2GDSA

Interrupting the hydrogen bonding network at the active site of human manganese superoxide dismutase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKNHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Interrupting the Hydrogen Bond Network at the Active Site of Human Manganese Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 68
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2gdsA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2gdsA02
1XREA 1AP5A 1EM1A 1EN5A 1AR5A 3CEIA 1VEWA 1AVMA 1MSDA 4JZ2A 1I08A 2CDYA 2ADPA 1EN4A 1P7GA 1XILA 1MA1A 3AK2A 4X9QA 4F6EA 1ZSPA 1ZTEA 4JZGA 1QNMA 1AP6A 4C7UA 2GDSA 3C3TA 1JA8A 1JR9A 1B06A 1BS3A 1GN4A 2QKCA 2AW9A 1ZLZA 1GN6A 1LUVA 2P4KA 1D5NA 5A9GA 1BT8A 1AR4A 1I0HA 3MDSA 4BR6A 3QVNA 3RN4A 1IDSA 4JYYA 1SZXA 1Y67A 1GN3A 1N0NA 2CE4A 1N0JA 2ADQB 3AK1A 3TJTA 3EVKA 3K9SA 5AG2A 1BSMA 3DC5A 1MNGA 3BFRA 1GN2A 1VARA 2QKAA 1WB7A 3OT7A 3IC9A 3LSUA 1EN6A 3AK3A 1WB8A 3C3SA 4YIPA 1IX9A 3KKYA 1PL4A 1XDCA 1IXBA 1MMMA 4FFKA 1PM9A 1XUQA 2RCVA 4GUNA 3DC6A 4E4EA 1KKCA 1LUWA 4YIOA 1ZUQA
chains in the Genus database with same CATH superfamily
4NKGB 1PD3A 4KP4A 2FMLA 1EM1A 3OFNG 1N33B 4H37A 1EN5A 2KQXA 2FYUH 4DV0B 2GTSA 3KG2A 5CA1B 1SQFA 2K1EA 3X2QC 4JI6O 2Q0AA 3F5TA 2OTJV 1P7GA 4N23A 5CN0A 4UB8Z 4O4HA 4I50B 2ZCEA 4F6EA 4GKKB 2CGOA 2DQ0A 4FM0A 3D36C 2QTSA 3CS5A 1H38A 3CRQA 5EBMC 4CH6A 1XNQO 4X64B 2WAMA 3WB2A 1TUEB 4FM2A 3L73H 2EIMC 4G28B 1Q6HA 3SGIA 3SJQC 2UXCO 3CCJV 5LGUA 4UUJC 1YVWA 2F95B 4DR3B 1HW7A 4UFZA 2HFEC 2YEVB 2CH7A 5IJ9B 1CPYA 2HVJC 2QWOB 1A32A 1J5EB 2X7RB 3QO7A 2ITDC 4FFBB 5IY5B 2EIKB 3VQYA 4DV6B 4I55A 1YIJV 1G4YB 3OD4A 2QSAA 2W6JG 3KZIZ 4WBNA 3HKDB 2RMKB 4DV7O 4X65B 1FXVA 2VWJA 2DWDC 2IH1C 3ABLB 2QKAA 3CC2V 2IM9A 4DUZB 4ICGA 1SERA 4X20A 3X2QB 2WPDG 3C3SA 2YI9A 2KG7B 4IYIA 1IX9A 4F4LA 3G6BA 1SF9A 2FB5A 2AGAA 3JALB 4EFEA 3KDRA 1IBLO 1H2SB 5GONB 2HKOA 4GX1A 4AHCA 5LP6B 4YIOA 4I4TA 3RFRA 1K5SA 2EIMB 4LFCB 5LYJA 4UVCA 4PI2A 3P30A 5EK0A 4J7KA 1L0LH 2E74B 1AVMA 1OHHG 3JAWB 5E1AC 5CA0B 3SPCA 2XTAA 1XEQA 3OUSA 3WB1A 2PGGA 1VQ5V 1HNXO 4AQYO 2DMXA 1FPOA 4X9QA 4GX5A 4YXWG 4OPHA 2YS8A 5LOVB 4PV1B 1NBMG 5D5PA 1MABG 2CGNA 4P2ZA 4XDLA 1JJOA 4P30A 3B40A 3J80N 1JR9A 4H0LB 2EILB 1R3IC 4I9WA 2VQFO 1PNKA 2P6JA 3BAAA 1KUQA 2OCCB 4NTWA 1QR9A 3OTOO 3AG4C 1OJHA 4DV5O 1WA8B 4B3TO 1Q90D 1ROPA 4R6ZA 4PD4F 2VWKA 4H13B 2WWWA 2PZSA 2R70A 4LC1A 4GKJB 1AILA 5AG2A 3FD9A 4CH3A 4LF7B 2QR4A 5IYZB 5K1PA 4J41A 1S5JA 4AILC 2ZIMA 3EFFK 2DN9A 4DR5O 3LSUA 4FFBA 3E22B 3BRCA 2IJJA 2XUMA 2ZD9A 2JEUA 4B3MB 1Q5OA 2DJVA 3SDLA 3ML0A 1X59A 1S5HC 3W7UA 4MW8A 2QA4V 4IL6Z 5J9PC 1ZUQA 2QWRB 1RPOA 4DV3O 3RYFB 4JI7B 5B1OA 4YJ2A 3G6EV 5KMGA 1FKAO 2Y4UA 1YJWV 3F7YC 4GCZA 3AK2A 3TGUH 3K0GA 3ZN1A 4DR6O 3CB2A 3ZMVA 1CXZB 2YIBA 3K3WA 4TUYB 1GKFA 2EIJB 1R73A 1Q86W 3ZHSA 3JAWA 4IT5A 1JPXA 2QKCA 2LO1A 4EB6A 1LNQA 2UU9O 1IBKB 1ZWIC 1GK9A 3H01A 1N34B 3E8HA 5CBHA 2QM7A 4Z1VA 4JF3A 2XT9A 2B1IA 2GV9A 4G2KA 1E79G 2V4DA 2AHZA 4JTCB 2WA3A 4ZBMA 2ADQB 2E5LO 3OE7G 2UUCO 1R3JC 3SJAC 1QU7A 3CRAA 3JD3A 4MVOA 1Q81W 1I94O 2CTWA 3FAVB 2A9HA 1S76D 3E8BA 2ZR3A 1WB8A 1IVSA 3CRRA 2WLLB 4LF4B 3L75H 1R3KC 1W2BU 3ZRXA 3T1YB 5B1AC 5KUKA 5JQGA 3RYIB 2P90A 5DN6G 1VMGA 3Q4HA 4X1IA 3LUTB 1MZFA 3EXAA 3G67A 1M9NA 2IJKA 1X4TA 2Y4TA 4JI0O 3W7SA 4WFAV 2EJRA 2LQTA 1L8DA 5BXZA 4DUYO 4B3RO 4QE7A 1I5XA 4J7ZA 4U3JB 5LHGA 2QWQB 2KKWA 3BCCH 1T5EA 1GO3F 4C7UA 4F6RA 1K4DC 3LSSA 4B7KA 2ZE8A 1GN4A 3AG2C 4TQDA 1FXKC 4NR1A 1NH2B 4FLYA 4NXMB 4JYCA 3OEEG 2GHYA 4ZKIA 4Q6GA 3K5NA 1N36O 4TUYA 1I0HA 1NVPD 4FMTA 1MG1A 2A79B 1VQPV 3AG1C 4FLWA 5LMNB 2ZR2A 3OMNB 4HAMA 1PPJH 1FJGB 5LA6B 2ZE5A 2ZE7A 4DV4B 1OCCC 2DYSC 1Y6XA 1BSMA 2Q8VA 4LF8O 1EBOA 3JASB 4X1KA 3OR6C 5KHKA 4LBEC 1V55B 3G71V 5EBLC 2CTRA 1AJPA 3LNMB 2RDCA 2EBOA 4DR2B 3A2FA 4K8ZA 1GM9A 3ZMZA 1QLNA 4O4LB 2RCVA 4JI5B 5IT9N 2IJIA 4NXNB 1WLEA 2A0LA 3E83A 1Z2GA 1U96A 4UV8A 1JCHA 2M6YA 4DR7B 4O2AB 1VQMV 1KKDA 4JI4B 3AG2B 3A0HZ 4JAUA 1FXKB 2WLLA 4CBCA 1W0JG 4TV8B 2X6BA 5KHJA 4JI1O 3D8CA 1TUBA 1XHZA 3HB3B 4PJ0Z 1KB9F 1N33O 2N04A 3CYOA 1F4NA 2Q9LA 3A0BZ 5BR8B 5CBGA 