2GDQA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis at 1.8 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
373
structure length
373
Chain Sequence
LVKIVRIETFPLFHRLEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVDWLPALHVGFTKRIIPFLLGKQAGSRLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRYREEIPVYASFQSYSDSPQWISRSVSNVEAQLKKGFEQIKVKIGGTSFKEDVRHINALQHTAGSSITMILDANQSYDAAAAFKWERYFSEWTNIGWLEEPLPFDQPQDYAMLRSRLSVPVAGGENMKGPAQYVPLLSQRCLDIIQPDVMHVNGIDEFRDCLQLARYFGVRASAHAYDGSLSRLYALFAQACLPPWSKMKNDHIEPIEWDVMENPFTDLVSLQPSKGMVHIPKGKGIGTEINMEIVNRYKWDGSAYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords yitF
publication title Crystal structure of mandelate racemase/muconate lactonizing enzyme from Bacillus subtilis at 1.8 A resolution
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Structural genomics, unknown function
total genus 124
structure length 373
sequence length 373
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2gdqA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2gdqA01
4MGGA 2PCEA 3VCNA 4E5TA 3PK7A 3BJSA 5FJPA 4K2SA 3OP2A 3T9PA 4A35A 4KEMA 2QJJA 3ZVIA 3SN0A 5FJUA 2P8CA 3MUCA 5J04A 3MKCA 3DERA 1EBHA 3V4BA 2XH4A 4IHCA 2PU1A 4DHGA 3PWGA 3I6EA 2PU0A 3MY9A 1F9CA 3I6TA 1PDYA 2PSNA 3D47A 2PMQA 1KKRA 1WUFA 2FKPA 2HNEA 3H7VA 3UJFA 5FJOA 3TWBA 2POZA 2GGGA 2NQLA 3ENLA 3VC6A 4DYEA 3EEZA 3UJEA 4IZGA 3VCCA 3QN3A 3CK5A 2OPJA 3R25A 3MSYA 3TOYA 4H2HA 3RR1A 2MNRA 3FYYA 2QQ6A 3JZUA 1KKOA 2ZADA 3RCYA 2AKMA 3UXKA 4HYRA 3V3WA 2XH7A 4FP1A 3SQSA 3DIPA 2XH2A 3VC5A 2PA6A 5ENLA 2OO6A 5BOEA 3QLDA 2PTZA 4E4FA 2OQYA 1XPYA 2P0IA 4KT2A 3V5CA 3QTPA 1OEPA 3N4FA 2AL2B 3GC2A 1KD0A 4HN8A 4DXKA 1SJDA 3DG7A 1W6TA 1NELA 3VDGA 3SBFA 2I5QA 2PTWA 2ZC8A 4HNLA 1EC8A 3SN4A 2HXTA 1RVKA 2MUCA 3JVAA 3GO2A 4G7FA 2XGZA 2GGIA 3OZMA 4H1ZA 2OG9A 4J1OA 3K1GA 2PP3A 3DG6A 4Z1YA 2PTYA 4A6GA 3Q4DA 2CHRA 4E6MA 3SN1A 3PWIA 3U4FA 3MWCA 3BOXA 3T8QA 1FHVA 2HXUA 4M0XA 4IL0A 3N4EA 3DDMA 1TE6A 2GDQA 2OKTA 2AL2A 5FJTA 2OQHA 1EC7A 4EWJA 4IP5A 3CAWA 3R1ZA 3U9IA 3V5FA 3P3BA 3DFYA 1SJCA 3MQTA 5IDZA 2P88A 1P43A 3DESA 2PGEA 3CXOA 1R6WA 3OZYA 4ZA0A 3ZVHA 3EKGA 3ES7A 4DWDA 3GY1A 4YWSA 3IJLA 2GSHA 4MMWA 2QJNA 3OPSA 5FJRA 3TW9A 1MNSA 2PP1A 2P3ZA 3NZGA 4ROPA 2PP0A 2RDXA 3KUMA 3TJ4A 1JPDX 1ECQA 4GYPC 4HCHA 2OZ3A 3VFCA 3H70A 3S5SA 1JDFA 2OX4A 3FJ4A 1MUCA 4HCDA 1SJBA 3B97A 2QGYA 3R0KA 3UCDA 4MKSA 3OTRA 3TQPA 3P0WA 4K1WA 2DW7A 4HNCA 3DG3A 1R0MA 2P8BA 2QDDA 2GGHA 3NFUA 3ZLGA 1BKHA 4DN1A 4A3RA 4E4UA 3JW7A 4IT1A 1EC9A 3MZNA 1MDLA 1IYXA 1P48A 2OFJA 3DEQA 1DTNA 3FCPA 3N6HA 1JCTA 3RITA 3SSZA 3ZVHB 7ENLA 4M6UA 3DFHA 4JN7A 4H83A 4E8GA 2QVHA 2PS2A 3QPEA 1KCZA 2HZGA 4KPLA 3R10A 4ENLA 1MDRA 1FHUA 2PTXA 3FVDA 4IL2A 2GGEA 4IP4A 4JHMA 4GIRA 4HPNA 3CB3A 1JPMA 4DX3A 3P93A 3T4WA 4JN8A 1SJAA 3UGVA 4GISA 4Z17A 3H8AA 3ZLHA 2OVLA 1TZZA 2QJMA 4FI4A 3I4KA 4KWSA 4H19A 2PODA 3N6JA 2QDEA 4GMEA 3TTEA 4GGBA 3VA8A 6ENLA 1WUEA 5EU9A 3UJ2A 4G8TA 3TCSA 3TJIA 4K8GA 3GD6A 3RGTA 3BSMA 3HPFA 3RRAA 4F4RA 2PGWA 1PDZA 2GGJA 3QKEA 1XS2A 3IJQA 4GGHA 2XSXA 3FXGA 2GL5A 3IK4A 1EBGA 3PFRA 3UCCA 2FYMA 2AL1A 3NXLA 3Q45A 3T6CA 2OLAA 3DGBA 3S47A 3STPA 3IJIA 1ELSA 3CYJA 1TKKA 4GFIA 3ZLFA 2OZ8A 1L8PA 1MRAA 2AKZA 3R0UA 3R11A 4X2PA 3THUA 4ZCWA 2OZTA 3H12A 5BOFA 1NU5A 1ONEA 4GYPA 1BQGA 3D46A 3UJSA 3RO6A 2ONEA 4HCLA 3TWAA 2DW6A 2PPGA 3UJRA 2O56A 1YEYA 3NO1A 3CT2A 4J3ZA 3ES8A 3UXLA 3FV9A 3SJNA 1E9IA 2XH0A 3OW1A
chains in the Genus database with same CATH superfamily
2WO5A 2PCEA 2I16A 2E4TA 1UR8A 4ZE5A 3BC9A 3BLEA 1D3CA 4GI4A 3OP2A 3T9PA 4A35A 3CZLA 4GQ0A 1V02E 4W85A 4WCJA 3U0HA 1Q7QA 2HK1A 4H6KA 1CPUA 5AY7A 4DPQA 2VQUA 3VD9A 2ZXQA 3EX2A 2O55A 4TIMA 5AC8A 5C7VA 1KR0A 1WDRA 3D47A 3WQ8A 3GTNA 3TONA 2JEQA 1GT8A 1A5SA 4TVYA 4LAMA 2FKPA 4L1GA 2YR1A 3GBDA 1VF8A 2WNZA 1SW7A 2WBGA 2HBXA 5TNVA 2QMJA 3EWZA 3BG3A 1ZP3A 2Y7FA 5C9UA 5KMYA 3UJEA 5D09A 4TXEA 4W5ZA 1W5MA 1NP2A 3G0XA 4UIOA 2F8QA 3MP4A 1I0BA 3CL8A 3MI3A 3LTSA 3NJ3A 3OZPA 3AHZA 5C0QA 3BURA 2XVNA 2WOVA 2BXYA 1GEUA 1KFWA 3ALGA 3EX3A 2GUBA 3AC0A 3GM8A 3WEMA 4CLMA 1EUAA 1LL7A 2FQIA 5HNRA 3BLKA 3G18A 2XN2A 3SCVA 2EQ7A 3GXPA 1V3KA 5F4SA 1PS9A 3VX0A 4PTVA 5CPTA 4AZCB 4O15A 1VIWA 2TMDA 4D6GA 1P0KA 4X0VA 5HPCA 3GO2A 2G5WA 3KCLA 4DB7A 3TYCA 1ZBWA 1QO2A 1P7TA 3GQYA 3LLFA 3WH8A 3CS2A 4H6RA 1XP3A 4NP7A 3NEVA 4RR4A 2PC4A 3WLSA 2V3GA 4PMUA 3BVJA 4ZQNA 1PWLA 3KP1A 2ZWZA 3QQWA 2DT2A 1H7XA 4MY8A 4IL0A 5LNUA 2BC0A 5M1TA 5EA9A 1K8XA 1TV3A 1NM9A 2BWGA 3UW6A 3QZEA 2AL2A 1E1FA 1DWHM 5I07A 4C60A 2QNEA 1EGMA 2QULA 1UR2A 3LRMA 4O1BA 1KGXA 3IS4A 3H7UA 3V5FA 4O12A 1FBAA 2J7FA 2PDUA 3FGCB 3S9YA 1EA9C 5K7JA 2DY3A 1D8WA 4R3UA 5HPOA 2WC7A 1ME8A 1ALDA 3R4IA 5EMUA 5HMSA 3WQFA 1VBJA 1PYMA 3FAWA 1VD6A 3GWQA 2FPYA 2PP1A 4UCGA 2I14A 4MDOA 1JPDX 1LWHA 3OA5A 1XIGA 4HNTA 2QUMA 3CWOX 3IIPA 3S42A 4B5XA 4X9YA 2FZNA 3VIFA 1G6CA 1PZ3A 1P0DA 4QDPA 3W88A 4GVHA 4MHBA 5CSRA 4YCPA 1X7FA 4QM1A 2YFOA 3B0YA 4G9PA 3HM7A 3TAOA 1XCWA 4JGDA 4MB1A 1HJQA 5EBAA 3CXBA 4M82A 1C8YA 3PFMA 2J25A 4J2MA 4HK7A 2VFIA 2XINA 4MPKA 5I3GA 4GY1A 4BI5A 2X50A 2OLHA 1JCTA 1EJXC 4R7WA 1RPXA 2AMGA 2DZWA 4QEEA 