA 3GLHB 1SXJA 4EJSC 1P9WA 5FUXA 1KI9A 1S1CA 4Q01A 4PQRA 4UNQA 2XNDD 4UNRA 2OM2A 4X8OA 1XWIA 3ONWA 2FGKA 2ZSBA 4RD6A 5G53C 1F48A 4CGZA 4NPHA 4Q02A 2BEJA 4HZIA 5CYPA 4URYR 2ZI9A 3AVYA 5JZVA 4HAUA 3TE6A 4DSNA 1L4UA 1T0HB 4ZO4A 1RPZA 4C0JA 1NSFA 3PFIA 1FTNA 2JATA 2IYSA 1HYQA 3H0KA 1E79A 2GEVA 2Q9CA 1Z06A 4PPFA 2QT1A 2YVUA 4TMKA 2EWWA 1AM4D 3A1UA 3I4LA 5JBQA 4ZCIA 3EIQA 3K0CC 1F3OA 2PCLA 1OXXK 2ZRGA 2YC2C 2GZAA 2VSFA 3WYAA 1E3MA 5FOSA 1YJ5A 5FTMA 2EYQA 3U3JA 1CXZA 2HJGA 3AVWA 2N1BA 5CIWA 4FMDF 4FI3C 4B2PA 5AUPB 4BRWA 2QPAA 2ZJ5A 1R8QA 2WZQA 5F9HA 4NMMA 1LFDB 4TLCA 1YZQA 5FOXA 1E9SA 4CEJB 1E1QD 1G4UR 1WQ1R 3Q72A 3W34A 2NZJA 2P3SA 3KL4A 3QNUA 1DAFA 1H8HA 2F1HA 2LKDA 3QIAA 1ANKA 4ZDWA 3TR0A 221PA 4ACAA 1CIPA 1KKLA 2BDTA 3P1JA 1IHUA 4LHXA 4LYFA 1QHNA 1KO1A 5CYOA 4ON9A 3FMOB 2GAAA 1N5KA 4W5JA 2AXNA 4UNSA 4F4CA 4HAZA 3KQKA 2ZUBA 3DO6A 2ZJOA 4GBMA 4K8OA 3GEHA 2OT3B 1SKQA 4YXWA 3I92A 1N0VC 4ERNA 3R9WA 2J0SA 3GLHE 1T0JB 2V54A 2VA8A 4BEJA 1FNMA 3OFNA 1JJ7A 1GNQA 2PLRA 4B34A 2JJ8A 4Q18A 3NBXX 3EZ7A 3W6OA 1XEWY 1W5SA 2FH5B 3BH0A 3EA0A 4S35A 2Q3HA 2YNMA 2ZRJA 3IDQA 1G6OA 4OK3A 3CB4A 1KDTA 4A0GA 3B2EA 2B6HA 4QHSA 5C18A 1C1YA 5EUQB 2BBTA 2NTYC 2GJ9A 5IRCD 1TQ6A 3DZ8A 4MGYR 5JSZB 3CIOA 2RGNC 4G5OA 3I62A 1FMLA 1KMHB 2C9CA 3U6BA 3G82C 4OK5A 3EWSA 4TLDA 4U7DA 1DG3A 4PZLA 4PSVA 4DUGA 4HEJA 2IYQA 1SXJD 4OL0A 2O8DB 5BYKA 3LNCA 1EESA 1CULC 3GD7A 2QP3A 3U60B 4G01B 3T61A 1RRGA 2ZSAA 4BECA 4RKEA 3AP3A 4PAQA 2WKRA 2VQSA 2J41A 4YLGA 2V7QA 3L0PA 5FL3A 1DPFA 2NQ2C 2BJWA 2TMKA 4W5WA 3EPKA 3IIMA 4A0HA 4BWYA 3OIYA 4D4KA 1UADA 4OJQA 1I4TD 1BMFA 1NIPA 3LXXA 2WHXA 1XD8A 2VSXA 1E79D 1EFRA 2JJ2D 3M6AA 3ND8A 5B30A 1KSJA 2AR7A 5KSPA 4CYMA 2GBLA 2QL6A 3WBJA 1TUEA 1AIPA 5DISB 1DAEA 4DLTA 1BKDR 2OHFA 3SFZA 2ZYWX 3WYFA 4DHEA 3IEVA 3L0OA 1UAAA 2RGBA 3M0EA 3CKLA 4PHHA 1YZTA 2XXAB 4O2RA 3BIFA 1Z3IX 4HLUC 2ATVA 2CCJA 1YU9A 2C9YA 2OBNA 2OFWA 3KB1A 5BWMA 1XCGB 2W6JA 2CHGA 2CL0X 2ZEJA 1NMYA 1H8HD 1CS4C 4R7ZA 2V6IA 3B5JA 3U5ZB 2WIAA 3PEWA 3HU2A 2VH5R 2X2FA 2P6NA 2A3RA 3U61B 1XZPA 2F1JA 2O5VA 3C41J 1US8A 1TTTA 4N0DA 5HE9A 2VF7A 3QSYA 2VP0A 2GF0A 1Q3TA 2GJKA 4YXWD 2CE2X 2RB4A 1GKIA 3WY9A 2IF2A 5FBWB 3OFND 4ABYA 6Q21A 5KOYA 1G8YA 2ZROA 1ZAKA 2F6RA 3DM5A 1Z6YA 3ZLJA 2C95A 3TBKA 2PT5A 2PZFA 3MD0A 2YINC 2YYZA 3B6EA 4LSGA 4V02A 2ZRNA 3THXB 1NRJB 2OLJA 3GJ7A 4KAXA 4JL8A 4PO1A 3P32A 1X3SA 1XP8A 2O8CA 3RS7A 1U9IC 4AY2A 1XD9A 4PAMA 2D7CA 2L0XA 2CDNA 4HYYA 5CJPA 4B75A 4II7A 1NBMD 2FPLA 1NJFA 1N0WA 1Z6TA 3TAHA 3VU9B 5FTJA 3UWKA 3IHLA 421PA 2C78A 4LUCA 1E0SA 2I1VB 1WBDA 4DUGD 3U3MA 5EP4A 1VHLA 2BHRA 4GRAA 5L3RA 1SHZA 1J90A 2IXGA 1Z2CA 5DHFA 1NY6A 1FQKA 4OHVA 2A2ZA 2VIIA 4QHTA 2GK6A 2ZJZA 1M7GA 1N25A 2ZSFA 2DFLA 1G3MA 4OQLA 1BMFD 2QAJA 3BH7A 1FZQA 4JBWA 4KI0A 2P6RA 3ASYA 4C0QC 1EFRD 1Q1ZA 2HF8A 4JIMA 1WCV1 4PSKA 5LB2A 4LPSA 4RY2A 1WRBA 3K0AB 4QBFA 1E2GA 2JA1A 1EG7A 5DN6A 4IDNA 5GJWC 5CK5A 3MAAC 4G5SA 4LOAA 1X8JA 3UPUA 2IHYA 2YWGA 3ADKA 1N6KA 3C14C 1NVWQ 2F7SA 3BFKA 1NF3A 3TQFA 4MYCA 5CDFA 5C4GB 3WMGA 3LLUA 1MO6A 4BLRA 4DLRA 1V43A 5A5GA 4IEEA 5BN4A 1RVDA 2NZ8A 4Q1DA 1GP2A 2W6JD 3NHBA 3QKTA 4EJSA 4AYWA 2O0HA 2XZPA 2ZJ2A 1GL6A 1N5JA 4DXAA 2R6FA 4MGIR 1L2TA 3ASZA 3DM9B 1GILA 3KZ1E 3DVLA 1E2LA 3PEVA 3HU1A 4CZ2A 3CPHA 4OHYA 1DS6A 4C0LA 4FMCB 4B32A 1E2DA 1ZIOA 4ESVA 3KQHA 2SHKA 2V1UA 3I61A 1GNRA 2WICA 5TV2A 1NI3A 4QGGA 3VFDA 4IXNA 1JR6A 4RVCA 1X1RA 2J46A 3AUYA 3HU3A 4IW3B 2IYUA 4US1R 