2GDSA

Interrupting the hydrogen bonding network at the active site of human manganese superoxide dismutase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKNHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Interrupting the Hydrogen Bond Network at the Active Site of Human Manganese Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 68
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2gdsA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2gdsA02
1EN5A 1KKCA 1GN3A 1AVMA 1BT8A 1AP6A 1XILA 1D5NA 1AP5A 1GN6A 1WB8A 1GN4A 2P4KA 1VARA 3AK3A 1SZXA 2QKCA 1VEWA 1EM1A 2ADQB 2AW9A 4YIPA 2CDYA 3C3TA 1QNMA 1JR9A 1N0JA 3OT7A 4YIOA 4E4EA 3LSUA 3KKYA 1PM9A 1JA8A 3DC5A 1ZUQA 1XDCA 3IC9A 1ZTEA 4FFKA 3CEIA 4C7UA 3BFRA 2RCVA 1B06A 1Y67A 1LUVA 1BS3A 3RN4A 1AR5A 1BSMA 2GDSA 4JYYA 3AK1A 3AK2A 1IXBA 1I08A 4X9QA 5AG2A 1MNGA 3EVKA 4F6EA 1P7GA 1MMMA 4JZ2A 4JZGA 1EN6A 4GUNA 1N0NA 1GN2A 3DC6A 4BR6A 1WB7A 1I0HA 1AR4A 1MA1A 1MSDA 1EN4A 3MDSA 1IDSA 1ZLZA 1ZSPA 1PL4A 2QKAA 1IX9A 1XREA 3K9SA 2CE4A 3QVNA 5A9GA 1LUWA 3TJTA 2ADPA 3C3SA 1XUQA
chains in the Genus database with same CATH superfamily
3ZHRA 1M57C 2XT9A 1AVMA 3HKCA 5KUKA 3T4ZA 2WLHA 1YCIA 2JGDB 3KZIZ 4WFFA 4LH6A 1VIBA 1VQ5V 2UUAB 1AJPA 4JI8B 3FYIB 2HG5C 4KHPB 2QSAA 4AILC 2HR3A 4YIPA 3ZHQA 4AQYO 2OCHA 3VQVA 3CCVV 4E4EA 3K58A 1LNQA 3RYHA 1DK1A 2EILB 2UXXA 1XDCA 4JAVA 3DGEA 4EFBA 4HAMA 4OX9O 4LH7A 4MVUA 4FFKA 1FJGB 2PF4E 4L8JA 4X66O 3CCJV 4O4HB 4DV3O 4O4HA 3APOA 5DN6G 3APQA 3ZRWB 4OPAA 3ZRWA 3A0BZ 1O9GA 1XI1A 5K1XA 4LF9O 3CJHA 1Z5VA 4DV2O 4Z1MG 5CA0B 5CA0A 3ASNC 3RBZA 1SESA 3K0DA 4UCOA 4GX0A 4TUYB 2UUCO 4TUYA 1NI8A 1N0NA 4FMTA 1QVGU 1N34O 4LF6O 2ZINA 2C2AA 3SGIA 3SJAC 2CTWA 2HVKC 4X64O 1RPOA 4J9ZB 2BTQB 2BTQA 2P67A 3K59A 1KYOF 4DUYB 4JI5O 2KKWA 1JMKC 2QKAA 4IYHA 3W7UA 4X89A 3RVZA 2PYLA 5DECA 3TJTA 1OCZB 1SRYA 2YI9A 4JI4B 2PI4A 3CCSV 3I55V 3B40A 4MW8A 1T5EA 2XAGA 3CRMA 1D5NA 2DW4A 1H8EG 1AP5A 2Q0AA 1GN6A 1OCCC 1ZX3A 1KP2A 1YVWA 2B9ZA 2F4VO 3JARB 1W0JG 3JARA 3THOA 1M56C 3BHPA 1XMOO 4FM2A 5IJ0B 1UPGA 1VQ9V 1QR9A 2YXYA 2EJ7A 4NYKA 3CRAA 3LSUA 4LP8A 1AI5A 5FL7G 3AEIA 4B3RB 3LNMB 2XHBA 4CC6A 2DWDC 2YSUB 2ZDIC 4TV9B 4TV9A 1QLEB 4YJ3B 5KA6A 2DQ3A 2WSSG 4TV8B 2UXBB 4WCEV 4MSWC 1HNXB 3KCXA 5LMUO 5LBQA 1H2NA 3H1JH 2AHYA 4ABMA 4BIUA 4I7ZB 1ENVA 3B8NA 3ETQA 1K8AW 4FPPA 2JS3A 1JCHA 5LA6A 3E83A 3H1KH 4FK5C 3F7VC 1F7YA 3CD6V 2DQ0A 5B1BC 4QJFB 1Q6UA 2ZIMA 1MMMA 1RFYA 3CE2A 3QTCA 5K1PA 1AI7A 4LFAO 1GN2A 1KECA 4X1IA 4RQEA 4Z1VA 1Q82W 2DE0X 4FZ0A 1BMFG 3IGAC 3OAAG 3KCYA 3K06A 4PDRA 4PI0A 1NZ6A 4KL1A 4LFBB 2KQXA 2Z0AA 4NTXA 3CMEV 5CA3A 1FXVA 2DYRB 4DR7O 3OW2U 4BIZA 2RMKB 3R65A 2RN9A 4X1YB 4Q20A 5KLVH 2Y69B 1XMQB 1AP6A 4YXWG 3AG4C 4DV1B 2A79B 2UUBB 4B3MB 2KSDA 3AK3A 4JYAB 4DR4O 2GV9A 3I5DA 1K34A 4WFHA 1BHAA 4ZBMA 3J80N 4JASA 3JSLA 2QA4V 2ZNIA 1IVSA 5B1AC 3VOUA 1QNMA 4W4KA 3K04A 3VBBA 3BVOA 1IBMO 1FOUA 3A2FA 3DC5A 1IBKB 2UU9B 2PYJA 1N36O 1VF6C 2HVJC 4RUEA 4YJ2B 4YJ2A 3MHHC 2W6JG 3DTUB 3K9AA 1E1QG 5D5QA 5EBLC 4GZRB 3E2EA 2MW2B 3AG2B 1GM7A 1VP7A 3D36C 3H1HH 4RAIA 5C93A 4PDMA 1JJOA 5CB4B 5CB4A 5KMGB 1FAFA 1OCRC 1V54C 4X9QA 1PV0A 4B3SB 2CH7A 5ITZB 1KBHA 5ITZA 1JFFA 4GKJB 4O4IA 4P9PA 1UJWB 3G4SV 3K5LA 1CXZB 4NXNB 1U97A 5EC2C 1K5QA 2YDEA 2YEVA 4QPKA 2YIBA 4QE9A 1NVPB 4QGPA 3MAQA 4JV5B 2EINB 4YHHO 1B04A 2K9PA 1ZSPA 3BA9A 2WLNA 1VQNV 4KP4A 4LFCO 1YZBA 1Q6IA 2R9AA 3Q4HB 1YTFD 3Q4HA 4BW9A 3OEEG 1ORQC 4O2AB 2XASA 3FB6C 4O2AA 1A32A 2JK5C 3TXSA 4JI7O 1S77D 4E2LA 1HWYA 2P4KA 1X59A 5KAIZ 2W0FC 3EXAA 2RJZA 4DV7B 1SZXA 4X65B 4FLUA 1GO3F 1KKDA 2CDYA 3BCCH 3C3TA 2Q68A 3SPJA 4U7OA 5L3FA 1MZFA 3WU2Z 