2L35A 4DV0O 3QO5A 3AG1B 3T2MA 4FK5C 5B1NA 3J81N 1DTOA 1K4CC 2OCHA 2JRIA 4BAYA 3OM3B 4GKKO 1KC8W 2A3QA 1N32B 2VQEB 1K92A 4O4HB 1XNRB 2DYSB 5LXTA 4JAVA 3E8FA 4UVAA 4X64O 2AW9A 3M99B 4U3JA 4YY3B 2CAZC 1D5NA 1F51A 3CSXA 2JGDA 4MVMA 4DR3O 4BR6A 2UXDB 3JD2A 4D7SA 2ZINA 2LGQA 5IE9A 2F4VB 2EZOA 1Y67A 3OGCC 2CH7B 1H2NA 1N0NA 1RM1C 1J5EO 2DYRC 1EFRG 1SQXH 1WPXA 4GT1A 1NH2D 3IGAC 3K0DA 3HKBA 4DV6O 1TGOA 3TK1A 4EFBA 4B7EA 4I55B 3LSQA 4X65O 1AI6A 4DV1B 4WBNB 3P3NA 2N74A 4OX9B 1WB7A 1THZA 1COWG 1EN6A 1Z5WA 2YI8A 4DUZO 1K7DA 3JAMN 1D5AA 3OR7C 4DO2A 1MMMA 2EZPA 3FX7A 4X20B 3ZRWA 1H2LA 3T1HB 3RGBA 5KAIZ 4JAAA 2IJHA 2CTPA 2HVKC 2JK5C 2XAGA 4I4TB 4LFCO 2X6AA 2JS5A 2YXHA 4BW5A 4FZ1A 1N4CA 3FB6C 5LYJB 1SQQH 4K0KB 2R9IA 1FAFA 4LP8A 5IYCO 4TV9A 3OMIB 4PDLA 3ZHRA 5LGTA 1RM1B 2BSKA 1P84F 2DYRB 1M93A 2UXBB 4O2BA 4CC6A 5GW7A 4RUEA 3S3WA 5FLXN 1VQ8V 4RWUA 2ETNA 1GM8A 1SQPH 4ZIBA 3UKMA 1VIBA 4JPRA 4CH5A 4NB5A 4ZI7B 3C90A 2QDOA 3ASNB 2WLNA 3FB7C 4JYBA 2KSDA 3CE2A 2WLIA 2W0FC 2P4VA 2QWNB 4GKJO 2O57A 3H1JH 5KHGA 1H2KA 4PDVA 2XAJA 1IBMB 1S5LZ 3OT7A 4LF7O 3ZMSA 5FNVA 3K58A 5LBQA 3QNEA 2BOBC 2BCCH 2LGWA 5EBWC 1CP9A 1PL4A 3H9VA 1IXBA 1BGYH 1KP3A 4WFEA 1JOYA 2AZ0A 3ETGA 1DF5A 1Y76A 4B3MO 1G8MA 1YTFD 1GM7A 3LDCA 3BY6A 1K73W 1JFFA 5IWAB 4J9ZB 1ZL8A 1AB3A 4BIUA 1VQLV 3SYQA 5KX5A 1KECA 5A2QN 1BQZA 2GSMB 4TQFA 1YJ9V 2UXXA 4RO2A 2JJ1G 3W7XA 4JI7O 4WFGA 3SYOA 3FB8C 3RYHA 3JSLA 5B3SC 4YHHB 4QPKA 2JGUA 3AG7A 3VQWA 4YJ2B 3TETA 5B5EZ 3ABTA 5KMGB 1NT2B 2GTAA 1WAZA 4XDJA 3BEHA 2HP8A 4B3SB 2Q73A 3ZBHA 1AP6A 2FKXA 1VF5B 1M1KW 3MHHC 3CC7V 3TXSA 2KB1A 1HNWB 4OPAA 3K5OA 4MTFA 4PHZA 1RPRA 5CB4A 3BPZA 4EB6B 1IBKO 1N34O 1R3LC 5H6QA 3ABMC 2QGNA 1UFIA 1MSWD 1HR0B 4TWKA 1WP7A 4HNAA 5IJ0A 1TVKA 3GWKC 2CE4A 2A06H 4DW1A 1GAXA 3DTUB 1NQTA 3DC5A 4ZI7A 1I7FA 4PDMA 3P32A 1GH6A 2UUAB 1JJ2U 2RN9A 5KUMA 3E89A 2YICA 5LGNA 1JNBA 3AG3C 5B3SB 1PL0A 3HKEA 3DSQA 3CD6V 3CPWU 2WLJA 3H1LH 4LF4O 3L70H 3CWBH 3APOA 4MTOA 3VQXA 3JCZA 1W0KG 3ZHQA 1YITV 1QLEC 2WSSG 1AI5A 2EINC 1US6A 1LUWA 1V9PA 4MTXA 4JI2B 3T1YO 3JATA 1KMIZ 5LHHA 5KHIA 1VQNV 3ZRVA 2PI5A 3BA9A 5JQGB 1AR5A 1YHQV 1R6NA 1SETA 1SKVA 3WG7C 3Q4HB 4X1IB 4MVZA 3ABMB 2GBOA 2WLHA 2CDYA 4BIZA 4JASA 5CMUA 1QVGU 2Z3YA 1ZSPA 3CCMV 3CMEV 1WN7A 4A5UB 3ZCCA 2RNBA 1GRJA 3IFXA 4CS4A 3RWRD 3CCUV 1M57C 2GDSA 1KYOF 1XHXA 2XHBA 4NTXA 3OEHG 4P9PA 1B06A 3SYCA 5LHIA 1BZKA 4U3FH 3G80A 3D3QA 4F6RB 4X66B 4NXMO 3SJBC 3AG4B 1FS0G 4IHJA 1AJQA 1VF7A 3BA8A 4CS2A 1FOUA 3D3IA 3JYCA 3JSNA 2YXYA 2Q7GA 1XOUA 5LMNO 1N0JA 1QLEB 1Q82W 2ZM6B 2EINB 3TJTA 1FJGO 2YIBD 5F2VO 3K04A 5KAFZ 4DV4O 1AI7A 2F66C 4FLTA 2HG5C 3E35A 4R8CA 3K08A 1XMOB 2N05A 4X1KB 1K34A 3WG7B 2XAFA 2YXLA 1SA0B 4XDKA 3RW0A 3AK3A 4OGQB 1IXMA 2QM8A 3OTFA 1XUQA 4DR2O 3ZIAG 1XI1A 1BE3H 4JI5O 1Y74A 4NXNO 2Q67A 1O9GA 1H2MA 3RVYA 3E8GA 4DR7O 4JI4O 1IJGA 3SPIA 2B1GA 4FLXA 3F5WC 2ILMA 4E2LA 2BE3A 1TUBB 1B3QA 3IC7A 2LW7A 2ADPA 3W7WA 3B2EE 5BR8O 5L3DA 4MT8A 3ZN0A 1AR1B 3JD0A 4UCTA 1MA1A 1RFYA 2P22C 3E86A 2Z0AA 2DQ3A 2OYQA 1N32O 3APQA 2VQEO 4LF9B 1XNRO 4DV2B 5EIBC 5LMUB 4CC5A 3T4DA 1KQSU 3TXQA 1NZ6A 2MW2B 4J42A 5LXTB 3A0RA 4PA7A 3GB7C 1LUVA 2ZNJA 3HKCB 1WJZA 2ODMA 2FL4A 4YY3O 5FL7G 1Q3EA 2AHYA 2UXDO 2JGDB 3IJ4A 3ZMTA 2F23A 4X62B 2XNDG 1V54C 4DRXA 3AK1A 1R6TA 4LF5B 3LDDA 1IURA 2HJDA 1GTOA 1RSOA 1OCZC 3NR7A 2QJ1A 3ABKC 2UUBB 1D2DA 1Y66A 4DYLA 2BOCC 3HKBB 4UV9A 2ITCC 4DV1O 3H1IH 4OX9O 4GYCB 3CMAV 2ZIOA 3CCLV 5BY1A 1JVMA 2ZXWC 2IW5A 1SS3A 5B1AB 4CZZA 3RT3C 2Y69C 2QEXV 2BTQA 1F4MA 2AXTZ 3JARA 2JS3A 3UT5A 4E4EA 3T1HO 3ZRWB 4UCSA 3ZHTA 1SA0A 2CTQA 4LNUA 1KU9A 2IBZH 4D7TA 1XREA 3E2EA 1GMGA 1AI4A 4LF6B 1VF6A 5DM6V 1PKXA 3CEIA 2HHHB 3RVZA 2R9RB 1ZAUA 3KCYA 4PA6A 1CEZA 1VEWA 3ZJZA 4K0KO 4JZ2A 3CC4V 5EZYA 4HBNA 2PUSA 5J2TB 4TV9B 3CCRV 2MK3A 5D5QA 1QCEA 1H8HG 4DR1B 4FIPC 5E79Z 4JV5B 4Z1MG 1YJNV 5J2UA 4LFBB 3SYPA 5JH7A 1KBHA 2BSKB 5JJJB 2Q68A 1L1FA 1DLBA 1YEWA 2UXBO 2DE0X 2GUZA 2ZDIA 4KHPB 1ZLZA 1XL6A 4O2BB 1QQCA 1WNSA 2OIGA 2R72A 4J11A 1IDSA 2EULA 2ZXWB 3ZRSA 4JI3B 1OCCB 2D2CB 3UO3A 3B4SA 3CHXA 3HKCA 2WLIB 3L74H 4MVRA 2CUGA 1Q6IA 1QBZA 5ITZA 4D6TH 4ZHQB 4BWAA 