1IN7A 3F0TA 2BBWA 3QF4A 2G1JA 2GETA 5JSZA 2GXUA 1G5RA 5DYIA 3ZVLA 1JALA 1U0LA 1KMHA 1G64A 4PO8A 5FPKA 3W6NA 2WTUA 3UKDA 4BUJA 3K0CA 1P62B 1QRAA 1Z0JA 4Q4HA 1E9EA 2IYYA 1XMSA 2OAQ1 3GLGE 4A36A 2IS1A 1G20E 1NKTA 2JLRA 2O8DA 1ZVQA 2IC5A 3N2IA 4NYJR 4HB0A 1F5NA 4LK2A 1EX6A 3GJ0A 2DWQA 3TNFA 4CEHA 1AGPA 4C0HA 3C4JA 5IHPA 1GAJA 1R0YA 4EAQA 4TMTA 2GJAA 2XSZA 1QHHB 1LB1B 4G5RA 5G3ZA 2IS6A 1Z0AA 4WXPA 1HUQA 3EX7C 3PUZA 1IY1A 4BZPA 1E0KA 2AFHE 1ODFA 2WJJA 4M0LA 3T1QA 3IEUA 5AJWA 4XVRA 2D2EA 3SR0A 4LZZA 1G1MA 1R5BA 5E7JA 5TB5A 2ZM5A 1E99A 1CF4A 5HCNA 1GL9B 1OXTA 4ZPXA 2GEUA 4B44A 4AYTA 4M9QA 5FH9A 3BAFA 1UF9A 5JWHA 2DFNA 2X1VA 3D3QA 3ZZUA 1XJCA 3B7GA 3GEIA 2H92A 4WZ6A 1E9CA 2DYKA 3GLIB 3TLXA 4HZUA 2Q9BA 4KSBA 4Q1AA 2CL6X 2O0JA 2X2EA 2I4IA 3UIEA 4JLJA 4N0EA 4JL5A 4EFMA 3SDZA 3GQBA 4OHZA 2PH1A 3BGWA 4OKSA 2GWHA 3RABA 2WAYA 2ANBA 1FX0A 1FMJA 3C15C 1E98A 4DT1A 2WOJA 1U0HC 4EPRA 1XF9A 2W2VA 5DN6D 1JPJA 3IGFA 4Q7JB 3JVUA 5GJCA 3K53A 3TSZA 2AK3A 2JLUA 1VHTA 2WWXA 5G41A 2HYDA 3MG9A 1X8LA 2IYZA 2BWJA 3MJRA 4PO9A 4TT3A 1GFIA 2RGNA 4DIDA 3CM0A 1UKZA 1ZIPA 4BPBA 2PEYA 2R62A 3IQWA 3B13B 5AJXA 4DIEA 1ZNZA 3WHKA 2J1LA 4XD7A 1Z0KA 4G3XA 3UXMA 1R5OA 1AGRA 4Q1CA 4JLDA 4ASUA 3O8DA 2DR3A 3SHFA 3EWAA 3DPUA 4A8JC 1G3QA 5CK4A 3I8XA 4MKFA 3THYA 2OXCA 2RGXA 3D31A 4Q9KA 2A5JA 4JSTA 4NTZA 1XBTA 1N3BA 5J4YA 1BYUA 2HF9A 2H16A 5EE1A 2GILA 2H5EA 5SZIA 4G5GA 3B1VA 3SN6A 3AEZA 1OKKA 2QGZA 4GOJA 4RCZA 1AS2A 3FPAA 4EPXA 1NN1A 4E09A 3EIHA 5TMPA 2RGCA 4JL6A 3AQ4A 1Z22A 5KSYA 1SXJB 3BBPA 3T15A 5JS8A 1GVNB 4NYIR 2ZJBA 1PLJA 4ZKEA 2JLZA 2QQEA 4PZYA 1I4LD 3I5YA 1NN0A 1ZD8A 4PHTA 4PC1A 2B92A 3HYRA 2IEYA 1KJZA 2OCAA 3BD9A 3LWNA 3K1JA 1KOFA 4IOJA 4LPKA 3EZFA 2JLVA 4DLUA 2DPXA 3KXLA 1D9XA 4NCKA 5EXXA 5IK2A 2BKEA 3T35A 1QDEA 3MMPA 4HLUA 4LDJA 3GLGA 3U44A 2XGJA 3AKYA 3HYTA 4CDGA 2QN6A 4TLEA 2I1QA 3CX6A 3BE4A 5EXTA 1AQYA 3C7KA 2WKQA 2KJQA 1QVRA 2OLKA 2OAP1 2XJ9A 2IL1A 3SYNA 1VIAA 1ZC3A 4NYMR 4ZV4A 5FPTA 2IS4A 3RNLA 2ASEA 4NYJQ 5HPYB 2D74A 2QMEA 1CRQA 2QORA 2DCUA 4A82A 1ZJ6A 1T8UA 1MV5A 1PZNA 2OSBA 1KKMA 2WJVA 3OEEA 4YMSA 2G77B 3EW9A 1QG2A 4NKRA 1BIFA 2IEZA 5LB4A 5JECA 2ORWA 4LYHA 1QHXA 4TLBA 4XJXA 1ZNWA 1TQ4A 2J45A 2QMUA 3BK7A 4JLAA 4Q4LA 1L4YA 2F43A 4RZXA 4TMWA 1KI3A 1BO6A 1S8FA 3GCGA 4PC2A 4PPNA 2IYWA 5FUYA 2W00A 3KKOA 3QF7A 1VMAA 4HDCA 5JS7A 2KWIA 5EP3A 4AKHA 3MJHA 2R6AA 3DL0A 3TRFA 1VCIA 4KLNA 2B8TA 1KK0A 2QRNA 1U9IA 2ODNA 5K8IA 2A5GA 3ZJYA 2JLSA 4TT3D 1RKBA 3TH5A 2C8VA 3CF6R 3E2IA 1Q44A 4PSAA 1XTKA 3KUCA 1G16A 3W8RA 4BFUA 1UJ2A 1W1WA 1TL7C 1FFHA 1N6OA 3LQRA 4ZI3A 2DB3A 1QVAA 3W6PA 3LDAA 2GF9A 3VKGA 3PR1A 4B3XA 1BOFA 1G7CA 2ZE8A 3L8ZA 3ZH9B 3KKQA 5JEEA 4CVNA 2C99A 4ASUD 1AA9A 1E2HA 3KJIA 4A2WA 1KSHA 4ZDIA 4W5HA 4HLQB 3AGQA 4CEIA 4OJKA 5DO9A 1F60A 2FFHA 4Q7LA 4OI1A 4F93B 1SHKA 4JVSB 3PXGA 4B76A 3MWJA 2PX3A 3BJIC 2JLWA 4RD4A 5B64A 2GJ8A 3H2YA 2CXXA 4FCWA 2OBLA 3CNLA 3QKRA 4D80A 1OKKD 4JLPA 1TX4B 1G6HA 1SVKA 2AD5A 3PG5A 2UZIR 1IONA 4TYQA 3ADBA 3HR7A 1S1MA 1UM8A 4BGDA 2E9SA 2QUZA 3ZZTA 2ZETA 2P0EA 2QP9X 3LD9A 3AM1A 1PUJA 3P4XA 1QZXA 5J5CA 1F2UA 2YWFA 2G83A 3EXAA 5H68A 2MMCA 3TIFA 2BCJQ 2PBRA 2GRJA 1E32A 1OJLA 1U98A 4TZ6A 3A58B 3KQNA 2FEOA 3ND9A 5HZKA 4NHOA 5L3SB 1CU1A 3I72A 5FUVA 2IS2A 3VHLB 4WA7A 4H9GA 5IK2D 1QHIA 1HY3A 4M9SA 3NEJA 1M7HA 4JKYA 1OF1A 2MSDB 1DADA 1ZM2A 2YWEA 2XITA 4DLXA 4KYIB 2AKYA 1VYUA 2QENA 2ZVPX 3C5CA 3JVVA 4QJ3A 1L7VC 2ZQ5A 2YOFA 1EFCA 1SVSA 1RZ3A 