2QWQB 2WAMA 1N32O 1D2DA 4LCUC 1FXKC 3SYOA 4DR5O 1WJZA 4MTGA 4G2KA 3M99B 5B3SC 2F93B 2DN9A 3C90A 2XTAA 2V7QG 2ZT9B 4WBNB 1Z2GA 5H6RA 5EBWC 1VQMV 2G38A 2NLJC 2Q4PA 1TVKB 1JOYA 1GK9A 2OCCB 3G71V 4PD4F 5J2UA 1J5EO 4CBCA 2JVDA 4LF8B 5KHGA 5HFMA 2ARHA 2Q67A 4HBNA 3TCUA 1QU7A 3E8FA 2B1GA 3JASA 1QBZA 3MDSA 3ABKC 1AJNA 3IC7A 4JAAA 4CH4A 3CCMV 3HB3B 2A3QA 2CAZC 3L9DA 3STZC 1F23A 1XNRO 4GKKO 1XUQA 3W7SA 1FD9A 1V55B 5J9PC 4PA3A 1M5IA 2Y48A 1BE3H 4DR1O 4UXNA 2A7WA 3ETGA 3SYQA 2OT5A 2BSKB 5IY5C 2BSKA 4DW0A 3SYPA 2AZ2A 3GWKC 2QKCA 5JCOA 3CHXA 3ML0A 2NNUA 1ZWIC 5FLXN 1VQOV 4K8ZA 3JCZA 1SF9A 2FKXA 5JVDB 1KC8W 2X6BA 1KMIZ 4OGQB 4FLVA 4DV6O 1FPOA 1TGOA 3OM3B 1ZTEA 4WFAV 4WFGA 2WPDG 4I0XB 4B7EA 4I0XA 1RM1C 1AILA 2R70A 3GB7C 3WG7C 1XNQB 2RCVA 1SZTA 4I55B 5B1OA 1JQ0A 1Y66A 1G1XB 2RQ6A 3JD1A 1Q86W 4X20B 4X20A 3ZRVA 2D3OW 3L72H 1H2GA 3W7XA 2DJVA 4B3RO 3MD0A 4EEQA 2PTMA 5LYJB 3CPWU 4UVBA 1Y76A 5IYBO 4B3TB 4X62O 4UVCA 3CCEV 2HLDG 3FAVB 3FAVA 3RYCB 3JD4A 4DK0A 1MA1A 1H8HG 3T4DA 3LUTB 2YIDA 3O9OA 2E76B 5JQGB 5JQGA 1GRJA 3BPZA 2VQEO 2NN4A 4JTAB 4JI0O 2DYSC 5EIBC 5EZYB 5EZYA 3OR6C 2EIJB 3SPCA 3E22B 3UT5A 3E22A 3GWOA 1GMGA 4DR6O 4UV8A 1QLNA 4I50B 1GKFA 3TXQA 3E8HA 1DF4A 2L35A 1TUBB 2JEXA 1M90W 1URFA 4R7CA 1I7FA 4X88A 4NTWA 2ZXWB 2CTPA 5IWAB 2E5LO 4I9WA 3OD4A 3HKCB 2PY5A 3CRQA 5BR8O 1E1RG 1IBLO 2KG7B 1R3JC 2KG7A 1SQQH 3T1YB 3HKEB 3HKEA 5JJNB 4CH6A 5LHIA 3ZHTA 3ZMZA 1PNLA 4FLZA 2P6JA 5KHIA 1LR1A 1Y67A 2ETNA 5FNVB 5FNVA 1AB3A 3RYHB 4TOIA 1RP3B 5JH7A 2IH3C 2ZE6A 3WB1A 1N33O 3ZJZA 1IXBA 5GW7A 3FKSG 4NXMO 4I4TB 4I4TA 3HKBA 3N2GB 3N2GA 4DR3O 1K3EA 3IAYA 3DC6A 3ABMC 4YY3B 4BR6A 4UCTA 4JI1B 1NH2D 3CC7V 1Y74B 1Y74A 3RVYA 5EIBD 2M7WA 3CJHB 3T1CA 2BCCH 4PV1B 4HYOA 2Q0OC 1XQ8A 4XDJA 1AI4A 2EIMC 4PA4A 1NQTA 2P5OA 3CSXA 5LMNB 1AR1B 2XAJA 4H13B 1IXMA 