3A13A 3KX6A 1DE5A 3GYCA 3VOHA 1AW1A 1GK8A 3STFA 3WK0A 2R9RA 1B54A 1MQRA 3GTFA 4R53A 2QJIA 2NW0A 2YXGA 4ZSTA 3AS1A 5F2MA 1CLXA 5A95A 4IJRA 2RJGA 1RA5A 3UXIA 5HULA 2L5HA 3L4UA 1C7SA 2ATMA 1BTCA 4ERIA 2PLCA 3L68A 3P2VA 4OKDA 1DXEA 4CCCA 4HYVA 4GISA 4AHQA 1X97A 3H8AA 1EJVC 2DZTA 4RZBA 2EAWA 4W86A 4LVBA 2O9RA 5CJ5A 1V7AA 5KTLA 1WOAA 2Y5JA 1E15A 1UD2A 1ESWA 3QTGA 2QF7A 4PE8A 5EL1A 3KVJA 2XYLA 2VYOA 3L5LA 4LY8A 3W1PA 2CETA 1ZHAA 3VIHA 1VZWA 2Y4SA 3NYDA 3H21A 5E09A 4JTHA 4O0QA 3DK4A 3UZZA 2ZUSA 4E2VA 4GK8A 4AY1A 4JQ4A 3OU8A 3VGGA 2W54A 1QATA 1VPQA 3B9NA 5GPRA 1RLDA 4NT0A 3M64A 4BY3A 1AK5A 3T6CA 2X30A 1OIMA 1V3IA 3C2RA 3V1HA 4F0SA 1J6OA 4JFTA 4OBTA 4WR3A 3QF0A 3SGZA 5TD4A 4L65A 1MRAA 3R0UA 3KS6A 5D9MA 3KM8A 1XSIA 2WSRA 1R46A 2HK0A 4UTKA 4GUFA 3L5MA 3PZQA 1G69A 7REQB 3HZ3A 5HK4A 2Z1XA 1GYLA 4B5WA 3PN8A 4QROA 5AOUA 3RO6A 3RO8A 4W7VA 3TWAA 1RLCL 4BF7A 3GRIA 4NXKA 3O06A 4AYSA 2GUYA 1UR0A 3NPXA 1YEYA 2X05A 4MAVA 4Z2LA 1PYFA 2XFWA 2F5ZA 3ES8A 4BHYA 3S8HA 4ZB5A 1VJZA 4EX4A 1JZ8A 5EMYA 3AYVA 2G3FA 5T9CE 5A69A 4I6VA 2Q02A 3PK7A 4F9DA 1GRTA 5FJPA 3WBWA 3CL7A 4LS1A 1DXFA 4PYSA 3BQ5A 1A5LC 3DHPA 2E28A 2P76A 1J0HA 4MWAB 3FJ6A 3WBAA 1H2IA 1ICQA 1J0JA 1S2UA 4UNLA 3FVMA 1XG4A 4ZMGA 3ITOA 4L5ZA 6TAAA 1JDDA 1X1OA 4JAWA 1SGJA 3WLKX 1R8LA 4ONVA 1UIPA 4V1YA 1Q85A 4H8HA 3TA9A 3LUTA 3IUIA 4WK9A 4RE4A 4HOWA 4Y9MA 3KL0A 4D6HA 3HV9A 3UWQA 2WHKA 3TLQA 1I2RA 2DQXA 3K8MA 5BMWA 4R7JA 3KTXA 3BO9A 4JX5A 1IT0A 1I4NA 4H04A 3GDMA 5JUVA 4X61A 3N9SA 4EXQA 3CEUA 4IIFA 4V2XA 4JTSA 1UJQA 1P7TB 3AS3A 3MV11 1B5TA 1P6BA 5BWAA 2QCHA 4HA3A 3G1VA 4OWGA 4DYKA 3TN5A 2VNCA 4XBKA 3W9ZA 1UR9A 2A1YA 4AIEA 1SM9A 1WP6A 4Q3MA 1B4EA 4K3ZA 2PTZA 1G1YA 3B8DA 4LW7A 3CBWA 1HVXA 2AL2B 4J57A 1PL9A 1Z6KA 4DXKA 3GW3A 5RUBA 1MOKA 4XZNX 1DJQA 4ZGYA 4WDUA 3SUUA 2PWFA 3FOKA 2YW4A 2OELA 4DWSC 2ADAA 4F0MA 3M0VA 5DFAA 3POHA 1H1ZA 1J2WA 1CXEA 2PTYA 3PBYA 4UTWA 3O7UA 1ISZA 1A5AA 1YRRA 1GZJA 1OHLA 2VEKA 2XIQA 5B7YA 2QDGA 3N2MA 1DEDA 2ACQA 3T8QA 4EQSA 3W7PA 1FHVA 1MFVA 4Q8NA 2E3ZA 3EWBX 1A0EA 5DRIA 3KTSA 3PZ9A 4MZYA 5FL1A 4IGHA 3UETA 1XLMA 1K9EA 5IRPA 3ZJ6A 1TWDA 1EDQA 3LX9A 1R3YA 1HT6A 1TPUA 2XVKA 4RXGA 1VAHA 1S2TA 1JGMA 1MZHA 4MJ2A 3WK3A 4DQWA 3KVMA 1UKSA 2E5DA 1OGGA 1ADDA 3UERA 4JX6A 1MXGA 2OB3A 4LU0A 3EA1A 4DJFA 1RBAA 3BV4A 3ZS4A 2VRKA 1ICSA 2I5IA 3REQB 2C79A 3BARA 5HNNA 3H4KA 2CFFA 2DSWA 3BOLA 1DJWA 4OV4A 1LT7A 4J3WA 3KUMA 5A6JA 1SVDA 4QLLA 5U25A 5CZKA 1ECQA 3RRXA 2QHAA 4N6FA 3V1PA 3DBPA 1QRQA 1KQZA 2QCMA 2QCGA 1M04A 4RCXA 3IIZA 1PKLA 5D2WA 3LHTA 3VNLA 2QGYA 3NCOA 1M1BA 5TF0A 1UOKA 2BX7A 4LAUA 3WLOA 3R58A 3WD4A 4FA3A 4LJ3A 1JROA 1CXKA 1XIJA 3PJTA 3TJXA 1OZQA 1FDJA 1M7OA 3AYTA 3RX3A 4TTGA 1F07A 1Q5MA 4XIMA 2GGHA 3MMWA 4ACZA 1N7KA 2A6LA 2G95A 4S23A 1TV2A 1CENA 3LU2A 3N6HA 4Z0SA 2PDYA 2ZFAA 3LYEA 3AIBA 4MF4A 5G1TA 1LOSA 3FKRA 3PUOA 5A6KA 3W7NA 1LF1A 4C90A 3V0SA 2PS2A 4N42A 1PCKA 1U2YA 3T2QA 3UQNA 5JCKA 3NVWB 4QAIA 1EGVA 4HK5A 2ACRA 3UP8A 2D0GA 1TG7A 2QCCA 3E2VA 5CJMA 1SUXA 3QYSA 4LAOA 1PBGA 3WJZA 4ATWA 4DLMA 5JIPA 1H7OA 1LLOA 1SZGA 1TZZA 1ZALA 4WY0A 4QE5A 4HPXA 3SDOA 3AHXA 4CD4A 3LBMA 1FUYA 1ZXIC 4YNGA 1SFJA 1XRVA 4PRRA 4WSHA 1VJIA 4GLEA 3UWUA 2W61A 1QPOA 1WUEA 2BNJA 4MJ4A 4YWOA 3U5UA 1U1JA 4HQVA 3A3WA 3RGTA 1V79A 4A3QA 3PPGA 1H6VA 4WQ6A 3EXRA 5I09A 1PTGA 1US2A 1EBGA 4KH2A 1W56A 4PGLA 4Y9OA 4JTKA 5KZ6A 3L2IA 5C2CA 1SR9A 1ZGDA 3SQPA 2A7RA 3BLDA 2ZRZA 1GRAA 3UZ5A 4QXIA 1FH9A 3EB4A 5LIYX 7A3HA 5FOOA 3TQ0A 4MB3A 1LL4A 1SW0A 3UPMA 1FHDA 4Q4SA 3UESA 3W37A 4EIVA 1ZUAX 2EQ8A 3V0UA 3SCPA 3QQ0A 1E5NA 1P4CA 3R8HA 1T7LA 4GYPA 4DUVA 1SB3B 2VEGA 3C4UA 5D38A 1B3OA 3EEGA 3P8IA 1P5BA 4FOUA 3OGSA 1W9BM 4ICNA 4C6CA 1BF2A 3PTMA 1E0UA 5JCLA 4TX9A 3ANVA 4HZ6A 2REQA 2ABBA 3AOFA 1P1MA 4TV6A 3OW1A 2VCAA 4JTFA 2PI6A 1OYCA 1BG4A 2F2KA 2V3DA 2VZOA 2CNCA 1SO4A 5L6UA 1W0MA 2KX9A 3OYXA 3W7EA 1R47A 2XIOA 4FX7A 1GG1A 1HGWA 2VX6A 3CGEA 1A5NC 3RNDA 2HSAA 1GKQA 3D9XA 2HE8A 2YFNA 3N3TA 4S3CA 2Z1WA 2A7PA 3R2GA 3H24A 2CWNA 2VR4A 5A6BD 1S2VA 1AQHA 1ZCCA 1AH3A 3H4GA 3BL3A 1L9WA 3TWBA 4S3KA 1J9YA 1CZ1A 5AC4A 3VPLA 1UA7A 1I60A 1O12A 1OSEA 2ZVRA 3NQGA 1C3FA 1D3GA 3VCCA 3W7CA 1FEAA 3O07A 3GTHA 1BWLA 2VWTA 4F3HA 2EG7A 4ZE4A 1UD8A 2V5LA 1BGAA 5ABTA 3P0XA 4TQTA 4A21A 1HN1A 3AS2A 4PB4A 3EMZA 4J7RA 4JEQA 1KKOA 2J6XA 3W07A 1VC4A 2VGFA 4ZTXA 2NX9A 4NZFA 1XJBA 3WNPA 4BS0A 1XC6A 1S3TC 4JIEA 3LSBA 1ZS2A 1EWEA 1VFMA 5LA1A 2OGJA 3WNLA 5DMMA 4ES4A 4C6MA 1F6PA 1IEXA 1UUOA 2YAUA 1H4PA 1K4QA 2WOWA 2XPKA 1F73A 3WBXA 5M17A 3VKBA 3ETRB 1H09A 3C3NA 4ZQCA 1W9DM 3CV2A 3GYEA 2WPBA 2QIWA 3MMUA 3W38A 1KD0A 2RABA 4HN8A 1WE5A 5C6MA 4LS0A 3G0UA 3DX5A 2QV4A 2FFIA 3R79A 2E8YA 3LHVA 4EXAA 1W9VA 4F48A 2PTWA 3ZFHA 4J35A 2FZMA 1JYWA 4UOJA 4ATLA 1TV4A 4O19A 4MLRA 1LPFA 2BTMA 3ZYZA 3V36A 3ZT5A 4H4YA 2TAAA 4UTLA 1FHLA 1JVNA 3EANA 1R9ZA 4REQB 4FNPA 3B03A 5KINA 1AL8A 5F1VA 5F2LA 1TV8A 1UBPC 3SN1A 1F61A 1NWRA 1N5WC 4PTNA 4WHBA 3N2BA 3NSXA 4MFEA 2Q71A 2ZTKA 5G1MA 1MFUA 3N12A 1XLJA 1YTKA 3WH5A 3CGCA 4J28A 1BYBA 2Q6ZA 1G0CA 5D05A 1B4KA 1W54A 3BGJA 3SRKA 1PKNA 4Y96A 5C55A 4RZ4A 4H8UA 1FRBA 1WPCA 4ZOEA 1GKPA 4RDWA 3QSTA 2Q3RA 1Z69A 3KHDA 3VTRA 3VI2A 