3AVXA 4NYIQ 1EWQA 3EA5A 1J70A 4LBZA 3GLFE 1OXSC 121PA 1VG9B 2VP2A 1YR7A 4I1UA 4PHFA 4U5XA 1KSFX 3MSXA 3E70C 2QQ0A 1GSIA 3OIUA 4US0R 4KFUA 3QG1A 5KPJA 3OEED 3G0HA 4NCHA 5KHOC 2VEDA 4HLDA 3VX4A 2FEMA 4AYXA 1P60A 2YOHA 1JXMA 1YR6A 5JRZA 5E3HA 2P5SA 4HUTA 2VP4A 1DO0A 2IWRA 3AVPA 2QGNA 2CVFA 3NVAA 3WXMA 4BZQA 3WP1B 4DCUA 4CT5A 4LJAA 4L15A 2HXYA 5GVRA 3ADCA 1P75A 4URUR 2XTZA 3NDBB 3AF0A 3K70C 1KJYA 2YC4C 2D3WA 4TQAA 2J7PA 4Q66C 1NBME 4TTQA 3TGPA 1US8B 2C96A 4U00A 4IDPA 4YDHB 1R7RA 2RH5A 4BLTA 4YMUA 3QOFA 3CPEA 1TPZA 3FKSA 4Q00A 3W3ZB 2HV8A 4MYHA 5H1YA 4RFSA 3SQWA 1OXUA 1LNZA 1OE0A 4LX0A 3TR5A 4BEBA 2CHVA 2ORIA 4OQNA 2ZRCA 2IXEA 5ANRB 4UXIA 4R71A 4IFEA 3AP1A 1OSNA 1ZM4A 2CLDX 1HH4A 4Q48A 4DEYA 2GZHA 4DSOA 3EZ2A 3I1FA 4K46A 3RC3A 1T5IA 3TAUA 4WOPA 3EG5A 5TY0A 2BBOA 5DIFA 3OIWA 4MDFA 4LJ7A 1W36C 2O8CB 2QI9C 4GP7A 2OESA 4RD0A 2J87A 1FW6A 3KXKA 2AFIE 1Z0DA 5JCPA 4D81A 2QAGC 1G3IA 1DAGA 3R7WA 4EKDA 3KUDA 3NEYA 2I3BA 3LQQA 2JJ2A 1ZCBA 3FFAA 4TSFA 5EZ6B 4DLYA 4Q9JA 1CJTC 4JBYA 1ZU5A 5AUOB 3GJ6A 2WMNB 3DDCA 2IYXA 1C9KA 3QE0A 2GA8A 1YRBA 3M4YA 5EXSA 3CZQA 4XWKA 1CP2A 1S9DA 2ZRBA 2BMFA 2Q9AA 3KJHA 1RRCA 3IPYA 4PC7A 1P9RA 2WJGA 2NPFA 4PANA 2C04A 1FTSA 2CBZA 4AKIA 1WMSA 5H70A 4V0OA 3T5DA 4LGMA 4TYNA 1GZSA 4W9MC 2YOGA 2W2TA 4R2HA 4A8JA 1GOTA 3AB3A 2AN9A 1XRJA 2RHDA 1GRQA 4D4JA 4R9UC 3DMDA 1Q1QA 2NMVA 1Q0UA 4MYUA 3R8FA 4MRSA 5CJ2A 2PT7A 1DELA 3GFOA 4Q4JA 2K5UA 4K81B 4UNPA 3GLFA 4IOMA 1IY2A 2CNWA 4I4LA 1RJ9A 4EQ6A 3REGA 4GFDA 4PC3A 1ZUHA 3WBKA 4C9BA 4EJSB 2W58A 1E94E 4L9SA 5EE0A 4QL3A 5FPSA 3U3RA 2V3CC 4D0GA 2Z4SA 4B47A 2QRZA 3RYTC 2HUPA 1CJMA 4CT4B 1HT2E 2QPOA 3AVOA 1W46A 3Q9LA 2QMOA 3ICEA 2J7PD 2HXSA 4OYHA 2CK3A 2B21A 5CITA 2ODBA 2V8OA 1Q1BA 2BVNA 3QENA 3HPQA 4BLPA 2GZDA 3THWB 3FKSD 2PEZA 1LF5A 5HKKA 2P2LA 5HE8A 3QF4B 2AL7A 1BYIA 1NBMA 4QNRA 3VAAA 5DGXA 4BFYA 2AKAB 4GDFA 5EE3A 3VX3A 1SKYE 1YZKA 1O87A 2LKCA 2R6DA 1AZSC 4HLCA 1W48A 1CJVC 4HB4A 4DJTA 4Q4HB 4KFSA 2FZLA 4UXJA 1U90A 2QE7A 1XMJA 4OHWA 4E22A 2R6GA 3QUSA 3K0FA 3A37A 1UBEA 4DDWA 3GJ4A 4C7OA 4GT1A 3SJZA 3QJYA 2ZUDA 5L3SA 4CEHB 5F98A 1SVMA 2VL7A 5DYGA 3GJ3A 3BS4A 1RC8A 1JR3A 3V4FA 4HB2A 1KDPA 1Z28A 3PUXA 3ZGXA 3N5CA 4E5UA 3D7MA 4M1SA 1PVOA 1MT0A 3IIJA 3ZD6A 4TSFD 2VHJA 2NO1A 4DC9A 3FWYA 3SZRA 3MCAA 4TYPA 4UNNA 1XTIA 3TKLA 3QI2A 1KZ7B 2IHBA 2GK7A 5CDFE 3L43A 3KFXA 1B0UA 1G8FA 2RKOA 3CUEF 4LBYA 3DOEA 5P21A 3RS5A 1MRNA 1ZM9A 1N6RA 2ZAMA 1COWA 3U7FB 4HZUB 3B1ZA 3J81k 4QXAA 4LJYA 2A9KA 3C5HA 3H1TA 1R0ZA 3FMPB 3V4RA 1GNPA 4AC9A 1G18A 1ZYUA 1A7JA 2W83A 3KFVA 4P4TA 3AVTA 1W4AA 4G0NA 4DCNA 2ZI7A 2QP4A 1FX0B 2X8AA 5C1BA 2VSOA 2IBMA 4C0SA 3NXSA 3A1VA 3TVTA 4DT1B 4YMVA 4D0LB 3R8CA 2BOVA 3RRYA 5GVSA 1KIMA 1IN6A 1M6NA 2ZYTX 3RHFA 4QJ4A 2J0UA 1SVLA 2JIZD 1U8AA 1ZBDA 4OHXA 4FD2A 4B74A 3RAPR
chains in the Genus database with same CATH superfamily
3ET4A 1E2FA 4F2DA 3PNQA 2YV2A 3Q3HA 1XNGA 4RKFA 4OJTA 3PVSA 4YECA 4CN8A 1OH8A 1UEIA 2CLEB 1MUUA 4TM7A 3C45A 4B31A 5E7MA 5IKMA 1A9QA 4DAOA 4LSMA 5JCXA 1FSSA 1Q7EA 1LTKA 1MB0A 3A4YA 4G24A 3P94A 4JX9A 1ZD3A 4N9QA 4TMZA 5AI4A 1GFSA 4HAWA 1HSZA 3A4VA 3UENA 2FWBA 4JA0A 1XCJA 1WXWA 4O33A 4PNHA 3THYB 1A9TA 3GLRA 1UKCA 1B41A 3ISJA 1KIAA 1QPZA 1U04A 1IHYA 4EUEA 3K09C 3VR4A 3QWAA 2G06A 4B45A 4LWQA 2AG5A 4ZC8A 2Z4TA 4MW9A 3CLUC 3D3NA 3H11B 4QM6A 1PV1A 1A77A 3PWSA 2ZYUX 1EP9A 3N39C 1OASA 5E3JA 5AVJA 4F5ZA 2C7PA 2PBZA 1FRVA 2OUIA 5U9CA 3Q8LA 1LPSA 3QUTA 1WUTA 