4J9YB 3I5DA 3IC9A 1IBMO 5HFLA 2NN4A 4I0XA 4LWSA 4X88A 4LFAB 5FNVB 3M8AA 1R6KA 4PA3A 4O4IA 4TOIA 1FXHA 1P7BA 4WCEV 5JVDA 3VBBA 2RJZA 1Y76B 1SRYA 5IWAO 4RQEA 1JFFB 2XASA 4MVSA 1B04A 1VQKV 4EKWA 4PI0A 1ZL8B 3UO2A 2AZ2A 4I7ZB 1LR1A 3ETQA 2NLJC 1XBLA 5KX5B 1BHAA 1VQ9V 3RYCA 3SPJA 2P67A 4WF9V 4XBFA 2H8PC 4H44B 3FYEB 5H9CA 4YHHO 1OCRC 5B66Z 3RYHB 2DWEC 1JMKC 4JZGA 2YIAA 4B3SO 3C3TA 1JA8A 2LW1A 2VS0A 4FVMA 3B8NA 5JWPA 3WU2Z 2JJ2G 1HNWO 1DK1A 5J2TA 4J10A 2HR3A 3KCXA 3O9OA 5H6RA 5CB4B 3DXRA 1P4RA 2YDEA 2P7TC 1EZJA 2EJ7A 1HR0O 1GN3A 4IIJA 1J95A 1H5WA 4UCOA 3FKSG 3H1KH 4HNAB 5IJ0B 2Q4PA 5B1BC 1TVKB 1O9HA 5K1XA 1FFTB 3B77A 3CRCA 1JQ0A 3JCUZ 1NS1A 4QPJA 3UCSC 4N21A 5IY5C 2LP7A 2EIKC 2JVDA 1BHBA 3N27A 1VARA 3MD0A 1M56C 4OXSA 4KFMA 2UUAO 3EHBB 3DGEA 3ABLC 4JGSA 4WFFA 1BCCH 4TT3G 4JYAB 1OCRB 3VOUA 1PM9A 4HZ3A 1JX9A 1XMQB 3FFQA 3HKEB 4Z2WA 3BVOA 3CJHA 2WLMA 4ZHQA 4X1YA 4GLXA 2HEPA 2YUAA 4GX0A 4JI2O 4R7CA 5LP6C 3L9DA 1AP5A 4K3AA 3JATB 5CBFA 4NYKA 4U7NA 2HLDG 4DK0A 5IYDO 2F1MA 2QM4A 2X0LA 3OUFA 1W59A 1MSDA 3U0ZA 1HNZB 4BIOA 3L71H 1XILA 2QWPB 1UPGA 4JTAB 2R9AA 4K8XA 3OGIB 4O4JA 5B1BB 5BMVA 3R65A 3JAKA 3K57A 2ZKOA 3ABUA 4DR4B 1M56B 2V7QG 4CS3A 4X66O 2Q6AA 2EILC 2F93B 1BT8A 3N2KB 1AR4A 3GVMA 1TA8A 3QVNA 3NXSA 4IHJB 2OCCC 5EYPB 1RP3B 1XQ8A 5JJEB 1YI2V 3OAAG 2ZM6O 3HR0A 4ZOLB 4DK1A 4MVUA 1G1XB 1M90W 2B9ZA 3K59A 5EC2C 4B08A 2EX3A 1XMOO 1I5YA 4JI8B 1OV9A 3STLC 2BTOA 3ETEA 2Q0OC 4ABMA 5BZBA 3ZHUA 1XDCA 4DW0A 3J7AU 1K3EA 1HWYA 4UB6Z 3VQVA 4QNHB 4GZRB 5L3GA 4MVQA 4FLUA 4UCVA 4NVPA 5HFMA 1Y74B 4QGPA 1XL4A 1YZBA 1FD9A 2CK3G 2E3CA 2Q7EA 5CA1A 1MOFA 2JEXA 3THOA 2M7WA 2OIEA 2OTLV 4R50A 2YC0A 2WLKA 4JI6B 3ZS8C 2IU0A 4WFHA 4I50A 4L87A 5C93A 1I08A 2NNUA 3B8MA 4MTGA 1QHTA 2XOKG 3ZMUA 1ZTEA 4PELA 1XNQB 5CA3A 4KL1A 1K8AW 3R66A 4K35A 1HDJA 5KLVH 2UXCB 1F23A 4LF9O 4DV2O 3TCUA 2EIJC 5LMUO 3QF7A 1ENVA 4W4KA 1GN6A 2YEVA 1AJNA 4FPPA 5A9GA 3CCEV 4U7OA 5IJ9A 2V1DA 1K9MW 1VF6C 3RN4A 4UCUA 1SZXA 4FLVA 2LJ2A 3BABA 4P9OA 5JCOC 1WP8A 3HKDA 5GTHZ 4X62O 3QTCA 2YIDA 4J7JA 4QE9A 3STZC 5EC1C 2P06A 4DV7B 4W4LA 1Q43A 3N2KA 4DRXB 3I56V 4LF5O 3CCQV 3SPGA 2ZQMA 2RQ6A 1S77D 3AG3B 4PA9A 1S3JA 3AEIA 3K03A 1RSOB 4MS2A 5EYPA 2KG7A 4MW3A 2UUBO 1ORQC 3WB0A 3SPHA 1VP7A 3JALA 2WA4A 4J80A 2ZDIC 1E1QG 5KA6A 5GONA 2OWOA 1IBLB 3D36A 4ZOLA 4WFBV 1Q7YW 1TAEA 1PNLA 2HJFC 2ATKC 4X8AA 4TSFG 2A7WA 5LP6A 2X6CA 1PP9H 1NVPB 4GUNA 1KKCA 3CXHF 3RBZA 1Z5VA 1VQ4V 2BTQB 5TISZ 3JARB 3UT5B 1YSCA 4LNUB 2ARHA 1VQ6V 4QJFB 5CA0A 3CRMA 1S72V 1K5QA 4BW9A 5C8YB 4LF6O 2HHHO 1HNXB 4AQYB 5LOVA 5JJNB 4DXWA 2ZE6A 5FPRA 3OW2U 1M57B 3BHPA 3U11A 5EZYB 1UJWB 3QO8A 4YJ3B 3ASOC 3CX5F 1EZVH 3CCSV 4DR1O 2PYLA 2NR5A 1K97A 3T1CA 3MAQA 4JV5O 1NTZH 4LFBO 1DF4A 1Q6UA 2VQFB 2P5OA 5J2UB 1P49A 2E76B 3F7VC 5JH7B 5KA5A 2OT5A 3ETDA 3OTOB 4KHPO 2UXNA 2GUZB 1WA8A 4DV5B 5L3CA 4JTDB 4UXNA 4B3TB 1KD1W 1M5IA 5IYBO 4JI3O 1BMFG 3ZEDA 1NR7A 1URFA 1K33A 1NTMH 1NKDA 1Y4MA 5DEDA 2B5UA 1OZ0A 2Y48A 3ICXA 5IYZA 2K9PA 5LL6Y 5IDJA 2YSUB 1GN2A 2LFSA 3PJSK 3ZHVA 4DR5B 3L72H 2Z5UA 3E22A 5ITZB 1BQ0A 1V55C 1SESA 3OMAB 2F4VO 4FLZA 4MSWC 4FFKA 1NTKH 2FTKA 3HPLC 2QE7G 3S3XA 4UCRA 4LFAO 3N2GB 4I0XB 4LH7A 4LWSB 1SC5B 2LFRA 1F7YA 2IH3C 2DOSA 3K79A 3ASOB 4LCUC 4O4IB 1S0VA 3LDEA 4KXRA 4LH6A 5JVDB 3RYFA 4FZ0A 4I9QA 4DV3B 1PV0A 2VRZA 4LR3A 5GTIZ 1NJIW 1G6UA 1NR1A 4L8JA 1U97A 4RAIA 1FFXB 1L0NH 3P3PA 2PYJA 5L3EA 1N8RW 2L6LA 3RYCB 4EEQA 4DR6B 1SQBH 3UQ8A 3QG5A 1WPBA 1M4UA 5C8YA 5L3FA 2H94A 2UU9B 2XAQA 1IZ3A 2PI4A 5JCOA 1HP8A 1B6QA 2P4KA 4I5SA 1NU1H 4X89A 1H8EG 3SJCC 3H1HH 4YJ3A 1YF2A 1V54B 4JYYA 4IGGA 3DXRB 2H3OA 2E5LB 2UUCB 1OCZB 1YDXA 3EVKA 3LNNA 3ABKB 4IIJB 1QVFU 4Q20A 3FAVA 1MNGA 1I94B 3K5MA 3FYIB 5FPOA 4RUFA 3CP1A 1QR8A 2Y69B 3KKYA 4RQFA 5L3BA 4ASUG 3U10A 3I55V 3G4SV 4JYAO 1H2GA 1OCOC 2F43G 3A8TA 2QTOA 1XMQO 3RYIA 3JD1A 3CXCU 4H33A 1DGSA 3CJHB 1KP2A 4FJCC 4X1YB 4AI8A 3N2GA 3K5LA 2W6IG 1FYJA 4JI0B 3UM7A 3JD4A 4DUYB 3PN1A 4B3RB 3SR2C 3B09A 1EN4A 1HNZO 4UVBA 1AROP 1YCIA 2Q69A 4KUMA 1QNMA 2PF4E 3T4ZA 1FFXA 2QKSA 2JIZG 1BS3A 5KHHA 4CH4A 2E75B 4O4JB 1YTFB 4PDRA 5BMVB 3JAKB 1BL8A 1N36B 4DR4O 2PTMA 2Q7HA 2C2AA 1MZEA 3MDSA 4FM1A 5LA6A 1VQ7V 1ZX3A 1SZTA 1Q8IA 1OCOB 5EIBD 2Y0IA 2ZT9B 1E1RG 3ASNC 1SQGA 3FB5C 3CCVV 1SQVH 3JASA 3MHSC 3K9SA 4LF8B 5DECA 5H2FZ 3GWOA 2IU3A 2XAHA 2Q5ZA 3BFRA 3ZX6A 4NTYA 4GX2A 2Y0PA 3WFVA 3M7MX 1YXBA 2D3OW 2W0XA 5H5NA 3IAYA 4O4LA 4JI8O 4YIPA 4PA4A 2DW4A 1PNMA 2PY5A 2G38A 4HYOA 3W7TA 1VQOV 4IYHA 3SYAA 4O2AA 1R1BA 3DC6A 1FXKA 3K9AA 3K06A 3O65A 2ZNIA 4TV8A 2JDIG 1NI8A 4QIWF 4G27B 4JI1B