1YTEA 3QV8A 2V5JA 1YQ2A 1VYPX 4F2UA 4GXPA 4QLJA 2YZ5A 5BU9A 1GQJA 2HEJA 1T40A 3C2VA 4NI3A 1A3WA 3B9EA 4Q7NA 1UMYA 3KP0A 4ZOHB 3TJ4A 4DO7A 1UIOA 4DNMA 7TIMA 1Q4NX 3QR3A 1UKQA 2Z1KA 3F5KA 4X3ZA 1LG2A 1MUCA 2VC9A 1SJBA 1E6ZA 4M6PA 2Y0FA 1VLIA 3PZMA 4IISA 4QCFA 2DDXA 2D1ZA 2ZXAA 3T0DA 4D6EA 3WENA 4C6PA 1A4LA 4L6HA 4GZIA 1EX5A 2XHYA 3IGHX 3FSTA 1CB7B 4WZHA 5DY2A 3W86A 5AHIA 3URNA 4MY9A 5FJIA 1LM1A 1WZMA 5FEZA 2O4MA 1RQBA 4HD5A 4WD0A 4E4UA 5BRQA 3NQAA 3P7YA 4JY9A 1IV8A 2Y1HA 4UQBA 1G94A 3PHAA 1XYBA 1DTUA 2DZPA 3CTTA 5CPSA 3L65A 3F2BA 2VX7A 3WJXA 5EMMA 2QEZA 3H54A 1F3EA 4LVGA 4AB4A 3SCNA 1GCYA 4IMFA 4KPLA 2P53A 2EJ1A 3B9DA 5EBKA 3LXAA 3QV6A 2VFHA 1IIGA 2VZVA 2YA1A 4RLIA 5EMKA 1LBLA 4KF1A 2CLIA 9RUBA 1H50A 3KE0A 4DX3A 2CESA 1V6TA 4QEHA 2CC0A 3VIKA 1GOIA 4MDPA 1GHSA 1I2OA 4H01A 3QFWA 3L5OA 3VINA 1MW2A 2WPCA 3H2EA 3FA3A 4AMAA 2CBUA 3GNPA 3M43A 5GVJA 1F8WA 1KFKA 3TW6A 1Z8AA 1QK0A 3F4WA 2IXUA 2WHJA 2AAAA 6ENLA 1GRGA 3W85A 4AW7A 4XX6A 1UWAA 1I9CB 4KS0A 3WQ4A 3EDEA 4G1KA 2YKKA 1QU4A 2G96A 3HPFA 3W28A 3GFZA 3UPBA 3GHTA 3S1WA 2PDXA 2PLKA 4GGHA 4LIIA 3N2CA 3S5NA 2HPIA 2AGTA 2AL1A 3ABXA 3SO7A 4CQCA 4JTAA 4PRWA 3M7SA 1ONWA 3EF6A 3HF3A 4BI6A 3W83A 4BJHA 2CLFA 3UPWA 2GR3A 3KOWA 5ER0A 2JGQA 4LYPA 4ZB0A 4LUSB 2PDKA 1O4UA 4QS5A 3AMLA 5HQEA 2C3CA 2IPJA 3S1VA 1FWBC 4EPEC 3A7UA 1T5AA 2FZ9A 1CIUA 2Y24A 3TUUA 4RDYA 1JRBA 4C1KA 5DELA 2GRTA 1DJYA 4CEXC 3TXVA 2OKOA 4PUKA 2PZ0A 3NO1A 3E49A 3WDIA 5JVLA 2W0UA 4O1AA 2YCLB 2WW5A 4YHGA 4MKVA 5FESA 4IF2A 5CG7A 1RP9A 2NQJA 1ISXA 1JFXA 4G56A 2CEQA 1F74A 4ACYA 4CCDA 2DZSA 1CW2A 3K2GA 4AXNA 3GUGA 1ME9A 1A80A 1J0ZA 4XTIA 1D7FA 2YA0A 3Q94A 1NOWA 2WM0A 3XINA 4IFKA 4IHCA 2HWGA 4KPRA 3CUIA 2WWCA 4GI9A 3T0TA 1JDAA 3MW7A 4C5YA 5G5IA 1ZAIA 3JU2A 2DZUA 2FTWA 3MHUA 4Y90A 1VQZA 3W2JA 3KL5A 5FS9A 4K68A 2WVUA 2VT0A 5A6SA 4PFMA 1EP1A 2WBKA 3CWHA 3WDHA 3PF3A 1DIKA 3BG9A 1TJRA 8CGTA 1VHNA 2ZX7A 3FIGA 3WLLA 4WUIA 3VM7A 3CGDA 2WK2A 3KVKA 1TQXA 1YNYA 4BR1A 2GVLA 2BLEA 4K39A 1TA3A 4JHZA 2PBOA 4KQNA 2CZDA 2JE8A 1TFVA 2OT1A 4AISA 3AU6A 4GA8A 2GQ3A 2AQVA 5CG0A 1UH2A 1XD0A 1QNSA 1DJHA 5F7UA 1UD4A 1EQPA 3H2NA 3PB2A 2D24A 4Z1BA 1V0KA 3MV01 3T0CA 1DYSA 1UROA 2YYUA 3GXIA 3TTSA 3OOQA 1QUMA 1VFFA 4HZ7A 4JTDA 3WYZA 3BSGA 3SN4A 2D2OA 2FTPA 4GWEA 3SJ3A 1KBIA 4H1ZA 4NJGA 1VCGA 3OG3A 2H3DA 1LWJA 2CHRA 1XV8A 3H4XA 5CXPA 3VUPA 4BQ4A 5BYWA 1RZMA 2ZUWA 5I23A 4O0ZA 4LA1A 2X41A 3LADA 3ABQA 4IMEA 5EY5A 1UG6A 2VURA 2DQWA 3W2NA 5J5DA 3ISIX 1UJPA 3AYRA 4E4PA 2YDAA 1VFSA 4BF9A 4LUIA 2YDRA 4FHAA 3BUVA 2IKIA 1UWRA 1X1ZA 1TJ2A 3CASA 1W2VA 3GB6A 4XQ6A 3AIUA 4O1CA 5EMLA 3EYPA 3ZQ9A 3ARUA 4KCVA 3T40A 3I7RA 1WXZA 3USBA 3KHJA 5ECVA 2QZRA 4BV6A 3E6EA 1PZ1A 2CBVA 1EBDA 3E0IA 4KW2A 1P43A 1QDSA 4U28A 4V28A 3B8WA 3OZYA 3TYDA 1UKPA 1WKDA 4RKAA 4DWDA 1NVMA 3NM3A 1NTHA 3URQA 4UOZA 3VO0A 1JAKA 2EQ9A 1Z44A 1E73M 1O5QA 2TPRA 5G2IA 2YX0A 3SR6B 1BKSA 3HPSA 4H00A 1NP0A 1W17A 3NZGA 5CCZA 2PRMA 2F6XA 2RDXA 2V38A 2Q3OA 4BCEA 3BQ6A 3PY2A 3S1XA 1RK5A 3GKFA 2Y85A 2P10A 3TNBA 3NQEA 4J27A 4GBDA 2HDJA 6XIAA 3ID7A 3T09A 3EWYA 3LPFA 1SYTA 3DHDA 3FS2A 3BK0A 1FFRA 2H90A 3GAYA 3R5EA 1RA0A 2NV9A 1PKYA 2AOSA 1KM1A 4QNWA 3M0JA 3UCDA 3TQPA 3NL2A 5CGMA 4HNCA 3TKFA 1R0MA 4LV9A 1DP0A 4AWTA 1R2RA 5XIMA 4I3GA 1R3VA 1YBQB 2VX5A 4BZYA 3WL1A 5BXPA 1DIOA 1A5KC 3APYA 1C8QA 1W3NA 3LNMA 1MDLA 3HQPA 1FCQA 3SSZA 3WDPP 3JZEA 4ZXLA 2ESCA 4Q6JA 3ARWA 4Z2GA 1XLKA 1IXOA 4UR9A 3SRFA 1Q63A 3KBVA 4XZLX 3PPFA 1F8MA 3UA4A 3WH9A 3NGFA 1QOPA 1FKWA 3AMGA 3OEXA 3TV8A 7PTDA 3FY1A 4AD4A 1MDRA 4PZVA 4LBRA 3SCRA 1ZMDA 3MSRA 4B3KA 4L4MA 4MVAA 2CLMA 5LXEA 1NARA 3WNNA 3BPWA 1VBGA 3B9JB 3EGJA 4J3SA 1O94A 1AODA 2ZX5A 3UR7A 2NVAA 4US5D 1W5QA 4Z17A 1LROA 5ABFA 4PBFA 1S7MA 4FS9A 1RJPA 3ZSSA 4X60A 1AUSL 1AJ0A 1F7BA 2PE4A 4XG1A 3G77A 2FGLA 3IWPA 3L4VA 2W92A 5I3FA 1C90A 4LTSA 1QPRA 1DWJM 3GXDA 1KN0A 1A5OC 1XGZA 3H2AA 3APGA 4GUIA 1NOUA 2ZWYA 2X8CA 3WD3A 1JCXA 3RRAA 1ZCOA 3RLUA 4U2YA 4JQ2A 2VEPA 4RDZA 1XS2A 3D3AA 4O11A 1OY0A 3N9RA 3UXAA 3S6DA 1EHNA 2CERA 4GC4A 1TCMA 2R82A 1O66A 3F4NA 3FN9A 3UNTA 2E6FA 3S47A 3DYPA 3GH7A 5CH9A 1ONXA 4DO5A 3E2RA 2NX3A 1GW1A 3WQ5A 1CXLA 1UUMA 2YBUA 3L2LA 2PD5A 1XYMA 1L8PA 3CV6A 3THUA 4RE2A 2EEXA 1E40A 4RK8A 1NU5A 1ONEA 4TVUA 2WQDA 3FDGA 3TDFA 2F6KA 5FF3A 2X42A 4C6FA 2ZICA 2DVXA 5C2XA 1F3WA 2E1DA 1DQXA 1B1YA 4HHHA 2ALRA 4S3DA 3D46A 3AZRA 3SGGA 3OO2A 3EZ4A 3T0AA 4DZ5A 1MXDA 2DW6A 1R3WA 2A0NA 2G4FA 1VBRA 3TLLA 1AMYA 4LYRA 3WLTA 1FVPA 1FXPA 3RCNA 3KRSA 1AD4A 1GJPA 3VNZA 4DBEA 4U5KA 1OB0A 3HURA 4GZEA 1YE6A 2FB3A 4F2TA 1J4EA 5FL0A 3RFAA 3HPAA 5E9AA 3QSRA 5AC5A 3UYCA 4Y7EA 4M6QA 4R85A 3VIMA 1RJQA 5JBFA 3KOYA 4LPCA 2DSUA 3OJGA 3CMFA 2C7FA 2G97A 4RNIA 5FF4A 1B9ZA 1UZHA 3R6IA 1JEZA 4NRSA 1GVRA 2OGYA 5TIMA 4CNUA 3SURA 1ZBCA 3QY8A 1VH7A 2CXGA 5DBUA 1E6SM 4DUXA 5FJOA 1JDEA 2NZLA 4O8RA 4JNYA 1D9EA 3UVIA 2ABAA 5C9XA 4DYEA 5DX7A 5D2YA 3C2FA 2ISWA 3CTLA 1KM2A 3QPYA 4YL2A 1K4HA 4F0RA 2UWFA 2PFHA 3RR1A 4M8UA 1BQCA 2XGIA 3B0UX 1SW3A 2HVOA 1AVAA 1EDGA 5EKYA 3LENA 1M7PA 1H60A 3MT1A 3H22A 4DXVA 3AQUA 4CUCA 3BLLA 3EUB3 2B81A 4H9UA 3TAKA 5E1QA 3WNMA 2XWDA 5BCAA 2P0IA 3CC1A 2OJPA 2GWGA 4CNSA 1HXJA 1T6MA 