3ICQB 3H8JA 4NG4A 1FYDA 3IVXA 2ZSHA 2XWQA 3I4CA 1LSSA 2WMDA 2X9QA 2NVBA 3HCPA 4KZKA 4CTMA 3OX1A 1I3LA 2JIMA 3AG5A 3GHHA 3IDSA 3WGHA 2ZJ1A 2QE7D 3QXXA 4NXMB 2WE8A 2OTCA 1H2FA 1NRIA 2C42A 3J7TA 4MIOA 4OD0A 4E7PA 1CY7A 1XNJA 2W7TA 3N58A 3SLRA 3MB5A 1CBUA 3G3EA 4M1QA 5EPUA 3N9IA 3CVUA 2DUJA 2G9VA 5EJ4A 3CF2A 4CW7A 3EPHA 4WDRA 3GLGB 3CYFA 1A4XA 1BNCA 4CMIA 5AKKA 1JG4A 1E2JA 3ORSA 3OTQA 4D1YA 2J3KA 5FWXB 5B53A 5K8TA 1PJRA 4RFVA 1Z0FA 2NO0A 4PC6A 4BNUA 1M8PA 2ATXA 3CRRA 2OD7A 3HUFA 4WK0B 4AXBA 6LDHA 3BB3A 2O8EA 3FVRA 1J8DA 2W6OA 1T2EA 3QUBA 4WBXC 4DRZA 2AX4A 1ZH4A 2P2SA 1VXOA 2R8RA 4IZHA 3VDMA 3E82A 5A5FA 4V1CA 3FPEA 5AW2A 5JHHB 1T9AA 1W93A 2YWXA 1DRVA 1Q0PA 1UOEA 3ZG6A 3EUAA 1IUKA 2ZTMA 1AS0A 4UAJA 2QRVA 2LBPA 1TJ3A 1VKOA 3B8HA 2QAIA 1HG1A 2WP0A 8ABPA 1M8KA 1RTTA 3T38A 3DLBA 4WUVA 2D7DA 2OD2A 1ZONA 3A6KA 2B3TA 2P4QA 3C87A 2FR8A 3FNRA 4LHVA 4LV5B 1AT1A 5FI1B 3DFIA 3RK4A 4EO9A 1TCVA 2IDJA 1WPXA 2NPIA 3N8IA 1EX9A 1JPUA 5E4TA 2J5QA 1T6NA 3KOXA 4A92A 2YKGA 1NBEA 1ID1A 1HTWA 2IZ0A 3PC8C 2DR2A 3ZLUA 3LZCA 4E46A 1K8RA 2HDNB 1KQ3A 2EFGA 1OXVA 5E7IA 5LD2C 3ZV6A 3AERA 2GCNA 1F20A 3P2JA 4UDOA 4Z0PA 2A5DA 3H4TA 5EJ6A 4B79A 1RSZA 5LWQA 4MROA 4X8HA 3IOYA 3OHSX 1VSTA 1P7YA 2QK4A 1DPGA 2LIPA 4BV3A 3RBXA 2QAGA 3JD3A 4BO4A 4R4JA 2C00A 4KR6A 1RHUA 2ZRPA 2W8BA 5FTLA 1KOGA 3V1UA 4IKPA 4MS4B 3RWOA 4A1FA 4D26A 1NU6A 1W29A 2P40A 3CWZA 4RZHA 3DUFA 3AC0A 4HF7A 2Y68A 4HXGA 2DLCX 3L1KA 4FFWA 4I14A 4ZT3A 2GTIA 2QYTA 1MC1A 1TCBA 4FS3A 3ICPA 4BNGA 5AQ1A 2H1LA 3AG6A 3CH7A 5E7QA 3WYGA 4DLZA 1PW5A 5G4LA 3KTDA 4CEIB 1RLTA 4LJ6A 2PRSA 1W5FA 1J2TA 3CF0A 3QBTA 3QUAA 3O2JA 4JU8A 1L8QA 1YZUA 4UTRA 1XZNA 1XV5A 2XF8A 4LXXA 1KL7A 2R84A 4IJ5A 3VAZA 3WLKX 2ZYVX 1N3IA 4F71A 1GT6A 3STXA 3AR4A 2LD4A 1N5LA 1QB8A 2WUEA 3CRZA 1ECLA 1U2ZA 3HKCB 1RRPA 1OQAA 3O2SB 3ZIAA 1OAKA 2NUPA 3ED5A 2O0KA 1IC6A 4DCSA 3A4IA 3E8XA 4B3GA 5ES3A 1SCKA 1DEOA 1I5EA 3S29A 2J9XB 2JAXA 1F2UB 4IFTA 3FYTA 5T4FA 3DMGA 4JT2A 2V6FA 1N0HA 3OJFA 4HAVA 1L5GB 4M1WA 3X1XA 3JARA 4ZQGA 5KJCA 3MGCA 1N1DA 1AC5A 4NNJA 1XX6A 4H7PA 1RI2A 1VCOA 2YIMA 4ZCTA 1QGUA 3EGEA 1O2DA 3GEBA 3M6XA 4L8WB 1J06A 1EZ4A 2CHUA 4AD8A 3T7TA 1FB5A 2X2OA 3ZDQA 5FWYA 2O6LA 1AKVA 3PDCA 3PVCA 3T3OA 5BMVB 5CB4A 4PQYA 3LHKA 2BE7A 2E48A 1RWBA 1ND6A 4KUEA 3NWOA 5IXJA 4WK4B 5C8YF 2J3LA 3UFXB 4DA7A 1MOSA 1PRYA 3HUUA 1MDBA 4XM0A 3VJKA 1P5FA 1M5TA 4C1BA 4Z51A 3Q6NA 2PD3A 2QG6A 3WLAA 1VPWA 2NO9A 3JZMA 1T1EA 3GRZA 1JG6A 1T9GS 4KBFA 2GDZA 4PAWA 5HF8A 1NW7A 1I7LA 1TMGE 2JASA 3IJRA 2ODWA 2OBMA 4DPMA 4D9FA 2WM8A 4D4IA 4B3MB 1U7DA 3VKWA 2MT9A 3OTGA 3OZIA 5I51A 3ISVA 1EK0A 4QAQA 2I99A 3B70A 2VHVA 3KPYA 3CT4A 4JBXA 4IIDA 4QGFA 4Z53A 4Z7OB 1OX4B 3U1BA 3EXIB 1FDUA 4OGKA 2ZREA 4MJ3A 1E6UA 3O8OB 2O3JA 4DG5A 3JX9A 1E2NA 2EBUA 4ENRA 4XJVA 1I1OA 4FFOA 2QXUA 4FWIB 1SVIA 4DDUA 2HCRA 3ITNA 3K35A 3GLVA 1C3JA 1WXHA 1ADYA 1RXUA 2XMCA 1W36D 1SQFA 2QD5A 3RRJA 1Y9JA 1NLFA 5D86A 1KH3A 5JQGF 4R2WA 1NT4A 2QGFA 4KWIA 3F4KA 2QTVA 5JI2E 1UDAA 1N7JA 1OIXA 4WK2B 1DUVG 2I33A 1L5VA 5I48A 3WLQA 4ZJUA 4KWHA 1Z4KA 4UM8B 3PLAE 1SJ9A 4L5BA 3N2YA 2EC5A 2XNSA 3IR6A 2FUCA 1G41A 4D8WA 4FR5A 4CLOA 3RLFA 1DKMA 1E8DA 1X7GA 2DOKA 4G6ZA 4Q6BA 3UBTA 3R3WA 1IU9A 1M34A 3M3DA 1MEEA 4KR0A 4P54A 1U5BA 1NVKA 3KCQA 4UMDA 3TMKA 3GARA 4XSGA 1JBKA 2I3GA 4DNOA 4L6CA 1D0IA 4N3NA 5K9ZA 5G40A 4KOAA 3WGMA 4F6LA 2A0UA 1JYSA 1ZA1A 3OD1A 3PYMA 3IDFA 2ZBPA 3FN4A 4ZQHA 4BN0A 4PYJA 4PE5B 2WF7A 4FMBB 2H17A 