chains in the Genus database with same CATH topology
1XREA 1AP5A 1EM1A 1EN5A 1AR5A 3CEIA 1VEWA 1AVMA 1MSDA 4JZ2A 1I08A 2CDYA 2ADPA 1EN4A 1P7GA 1XILA 1MA1A 3AK2A 4X9QA 4F6EA 1ZSPA 1ZTEA 4JZGA 1QNMA 1AP6A 4C7UA 2GDSA 3C3TA 1JA8A 1JR9A 1B06A 1BS3A 1GN4A 2QKCA 2AW9A 1ZLZA 1GN6A 1LUVA 2P4KA 1D5NA 5A9GA 1BT8A 1AR4A 1I0HA 3MDSA 4BR6A 3QVNA 3RN4A 1IDSA 4JYYA 1SZXA 1Y67A 1GN3A 1N0NA 2CE4A 1N0JA 2ADQB 3AK1A 3TJTA 3EVKA 3K9SA 5AG2A 1BSMA 3DC5A 1MNGA 3BFRA 1GN2A 1VARA 2QKAA 1WB7A 3OT7A 3IC9A 3LSUA 1EN6A 3AK3A 1WB8A 3C3SA 4YIPA 1IX9A 3KKYA 1PL4A 1XDCA 1IXBA 3KDRA 1MMMA 4FFKA 1PM9A 1XUQA 2RCVA 4GUNA 3DC6A 4E4EA 1KKCA 1LUWA 4YIOA 1ZUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRE A;  1AP5 A;  1EM1 A;  1EN5 A;  1AR5 A;  3CEI A;  1VEW A;  1AVM A;  1MSD A;  4JZ2 A;  1I08 A;  2CDY A;  2ADP A;  1EN4 A;  1P7G A;  1XIL A;  1MA1 A;  3AK2 A;  4X9Q A;  4F6E A;  1ZSP A;  1ZTE A;  4JZG A;  1QNM A;  1AP6 A;  4C7U A;  2GDS A;  3C3T A;  1JA8 A;  1JR9 A;  1B06 A;  1BS3 A;  1GN4 A;  2QKC A;  2AW9 A;  1ZLZ A;  1GN6 A;  1LUV A;  2P4K A;  1D5N A;  5A9G A;  1BT8 A;  1AR4 A;  1I0H A;  3MDS A;  4BR6 A;  3QVN A;  3RN4 A;  1IDS A;  4JYY A;  1SZX A;  1Y67 A;  1GN3 A;  1N0N A;  2CE4 A;  1N0J A;  2ADQ B;  3AK1 A;  3TJT A;  3EVK A;  3K9S A;  5AG2 A;  1BSM A;  3DC5 A;  1MNG A;  3BFR A;  1GN2 A;  1VAR A;  2QKA A;  1WB7 A;  3OT7 A;  3IC9 A;  3LSU A;  1EN6 A;  3AK3 A;  1WB8 A;  3C3S A;  4YIP A;  1IX9 A;  3KKY A;  1PL4 A;  1XDC A;  1IXB A;  1MMM A;  4FFK A;  1PM9 A;  1XUQ A;  2RCV A;  4GUN A;  3DC6 A;  4E4E A;  1KKC A;  1LUW A;  4YIO A;  1ZUQ A; 
#chains in the Genus database with same CATH topology
 4NKG B;  1PD3 A;  4KP4 A;  2FML A;  1EM1 A;  3OFN G;  1N33 B;  4H37 A;  1EN5 A;  2KQX A;  2FYU H;  4DV0 B;  2GTS A;  3KG2 A;  5CA1 B;  1SQF A;  2K1E A;  3X2Q C;  4JI6 O;  2Q0A A;  3F5T A;  2OTJ V;  1P7G A;  4N23 A;  5CN0 A;  4UB8 Z;  4O4H A;  4I50 B;  2ZCE A;  4F6E A;  4GKK B;  2CGO A;  2DQ0 A;  4FM0 A;  3D36 C;  2QTS A;  3CS5 A;  1H38 A;  3CRQ A;  5EBM C;  4CH6 A;  1XNQ O;  4X64 B;  2WAM A;  3WB2 A;  1TUE B;  4FM2 A;  3L73 H;  2EIM C;  4G28 B;  1Q6H A;  3SGI A;  3SJQ C;  2UXC O;  3CCJ V;  5LGU A;  4UUJ C;  1YVW A;  2F95 B;  4DR3 B;  1HW7 A;  4UFZ A;  2HFE C;  2YEV B;  2CH7 A;  5IJ9 B;  1CPY A;  2HVJ C;  2QWO B;  1A32 A;  1J5E B;  2X7R B;  3QO7 A;  2ITD C;  4FFB B;  5IY5 B;  2EIK B;  3VQY A;  4DV6 B;  4I55 A;  1YIJ V;  1G4Y B;  3OD4 A;  2QSA A;  2W6J G;  3KZI Z;  4WBN A;  3HKD B;  2RMK B;  4DV7 O;  4X65 B;  1FXV A;  2VWJ A;  2DWD C;  2IH1 C;  3ABL B;  2QKA A;  3CC2 V;  2IM9 A;  4DUZ B;  4ICG A;  1SER A;  4X20 A;  3X2Q B;  2WPD G;  3C3S A;  2YI9 A;  2KG7 B;  4IYI A;  1IX9 A;  4F4L A;  3G6B A;  1SF9 A;  2FB5 A;  2AGA A;  3JAL B;  4EFE A;  3KDR A;  1IBL O;  1H2S B;  5GON B;  2HKO A;  4GX1 A;  4AHC A;  5LP6 B;  4YIO A;  4I4T A;  3RFR A;  1K5S A;  2EIM B;  4LFC B;  5LYJ A;  4UVC A;  4PI2 A;  3P30 A;  5EK0 A;  4J7K A;  1L0L H;  2E74 B;  1AVM A;  1OHH G;  3JAW B;  5E1A C;  5CA0 B;  3SPC A;  2XTA A;  1XEQ A;  3OUS A;  3WB1 A;  2PGG A;  1VQ5 V;  1HNX O;  4AQY O;  2DMX A;  1FPO A;  4X9Q A;  4GX5 A;  4YXW G;  4OPH A;  2YS8 A;  5LOV B;  4PV1 B;  1NBM G;  5D5P A;  1MAB G;  2CGN A;  4P2Z A;  4XDL A;  1JJO A;  4P30 A;  3B40 A;  3J80 N;  1JR9 A;  4H0L B;  2EIL B;  1R3I C;  4I9W A;  2VQF O;  1PNK A;  2P6J A;  3BAA A;  1KUQ A;  2OCC B;  4NTW A;  1QR9 A;  3OTO O;  3AG4 C;  1OJH A;  4DV5 O;  1WA8 B;  4B3T O;  1Q90 D;  1ROP A;  4R6Z A;  4PD4 F;  2VWK A;  4H13 B;  2WWW A;  2PZS A;  2R70 A;  4LC1 A;  4GKJ B;  1AIL A;  5AG2 A;  3FD9 A;  4CH3 A;  4LF7 B;  2QR4 A;  5IYZ B;  5K1P A;  4J41 A;  1S5J A;  