3VCRA 2CLKA 4JXCA 2NLYA 4A3UA 1X98A 1WOBA 1EWDA 3CNYA 1RVKA 5CC7A 1X39A 4N9EA 3UZJA 2GR2A 1BD0A 3LGGA 3G0SA 3QC3A 4H7VA 4XAGA 2RDTA 4JBRA 5E70A 3DBNA 1B3ZA 1Z48A 3FFSA 5AHNA 1OX6A 5BRBA 4MKNA 1GRHA 3MBDA 1QMLA 4KWVA 4QFUA 2CLHA 3BLFA 1XIHA 2BMBA 1XIIA 3NQCA 1X6LA 1GOMA 2ZA2A 2HXUA 1IWPA 1V3JA 4GCXA 5CBBA 1G01A 3QFEA 3WUGA 3IAQA 2BG5A 3AROA 1N61C 3BV7A 3VZZA 1SSDA 3BDKA 3GG1A 4PULA 4HSNA 3ZR6A 2J13A 3OLEA 3HGOA 2JKPA 2OCZA 1GNXA 2EO7A 1XSKA 1TPB1 2G3MA 3N19B 4IG2A 3PZUA 4HP5A 4LB3A 2GSEA 4CD7A 4ZA0A 3ZT7A 2NQHA 5CBJA 4PMRA 1S2CA 2VC7A 4FR6A 2DH2A 1LRNA 1QJWA 2GPTA 3TW9A 1UWUA 3B8UA 3M5YA 2VX4A 2E5BA 4EE9A 4A4AA 4YN5A 2HQAA 1CX9A 4ATDA 3DHUA 7XIMA 2X7VA 4KCTA 3LZ5A 2GJXA 3EPOA 4WVXA 5BMXA 2ISVA 1LT8A 1XANA 3FJ4A 4JYFA 2TSYA 3BAXA 1GGOA 1JZ7A 2ZQ0A 1IEWA 4MWAE 3GLCA 1NAL1 1EIXA 3I3BA 3CPRA 2CZVA 3TN6A 3IIOA 1M03A 3IVSA 2VZUA 3L0NA 4MKSA 2VOTA 2SFPA 3V7PA 4Q8TA 3MKVA 3AZSA 3O3RA 3LK6A 5ECUA 5ABFB 1FWHC 4Q8WA 4UQ9A 3OBAA 4A3RA 3VFLA 4CQBA 1OCNA 1UPMB 4I7WA 5H6HA 1V6YA 3VMOA 1WNOA 1RP8A 4JTEA 3GH4A 4CEUC 4AEOA 4PMYA 3CH9A 2WNQA 3ZVHB 1K6AA 3SIZA 3K4AA 1EIBA 1W32A 4C6KA 1JL8A 4K38A 3PBVA 2WVVA 3ONBA 2F38A 1EDTA 1UOZA 1FIQB 2YLAA 4PMJA 3FK4A 2W55A 2GOUA 2OODA 3R07C 4DNAA 1HP4A 3FVDA 4B2DD 2GDVA 2JK2A 1CGVA 2W63A 5E6YA 4FEZA 3L9CA 3VZYA 2FIQA 3UD6A 1M3UA 4F40A 1J0KA 4MB5A 4FZIA 2E6YA 3P93A 4AIBA 1RHCA 5EBUA 4NEWA 3LRLA 1TYPA 4BQ2A 3R8RA 4AZIA 2ZRWA 4BURA 3P74A 1UW9A 1O5XA 2ZA1A 3SFWA 4NVTA 2V5KA 1IWAA 3HBLA 2GYIA 3B06A 5D30A 2B7PA 1VFLA 3WLPA 1Q6CA 1I0DA 1ZRQA 1QOXA 1GOQA 3JR2A 3PSWA 4U5IA 4O17A 4QQUA 4JIRA 4H50A 3DH9A 3PNZA 2XIJA 4C7FA 1BXCA 4HU8A 5FS6A 3DGBA 3M5VA 1KWKA 1NY1A 1KM6A 3HO8A 2WMFA 5I03A 4LQ1A 3ARRA 2PWVA 3O8AA 4GYFA 4NZCA 1TKKA 1S5MA 3W72A 3LB8A 1TWIA 1Q2SA 3NIYA 2RJHA 2X0YA 5CPNA 3NUKA 5K9XA 4X2PA 5A6BA 2JBMA 1OX4A 2D2JA 3H12A 3E0VA 4HPHA 5AZ1A 4AZBA 1ONFA 4QHRA 4UTWC 4GKLA 1QASA 4ZR8A 3D5HA 2E9MA 5AYIA 3F1QA 5AYBA 2RDUA 3CV1A 3OVRA 3LS9A 1L6SA 1TWZA 1H1YA 1XRFA 3QOMA 4NAFA 3SI9A 1K9DA 1JYNA 4NI8A 1DHKA 3ELFA 3WMLA 4I5XA 5H2ZA 1AJZA 5MKGA 2ACUA 2X1IA 1JPHA 4FB7A 4DJFC 4KEMA 3ZSTA 5CBIA 3BZGA 5FJUA 2YL8A 5E0CA 9XIMA 3M5ZA 2BGNE 2INEA 4GUHA 1QW7A 3W1AA 4Y9AA 1PDYA 3W7KA 3BJTA 1IF2A 1LG1A 1YW1A 1FWIC 3VOFA 1GG0A 4AY7A 4FPSA 4E2DA 3H7VA 5EYWA 3FYOA 1ZL1A 2PDJA 3T8LA 3TN3A 3VOCA 2VZTA 3NG3A 1T3QC 2POZA 2NQLA 1RD6A 1PE1A 1K9TA 1U1UA 5I3KA 4KRTA 1AH4A 2WCAA 3L2MA 3OHMB 2WB5A 3EWWA 3VGFA 3H2CA 5C5YA 3F2CA 5HR6A 4Q8PA 3S83A 3NA8A 4OU1A 2ACSA 3KOZA 1W1ZA 2CDUA 2ZADA 1KLYA 1FX6A 1REQB 4C91A 5B7ZA 3BWWA 3VMPA 3GNNA 1OFBA 3SQSA 2VJXA 4GQRA 3R89A 5ENLA 1KNWA 2CZFA 1Q6EA 1LRTA 4IFRA 1XHGA 1ZK7A 1HKIA 2CLLA 1SZEA 2PGRA 4P8VA 3C2YA 2WPEA 1WBJA 4V27A 4HMNA 2DZBA 3P67A 5I3IA 3MKKA 1A3XA 1TCDA 4R88A 2Q01A 3NDYA 5CPLA 3B0VC 3WZ0E 1ZMCA 3N13A 2QCNA 3SQLA 3GXNA 4Q8QA 4MUPA 1K7FA 2X1RA 1JI2A 1OFOA 2BOFX 2YB1A 3GDLA 3UVAA 2BODX 4Q4KA 4LB4A 4K36A 3BW3A 1GJWA 3C2OA 3KBNA 1GJUA 3WUBA 4O16A 3WQPA 3DCPA 3HG4A 3A5VA 5HNTA 2NWRA 3PJUA 3GC5A 1E5JA 1W91A 3EDFA 3K30A 3W1NA 3N29A 3VNMA 1R87A 3E5PA 3GU2A 3EB3A 4Y2WA 4IQJA 3DU0A 4QSFA 2OKTA 3H2OA 2VEIA 1SO3A 3E1F1 3WNOA 1M9HA 2VELA 4GOAA 1RJRA 4B9YA 2W27A 1XGDA 4JTTA 2Y2WA 2XM2A 4WOZA 4K8EA 4D8AA 1R9YA 3MQTA 2R14A 4GNKB 3OG2A 4H9ZA 3IAPA 2V2DA 1GW9A 4UR8A 1IXPA 2HTMA 3CH0A 1DIDA 1VB9A 4KERA 2XVPA 1LVLA 3IJLA 4GXWA 3UY8A 1TRIA 4HHLA 3W2MA 3FJNA 3SY8A 1UP2A 4O1EA 3W1MA 3FA4A 1BRLA 1MNSA 4ROPA 3MUIA 4ZZ9A 1GONA 4R9OA 4K7ZA 4PCTA 4GFSA 1E4NA 2DGAA 4GYPC 5JH2A 2D3NA 3FG2P 1A49A 3CO8A 3G1RA 3POCA 1CNVA 4NZ1A 1KV8A 2XIIA 5M5DA 3L0KA 1PO9A 3APTA 1BVZA 4XZIA 4CN1A 1JUEA 3W7LA 1MVYA 2ZOXA 3RDKA 4PUWA 1GQKA 5LNWA 3NZ1A 1DWGM 4FXSA 1PUDA 1UPPA 1KW1A 3M46A 1U5VA 3DG3A 1DWFM 5J5RA 1EOKA 1VFOA 1VBHA 1HGYA 4M19A 4PSRA 5TAOA 4HSOA 2Y8UA 3RJXA 1EB3A 5B80A 4CNNA 3R94A 3W7HA 4B16A 3RITA 1TUFA 4H83A 4KETA 1A0DA 2ZUNA 4IWWA 4H7ZA 2R1MA 3PZNA 1BWKA 5K9CA 1CTNA 2NUYA 3MMDA 3QPEA 1OT1A 1H63A 3II4A 1VFUA 4FNRA 1MMFA 1M01A 4I6KA 4ROQA 1MUMA 2PDPA 4C1NB 3D6NA 1LZOA 1RSCA 2GUUA 4XISA 2E9BA 1ITXA 4H4WA 2CXEA 3ZLHA 4LRSA 4LAKA 4A05A 3NDZA 3MI6A 1SZFA 5JMUA 4W89A 2W79A 3SADA 3R0DA 5ABGA 3IRDA 1FWSA 3SIMA 2FPVA 1FH7A 1YADA 2XVLA 1OCBA 3TJIA 2OWWA 4K8GA 2J3NA 1FECA 3I4EA 1U1HA 1W3KA 3W71A 4ZTYA 3UWYA 2PGWA 4PL2A 1PDZA 4OBRA 1GVFA 3MDWA 4S39A 3MZ2A 3PJXA 1NDYA 4GZ7A 4S38A 4EK7A 3TFCA 1E0VA 4AD2A 4MJMA 4KRUA 5I3HA 4P7QA 2F6UA 1W1A1 4IPIA 2XN0A 5FEXA 1PZ0A 4M1BA 1DQUA 2PAJA 3GHRA 4X63A 4I8DA 4NZ5A 2C18A 1KA9F 3DHFA 3HFYA 1YLVA 5TQLA 3VD4A 4G7EB 3PG6A 4KFPA 5IOBA 4L80A 4B4HA 4MG4A 2EPOA 3KS5A 3TYBA 2V6OA 4FLSA 1LBFA 4PEEA 1T41A 3UJSA 5C7HA 1POKA 3TK7A 1IZCA 4JTLA 3A47A 5LZLA 3C86A 2WSKA 3LLDA 1WYGA 2XISA 4PUMA 1PPIA 4DZHA 1HKVA 4YPJA 3H55A 4I5RA 4MYXA 5LIXX 4UWMA 4M6VA 5EGRA 3MCMA 5AB3A 1EUNA 1PV8A 1D3HA 1WXJA 3L23A 3A4AA 2XH0A 2VRQA 3QC0A 2C6QA 1PHWA 4RNJA 3WFZA 2ZZBA 1QAPA 5I02A 3ZT6A 3EOOA 1W37A 3NOEA 3VX1A 1YDYA 4EMJA 2JKAA 2AMXA 2XH4A 2C0AA 3PUGA 5DLCA 3PWGA 2A5HA 2XVGA 2PU0A 3MY9A 1F6YA 3TJLA 3G5EA 2E25A 1EH9A 3O9NA 3DECA 2PZNA 4V33A 4XVDA 3WMSA 5L9FA 4AZCA 3OA3A 3MA8A 2FHFA 5FF0A 3SUSA 2VMFA 