4DKXA 4XGRA 2VKTA 5MFZA 2IUEA 1EK2A 2J9YB 1DEKA 3F6CA 4IJQA 1QMGA 2XCUA 3N8DA 3UAWA 2WD9A 3R7WB 1V41E 3GAFA 4NEHB 5LP1A 5BYJA 1IXRC 1TKAA 4PS1A 2OCYC 1E3WB 3OU7A 3IXLA 3PR2B 1JEQA 1X2EA 2YN0A 3GGCA 3IPXA 1J0DA 2FZGA 3OZCA 2H06A 3VMFA 4BNTA 4D9MA 4EHDA 4ZI7F 1HZZC 1AUVA 4FOPA 4YV1A 3C3KA 3WGZA 1WB6A 2EZ4A 1WWKA 3C70A 3HBFA 4Q9HA 5HM6A 1ZEJA 1RR6A 3GFTA 3DJYA 3HDJA 3PIRA 4TRMA 3HWX1 3LBFA 4XQEA 2OFFA 4TZ0A 2X0NA 3H5NA 3SBXA 3UB4A 1ABEA 1FA9A 1ZI6A 3T3NA 2ZPTX 1QIHA 5K0NA 2HBYA 3C5VA 1PUIA 1BVHA 1VB5A 1O94A 5D7NA 4UZEA 2DPGA 1NPDA 3M8KA 4KEAA 2ZB7A 5FI3A 4IP0A 2BM9A 4TZTA 5J47A 2IYVA 3F7TA 2WSSD 3GRKA 5EIBC 3L7MA 3JD4A 1K4KA 1H6AA 1UZAA 2PXXA 2Z3ZA 4BLUA 4AL4A 4A8JB 2OO5A 1KPHA 4O59O 3QUQA 5I7AA 3WIBA 3EVEA 4LXGA 4MB0A 2YJZA 4DNQA 2QTAA 4IEIA 4P7BA 1PGPA 3EMVA 1DCMA 2EZ8A 4N18A 3S2UA 4JI7B 2YL2A 4BNDB 5KWSA 3ZV7A 1QP8A 4H1WA 1W0KD 3BKXA 3MWFA 2XCRB 1UEXC 3BKWA 4K87A 4Q4JB 2PSEA 4HYTA 3ZDBA 1WE2A 1OFTA 2AFVA 5EZYF 4IWYA 3FUXA 4CQMD 2JJ1D 3GEMA 1RJ9B 3HHPA 3QSGA 1PT9A 3PL5A 4FDVA 4EQ6B 3AEKB 4HH1A 2CDRA 2A84A 3Q7PA 3QLVA 5THXA 1EDBA 3FWNA 3S1AB 1KK3A 4RHXA 2FSGA 4IAOA 2E37A 3VR5H 3OETA 4BATA 2BR5A 4W99A 5FBZA 4KB5A 1E2IA 1C4OA 1D1QA 1EXNA 1EWKA 4YP1A 5J5AA 1C9YA 3U7QB 3PR3A 4KI7A 3PPXA 4JP2A 4Z4GA 4F9EA 3M2TA 4P3OA 4MUMA 5THQA 1QH8B 3NBYC 3ZWOA 3PUJA 1Q0TA 3I2JA 4HBZA 4LEIA 4OGLA 1T3GA 4OH7A 5U1PA 5AXDA 4JLKA 1FQWA 3RAEC 3T5TA 3QPUA 4D6PA 2B0JA 3M9XA 4XDGA 4MW4A 2Q62A 5H4HA 4KPEC 3IDAA 1N6PA 3NO4A 1J8YF 2I4LA 3QFFA 2E89A 5FFFA 1TU4A 3ZHYA 5HM8A 2H0QA 3UAVA 1MZPA 4YRJA 1JQLB 3GA0A 1G3RA 3GHYA 1AB5A 2ZT7A 2CHEA 3EIWA 1DFHA 4P08A 1D4AA 3G6WA 3L7AA 3VTKA 4KVGA 1SA0B 4BGUA 3K0FB 2IW3A 4YAFA 3WK8A 5BN3A 4E03A 1DWPA 3IKJA 1XIVA 1YB7A 2WAOA 2ACWA 2Q0XA 4MHOA 3EYAA 3ZI0A 5G0TA 4JI3B 1KVRA 5HILA 4MS1B 4C7OB 4RTPA 3RKSA 4W5OA 3VV3A 4F1JA 4C4SA 1LTHR 2HT6A 3ER6A 4RMGA 4OBBA 1X87A 2HB6A 3PJFA 2RGEA 4W9NC 1I7QB 3ESXA 2ZE5A 4V0RA 2JAUA 2PYZA 4IDEA 5A3SA 1EFLA 1M1NB 1PWHA 2FLVA 4YJ2B 1YIDA 3MWKA 4FFLA 1JG1A 4FTWA 1QQ6A 3EH2A 4B3BA 3RSOA 4DAEA 2WUDA 2FK7A 4IIJF 4V0SA 4WQMA 1KE1A 1IRIA 4WZBB 1CD5A 3AM4A 2J3EA 1WCXA 3NZEA 4UEJA 1I80A 1Z4JA 5CU7A 3G2QA 4LS3A 4KH0A 1OH7A 3ZHXA 4OI2A 3RDPA 4ZYWA 3BVPA 1NN5A 3O0DA 5CTJA 1N0UA 5DMHA 1AMUA 1T1SA 1C3VA 2O2JA 3TQIA 4ZDJA 2Q0SA 3PJGA 1Z47A 3SD7A 3V4VB 5M04A 2XB6A 3PJRA 3STTA 4QLBA 2R7KA 2QRKA 4HNAA 3T54A 1P3JA 4GI1A 1X70A 3WB1A 1T5OA 5EMKA 1LJ8A 4L0DA 4MA4A 4CIAA 3BT7A 1DKRA 4DWJA 2HLNA 2C7BA 3OBIA 1RWPA 4KFRA 4B2LA 1D5CA 3PITA 3D0QA 4FDLA 1WZCA 3NH6A 1FPQA 4A9AA 4L28A 3D2BA 4OXYA 1T3HA 3EXIA 1A2BA 2FFAA 4WV3A 2AEJA 4OHPA 4CU2A 1ZS9A 4TL8A 2ACKA 5ERYA 2VCEA 2FUKA 4ZP1A 4X0EA 5F77A 3I05A 1NI5A 2FU5C 3EPLA 4EG7A 4KMOA 2V5AA 4IX9A 2BH9A 2DR0A 3KP1A 4DLAA 1ESZA 3CNNA 5AW5A 1XU4A 1Y4SA 2R96A 4LZJA 4Q12A 3ZGZA 3CTMA 4BDSA 1JIVA 1WXIA 1NP6A 4OP1A 3PEEA 5KUTA 4P34A 1LDNA 2B7BA 1DQSA 2X0EA 1U0EA 1YQGA 3B82A 2F9LA 4MITA 3W7BA 2PUCA 2B2NA 2FQWA 1WW8A 3UEOA 4IDHA 4HAIA 2L19A 1O9GA 1KY5A 4QBIA 5HQ3A 3K96A 3VR3D 4CTNA 3DXYA 1AZTA 3WYBA 4F8EA 4D6YA 3FBGA 2UXCB 1H8ED 1ZRHA 3LUFA 3N2KA 3PRKE 3G8DA 3U4IA 5D8DA 1SQ5A 1E9AA 2R4UA 1X94A 2RJOA 2ZXUA 2B69A 3FTQA 2EQBA 3BL5A 3QKUA 2FTKE 1UQRA 3CXUA 1B26A 3WZLA 3S2SA 1UM9B 3KO8A 5K8VA 4PLHA 1CW2B 2O52A 3ROXA 1G19A 1GYRA 3WGJA 2VQDA 4Q21A 1BS2A 5CUQA 1MW8X 4LWZA 1DZIA 4PGHA 4ARZA 4IQ8A 4QRDA 4GP9A 3EGOA 4X3CA 2CF6A 3ESDA 2XBUA 3GN1A 3NT4A 2ZI6A 3HRIA 5BYBA 1OBHA 2HBZA 