4AIL C;  2ZIM A;  3EFF K;  2DN9 A;  4DR5 O;  3LSU A;  4FFB A;  3E22 B;  3BRC A;  2IJJ A;  2XUM A;  2ZD9 A;  2JEU A;  4B3M B;  1Q5O A;  2DJV A;  3SDL A;  3ML0 A;  1X59 A;  1S5H C;  3W7U A;  4MW8 A;  2QA4 V;  4IL6 Z;  5J9P C;  1ZUQ A;  2QWR B;  1RPO A;  4DV3 O;  3RYF B;  4JI7 B;  5B1O A;  4YJ2 A;  3G6E V;  5KMG A;  1FKA O;  2Y4U A;  1YJW V;  3F7Y C;  4GCZ A;  3AK2 A;  3TGU H;  3K0G A;  3ZN1 A;  4DR6 O;  3CB2 A;  3ZMV A;  1CXZ B;  2YIB A;  3K3W A;  4TUY B;  1GKF A;  2EIJ B;  1R73 A;  1Q86 W;  3ZHS A;  3JAW A;  4IT5 A;  1JPX A;  2QKC A;  2LO1 A;  4EB6 A;  1LNQ A;  2UU9 O;  1IBK B;  1ZWI C;  1GK9 A;  3H01 A;  1N34 B;  3E8H A;  5CBH A;  2QM7 A;  4Z1V A;  4JF3 A;  2XT9 A;  2B1I A;  2GV9 A;  4G2K A;  1E79 G;  2V4D A;  2AHZ A;  4JTC B;  2WA3 A;  4ZBM A;  2ADQ B;  2E5L O;  3OE7 G;  2UUC O;  1R3J C;  3SJA C;  1QU7 A;  3CRA A;  3JD3 A;  4MVO A;  1Q81 W;  1I94 O;  2CTW A;  3FAV B;  2A9H A;  1S76 D;  3E8B A;  2ZR3 A;  1WB8 A;  1IVS A;  3CRR A;  2WLL B;  4LF4 B;  3L75 H;  1R3K C;  1W2B U;  3ZRX A;  3T1Y B;  5B1A C;  5KUK A;  5JQG A;  3RYI B;  2P90 A;  5DN6 G;  1VMG A;  3Q4H A;  4X1I A;  3LUT B;  1MZF A;  3EXA A;  3G67 A;  1M9N A;  2IJK A;  1X4T A;  2Y4T A;  4JI0 O;  3W7S A;  4WFA V;  2EJR A;  2LQT A;  1L8D A;  5BXZ A;  4DUY O;  4B3R O;  4QE7 A;  1I5X A;  4J7Z A;  4U3J B;  5LHG A;  2QWQ B;  2KKW A;  3BCC H;  1T5E A;  1GO3 F;  4C7U A;  4F6R A;  1K4D C;  3LSS A;  4B7K A;  2ZE8 A;  1GN4 A;  3AG2 C;  4TQD A;  1FXK C;  4NR1 A;  1NH2 B;  4FLY A;  4NXM B;  4JYC A;  3OEE G;  2GHY A;  4ZKI A;  4Q6G A;  3K5N A;  1N36 O;  4TUY A;  1I0H A;  1NVP D;  4FMT A;  1MG1 A;  2A79 B;  1VQP V;  3AG1 C;  4FLW A;  5LMN B;  2ZR2 A;  3OMN B;  4HAM A;  1PPJ H;  1FJG B;  5LA6 B;  2ZE5 A;  2ZE7 A;  4DV4 B;  1OCC C;  2DYS C;  1Y6X A;  1BSM A;  2Q8V A;  4LF8 O;  1EBO A;  3JAS B;  4X1K A;  3OR6 C;  5KHK A;  4LBE C;  1V55 B;  3G71 V;  5EBL C;  2CTR A;  1AJP A;  3LNM B;  2RDC A;  2EBO A;  4DR2 B;  3A2F A;  4K8Z A;  1GM9 A;  3ZMZ A;  1QLN A;  4O4L B;  2RCV A;  4JI5 B;  5IT9 N;  2IJI A;  4NXN B;  1WLE A;  2A0L A;  3E83 A;  1Z2G A;  1U96 A;  4UV8 A;  1JCH A;  2M6Y A;  4DR7 B;  4O2A B;  1VQM V;  1KKD A;  4JI4 B;  3AG2 B;  3A0H Z;  4JAU A;  1FXK B;  2WLL A;  4CBC A;  1W0J G;  4TV8 B;  2X6B A;  5KHJ A;  4JI1 O;  3D8C A;  1TUB A;  1XHZ A;  3HB3 B;  4PJ0 Z;  1KB9 F;  1N33 O;  2N04 A;  3CYO A;  1F4N A;  2Q9L A;  3A0B Z;  5BR8 B;  5CBG A;  2L35 A;  4DV0 O;  3QO5 A;  3AG1 B;  3T2M A;  4FK5 C;  5B1N A;  3J81 N;  1DTO A;  1K4C C;  2OCH A;  2JRI A;  4BAY A;  3OM3 B;  4GKK O;  1KC8 W;  2A3Q A;  1N32 B;  2VQE B;  1K92 A;  4O4H B;  1XNR B;  2DYS B;  5LXT A;  4JAV A;  3E8F A;  4UVA A;  4X64 O;  2AW9 A;  3M99 B;  4U3J A;  4YY3 B;  2CAZ C;  1D5N A;  1F51 A;  3CSX A;  2JGD A;  4MVM A;  4DR3 O;  4BR6 A;  2UXD B;  3JD2 A;  4D7S A;  2ZIN A;  2LGQ A;  5IE9 A;  2F4V B;  2EZO A;  1Y67 A;  3OGC C;  2CH7 B;  1H2N A;  1N0N A;  1RM1 C;  1J5E O;  2DYR C;  1EFR G;  1SQX H;  1WPX A;  4GT1 A;  1NH2 D;  3IGA C;  3K0D A;  3HKB A;  4DV6 O;  1TGO A;  3TK1 A;  4EFB A;  4B7E A;  4I55 B;  3LSQ A;  4X65 O;  1AI6 A;  4DV1 B;  4WBN B;  3P3N A;  2N74 A;  4OX9 B;  1WB7 A;  1THZ A;  1COW G;  1EN6 A;  1Z5W A;  2YI8 A;  4DUZ O;  1K7D A;  3JAM N;  1D5A A;  3OR7 C;  4DO2 A;  1MMM A;  2EZP A;  3FX7 A;  4X20 B;  3ZRW A;  1H2L A;  3T1H B;  3RGB A;  5KAI Z;  4JAA A;  2IJH A;  2CTP A;  2HVK C;  2JK5 C;  2XAG A;  4I4T B;  4LFC O;  2X6A A;  2JS5 A;  2YXH A;  4BW5 A;  4FZ1 A;  1N4C A;  3FB6 C;  5LYJ B;  1SQQ H;  4K0K B;  2R9I A;  1FAF A;  4LP8 A;  5IYC O;  4TV9 A;  3OMI B;  4PDL A;  3ZHR A;  5LGT A;  1RM1 B;  2BSK A;  1P84 F;  2DYR B;  1M93 A;  2UXB B;  4O2B A;  4CC6 A;  5GW7 A;  4RUE A;  3S3W A;  5FLX N;  1VQ8 V;  4RWU A;  2ETN A;  1GM8 A;  1SQP H;  4ZIB A;  3UKM A;  1VIB A;  4JPR A;  4CH5 A;  4NB5 A;  4ZI7 B;  3C90 A;  2QDO A;  3ASN B;  2WLN A;  3FB7 C;  4JYB A;  2KSD A;  3CE2 A;  2WLI A;  2W0F C;  2P4V A;  2QWN B;  4GKJ O;  2O57 A;  3H1J H;  5KHG A;  1H2K A;  4PDV A;  2XAJ A;  1IBM B;  1S5L Z;  3OT7 A;  4LF7 O;  3ZMS A;  5FNV A;  3K58 A;  5LBQ A;  3QNE A;  2BOB C;  2BCC H;  2LGW A;  5EBW C;  1CP9 A;  1PL4 A;  3H9V A;  1IXB A;  1BGY H;  1KP3 A;  4WFE A;  1JOY A;  2AZ0 A;  3ETG A;  1DF5 A;  1Y76 A;  4B3M O;  1G8M A;  1YTF D;  1GM7 A;  3LDC A;  3BY6 A;  1K73 W;  1JFF A;  5IWA B;  4J9Z B;  1ZL8 A;  1AB3 A;  4BIU A;  1VQL V;  3SYQ A;  5KX5 A;  1KEC A;  5A2Q N;  1BQZ A;  2GSM B;  4TQF A;  1YJ9 V;  2UXX A;  4RO2 A;  2JJ1 G;  3W7X A;  4JI7 O;  4WFG A;  3SYO A;  3FB8 C;  3RYH A;  3JSL A;  5B3S C;  4YHH B;  4QPK A;  2JGU A;  3AG7 A;  3VQW A;  4YJ2 B;  3TET A;  5B5E Z;  3ABT A;  5KMG B;  1NT2 B;  2GTA A;  1WAZ A;  4XDJ A;  3BEH A;  2HP8 A;  4B3S B;  2Q73 A;  3ZBH A;  1AP6 A;  2FKX A;  1VF5 B;  1M1K W;  3MHH C;  3CC7 V;  3TXS A;  2KB1 A;  1HNW B;  4OPA A;  3K5O A;  4MTF A;  4PHZ A;  1RPR A;  5CB4 A;  3BPZ A;  4EB6 B;  1IBK O;  1N34 O;  1R3L C;  5H6Q A;  3ABM C;  2QGN A;  1UFI A;  1MSW D;  1HR0 B;  4TWK A;  1WP7 A;  4HNA A;  5IJ0 A;  1TVK A;  3GWK C;  2CE4 A;  2A06 H;  4DW1 A;  1GAX A;  3DTU B;  1NQT A;  3DC5 A;  4ZI7 A;  1I7F A;  4PDM A;  3P32 A;  1GH6 A;  2UUA B;  1JJ2 U;  2RN9 A;  5KUM A;  3E89 A;  2YIC A;  5LGN A;  1JNB A;  3AG3 C;  5B3S B;  1PL0 A;  3HKE A;  3DSQ A;  3CD6 V;  3CPW U;  2WLJ A;  3H1L H;  4LF4 O;  3L70 H;  3CWB H;  3APO A;  4MTO A;  3VQX A;  3JCZ A;  1W0K G;  3ZHQ A;  1YIT V;  1QLE C;  2WSS G;  1AI5 A;  2EIN C;  1US6 A;  1LUW A;  1V9P A;  4MTX A;  4JI2 B;  3T1Y O;  3JAT A;  1KMI Z;  5LHH A;  5KHI A;  1VQN V;  3ZRV A;  2PI5 A;  3BA9 A;  5JQG B;  1AR5 A;  1YHQ V;  1R6N A;  1SET A;  1SKV A;  3WG7 C;  3Q4H B;  4X1I B;  4MVZ A;  3ABM B;  2GBO A;  2WLH A;  2CDY A;  4BIZ A;  4JAS A;  5CMU A;  1QVG U;  2Z3Y A;  1ZSP A;  3CCM V;  3CME V;  1WN7 A;  4A5U B;  3ZCC A;  2RNB A;  1GRJ A;  3IFX A;  4CS4 A;  3RWR D;  3CCU V;  1M57 C;  2GDS A;  1KYO F;  1XHX A;  2XHB A;  4NTX A;  3OEH G;  4P9P A;  1B06 A;  3SYC A;  5LHI A;  1BZK A;  4U3F H;  3G80 A;  3D3Q A;  4F6R B;  4X66 B;  4NXM O;  3SJB C;  3AG4 B;  1FS0 G;  4IHJ A;  1AJQ A;  1VF7 A;  3BA8 A;  4CS2 A;  1FOU A;  3D3I A;  3JYC A;  3JSN A;  2YXY A;  2Q7G A;  1XOU A;  5LMN O;  1N0J A;  1QLE B;  1Q82 W;  2ZM6 B;  2EIN B;  3TJT A;  1FJG O;  2YIB D;  5F2V O;  3K04 A;  5KAF Z;  4DV4 O;  1AI7 A;  2F66 C;  4FLT A;  2HG5 C;  3E35 A;  4R8C A;  3K08 A;  1XMO B;  2N05 A;  4X1K B;  1K34 A;  3WG7 B;  2XAF A;  2YXL A;  1SA0 B;  4XDK A;  3RW0 A;  3AK3 A;  4OGQ B;  1IXM A;  2QM8 A;  3OTF A;  1XUQ A;  4DR2 O;  3ZIA G;  1XI1 A;  1BE3 H;  4JI5 O;  1Y74 A;  4NXN O;  2Q67 A;  1O9G A;  1H2M A;  3RVY A;  3E8G A;  4DR7 O;  4JI4 O;  1IJG A;  3SPI A;  2B1G A;  4FLX A;  3F5W C;  2ILM A;  4E2L A;  2BE3 A;  1TUB B;  1B3Q A;  3IC7 A;  2LW7 A;  2ADP A;  3W7W A;  3B2E E;  5BR8 O;  5L3D A;  4MT8 A;  3ZN0 A;  1AR1 B;  3JD0 A;  4UCT A;  1MA1 A;  1RFY A;  2P22 C;  3E86 A;  2Z0A A;  2DQ3 A;  2OYQ A;  1N32 O;  3APQ A;  2VQE O;  4LF9 B;  1XNR O;  4DV2 B;  5EIB C;  5LMU B;  4CC5 A;  3T4D A;  1KQS U;  3TXQ A;  1NZ6 A;  2MW2 B;  4J42 A;  5LXT B;  3A0R A;  4PA7 A;  3GB7 C;  1LUV A;  2ZNJ A;  3HKC B;  1WJZ A;  2ODM A;  2FL4 A;  4YY3 O;  5FL7 G;  1Q3E A;  2AHY A;  2UXD O;  2JGD B;  3IJ4 A;  3ZMT A;  2F23 A;  4X62 B;  2XND G;  1V54 C;  4DRX A;  3AK1 A;  1R6T A;  4LF5 B;  3LDD A;  1IUR A;  2HJD A;  1GTO A;  1RSO A;  1OCZ C;  3NR7 A;  2QJ1 A;  3ABK C;  2UUB B;  1D2D A;  1Y66 A;  4DYL A;  2BOC C;  3HKB B;  4UV9 A;  2ITC C;  4DV1 O;  3H1I H;  4OX9 O;  4GYC B;  3CMA V;  2ZIO A;  3CCL V;  5BY1 A;  1JVM A;  2ZXW C;  2IW5 A;  1SS3 A;  5B1A B;  4CZZ A;  3RT3 C;  2Y69 C;  2QEX V;  2BTQ A;  1F4M A;  2AXT Z;  3JAR A;  2JS3 A;  3UT5 A;  4E4E A;  3T1H O;  3ZRW B;  4UCS A;  3ZHT A;  1SA0 A;  2CTQ A;  4LNU A;  1KU9 A;  2IBZ H;  4D7T A;  1XRE A;  3E2E A;  1GMG A;  1AI4 A;  4LF6 B;  1VF6 A;  5DM6 V;  1PKX A;  3CEI A;  2HHH B;  3RVZ A;  2R9R B;  1ZAU A;  3KCY A;  4PA6 A;  1CEZ A;  1VEW A;  3ZJZ A;  4K0K O;  4JZ2 A;  3CC4 V;  5EZY A;  4HBN A;  2PUS A;  5J2T B;  4TV9 B;  3CCR V;  2MK3 A;  5D5Q A;  1QCE A;  1H8H G;  4DR1 B;  4FIP C;  5E79 Z;  4JV5 B;  4Z1M G;  1YJN V;  5J2U A;  4LFB B;  3SYP A;  5JH7 A;  1KBH