3W7RA 3N04A 4JYEA 3XIMA 3PVFA 3LHYA 3MO7A 3WD2A 1SFTA 2QUNA 1EPVA 4O14A 1FDZA 2J88A 4AZHA 1HL9A 3ABZA 1RV8A 1PTAA 4R33A 4QBXA 4IZGA 6CGTA 3U2ZA 2EPHA 4LXFA 4FXRA 1R3RA 4DJDA 5DBTA 3G1AA 2YQUA 1GORA 3IV8A 2WSYA 1S39A 1YMYA 1H2JA 3LDVA 3S2NA 1Q8AA 3QVQA 2PLMA 3LTPA 2X2YA 3TX9A 1UR3M 4N0RA 4BWLC 1M7XA 5HJYA 5T26A 3CHFA 2C15A 1HL8A 1FWFC 3NAVA 4TVDA 5FEPA 4E4FA 1XRSA 9CGTA 3W1LA 3O2LA 1FCUA 2Z6JA 4DUWA 2YOCA 4K6AA 3V5CA 4TX8A 4JL1A 3IGSA 5E0FA 1XLFA 4K8DA 1IEIA 3CU2A 3OZOA 1IXNA 2AGKA 2H6RA 2P1FA 4DM1A 3VDGA 6TIMA 1MW0A 1BWCA 1IWBA 2V82A 3ITTA 1GYNA 2HPMA 3INPA 1XPGA 1MW1A 1Z7AA 1J11A 4TR9A 4J1OA 2ZDRA 4LNYA 1G9HA 3KZSA 1FCBA 4OQVA 3PPHA 3ZO9A 2ISFA 5AZ0A 3U4FA 3B8SA 4L9ZA 1N2VA 1N55A 3CL6A 5IXEA 4U31A 4RL3A 3NNTA 2VOMA 2VM8A 1GXFA 1IEQA 3FHQA 4FLOA 1A4MA 3UEQA 4D8ZA 4MB4A 4N6EA 1RUSA 5HMFA 4WEVX 2FDSA 3WF1A 1LORA 3HGJA 1EPXA 5SWUA 1Q1RA 4YYCA 1AJ2A 3I10A 4UTTA 2J8TA 3CPUA 2DT0A 4JPGA 3DESA 3SCTA 2I17A 5KZDA 1ENUA 3QKZA 4YWSA 5DCDA 4LGXA 4MMWA 3OPSA 3B8IA 3SCQA 1KRCC 2OYLA 2YZRA 4HPGA 2NQ5A 4HHMA 4DLFA 4GX8A 2WKJA 2RUSA 4PRTA 4YVXA 5HJXA 2DORA 4XIAA 3M6YA 1JYVA 2VRJA 2XM1A 4IIEA 4HCDA 1N63C 4TOQA 4JOMA 3AMCA 1M7JA 3VNYA 4WF7A 2ODOA 4HHPA 2PDNA 3AXMA 2XIMA 4O1FA 4B15A 1RPKA 1D2KA 2Z1SA 2HVMA 3M44A 3N34A 1NHRA 3H23A 3AIWA 2QV5A 3GRTA 3HA1A 1KO0A 3CZJA 1C9DA 4DBWA 1IQ8A 4HU0A 2OFJA 1C8XA 4GC3A 5CZ0A 3W87A 3GR4A 2Q8XA 4ZODA 2J7DA 2W9MA 3A4WA 1KFCA 2WWDA 2G0WA 3G2GA 3QXBA 2XFFA 1KCZA 1WKEA 4UTIA 4C7GA 3ARZA 5A2CA 3N14A 4ZFMA 3SY1A 1WAWA 5LGZA 2GGEA 4JHMA 3HMCA 2WZIA 1XYFA 3E3HA 1UKOA 2DV0A 4F0LA 1ZDLA 4FNTA 1E9LA 5KVHA 4JN8A 5U1OA 3UGVA 5CPOA 1X2GA 4C6EA 4C7DA 1FWGC 2BVYA 2NSXA 3WFLA 3OVGA 2C1IA 2E9LA 4PB5A 4UZUA 7REQA 4H19A 3T78A 5AHMA 3QZAA 3B8TA 3TSBA 1PAMA 1UC4A 4KCWA 5BOOA 6REQB 2UZ9A 4RJEA 3AS0A 4OOUA 1XHCA 3DKJA 4LAZA 1HW6A 2VZSA 4WGHA 1H7WA 3GVRA 4DZAA 1MWOA 3T1GA 5AKQA 1WDWA 3NXFA 3QHNA 1TSIA 4GO9A 4GRTA 3GKAA 3QY7A 3FXYA 1LBMA 1NWUA 3L21A 2PDBA 2PTDA 1Q6DA 2Z29A 3E96A 4AIUA 5AVHA 2Q09A 1ME7A 2WHMA 4NILA 3U2EA 1JXJA 4QJ3B 3N3MA 2V5BA 1DBTA 4MWAA 4XZBA 2Y7GA 4B5VA 4D2JA 2FH6A 3CYJA 3PP7A 3IV3A 1US0A 4DBUA 3IJ7A 4Q32A 3HTWA 1QI4A 1F5ZA 2V0TA 1TUXA 1S3HA 2R1NA 1E0WA 3W25A 2WOQA 3VUSA 4RPPA 1N60C 2NVKX 4FIRA 1XYZA 4IUOA 4IIHA 1OFRA 3W27A 3OIXA 5FA5A 4GUGA 3KZPA 2FVKA 1J93A 4D72A 1TWSA 1QI2A 3BW2A 4YVVA 4IGSA 2WMGA 3CUJA 4AIOA 4UUIA 2WSQA 5CSUA 5M3WA 2EHHA 3UXLA 4XD5A 1IZKA 4MZ1A 1GQLA 2DPEA 1VENA 4MGGA 5I0DA 4KMQA 4ICCX 1EP3A 3OHIA 1XFBA 2VR5A 2H8ZA 3EX4A 2CBIA 2EQ6A 3LSCA 1W9XA 3RPTA 3WMBA 3KLKA 4N02A 1EJ7L 4HNUA 1XFCA 2CKRA 3B40A 1GVOA 3UWWA 4QJ4B 1BXNA 1FWWA 4HK6A 3I6EA 4DBDA 1Y5XA 2A3LA 3N4AA 2JKEA 1F9CA 1OFEA 3CZKA 1GOKA 2ZVIA 3VILA 1W1B1 3C0QA 3GIYA 4XKYB 5LYRA 1YPXA 1O5RA 3NO3A 2JFEX 3EKZA 1W3IA 3QW3A 5FCZA 3GVQA 1LUCB 2HISA 4B5NA 4H6EA 4OJYA 1N62C 4GQGA 1XIDA 2YVGA 3LCLA 5GJMA 4IICA 4J40A 1RY0A 1FWCC 1Q65A 1TR1A 3R12A 2QCEA 4QQ3A 3CB8A 2VENA 3ZWTA 1UD6A 4XD6A 2WQPA 3FYYA 3JZUA 3RCYA 4LVAA 2KAUC 1JZ3A 4LYQA 4FP1A 2V3BA 3TYUA 2NQZA 2OO6A 3IACA 4D9PA 1QK2A 1M6IA 4O52A 3W2KA 4Y9NA 4PBEA 3B4YA 4NX5A 2BZNA 1HJUA 3HOJA 2XDFA 2PLJA 4W8AA 3GC2A 1SU5A 4GABA 3KBJA 3N6QA 1MRQA 4GYKA 2OLSA 2CW6A 3NPWA 1Z3NA 3REQA 1EX1A 2DSKA 6PTDA 1W1PA 2G50A 3BANA 4A8LA 1UR1A 2WBAA 3MVTA 1Q7ZA 1JDCA 4P7LA 2CITA 3FKKA 7TAAA 3AWNA 1HKWA 3E5BA 2QS8A 3QY6A 5IBXA 3TIMA 4MPQA 2D2GA 4RXFA 1H7RA 3WEZA 2W66A 4O53A 2J6VA 1BSIA 3M0HA 4FK9A 4FOJA 3Q2DA 1C9WA 4PMVA 3WKZA 3DC0A 4O0KA 3W1RA 4EWJA 2NT1A 2D3LA 1L6GA 4WSKA 5ABHA 4UTFA 2ZZ3A 3P14A 3U9IA 3C56A 1AW5A 3M16A 4Q4PA 3PUDA 1QI3A 2PGEA 2Z6IA 2ZZ0A 2GSJA 4NG3A 2R9ZA 3KAOA 4JY8A 4S3JA 2PDQA 4RNHA 4EWND 4O57A 1NDWA 1E72M 3LM3A 1B3WA 3BZJA 2XFYA 4B2DA 5HUOA 3KBWA 4NKCA 5BW6A 2D73A 3THDA 3C61A 2NSOA 1T99A 3NQ8A 1Z42A 1B3XA 2JALA 3B8VA 1BYDA 3PBWA 4NIRA 5A6LA 1E6NA 2INFA 1XR2A 1QNVA 3GS6A 3DOPA 4ASTA 1BFNA 4OECA 3VZXA 2W6RA 1HVQA 4K1WA 3GBEA 1S5VA 4XZ9A 4HMDA 1TQJA 2OWCA 1KGWA 1XLAA 5D02A 3K4WA 4CQDA 2VD9A 2BHYA 2DSVA 2ZZ2A 4Q22A 2VKZG 4Z2KA 3LHUA 3H4WA 4GY7A 4BKNA 4HZMA 2Y89A 3KTCA 5K4ZA 4EVZA 1FOBA 1V59A 1B31A 2WP5A 4L9YA 1V6XA 3U7VA 2DSZA 3WX7A 2G4JA 4QP0A 4CD8A 4X22A 4JFWA 4L4LA 1OFPA 1VFTA 4FNUA 4Z42C 2WZTA 1C92A 1JCMP 3CQIA 1WZKA 4JIPA 4DEFA 3W01A 3WJYA 3QM3A 4IL2A 1OG6A 2WJEA 3PB0A 4IX0A 5LIWX 1XX1A 4UZSA 1OYBA 1QCWA 1GTHA 3K46A 1LQ0A 1I2QA 1DXLA 1Q66A 4GIYA 2QJMA 1PB0A 4NEVA 4AZ5A 1TYGA 2QUUA 4R27A 2O7QA 5KZMA 2BHUA 2ZZ7A 1O6IA 3VD5A 3N6JA 4GMEA 1QNOA 2YA2A 2EG8A 1ZQ5A 3PBMA 3WLNA 3LNPA 3CLMA 3NZPA 4XK2A 1DWIM 2RGMA 2RHGA 3LBCA 1YIXA 4GRSA 4LYKA 1BTMA 2PC8A 4LBSA 1XIFA 3B9OA 4H4VA 3IJQA 4BFAA 1RH9A 3CIVA 3G1XA 3CUGA 3PFRA 1W3JA 3UCCA 4B91A 1WKYA 4WKHA 1FY6A 5DEZA 5A8PA 1EGZA 5E5CA 3VXGA 2FMNA 4TTUA 4UTUA 3N18A 3W1TA 4EAYA 1ELSA 4H7CA 2BXZA 4IXHA 1BF6A 3KBSA 4WXYA 5HBFA 1LTDA 3WDRA 5A8NA 5CPMA 3IUDA 5DT5A 2AKZA 4U2ZA 4UFIA 2Z7GA 4FX8A 1FEBA 2HJPA 2BP1A 1DJIA 1O1ZA 1HF6A 4UQEA 2Y5SA 3RLVA 4C6LA 4DPPA 4YTRA 3IEBA 1JIBA 1OC6A 2ZRXA 2IQTA 4OT7A 5A3HA 4XZHA 1FP9A 2VFFA 3G1FA 4NHVA 4DJFD 4APNA 1NIUA 1ZB5A 2OOGA 3IUHA 3TZFA 2E1WA 1Q6QA 2V8ZA 1UZ1A 3AYSA 3EDDA 4Q8OA 4YS1A 1TTIA 