1VI5A 4G9GA 4HOYA 5SICE 7AT1A 4DR5B 4QC2A 5A03A 4AMZA 4C21A 3U2QA 1QFMA 3RRBA 1ZUIA 1SKYB 1BMTA 2KE5A 4FNMA 1PDWA 1WX1A 1N6HA 1A8HA 1JWAB 5ADHA 3TFOA 3OT1A 2NVUA 3BGIA 4WSOA 5F7ZA 1UBGA 3WLPA 3H4VA 2ST1A 3BD8A 3HA3A 5AW6A 3BRSA 1T8TA 4QEDA 3U4QA 4UPVA 3AKDA 1ZVMA 3C24A 3G79A 1L7BA 4L4RA 5EERA 3FWPA 5JANA 5DLQC 3FPJA 4EW2A 2GUGA 3QG5A 2CJYA 4NL4H 4IUYA 1R0WA 2AJCA 2W6ID 3BERA 2VOJA 5IEBA 4DUZB 4JHXA 2X9GA 2AZDA 2IU6A 1N75A 4DMUB 1IJKA 2Q6LA 3K70B 2EARA 4YQEA 3WB0A 2PWAA 3ZQ6A 2D5AA 3NC0C 3HR8A 4R83A 1SU8A 1N8NA 3O26A 4DJDC 3L93A 5J23A 1NJ1A 5E95A 3QEJA 1A1SA 2N42A 2ZM6B 1V1JA 4BNDA 1KY3A 4F91B 1WDMA 1P2DA 1QIEA 4O4JB 3P27A 4CBVA 3OTOB 3H05A 5FEMA 2WRZA 4OFWA 1AKRA 4V0KA 5BR4A 3ZTWA 1XRQA 2Q50A 2QL9A 2AYYA 3HKDB 2C2OA 1OGIA 3R0IA 4GF5A 2ASVA 4U6SA 4ZAWA 5KREA 5EJ9A 1I0ZA 1I2DA 4FKMA 4GP6A 2OK7A 4N03A 5EJEA 4N9WA 4CUZA 4Y6LA 1MO3A 4PLFA 5KNCA 3S1AA 2CHQA 3TJZA 4URXR 4O25A 4K6CA 3PPVA 1Y9EA 3QW2A 1NSTA 3OEHD 1ZMOA 1PKXA 4FSDA 1S3GA 4BFWA 1N36B 3PHJA 3UGJA 4W82A 1U2GA 1E6LA 3WS7A 1QPBA 2PGIA 4L50A 2R5FA 3X2FA 1TJPB 2IA5A 1JPNA 2FPKA 1D4FA 2ZW9A 1LV7A 1H4QA 2NUAA 1N6IA 2VO1A 4QTXA 4NH4A 2FXIA 4BVAA 3DD1A 2IGBA 3BTVA 2TECE 5K03A 1WB9A 4HTAA 5MN5A 1D2GA 3RM3A 5CG1A 4P32A 1U3DA 1Q12A 5K6RA 4R2IA 1F6BA 3KWJA 5K8LA 4COOA 4ER6A 1CNEA 4PXSA 4HNVA 4PHGA 4QASA 4RV5A 2F1KA 1UPTA 2RBGA 2WSMA 3N0RA 3C4QA 5J58A 1CDZA 3KKEA 4CHGA 3IJPA 1IY9A 1HE4A 1BX1A 1KDOA 1QYDA 1ADFA 4Q7MB 3CUVA 4HDSA 4ER7A 3I0NA 4RPKA 1N34B 5CT5A 5L4SA 1Y6GA 5K20A 3SQDA 3FCSB 2HN9A 2ACEA 5IYZA 4FX2A 1T9HA 5G3YA 1T8SA 2ID7A 3BWYA 4Q5IA 4ZOCA 2V8BA 1Z38A 2II6A 2H48A 3OZRA 5LA6A 1YHNA 3PQ8A 5JI3E 4IDFA 1HYEA 4BZWA 4BQEA 1IM8A 4FP9A 2R66A 3LOQA 4ZO8A 1A5AB 3VU0A 2VTKA 1OYYA 1SVWA 3O5AA 2VRWA 2DG2A 4G85A 1T5SA 5FO0A 3UV7A 2W2KA 1O96A 4YV7A 3ZJ4A 1S4QA 3CFYA 1UDWA 2ETVA 3WLMA 5IAJA 4EHBA 5CFNA 3VISA 3WK4A 2VSNA 3QX9A 1G7SA 4RL6A 4WZAB 1XDGA 3OWOA 4RU1A 5IUJC 4XDHA 1M2FA 2H2DA 1M1YE 2VHYA 3S2EA 3U3ZA 1RS0A 1NTOA 3BFJA 3T52A 3NHFA 2WKPA 2I2AA 2OWEA 4KHZA 4Z2YA 5KDLA 1LW7A 2K7ZA 3IBCA 5AW1A 3K8ZA 1GPJA 9LDTA 5KX5F 2KM1A 2OKGA 2XB2A 2EEZA 2EJVA 4EJ6A 1ZD1A 3Q3CA 4FXPA 4RDHA 3TLGA 1YBFA 4GW3A 1W4BA 3UY4A 5ISMA 3NVKI 1E4VA 1HDIA 5E1MA 3Q8MA 1VCNA 2IEIA 5IMBA 3RU3A 3HKBB 3C3JA 2ECOA 1JKXA 4WUTA 4M3NA 3FHJA 4CM7A 3I01M 1JIIA 3R5XA 1GR1A 2G72A 3RE1A 3ZDCA 3ZK8A 4BPBA 3IBTA 4IMRA 3ILSA 1JHPA 4JJAA 4KVAA 2QLFA 4MDYA 3UFBA 1PX0A 2C77A 2FZ4A 4PRZA 2JDID 3CZRA 3GP8A 4B0OA 3MRTA 3VDRA 2BMEA 1HLPA 3N05A 3NTLA 2A14A 2R4QA 1REQB 4BO9A 3SF0A 5C1OA 2NAPA 5LMNB 1IWOA 3QXSA 6AT1A 2SKDA 5D3MA 1S2GA 2V4ZA 3K72B 4IGEA 1NG1A 1YQ9A 1C0PA 1GPBA 1WU8A 2J0VA 2PPVA 2V7BA 2VJDA 1GCIA 1K75A 2W2LD 1PSZA 2Y1CA 4ONEA 1XCOA 3QFSA 2H00A 3SHVA 4BNFA 3CU5A 3M70A 4NBSA 1R8SA 1V0JA 1F8UA 4ZTBA 1W85B 2ZKIA 2AEFA 3HB9A 1KU0A 5C3UA 3SNHA 1NOIA 2L82A 3GT7A 3MF4A 4JB2A 3O8QB 3OI7A 5D7BA 2J5BA 2VLBA 3WQQA 4O4HF 2PUHA 1L5SA 4RDXA 3ZOZA 5IWCA 2BF7A 5SZKB 4WE3A 1G7RA 4NU5A 1KJQA 4QOJA 3VNSA 2OXTA 4XCVA 4XW2A 4DUYB 5E2BA 1L5KA 1Y6QA 1ZNXA 3M1LA 3NIDB 4NK4A 1E6CA 2IPMA 1SHUX 3A9WA 4OUKX 5FJJA 3ZHOA 1H2YA 4ZI5A 2WHYA 2W2PA 1BTOA 2JAQA 2X0RA 4B4UA 1XZGA 4X93A 3F6SA 4F4DA 3GLHA 3JQ7B 3OLXA 1DC4A 4TUYF 2JI6A 3RAJA 1V8FA 2BFMA 4DLVA 2YZ7A 2AN3A 1KAEA 1GUAA 2DHCA 5KC8A 4KQ1A 5BR7A 4UQLA 1BDBA 3UOAB 1CUFA 2ZU0C 4RABA 4DG9A 2DX7A 2LWIA 3SX0A 4ENSA 5C37A 5KTRA 3AESA 2G1KA 4MA5A 3OPYI 1RBZA 3L9WA 1QYCA 2AOVA 3O1IC 3QGMA 