A;  2BSK B;  5JJJ B;  2Q68 A;  1L1F A;  1DLB A;  1YEW A;  2UXB O;  2DE0 X;  2GUZ A;  2ZDI A;  4KHP B;  1ZLZ A;  1XL6 A;  4O2B B;  1QQC A;  1WNS A;  2OIG A;  2R72 A;  4J11 A;  1IDS A;  2EUL A;  2ZXW B;  3ZRS A;  4JI3 B;  1OCC B;  2D2C B;  3UO3 A;  3B4S A;  3CHX A;  3HKC A;  2WLI B;  3L74 H;  4MVR A;  2CUG A;  1Q6I A;  1QBZ A;  5ITZ A;  4D6T H;  4ZHQ B;  4BWA A;  4J9Y B;  3I5D A;  3IC9 A;  1IBM O;  5HFL A;  2NN4 A;  4I0X A;  4LWS A;  4X88 A;  4LFA B;  5FNV B;  3M8A A;  1R6K A;  4PA3 A;  4O4I A;  4TOI A;  1FXH A;  1P7B A;  4WCE V;  5JVD A;  3VBB A;  2RJZ A;  1Y76 B;  1SRY A;  5IWA O;  4RQE A;  1JFF B;  2XAS A;  4MVS A;  1B04 A;  1VQK V;  4EKW A;  4PI0 A;  1ZL8 B;  3UO2 A;  2AZ2 A;  4I7Z B;  1LR1 A;  3ETQ A;  2NLJ C;  1XBL A;  5KX5 B;  1BHA A;  1VQ9 V;  3RYC A;  3SPJ A;  2P67 A;  4WF9 V;  4XBF A;  2H8P C;  4H44 B;  3FYE B;  5H9C A;  4YHH O;  1OCR C;  5B66 Z;  3RYH B;  2DWE C;  1JMK C;  4JZG A;  2YIA A;  4B3S O;  3C3T A;  1JA8 A;  2LW1 A;  2VS0 A;  4FVM A;  3B8N A;  5JWP A;  3WU2 Z;  2JJ2 G;  1HNW O;  1DK1 A;  5J2T A;  4J10 A;  2HR3 A;  3KCX A;  3O9O A;  5H6R A;  5CB4 B;  3DXR A;  1P4R A;  2YDE A;  2P7T C;  1EZJ A;  2EJ7 A;  1HR0 O;  1GN3 A;  4IIJ A;  1J95 A;  1H5W A;  4UCO A;  3FKS G;  3H1K H;  4HNA B;  5IJ0 B;  2Q4P A;  5B1B C;  1TVK B;  1O9H A;  5K1X A;  1FFT B;  3B77 A;  3CRC A;  1JQ0 A;  3JCU Z;  1NS1 A;  4QPJ A;  3UCS C;  4N21 A;  5IY5 C;  2LP7 A;  2EIK C;  2JVD A;  1BHB A;  3N27 A;  1VAR A;  3MD0 A;  1M56 C;  4OXS A;  4KFM A;  2UUA O;  3EHB B;  3DGE A;  3ABL C;  4JGS A;  4WFF A;  1BCC H;  4TT3 G;  4JYA B;  1OCR B;  3VOU A;  1PM9 A;  4HZ3 A;  1JX9 A;  1XMQ B;  3FFQ A;  3HKE B;  4Z2W A;  3BVO A;  3CJH A;  2WLM A;  4ZHQ A;  4X1Y A;  4GLX A;  2HEP A;  2YUA A;  4GX0 A;  4JI2 O;  4R7C A;  5LP6 C;  3L9D A;  1AP5 A;  4K3A A;  3JAT B;  5CBF A;  4NYK A;  4U7N A;  2HLD G;  4DK0 A;  5IYD O;  2F1M A;  2QM4 A;  2X0L A;  3OUF A;  1W59 A;  1MSD A;  3U0Z A;  1HNZ B;  4BIO A;  3L71 H;  1XIL A;  2QWP B;  1UPG A;  4JTA B;  2R9A A;  4K8X A;  3OGI B;  4O4J A;  5B1B B;  5BMV A;  3R65 A;  3JAK A;  3K57 A;  2ZKO A;  3ABU A;  4DR4 B;  1M56 B;  2V7Q G;  4CS3 A;  4X66 O;  2Q6A A;  2EIL C;  2F93 B;  1BT8 A;  3N2K B;  1AR4 A;  3GVM A;  1TA8 A;  3QVN A;  3NXS A;  4IHJ B;  2OCC C;  5EYP B;  1RP3 B;  1XQ8 A;  5JJE B;  1YI2 V;  3OAA G;  2ZM6 O;  3HR0 A;  4ZOL B;  4DK1 A;  4MVU A;  1G1X B;  1M90 W;  2B9Z A;  3K59 A;  5EC2 C;  4B08 A;  2EX3 A;  1XMO O;  1I5Y A;  4JI8 B;  1OV9 A;  3STL C;  2BTO A;  3ETE A;  2Q0O C;  4ABM A;  5BZB A;  3ZHU A;  1XDC A;  4DW0 A;  3J7A U;  1K3E A;  1HWY A;  4UB6 Z;  3VQV A;  4QNH B;  4GZR B;  5L3G A;  4MVQ A;  4FLU A;  4UCV A;  4NVP A;  5HFM A;  1Y74 B;  4QGP A;  1XL4 A;  1YZB A;  1FD9 A;  2CK3 G;  2E3C A;  2Q7E A;  5CA1 A;  1MOF A;  2JEX A;  3THO A;  2M7W A;  2OIE A;  2OTL V;  4R50 A;  2YC0 A;  2WLK A;  4JI6 B;  3ZS8 C;  2IU0 A;  4WFH A;  4I50 A;  4L87 A;  5C93 A;  1I08 A;  2NNU A;  3B8M A;  4MTG A;  1QHT A;  2XOK G;  3ZMU A;  1ZTE A;  4PEL A;  1XNQ B;  5CA3 A;  4KL1 A;  1K8A W;  3R66 A;  4K35 A;  1HDJ A;  5KLV H;  2UXC B;  1F23 A;  4LF9 O;  4DV2 O;  3TCU A;  2EIJ C;  5LMU O;  3QF7 A;  1ENV A;  4W4K A;  1GN6 A;  2YEV A;  1AJN A;  4FPP A;  5A9G A;  3CCE V;  4U7O A;  5IJ9 A;  2V1D A;  1K9M W;  1VF6 C;  3RN4 A;  4UCU A;  1SZX A;  4FLV A;  2LJ2 A;  3BAB A;  4P9O A;  5JCO C;  1WP8 A;  3HKD A;  5GTH Z;  4X62 O;  3QTC A;  2YID A;  4J7J A;  4QE9 A;  3STZ C;  5EC1 C;  2P06 A;  4DV7 B;  4W4L A;  1Q43 A;  3N2K A;  4DRX B;  3I56 V;  4LF5 O;  3CCQ V;  3SPG A;  2ZQM A;  2RQ6 A;  1S77 D;  3AG3 B;  4PA9 A;  1S3J A;  3AEI A;  3K03 A;  1RSO B;  4MS2 A;  5EYP A;  2KG7 A;  4MW3 A;  2UUB O;  1ORQ C;  3WB0 A;  3SPH A;  1VP7 A;  3JAL A;  2WA4 A;  4J80 A;  2ZDI C;  1E1Q G;  5KA6 A;  5GON A;  2OWO A;  1IBL B;  3D36 A;  4ZOL A;  4WFB V;  1Q7Y W;  1TAE A;  1PNL A;  2HJF C;  2ATK C;  4X8A A;  4TSF G;  2A7W A;  5LP6 A;  2X6C A;  1PP9 H;  1NVP B;  4GUN A;  1KKC A;  3CXH F;  3RBZ A;  1Z5V A;  1VQ4 V;  2BTQ B;  5TIS Z;  3JAR B;  3UT5 B;  1YSC A;  4LNU B;  2ARH A;  1VQ6 V;  