1X6UA 5C9ZA 5EMJA 4QGCA 2BB0A 2WCGA 3W02A 2DZXA 2QUTA 5C8BB 1GYMA 1CLVA 2J8FA 3TEVA 2J79A 4DHGA 2WPFA 2F9RA 2OSYA 3V18A 3NURA 5I00A 4YHEA 3GR8A 1GVYA 5AHEA 4U3AA 4JQ3A 5H8PA 1C93A 4W8LA 5JU6A 3EOLA 1NPXA 4PH6A 1AQ0A 2IQ0A 8TIMA 4OGZA 1OINA 3G3DA 3CAVA 4R9XA 3LERA 3ECQA 2ZUVA 4US6A 1V93A 1A5BA 4QE1A 4REQA 3JUGA 4H9VA 3G24A 5REQB 2Y88A 5IHRA 3LCGA 4UFMA 1PTDA 2QCDA 5K3VA 4H2HA 2V67A 1KXQA 3AJXA 3BCJA 1B3YA 1NF7A 5AFDA 4H41A 3EDKA 1IE7C 4PCPA 1VLWA 2XH7A 5JCNA 3THQA 4E2OA 1IIHA 4EKJA 4RNFA 1EFZA 2GVJA 2GLKA 2VC5A 4CKQA 4Y6GA 4X9SA 3ATYA 5LSMA 1EOMA 1W5PA 1AMKA 4E3VA 4H4QA 1IXQA 1QHOA 4LC6A 2V2HA 1EHAA 4PC8A 2YVJA 4KFOA 1CECA 1W6TA 4HVXA 4G2DA 4MUZA 4JDYA 1HKJA 3QQ1A 3A4JA 4UFLA 4PSPA 3WF2A 4HB7A 1EC8A 1V0NA 2GWNA 1IR1A 4JCLA 4QITA 3S5YA 3OBEA 2ON3A 3OYZA 4GYJA 4WJXA 3MUXA 3QZ6A 4PUNA 2J7EA 3K1GA 3PAJA 5FIPA 1ZY9A 2PDHA 3IVUA 1VPYA 4WSJA 3UXDA 1GZGA 4QG8A 4XBSA 3EMCA 2DUAA 3I3EA 5GJPA 1UZDA 1R2SA 3CYVA 4A2RA 3QGKC 5E0KA 1IHIA 3KW3A 4D6FA 4EF8A 1CT5A 4P2VA 1H62A 3EX6A 1JULA 1NSJA 2E8ZA 5HWNA 4XKMA 1UA3A 3W1UA 3R1ZA 1UQYA 1SO6A 1OYAA 3DXIA 1TVNA 3TC7A 1B2YA 1OVDA 4NZ3A 1J79A 4BQ5A 1FWEC 1LP6A 1HZYA 1D8CA 1VHCA 5EFFA 4B5SA 1W5NA 1AA1B 1N5XA 3QMRA 1DNCA 1ITQA 1HTIA 3UG5A 2WMKA 4QRNA 5FJRA 4BEQA 4CGTA 3TR2A 2DFAA 1G4SA 5BRPA 3NRZB 3WCZA 3DZ1A 2EGZA 5G2HA 2YCEA 1H51A 4JTGA 4AVFA 2WOIA 1XBXA 2PWGA 4L1WA 1Y7VA 3B3DA 5C54A 3W73A 1OGBA 4Z2HA 1S46A 3O05A 1RK6A 1QO5A 4G5DA 4JKLA 1CLKA 1VIZA 2EF9A 4K1GA 3XISA 3GC4A 3NL5A 4AF0A 4TX6A 2C16A 2VL4A 4JTRA 1K9FA 2R6OA 3NVVB 5CSSA 2WZMA 1MUWA 3ZLGA 1MEIA 1WX0A 5EPDA 1EF2A 1KFJA 2YPIA 1F3TA 4L6DA 5CLWA 1VJSA 5CSYA 2BY0A 4JKKA 4ZOCA 2NLIA 3H26A 5FMHA 1SR0A 4DJEC 4IIDA 3MHFA 3CZGA 3BMVA 3GW0A 1OF8A 4B3LA 2PF8A 2NVDA 3DJJA 2GQAA 2V3FA 2V81A 1E6XM 1OT2A 2QPSA 4UC5A 2YBVA 1SFLA 4LUYA 3EX1A 4Q4QA 1PCWA 1U33A 3LXBA 3W00A 3STGA 4FMVA 1DJNA 3GU1A 4RV8A 3FYPA 4XO7A 2H9AB 1ZJIA 3CQ0A 1HO4A 5XIAA 2QJGA 1ZZMA 3GNXA 3NQ2A 4LUSA 2R1LA 1JZ5A 4NAEB 3SUVA 3I4KA 2VHLA 3OVQA 1W2PA 1W9PA 4XSMA 1FA2A 1KQYA 4A22A 3EPMA 3R13A 2DZAA 4GGBA 3GXFA 4AU0A 4AZ7A 2CU0A 1CCWB 5T8GA 3SGUA 3VAVA 2PRLA 1R30A 4TUFA 1KBBA 3TCSA 3GD6A 3S2JA 1JCLA 1R85A 1YPIA 2YCLA 1NHQA 3NM1A 1T8QA 1IEVA 4W87A 2JF6A 2GGJA 5F4WA 2J9YA 4MNMA 2UV8G 2XSXA 3VYLA 4PMXA 2LLEA 3GHSA 4FR1A 4E3TA 5LNRA 2YDSA 4JIIX 4P7RA 2Y6ZA 4JDRA 2DZVA 3QV9A 4PTXA 1KCLA 2J7CA 4Q4MA 4TO8A 3TOPA 1EXPA 4ZCWA 1XH2A 3N2XA 3KLJA 4S3EA 2D22A 3FX4A 2AAMA 4WDWA 3NVTA 1KM0A 4CN4A 1BQGA 3E2QA 2FGBA 2W5FA 4TMCA 2GOKA 2ONEA 3BLIA 1YXYA 3LTYA 1MNZA 3D3FA 4B5UA 4URIA 2JF7A 3G6LA 3TCEA 3CT2A 4J3VA 3U48A 1EYEA 4DBSA 4LY4A 3L8KA 3P6LA 4XB3A 1EF3A 2IQDA 4ZOBA 1EA0A 2G37A 4HNOA 2GDUA 1XDIA 1XYAA 3VCNA 5HQMA 4G1NA 3BJSA 2QCDB 4K2SA 4EAMA 3K13A 3WQ6A 2O92A 3P61A 2IUZA 3MUCA 1CEOA 1V02A 4H4UA 1V0MA 1M65A 2PU1A 1GSNA 3ARYA 1V51A 3EMQA 4GH1A 2YCKX 1BVNP 2EJAA 5BXRA 1LWIA 1S2WA 2PMQA 4DF1A 4BA0A 3ZWSA 1YHTA 1DL3A 1BLIA 4HBKA 3VNIA 2VTFA 2HNEA 1VRDA 4NNBA 4GUJA 1XUZA 3W7DA 1C91A 2UY4A 2FVLA 2Z00A 3B05A 3ENLA 3EEZA 4ERAA 2VI0A 4QISA 4O10A 1TR9A 3PJWA 2OWXA 2OXNA 3BW4A 3STCA 1ZBKA 2HROA 2X1SA 3UCQA 3FHAA 3MP3A 1ZU8A 2MNRA 1XISA 3IJ6A 3R7MA 2A3HA 3ABOA 3PZTA 4DO4A 5AC7A 3AUOA 3VIGA 1S2AA 3QPZA 3PG9A 5D37A 4HYRA 4MYAA 1XBVA 4EANA 4AWEA 1XKYA 3SCUA 2X7WA 1W8SA 3ARQA 1TREA 4J3TA 1XIMA 1WDDA 4LH8A 1L6FA 3W84A 4IPJA 2QAEA 3P5YA 5FKYA 4GR1A 1GHRA 3DN5A 1OADA 4CCZA 4L4PA 1W8GA 3KWSA 4JD4A 1V7YA 1JCJA 4HA1A 2QF8A 3WF0A 1K7EA 2GR0A 2ZXDA 5H8MA 1CI1A 4L6OA 2ZC1A 3HB9A 3A22A 1HIZA 3HPZA 4S3BA 3M41A 4RV3A 4G7FA 3W7MA 2WVTA 1QHZA 5JCIA 1KB3A 3S5ZA 1R7AA 2BY1A 1OQFA 3L67A 1CBGA 4ADTA 4I5UA 2PP3A 1H0IA 1QT1A 2ZX6A 1XW8A 4A6GA 4XAYA 3LV6A 3T05A 1XLHA 1TMQA 4M0XA 1E9YB 1V3LA 3N11A 5GRTA 4BI7A 3KEHA 4UTJA 4EQRA 1GVIA 2YXOA 2Z28A 2IKHA 2V5DA 1Y5VA 1L8NA 1XLGA 1YDNA 3W2UA 4HSHA 1GUVA 2BASA 4I7UA 1TPEA 2NV2A 3VKKA 4LOCA 8RUCA 1YBQA 2WMIB 1PIFA 1B0IA 4JL2A 2CLPA 5FD0A 4AF0B 1K70A 1R86A 2PWHA 3CJPA 3E2SA 1R6WA 5I6SA 3F4VA 3ES7A 1UC5A 1Y0EA 2C3ZA 3SCWA 1K1DA 4KFNA 2GQ8A 4H4XA 3PSVA 4TV5A 4ZEPA 4GJ1A 3VE7A 4IMDA 5LA2A 2CLEA 2GJPA 3IARA 1H5YA 3HFTA 1K6WA 2GK1B 2VVSA 1GKRA 2PD9A 3GG0A 1JAEA 2FGZA 5T9BG 1TB3A 3B97A 4KBXA 3C5QA 1FWJC 4I9AA 3WLIA 1SZRA 1EEPA 3ITGA 4UTMA 3A6OA 1SFSA 3KRZA 4ZENA 1F05A 1ISYA 1QNRA 3T55A 3N2TA 2HE5A 2FZ8A 3NOYA 3GRSA 3ARXA 3SCOA 3ZJ7A 2EBNA 3LCHA 3TSMA 2DVUA 2D23A 4HYWA 4ZQPA 5D32A 1AL7A 5F1UA 2B7NA 1OZMA 2BXVA 1GOXA 3DEQA 4FALA 3VE9A 1M53A 1UMLA 3Q58A 3LPOA 3MU7A 3MBFA 3WQGA 5IM51 2BVDA 2A4AA 3ZM8A 2WYSA 2QIIA 4AD3A 3S9IA 1RXOB 4H4PA 3W26A 3L4ZA 1QI5A 3OQEA 1FHUA 2XSAA 5D2VA 2EPLX 2OMAA 2CZ5A 2V6AA 4YXGA 2YJQA 1KXVA 1UYQA 4DYJA 2R1KA 5KZEA 1A53A 4PMNA 3L4TA 3WLRA 1LL6A 4HU4A 4D6IA 4R7OA 3ZMRA 3USZA 3LPPA 4AFYA 1E51A 3KOFA 4DJDC 5BXSA 1O5KA 1KFBA 3M0YA 3UR5A 5EB8A 4OVXA 2ATSA 2QT3A 4JTJA 1Q6GA 2X0HA 3AXXA 1SSGA 4ZQRA 3MC5A 5EU9A 1H11A 4EPKA 3VIOA 3HJEA 5HUPA 4IJBA 4AC1X 2V68A 2ZZ6A 2YDQA 3ZOAA 1XCFA 2RAGA 4JTUA 3O6YX 4LUTB 4NYUA 5FSEC 3C2EA 3I7SA 6A3HA 4J5NA 3DAQA 3P84A 3IJDA 4HZ8A 4FOKA 3ZXWA 1E3XA 3Q45A 2AQWA 1V6VA 3HU7A 3T4CA 3AXHA 3WQCA 1XDLA 2WNWA 3ME3A 4N9DA 