3NM6B 5CP8A 3I52A 4FOTA 1QFZA 3L9XA 4D56A 1Y63A 1ISGA 2ZT6A 2D5LA 3KFLA 1B6TA 1P2GA 4RLQA 4BQNA 3NDIA 3EZGA 1NVBA 3ICVA 4Z7NB 1XI2A 5GPBA 1VL2A 2YXNA 4FUQA 3OAAD 4QUEA 3NBAA 4BBJA 3C3MA 1KTVA 1O97C 3DOJA 4FE4A 1RLUA 1V2GA 2XOXA 3SQOA 3LV8A 1NA5A 10MHA 4DKJA 3DV0B 3JZAA 1H65A 2GN8A 5D5HA 1FPMA 4I1VA 2B20A 1X19A 3COZA 3TINA 3WZ2A 1W30A 1X8KA 5I8ZA 1J8MF 5IG2A 5JFGA 2AE1A 4ENVA 5ALWA 2DTDA 1H05A 2XDYA 3CJRA 3M6WA 1WULS 1BS1A 1IFXA 1JQJC 2AMFA 1ZNQO 3V1YA 3HKDA 4XFJA 3V00A 5K0FA 2WHQA 4A4DA 2YBDA 1ZMXA 1IXKA 3D6HA 3P2OA 4HNSA 3FX2A 3AUJB 4RA9B 3WYNA 2CSUA 2ONZA 4ZARA 2TMDA 2B1JA 1U02A 3WLIA 4RM2A 5LOVA 3MQFA 5GWXA 1HR0B 3UXYA 4EJ2A 2FLWA 1P18A 2FSIA 2R79A 1HORA 1KZ9A 1MH9A 1R88A 2Q6VA 3GL9A 4AMVA 2ZTSA 3O94A 6PFKA 1F9AA 1RE1A 1YR2A 2E4ZA 2OGUA 2ZR9A 3EDOA 3KHUA 3OJLA 4IJVA 5A4FS 4B3CA 5DGHA 3N0VA 4CL3A 2AOUB 5ALLA 4XIGS 5FR2A 5H9WA 4TYWA 3UJ8A 5C35A 4DTCA 1X1TA 3ZWWA 1Q0ZA 1Y5LA 1LCIA 3ECCA 5CPFA 1J2RA 1XG5A 3CR7A 2M1XA 2VATA 4HD8A 4BFZA 5FOWA 3LVRE 2XYGA 4BMCA 2FPUA 4QM7A 1B0AA 1R37A 2P67A 3VO2A 1NQXA 4IMJB 3GFGA 3EPJA 4RNDB 3GJ8A 1A50B 4D2IA 2VCHA 5IN5A 2OG1A 3BMOA 2HCJB 2JFWA 3H4IA 5ALZA 5KNBH 3S44A 1KGSA 4YK7A 1GG9A 4ND4A 4ED9A 4DZTA 1XDDA 4EMTA 1RI4A 5JXIA 3RLIA 3OM9A 5AKXA 1RW4A 1SB9A 2CXQA 1IDN1 2EQAA 3COVA 4HB3A 4EMBA 4US2R 5IT4A 3WA7A 1M67A 3ZNNA 2MSNA 4CIBA 4MKGA 5KHLB 1BFKA 3MLAA 5TE9A 1SC1A 4QBKA 5DBHX 1R6VA 3RARA 4CGYA 3C16C 3SBEA 3UOGA 4GX2A 4IR7A 4BFSA 4X92A 5BSFA 2W93A 1FVHA 3ZKAA 3F6BX 5HKLA 4YWHA 2NNWB 4HTFA 5KSOA 4O3MA 3PUHA 1X80B 2NM0A 4RGQA 4UBJA 2N1MA 4G97A 3W1VA 1ST3A 4GX5A 4QVIA 1P5ZB 4KQEA 5EMLA 1BZYA 1I9GA 3THSA 1KNXA 4FDTA 4W9RA 5T8KA 5JNSA 2PGXA 3FYSA 1C2YA 1GPDG 3OLVA 3GZ4A 5L51A 1RMTA 3FKQA 2DFTA 3HCOA 2QMHA 1YRQA 2V9PA 1B14A 3KHSA 3DMTA 2Z09A 1M66A 2WYWA 4J0FA 4KODA 4MLCA 2TMGA 3VC2A 3ZWDA 5AVSA 4GM4A 2O2YA 2GKSA 3O4JA 3R77A 2FP4B 3FA2A 4ARIA 5CMLA 4RD3A 5F51A 3SEQA 2Z5VA 3RV4A 2F3PA 3HDYA 5IARA 2QX9A 3LWDA 4A8PA 4MWZA 2B1GA 2J9FA 2GYWA 4RDCA 3FMVA 5F5LA 3PICA 4L5JA 4F9TA 4D0SA 5KWIA 2G63A 1QAQA 2O9JA 3FG9A 5LR6A 3BCUA 2Q2NA 1ML4A 1SQ6A 1J6UA 3PNKA 4M0FA 1UBNA 4X8LA 4ZMSA 4IF4A 3EUEA 2UYHA 3EZYA 4YRBA 1E9RA 4YO7A 1P77A 3NBFA 1GZ5A 4BHTA 1D09A 5BO5A 3KSAC 4HN4B 4EJ0A 5KYXA 2VR1A 5FPHA 1RYNA 1E2KA 1A8QA 1QDUA 3KG2A 5BN5B 2PZJA 2WPDA 5E0KB 2WAAA 4YQZA 1NLZA 1CY1A 4JXZA 3ZWVA 3ZZNA 3MUFA 3M1IA 2VPWA 3A0RB 1V8ZA 3DHWC 4TGLA 1NW4A 4AMBA 5EIEA 4P82A 1Y6RA 4UEQA 1HETA 2OC4A 2ZSDA 3IPCA 1YKFA 1E4OA 3O9VA 4A1OA 4IIHA 1YE8A 1RI3A 4EA6A 1MOPA 4YRSA 2VZLA 1D2EA 4HATA 2QNRA 5JD4A 2EBWA 4KWTA 3L6UA 3FNBA 1ZKMA 3MPUA 3C7DB 3OZUA 1UKYA 3TEMA 4BO6A 1PV2A 5D01A 2I2BA 4MW5A 2PUTA 4ZAZA 2W4MA 1XMIA 3VMMA 5DXJA 2IF0A 2RGAA 2J8ZA 4TYYA 3VGPA 3DVQX 5EGNA 3ITDA 3WKEA 3E3NA 5TARA 1FRFS 2NADA 2QPLA 2QSUA 3DH0A 1PCXA 3P0RA 4JUBA 3GAAA 3KQSA 3GT4A 3T5BA 3TVDA 1UP7A 1OJ7A 4YR9A 2JFUA 1FU7A 3PKZA 1E2MA 4DHEA 2QBYB 4AI6A 5IDWA 2IK8A 1GG2A 3JWEA 2WM9B 2WEKA 4YA6A 4QDOA 4XTRA 3DZGA 1DAIA 2FFBA 5JDIC 1I3MA 3ZTYA 3JQ7A 1DC8A 1QH1B 1K06A 1Z7YA 3HUDA 4PAMA 3KELA 4I7EA 4BE9A 1EAMA 3TZLA 3SKYA 3D1LA 2JGLA 4QG3A 2HO5A 5I45A 2NP7A 2JZOA 4IIXA 4C89A 4PGGA 1OLUA 1WHTB 4BZZA 3D7SA 4EHNA 2ZRKA 3HWWA 3EWIA 3CF4G 2BRUC 1OHHA 4HDMA 3P2YA 4CFYA 3ZN2A 4PIPA 3V7FA 1JZSA 4OIFA 4AAYA 2C5AA 3IV9A 1WL8A 4MIYA 2PA0A 3VU9A 2CLSA 2FSSA 2ZXFA 3D4OA 1LTQA 2OAEA 2PVPA 2ZWIA 1S2NA 1WP9A 5DPMA 3B3FA 4BWVA 3A4LA 4FFPA 3FMIA 2D4AA 2XEDA 4IGIA 2YZMA 