4QJF B;  5CA0 A;  3CRM A;  1S72 V;  1K5Q A;  4BW9 A;  5C8Y B;  4LF6 O;  2HHH O;  1HNX B;  4AQY B;  5LOV A;  5JJN B;  4DXW A;  2ZE6 A;  5FPR A;  3OW2 U;  1M57 B;  3BHP A;  3U11 A;  5EZY B;  1UJW B;  3QO8 A;  4YJ3 B;  3ASO C;  3CX5 F;  1EZV H;  3CCS V;  4DR1 O;  2PYL A;  2NR5 A;  1K97 A;  3T1C A;  3MAQ A;  4JV5 O;  1NTZ H;  4LFB O;  1DF4 A;  1Q6U A;  2VQF B;  2P5O A;  5J2U B;  1P49 A;  2E76 B;  3F7V C;  5JH7 B;  5KA5 A;  2OT5 A;  3ETD A;  3OTO B;  4KHP O;  2UXN A;  2GUZ B;  1WA8 A;  4DV5 B;  5L3C A;  4JTD B;  4UXN A;  4B3T B;  1KD1 W;  1M5I A;  5IYB O;  4JI3 O;  1BMF G;  3ZED A;  1NR7 A;  1URF A;  1K33 A;  1NTM H;  1NKD A;  1Y4M A;  5DED A;  2B5U A;  1OZ0 A;  2Y48 A;  3ICX A;  5IYZ A;  2K9P A;  5LL6 Y;  5IDJ A;  2YSU B;  1GN2 A;  2LFS A;  3PJS K;  3ZHV A;  4DR5 B;  3L72 H;  2Z5U A;  3E22 A;  5ITZ B;  1BQ0 A;  1V55 C;  1SES A;  3OMA B;  2F4V O;  4FLZ A;  4MSW C;  4FFK A;  1NTK H;  2FTK A;  3HPL C;  2QE7 G;  3S3X A;  4UCR A;  4LFA O;  3N2G B;  4I0X B;  4LH7 A;  4LWS B;  1SC5 B;  2LFR A;  1F7Y A;  2IH3 C;  2DOS A;  3K79 A;  3ASO B;  4LCU C;  4O4I B;  1S0V A;  3LDE A;  4KXR A;  4LH6 A;  5JVD B;  3RYF A;  4FZ0 A;  4I9Q A;  4DV3 B;  1PV0 A;  2VRZ A;  4LR3 A;  5GTI Z;  1NJI W;  1G6U A;  1NR1 A;  4L8J A;  1U97 A;  4RAI A;  1FFX B;  1L0N H;  3P3P A;  2PYJ A;  5L3E A;  1N8R W;  2L6L A;  3RYC B;  4EEQ A;  4DR6 B;  1SQB H;  3UQ8 A;  3QG5 A;  1WPB A;  1M4U A;  5C8Y A;  5L3F A;  2H94 A;  2UU9 B;  2XAQ A;  1IZ3 A;  2PI4 A;  5JCO A;  1HP8 A;  1B6Q A;  2P4K A;  4I5S A;  1NU1 H;  4X89 A;  1H8E G;  3SJC C;  3H1H H;  4YJ3 A;  1YF2 A;  1V54 B;  4JYY A;  4IGG A;  3DXR B;  2H3O A;  2E5L B;  2UUC B;  1OCZ B;  1YDX A;  3EVK A;  3LNN A;  3ABK B;  4IIJ B;  1QVF U;  4Q20 A;  3FAV A;  1MNG A;  1I94 B;  3K5M A;  3FYI B;  5FPO A;  4RUF A;  3CP1 A;  1QR8 A;  2Y69 B;  3KKY A;  4RQF A;  5L3B A;  4ASU G;  3U10 A;  3I55 V;  3G4S V;  4JYA O;  1H2G A;  1OCO C;  2F43 G;  3A8T A;  2QTO A;  1XMQ O;  3RYI A;  3JD1 A;  3CXC U;  4H33 A;  1DGS A;  3CJH B;  1KP2 A;  4FJC C;  4X1Y B;  4AI8 A;  3N2G A;  3K5L A;  2W6I G;  1FYJ A;  4JI0 B;  3UM7 A;  3JD4 A;  4DUY B;  3PN1 A;  4B3R B;  3SR2 C;  3B09 A;  1EN4 A;  1HNZ O;  4UVB A;  1ARO P;  1YCI A;  2Q69 A;  4KUM A;  1QNM A;  2PF4 E;  3T4Z A;  1FFX A;  2QKS A;  2JIZ G;  1BS3 A;  5KHH A;  4CH4 A;  2E75 B;  4O4J B;  1YTF B;  4PDR A;  5BMV B;  3JAK B;  1BL8 A;  1N36 B;  4DR4 O;  2PTM A;  2Q7H A;  2C2A A;  1MZE A;  3MDS A;  4FM1 A;  5LA6 A;  1VQ7 V;  1ZX3 A;  1SZT A;  1Q8I A;  1OCO B;  5EIB D;  2Y0I A;  2ZT9 B;  1E1R G;  3ASN C;  1SQG A;  3FB5 C;  3CCV V;  1SQV H;  3JAS A;  3MHS C;  3K9S A;  4LF8 B;  5DEC A;  5H2F Z;  3GWO A;  2IU3 A;  2XAH A;  2Q5Z A;  3BFR A;  3ZX6 A;  4NTY A;  4GX2 A;  2Y0P A;  3WFV A;  3M7M X;  1YXB A;  2D3O W;  2W0X A;  5H5N A;  3IAY A;  4O4L A;  4JI8 O;  4YIP A;  4PA4 A;  2DW4 A;  1PNM A;  2PY5 A;  2G38 A;  4HYO A;  3W7T A;  1VQO V;  4IYH A;  3SYA A;  4O2A A;  1R1B A;  3DC6 A;  1FXK A;  3K9A A;  3K06 A;  3O65 A;  2ZNI A;  4TV8 A;  2JDI G;  1NI8 A;  4QIW F;  4G27 B;  4JI1 B; 
#chains in the Genus database with same CATH homology
 1XRE A;  1AP5 A;  1EM1 A;  1EN5 A;  1AR5 A;  3CEI A;  1VEW A;  1AVM A;  1MSD A;  4JZ2 A;  1I08 A;  2CDY A;  2ADP A;  1EN4 A;  1P7G A;  1XIL A;  1MA1 A;  3AK2 A;  4X9Q A;  4F6E A;  1ZSP A;  1ZTE A;  4JZG A;  1QNM A;  1AP6 A;  4C7U A;  2GDS A;  3C3T A;  1JA8 A;  1JR9 A;  1B06 A;  1BS3 A;  1GN4 A;  2QKC A;  2AW9 A;  1ZLZ A;  1GN6 A;  1LUV A;  2P4K A;  1D5N A;  5A9G A;  1BT8 A;  1AR4 A;  1I0H A;  3MDS A;  4BR6 A;  3QVN A;  3RN4 A;  1IDS A;  4JYY A;  1SZX A;  1Y67 A;  1GN3 A;  1N0N A;  2CE4 A;  1N0J A;  2ADQ B;  3AK1 A;  3TJT A;  3EVK A;  3K9S A;  5AG2 A;  1BSM A;  3DC5 A;  1MNG A;  3BFR A;  1GN2 A;  1VAR A;  2QKA A;  1WB7 A;  3OT7 A;  3IC9 A;  3LSU A;  1EN6 A;  3AK3 A;  1WB8 A;  3C3S A;  4YIP A;  1IX9 A;  3KKY A;  1PL4 A;  1XDC A;  1IXB A;  3KDR A;  1MMM A;  4FFK A;  1PM9 A;  1XUQ A;  2RCV A;  4GUN A;  3DC6 A;  4E4E A;  1KKC A;  1LUW A;  4YIO A;  1ZUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...