3S2MA 2QCLA 4H4ZA 1SMAA 4A3YA 1JYXA 3NZRA 2P0OA 4UCFA 3KWXA 4ZO8A 2XJ7A 1UWQA 1VBUA 3LB0A 5HOSA 3B4UA 2WC4A 3A24A 2VCBA 3THAA 7CGTA 3UZWA 4HA0A 5KVIA 3NL6A 1PSCA 3O6AA 1XLBA 3I6RA 1QHPA 2V30A 5K2ZA 3AWOA 1WDPA 3N15A 3P5ZA 1YQZA 1N82A 1E6QM 4HCLA 4Z0JA 2OSWA 2C0HA 4HA4A 3L4XA 4TVCA 2DT3A 4ZQOA 1XF0A 2VGBA 5DMYA 2PPGA 4A2SA 1GVSA 2OU4A 3EWUA 5KEZA 1ZTVA 2UY3A 3A7RA 3BG5A 1TPC1 2I9UA 1T8XA 2PBGA 4ZOAA 3CV7A 1THFD 3CUHA 3PBGA 3FV9A 4MZ8A 4IFOA 3QR1A 2J74A 3A9BA 4UTTC 2JEPA 3K8KA 3VDBA 2W4XA 1AOGA 5C70A 2NX1A 3LI1A 4C6BA 3MP5A 1QWGA 2OYKA 4IH3A 2DIKA 4P7NA 3GTIA 3WK2A 1WDSA 3RUBL 5LKYA 2C19A 1QW8A 1EBHA 3V4BA 4DIAA 3VDAA 4OTKA 3GDBA 1EJUC 1W1TA 1YDOA 3IGXA 4HOXA 4QS6A 4WY0F 3UWEA 2I7GA 3LGDA 2CPUA 1LQ2A 3G8EA 1E55A 2WCSA 3WH6A 2FDMA 4AMCA 1BXBA 1X7IA 1ZBVA 3MSDA 4ADSA 2QDHA 1XLIA 2YCJA 5DMNA 3WUEA 1VCFA 3OC4A 1X1NA 4LEQA 4GNJA 5TR3A 4S3FA 3TMLA 1QNQA 3R25A 1S1PA 3B0PA 3MSYA 4NRRA 4CNPA 5PTDA 4M3PA 3DENA 1JR1A 3LG3A 3AM9A 3LN3A 3V3WA 1OCQA 1HP5A 2DJLA 1K77A 2HQMA 1XL9A 2XH2A 3M1ZA 1BVWA 4ZSUA 2WJFA 2P3EA 3TSDA 3RNMA 1XDMA 4M52A 4NASA 1F4HA 4XAZA 1OFAA 4C5ZA 4JX4A 1ZY8A 5JCMA 1VYRA 3RMJA 3TYEA 1TV5A 4Q8UA 1C7TA 4H4IA 3QYQA 1TTQA 1GVQA 1NELA 2FLIA 2YXXA 2BOGX 3NQVA 5H91A 3SBFA 1XD1A 3CQHA 4H6QA 4HNLA 2NQ9A 3WLJA 4DY1A 1Q8JA 1HFBA 1KM4A 2DVTA 1AH0A 2XZ7A 2EPMX 3N9KA 4D6DA 4YTQA 2X99A 2V63A 3CIWA 3M0ZA 5LIUX 3Q4DA 4GG9A 4PCFA 1PHQA 4LVFA 3PWIA 4BEUA 3GX9A 2XN1A 2ANUA 3DFSA 4M24A 3NO5A 2AQOA 3GZ3A 4N9BA 4E8DA 3PPCA 4CCEA 4NL1A 4QJ1A 4FLRA 2IKJA 2E5CA 1JNEA 4NXSA 5XINA 5C2GA 1QPQA 4AZ6A 2AAQA 3BLOA 3DDMA 2YVFA 3U7BA 1W1VA 4WDTA 4E38A 3W2LA 3NQFA 1Z41A 4FNSA 1FFQA 4CQAA 2YBTA 1UD5A 2J9XA 3UT0A 5AYZA 1TPWA 4M56A 4I9TA 4S3AA 3P3BA 2I57A 3U8GA 1YTDA 2GVEA 1O7AA 1CXIA 3CUXA 2BGQA 3AICA 2JK6A 2OEKA 3PZVA 3MCNA 1TRDA 3ZVHA 3VKCA 4MWAC 1KTCA 1GWJA 4XSLA 4KEZA 3RF9A 4NF7A 1X8CA 3RN6A 3KCOA 1E56A 2VGGA 1KWGA 5JQ9A 1WAUA 3E38A 2DH3A 3EWXA 2GFTA 1V4YA 3QR0A 2ASHA 5I2UA 1ONRA 3S5SA 3QBUA 1V0LA 2VFEA 5CAKA 1KCXA 4FX6M 1QW9A 3TTQA 3RPMA 3RILA 5H8UA 1KXTA 2EPNA 5F2GA 3UG3A 3MTWA 4NY2A 3VIJA 3BAYA 4OHQA 1H5VA 5LIKX 1NHSA 4POCA 5GNYA 3W7JA 2BVTA 1KTNA 4GD0A 1E70M 1BYCA 5FS8A 1BKHA 2RGLA 4I7VA 3DJGX 3O6DA 3GVWA 4NJHA 1TZ7A 2QKFA 3MZNA 1V08A 2ZUTA 3FCPA 3HQOA 3RAOA 5TBOA 4IIBA 1G7UA 3UNDA 5CC3A 4EM4A 1HQTA 1QNPA 4E8GA 1TJ1A 2Y62A 4M80A 1JF5A 4KWWA 4ORMA 5HAOA 2JQXA 2WHLA 1L2QA 4O18A 5HWJA 4YIWA 1I75A 1LQAA 1CXHA 2F7FA 2NV1A 1JNDA 4JNMA 1U5HA 4LALA 4O54A 1K7XA 1KRAC 2FPTA 3GNOA 3DGRA 3CB3A 2J77A 1TELA 3GDKA 3WF4A 3WO8A 3MANA 1QI0A 3MJYA 2Y63A 3DK9A 1K8CA 3O0FA 4XD3A 3SY5A 3WN6A 2YL5A 3MUY1 4PUJA 4E8CA 3TU9A 1I6NA 5I3DA 3CGBA 3NWRA 2PWEA 2NUXA 2BHZA 3TQVA 2FTYA 5A5WA 1AQFA 2A7NA 3SRHA 2V9DA 5DT7A 2JGYA 2ISDA 1E0TA 3QKEA 1ICPA 1P1XA 4GO8A 3UWZA 3L4WA 3LI0A 4UNKA 3L66A 3ABRA 1I1WA 3IK4A 5M2FX 3S0CA 4ZB2A 4LCRA 2OLAA 4NSBA 1UASA 3NYZA 1YE4A 1FCVA 3STPA 5E6ZA 1XG3A 3GUWA 5CEWA 1E71M 3O6CA 2TPSA 1Y65A 4TU1A 1XWYA 2X8RA 3R11A 2J47A 3GK0A 4AH7A 4INFA 3E0LA 3AZTA 2W3ZA 4DWSD 3GD4A 1Q1WA 3NR0A 5IBXC 4GVGA 1UB3A 4PUUA 1Q4WA 1OFDA 4Z2JA 3QV7A 1ZENA 1DJGA 1Z89A 4D8LA 1LLWA 2BBFA 1XLLA 2A79A 3OODA 2O56A 3WY1A 3DKLA 3W6LA 2BS9A 2OZ0A 3SB0A 3MJMA 5MF5A 5FACA 3MCOA 1CDGA 1IT7A 1J96A 3A9IA 4GINA 1UCWA 4YTSA 2VDIA 3NSMA 1XGEA 1REQA 3KDNA 2YSWA 2POTA 3LV5A 2Z26A 1TYTA 4GPNA 2QVNA 3LGEA 5A6MA 2Z2UA 3P81A 4H9MA 5CC5A 3QFBA 3UGRA 5J04A 1MZRA 3MKCA 3DERA 4XBJA 1TPH1 4HTYA 4XZWA 3RM8A 4CU7A 3PZIA 1GEHA 1R9XA 3H2FA 1AFSA 1XYLA 3I6TA 3RU6A 4MNJA 4JFSA 5I79A 1HJVA 2H3BA 2DT1A 5FF7A 3NQ7A 3U6WA 4W9TA 1H0GA 4LF1A 2A3BA 3W7IA 2A85A 1UQZA 4WKAA 6XIMA 2WLYA 2GGGA 2E6DA 3VC6A 3ARTA 5HINA 3CK5A 3A64A 3VOGA 1EYWA 1S38A 3TTOA 1UH4A 3TW7A 5CQ1A 5JIWA 1Q7MA 3CM4A 4C6DA 4HU3A 2P5NA 4H4SA 3CWNA 4DVOA 2PDLA 1VEMA 4AHPA 5IFPA 1EKOA 4AQLA 5G4WA 1WYIA 3AHVA 3DIPA 2XTKA 3RX4A 2J66A 1TO3A 4PR4A 3E02A 4YCOA 1Q6LA 3MMTA 3MUAA 3FEMA 2IPGA 4KT2A 1UWSA 3QTPA 5A8QA 4K7VA 4OV9A 2Z2AA 3C6CA 1VR6A 3ANUA 3VIPA 2O0TA 4JIQA 4F2BA 1KM3A 3W6YA 3LRKA 1NDZA 4XAPA 2CIPA 2GJNA 2WM1A 5CC6A 1WA3A 4QG9A 7ODCA 2PEVA 2XGZA 2GGIA 2WPGA 4WJ8A 2FJUB 3VVGA 1JFHA 3KRUA 4C65A 3F2DA 2OX1A 3DG6A 4Z1YA 4PFHA 3ZR5A 1JGIA 3G8RA 1G4TA 2Z25A 4PTMA 1GESA 1FTXA 3LA4A 4LRTA 2WSPA 4ADWA 3I65A 3WH7A 4F0HA 2BV9A 2R94A 4B92A 1K3UA 2DUXA 4YLWA 4UQCA 1E43A 1X38A 1V6WA 1QPNA 1ZFJA 3OBKA 4ZO6A 1W3TA 4PUEA 3P80A 3BGAA 3KBMA 2GVYA 1RR2A 5HWMA 4CQ9A 1B9BA 1JF6A 3EPNA 2ICSA 4FDCB 2HNHA 2FH8A 1XC4A 1OBAA 4JDBA 3AMKA 1MYRA 3ITCA 9XIAA 3W1QA 1KRMA 4LF2A 3EKGA 3KCJA 5G5HB 3NPUA 1M68A 4IQDA 2E7FA 3OGRA 3STEA 2GSHA 1E0XA 3S9ZA 4AWSA 3C0JA 1TX0A 3A4XA 4AAJA 3K4DA 3DGHA 4OBSA 1ZJBA 1SZNA 3IJ9A 1RALA 2G3JA 2W62A 2ZRVA 1L0PA 3VFCA 4C1NA 3PNUA 3W81A 1HJSA 4WKFA 4O50A 2NXIA 3AJ7A 1J6PA 4YU1A 1B57A 4V1XA 2FVMA 3W82A 1FWTA 4DRSA 1KLZA 2BCPA 3CZ8A 3OTRA 4DNHA 1E1CA 3LD5A 4DJED 2JIWA 3P0WA 4HNVA 4I90A 4F66A 3BMWA 4PB3A 1EJSC 2QDDA 3AN1A 3LZ3A 4DN1A 4ZBCA 4JTIA 3NQMA 4E2BA 1ADOA 4YJ5A 2X09A 3MWAA 4JN7A 1RCQA 5JRBA 5HXMA 2O9OA 2V2CA 4H9XA 4EM3A 4H9TA 1W3HA 3QOKA 2UY5A 1WXYA 1UWTA 3SEPA 1GV4A 1G4PA 1FQ0A 3LPGA 4TVWA 1WO2A 3EA3A 