3EN0A 5JFTA 3T5AA 1KI2A 2WJ4A 2ZR8A 2XCQA 3ONDA 3T12A 1OROA 1ECFA 3EZNA 1J7KA 4F97A 2REQA 2P9GA 4ZYLA 5JJKA 1MPXA 3X3HA 2MDTA 2YNMC 4AUNA 1VBFA 1UBFA 1LDYA 1DT5A 2JEZA 2PZAA 3EUFA 4G1FA 1KWKA 4DWVA 4HG2A 2HW8A 4LMAA 2Q3DA 1J42A 2QNBA 4NCBA 2IYTA 3T3EA 3K15A 4B6FA 4H7DA 2RIPA 3AJ9A 3KQMA 3O2NA 4DV0B 1QCZA 2GOYA 3JCZA 3PHHA 3KVVA 1DQYA 4MW0A 3TBHA 1LDBA 1UK6A 1X1DA 3K0AA 1FUIA 3T7KA 3ZC3A 1YQTA 1POXA 2DWOA 1K8XB 1IB6A 1V1RA 2EWVA 4U2BA 4YRFA 1FW8A 2IUFA 2GN1A 3G8AA 3HNRA 3LUJA 2NSDA 3PGA1 3PI7A 1RZVA 2H7XA 3M3HA 4W1QA 1KARA 3U4GA 2DE0X 4WN3A 2JJQA 3B6KA 4QOEA 5DCWA 5ALJA 1P61B 1ESDA 4RA6B 2FEAA 4EPTA 4RV4A 4Y0VA 3UCXA 1BWQA 2XDWA 5CM8B 5A7GA 4E15A 4F5DA 3GAMA 4NZ9A 1MNAA 4UVIA 2VQ3A 3OZVA 2V59A 4LZNA 1X7ZB 2MSEB 3C1AA 4EIWA 1C1DB 4INJA 1GQYA 5BWOA 2V6BA 3UJBA 1XKXA 3UK7A 2Z3VA 2VQEB 2J32A 4UM9D 4C6RA 1JFRA 3PBKA 2KLBA 5ABPA 2BMJA 3UWDA 1WSDA 4I4NA 4QSMA 1RYYA 5K3AA 1JHDA 3K0KA 2QX6A 3QRWA 5JCJD 3KNZA 4PZ0A 2YXBA 4BMSA 4WGFA 1YUBA 1PGNA 1S2MA 3ZZ1A 1MRSA 3BWXA 1RC1A 4ID9A 3GPCA 1NJ6A 2GBGA 2ZANA 1WZIA 1YRAA 3OF3A 2XGSA 3DB2A 3RSHA 3IA7A 1FUUA 3BAZA 4DJAA 2DU8A 4EKYA 3QWIA 4CM6A 4D3ZA 3LDHA 5LVAA 1G5QA 1V5EA 3NAQA 1V4VA 2PE5A 1UL1X 4EFDA 4XD7D 3CUUA 5ECGC 3IDZA 5KJEA 3FJ1A 4M60A 2QT0A 3AZOA 3B78A 5KEIA 3ZVMA 3BC1A 1GRCA 3A6PC 3DOOA 1L5RA 4HLNA 3G2IA 1PV4A 4WBNB 4B5KA 4KRXA 3UOWA 3NDPA 4DLNA 3MHTA 1SG9A 2QN7A 2BW0A 4HBGA 1BG6A 2ZU6A 3RCBA 4D3DA 4DYDA 3REQB 4N49A 3ZY3A 4MGKR 4HXEB 4BNHA 1GNSA 1N2XA 1B8OA 4H3KB 5FFMA 3GRAA 1ZD9A 3HA2A 3IELA 3BB4A 1JYFA 4TMYA 2BPOA 2WAXA 3MGAA 4QYMA 1J2JA 3G0OA 1RWKA 4U8HA 3DD5A 5BW8A 2W22A 1SPXA 4NJMB 3UJDA 4B48A 3M5PA 2NU7A 3MBIA 4GUAA 4MWTA 4OLHA 3ZKWB 2ZUSA 3GD5A 4OBEA 3RTAA 5M2QA 2PU5A 4L3OA 2JLCA 3BMXA 3QQ5A 2O06A 5L8VA 1ZGCA 2CFIA 2B98A 5FQOA 3D6MA 1T0UA 1RJFA 3C3CA 5DTEA 3OE7A 2XKAA 3RWMB 3TL2A 4EFNA 2BM0A 3UANA 5CDGA 1CUSA 1KYVA 1Z13A 3ZS9A 4TVKA 5IAAA 4S0XA 3VUFA 1NNEA 3K05A 5EZSA 3LXRA 3N86A 3U80A 5EE9A 4S2EA 5BN5A 3JQGA 2QR3A 3ZLVA 3HB0A 4XOIA 3I3OA 2F4NA 2BEWA 2NUTB 5ADVA 4BTVA 5L95A 3H5AA 1T8WA 2LDXA 5D3QA 1SOMA 1UWVA 4L8FA 1ZITA 1GQFA 3CLSC 2HCBA 3KQUA 3ZNPA 3Q12A 4WFIA 4LCBA 3TWOA 3A70A 3B60A 5GAJA 1JDPA 2C5LA 3VR2D 2BZSA 4D4HA 3WSWA 1F9EA 2PMCA 2C29D 3NRCA 4W5TA 1WIWA 1N5OX 2WTAA 3AF3A 3WNDA 1C81A 4ESEA 3OJ0A 1KEZA 4M8KA 4PZCA 1ARZA 1SD5A 4GMGA 1UZLA 3SZOA 1MOZA 1T4GA 2GEBA 4QELA 1JLLA 2J4DA 2QI9F 3OP4A 3ZI7A 4XWWA 2IBSA 3EEFA 4B3IA 1DRJA 3V4ZA 1B8PA 1LWNA 5ITZB 3AHHA 3JQFA 3NRBA 3S1SA 3Q7RA 1JNXX 1DRKA 2JI7A 4HUJA 4MJ7A 2IVFA 3RVBA 3TXAA 4YCMA 5JJ5A 3CH6A 3AV0B 3QYAA 4YHHB 1U0NA 1TQ2A 4KE6A 1FP6A 3M33A 2W9XA 3K9GA 3OLQA 4A16A 1E7MA 3LDUA 5AVOA 3IC5A 5F3DA 1UDXA 4ZGBA 2C83A 2XZLA 1DTSA 5HJEA 4LJ5A 1L4NA 3O8RA 5BSWA 3B89A 4OG2A 5I9IA 1CVRA 2BUCA 1G9XA 3KOZA 4WFJA 3KJGA 2RHHA 3THOA 3VXKA 4WJKB 1DIAA 1SBIA 1DEAA 3C8MA 4GLOA 3GRFA 1LKZA 5DU2A 3N8KA 1UJMA 1ZCJA 1XHLA 3KHKA 3OM0A 4FQ8A 1BD4A 2QXTA 3L8CA 1A9XA 1C1XA 1KR2A 4KAJA 3DC7A 3VR4H 4OLAA 4E31A 1R3UA 3BXOA 5HUHA 4V39A 1T34A 2HNKA 2Q5OA 4Y1RA 5FLKA 2PZGA 5K8JB 4IIYA 2XT9A 4F4HA 4YMWA 2XZOA 2F2TA 1KAQA 3KSZO 4KX3A 4YFVA 3SXJA 1ZR4A 1XB2A 2XGMA 3GWGA 4YREA 3GUHA 3PE4A 5JE8A 4OAQA 4B6JA 5IS2A 3GDFA 2JCYA 4H15A 3I2FA 1EXMA 1SXJA 4L5CA 3V6LA 4I9HA 4PQRA 4IDCA 3MJ4A 2V7WA 3RF6A 2XNDD 4UNRA 2OM2A 4X8OA 1VI2A 3WNVA 2FRVA 1IRXA 1L7EA 4RDIA 2ZSBA 4OUDB 1CJBA 4CGZA 3LU1A 2OVBA 3TRKA 2BEJA 2QYHA 1XZJA 4HZIA 4OMFG 5WRFA 3NJ8A 2ZO