1DXIA 1NWSA 4N7QA 3WLQA 2I9EA 3KLLA 5U4NA 3ARSA 2OTDA 1BPLB 4KEUA 2PTXA 2X1TA 2YB4A 3AXIA 4IP4A 2GQWA 2VWSA 1HG3A 2ZA3A 3MB9A 1BSLA 5A1AA 4HNNA 3P62A 3T4WA 1SJAA 2RH9A 2BY3A 3DI0A 1BEUA 4G7EA 1FKXA 3EOSA 4NJJA 5AVNA 3E0FA 1KRBC 4MM1A 3LQLA 1AQMA 4BQ3A 2TYSA 4W93A 3L5AA 4OIFA 4UNIA 3M0LA 5F4XA 1UR4A 3PZOA 4WDXA 1Q6FA 4ACZB 1RQEA 1R3QA 2PGFA 2G3IA 2PB1A 1LRQA 3GDTA 1EXBA 3BSMA 4XV0A 2WNNA 3NVDA 1FWDC 4GI8A 5FS7A 4J9JA 3LXDA 3N2OA 4WJEA 3RM9A 1J5SA 5I78A 4GE8A 3VK5A 4A8IA 3W4RA 2PDMA 2QJHA 5HR7A 3HJZA 3G22A 1AD1A 3K8LA 4EACA 1F2JA 1ZNNA 1E4MM 3HQNA 2J62A 4NUWA 3WF3A 1XDJA 1R38A 1KTBA 1ITUA 1CXFA 4GFIA 2OZ8A 2OZTA 1IGWA 4WGXA 4U10A 2D69A 4N4PA 4L4OA 2WZEA 4O28A 4WY0B 1GETA 1YNQA 3VABA 3CQJA 4W7WA 2DIJA 3GNDA 4EPBC 5A2BA 4BWLA 3WD0A 1XBZA 1NOFA 4FNQA 1XLCA 2OEJA 4GNVA 4IM4A 3GSMA 3URAA 1W1IE 1A3HA 3BTNA 1JPKA 3UJRA 2E77A 4Z08A 3DH7A 4XAFA 1DORA 5FF2A 4C6JA 4ZQMA 3GD3A 3CUZA 1FO4A 3T0BA 4Q4OA 4IXXA 3WELA 3WDQA 1NHPA 4IMCA 4TMBA 1XH0A 2O9TA 4XO6A 1GRFA 3GZAA 1KXHA 4XZMX 4GQBA 3CLWA 1OJTA 4LBUA 2XWEA 4E0CA 2A3EA 4CU6A 3CGTA 1R7OA 1WUFA 3VD7A 2GZXA 5M03A 3CQKA 3LCWA 2O4QA 4GY0A 4RW3A 1JQXA 3MO4A 2OR2A 3L0GA 3A12A 1NDVA 4J3UA 4AEEA 3EA2A 3K5XA 1B30A 4GACA 1NFPA 2YL9A 4MIMA 4IPNB 3QLLA 4P8UA 5G4EA 1CGTA 4XWUA 3TP4A 2HCVA 2ZDSA 3QMSA 2REQB 2AKMA 4LEFA 3UXKA 5LHFA 1DWAM 3RU8X 1NFBA 2OT0A 1O60A 4BF5A 1RY8A 2BVWA 1JUKA 1P6WA 3Q67A 1V03A 3EOEA 5BOEA 3W75A 3LHZA 2G41A 2OQYA 2VGIA 1ISWA 4GBUA 3RYSA 5J8LA 1WKFA 5CZJA 5HATA 3BAWA 1J8VA 4LNCA 1KGUA 4UMBA 1EO5A 4DO6A 3UA3A 4JS3A 3U57A 3TH6A 3BJFA 4EQXA 4YTUA 4XTDA 3KL3A 4L9XA 3HIJA 3BLPX 5CAHA 3T08A 1YYAA 1E9ZB 3IRSA 2ZRYA 3CPGA 3RXZA 3AU2A 4RW5A 4YTTA 3PUEA 3S6OA 3FAXA 3IJ8A 4E6MA 2J7GA 2NPXA 4J3XA 2IS7A 2BGSA 4RZ6A 5E93A 1PVNA 2GJLA 3U2OA 1EL3A 4KWOA 3TN4A 1A5CA 2YYTA 3P60A 2ZIDA 2Z24A 4AVNA 3LXCA 5FSDC 1TE6A 4MFDA 3WD1A 4L1XA 5FJTA 1MEWA 4FF7A 4IGMA 3UG4A 1BYAA 2ZXBA 3MYPA 4DZIA 4U3CA 4IX2A 2FZDA 5I3JA 2WAGA 2X1UA 1XCXA 3NVZB 3GVGA 1EO7A 2PDWA 5LNSA 4UFJA 4MOZA 5T91A 5IDZA 5C9WA 4XUYA 2W3RA 1E1CB 1S5NA 2J24A 4JTQA 3OGVA 2OYMA 3GY1A 4EOUA 2BFGA 1LOQA 3BAKA 4AXKA 2PDCA 1FFUC 1YXCA 1HKKA 5DXYA 4MNLA 3S1UA 4QLKA 1R2TA 1RQHA 3T7VA 3ZR4A 2P3ZA 2PP0A 1E1EA 2EG6A 2C3DA 1TIWA 2PUZA 1JXKA 2ZYFA 1ODZA 2OZ3A 3H70A 1JDFA 3ITVA 1FFVC 3GG7A 2ZZ4A 5FJJA 3UBPC 4A3HA 1L6WA 1U5JA 4B3ZA 1KR1A 2E6AA 3A23A 5CLTA 3W70A 1W5OA 3LCFA 5DQPA 4F8XA 2G3NA 1VRXA 1OGSA 1N8WA 2X0SA 3S3GA 3GR7A 2DW7A 4QJ5B 1VKFA 2J78A 3E9AA 6REQA 1L2UA 4W7UA 2J9ZA 2Z1BA 3NFUA 5AECA 4KIEA 2VXNA 2XU2A 4ICMA 1Q13A 1XYCA 3TVAA 3W24A 2TODA 3P82A 3B9AA 4P5UA 7ENLA 3TROA 4ORIA 4MNKA 2DEPA 3RG6A 2KZHA 3D0CA 2PDGA 3CHVA 1XLEA 1LCOA 4XVEA 1TPDA 2E67A 4KKXA 3WNKA 3BMXA 2WJDA 3NQDA 3DFNA 3ANYA 3E0WA 4MLJA 4DJDD 1W31A 3W6MA 4GVFA 4XUGA 4CVUA 2VDGA 3BE7A 4HPNA 1X6NA 3S6TA 4DI9A 4EMWA 4KGJA 2CLOA 3FW6A 3GE7A 4LV4A 4IMGA 3ZZ1A 3DGZA 3RCMA 1FWAC 3TYZA 4ALDA 1XINA 5D2XA 4KWSA 1WDQA 3HN3A 3KRBA 2ZZ5A 4BK9A 4CQ8A 1Z9AA 4I9MA 1XXXA 3HPXA 4HGXA 1PXGA 4O4VA 2ZUUA 5D4YA 3LMYA 2HS8A 4P8WA 3AHTA 3AIEA 2I56A 4G8TA 4M7SA 4EMIA 1L6YA 2NXHA 3GAKA 4EF9A 4D6CA 4QNEA 4AD5A 3M47A 2A3CA 1I2PA 2WXDM 3N25A 3VGHA 3VKDA 2W67A 2FYMA 4QE4A 4DM2A 2F2HA 3G1DA 1OIFA 3SW6A 4I9JA 3WQEA 2O9PA 3IJIA 5I06A 5LNVA 3HMJG 2ZRUA 3ZLFA 4MSSA 3ITYA 4S2CA 1NEYA 2ZX8A 4QSHA 3CHCA 4C6QA 4XKYA 3M6DA 4H4TA 4PL1A 1TPVA 1X96A 5DRCA 1F76A 1PX3A 2BOEX 2MANA 1JUBA 1LUCA 3IK2A 3SQMA 3IGUA 3NPVA 3W3OA 5BU6A 3G6MA 4FX9A 2CHNA 5H1WA 4WIWA 2VCCA 1NJJA 4J4KA 4YYFA 2XUCA 4J3ZA 1QVBA 4EQWA 3LCXA 4QR6A 4UQDA 3WEOA 4L7ZA 4P61A 1K8ZA 2A8XA 3SUWA 2X8HA 3SJNA 3T81A 3Q37A 1XLDA 4LCSA 4ML4A 2VVNA 3CT7A 1J2BA 1JG9A 3SN0A 2CHOA 2RFGA 5KSWA 2QXWA 3AISA 4JICA 1DHPA 2XZ9A 1MQQA 3PS7A 1R5YA 1I8JA 1MW3A 1VEPA 1M5WA 1PKMA 1OK6A 3KVLA 2VP8A 1H1NA 5CKSA 4YVPA 3VKAA 1MXSA 3PWAA 4H2CA 3VKJA 3FEQA 2OQLA 4UMCA 3CAQA 3MDUA 3CMGA 3PTDA 1OC5A 3C52A 3OLIA 3QHOA 2E0PA 2QAFA 5GNZA 3IIVA 4UXDA 4L56A 1IGSA 4GI6A 5CJNA 1E6RA 3FSUA 3NQBA 3ORWA 5HANA 5JH1A 4ZO9A 3EWDA 4ILSA 1XI3A 4UFKA 1SPQA 3II1A 2VEMA 3VOIA 4A8NA 3PC0A 4C6IA 4US5A 2Z2BA 2PA6A 2R24A 4PCNA 4AUBA 5DF0A 3PG8A 5E9XA 4IQLA 3A7AA 1QBAA 2VDHA 2YLLA 1JJKA 5MHBA 1UD3A 1JOAA 4QX4A 1O95A 5A2AA 3TXZA 2WLZA 4IFKB 4HOZA 2QPXA 3GG8A 5AC6A 3QGAC 3S2CA 3COTA 3LLXA 3N4FA 2VC6A 3F5LA 1SJDA 3DG7A 3HGSA 5HQLA 4MTVA 3UG8A 3LM7A 2BSLA 4M7TA 3I68A 1GERA 2HV5A 3AALA 1J5TA 2HBVA 3VGDA 3M0KA 3FLUA 1V8EA 3NSNA 5CGTA 4CD5A 5C9RA 1WB0A 4IJCA 2QAPA 3CHDA 1STZA 4PEKA 4W88A 3KFTA 2ZKMX 5FI8A 1HX0A 2X40A 3M07A 1TA3B 1J0YA 1B90A 3THCA 1VPXA 3C8NA 3WLMA 2EKCA 2Z4GA 1XUUA 3BOXA 2C8NA 4JZ5A 4RE0A 3WMCA 3O15A 1PWMA 4Y9PA 1BAGA 3SR7A 2GH5A 1P0EA 1ODUA 1V3HA 4PMQA 1VYSX 2XIBA 1UBSA 1KFEA 2GDQA 1NF0A 4MWAD 3GXTA 2Z27A 1TMHA 2YCIX 1OD8A 2ZBTA 1MO0A 3W29A 3CO4A 1JRCA 4JQ9A 3F4CA 2P88A 4HMEA 1K02A 1EJWC 4D6JA 4Q8VA 2QCFA 2XG9A 4DF2A 1HKMA 5I24A 5DMLA 5D9PA 1TWWA 1PEZA 3HV8A 1V5XA 2Q8ZA 3TNOA 2J27A 2QJNA 3A5FA 1EZWA 3MVIA 3RHGA 2HS6A 3DFPA 3RJYA 4AWUA 4PODA 2WV8A 4GXMA 2R91A 3BCFA 1J10A 1Q6RA 1UKTA 3T44A 5D8ZA 2INZA 1AZ2A 3N73A 3UFYA 2OX4A 1Q6OA 3QEZA 1SQ7A 1XKJA 1RAKA 2GQ9A 3L4YA 2QYGA