5KHKA 1HNZB 4BAYA 2B5UA 3CRRA 2ZM6B 3JAMN 5A2QN 2LGWA 4EKWA 1VQPV 2DOSA 5BXZA 2QJ1A 5IT9N 3CCQV 1I94B 1L0NH 3JAWB 3JAWA 3OTFA 4FLTA 1S76D 2W6IG 1K7DA 1AI6A 3L75H 1N4CA 5J2TB 5J2TA 1PM9A 1PNMA 4G28B 3RGBA 1K73W 1HNWB 2EILC 3G80A 1Q90D 2L6LA 2UXCB 1YXBA 1YI2V 4QNHB 4C7UA 2QM8A 4UCUA 4G27B 4F6RB 4F6RA 4RUFA 1ZL8B 1ZL8A 1SQFA 4H33A 3CC4V 3D8CA 2ZE7A 2FB5A 3ABLB 2E75B 5EC1C 4JI2B 2LFRA 1OHHG 2ZIOA 2VQFB 4D6TH 5E1AC 4X1KA 5JWPA 1R73A 2ILMA 2ZQMA 3JALB 3JALA 4P2ZA 3M7MX 5LHHA 1Q43A 2ZE5A 1OJHA 4N21A 5LOVB 5LOVA 5LA6B 4DUZO 2KB1A 1N8RW 2B1IA 4K3AA 1GTOA 2IU0A 4DV0O 3CMAV 3WB0A 5CBGA 3OMAB 2IH1C 1OCZC 4X1IB 4J11A 1XILA 2JEUA 4DV4O 2ZD9A 1HR0O 4NR1A 2X6AA 2N05A 3FYEB 1WP7A 2LJ2A 3P30A 4UUJC 3BAAA 5KUMA 3JSNA 1DTOA 2LQTA 2ADQB 5F2VO 1FKAO 3OT7A 3D36A 2AXTZ 4K0KB 3KKYA 3CXHF 4LF4O 2JIZG 2WLKA 4DO2A 1JPXA 2QEXV 2MK3A 2F43G 1KD1W 1QLEC 2V1DA 1XOUA 3ASOB 4BIOA 1Z5WA 3JD2A 4MW3A 4UV9A 2OYQA 4QE7A 1JX9A 1W59A 1P84F 4DV5O 1GAXA 1J95A 3B2EE 1WPXA 3ZMVA 1P7BA 4AQYB 4OPHA 4J42A 4FLYA 2GDSA 3L74H 2CTRA 2F66C 4GCZA 1I08A 1L1FA 1CP9A 4DR2O 3J7AU 4OX9B 3TGUH 3I56V 1SKVA 4O2BB 1JVMA 4O2BA 1NS1A 5EYPB 5EYPA 2GUZB 2GUZA 2VS0A 4X66B 4DV3B 2Y0IA 3F5TA 3OMNB 1VQKV 3ZCCA 2BE3A 4JTDB 1LUWA 2CH7B 4I9QA 1JFFB 2Q8VA 4O4IB 3SPHA 4LF9B 2PGGA 1H2SB 1PP9H 1SERA 2F95B 2DYRC 4PDVA 4DW1A 4A5UB 3G6BA 4LF5O 2YEVB 3CWBH 2Y69C 3UO3A 1VMGA 3B09A 2UUCB 5L3DA 3F5WC 2QTSA 3T1HO 4H44B 1H38A 4FJCC 4P9OA 1N34B 3ZHVA 4LF6B 5IYCO 2UXDO 1XEQA 1COWG 4X64B 4FLWA 1YIJV 3CS5A 2YIAA 3H9VA 2HHHO 2HJFC 4LR3A 2Z3YA 4JI5B 5BY1A 1R6NA 4YIOA 3U0ZA 3FFQA 4IHJB 4IHJA 1OCOB 5LP6B 5LP6A 2VWJA 2FTKA 2Q6AA 4UB6Z 5CN0A 2EX3A 2GSMB 5FPRA 2EIKB 3OTOO 4PDLA 3QNEA 2ATKC 3AG1B 5JJEB 4JI6O 3CCUV 1RSOB 1RSOA 2CTQA 2CUGA 4LF7O 3S3XA 2AGAA 1FFXB 1FFXA 2EJRA 2F4VB 4CC5A 3K57A 2Y4TA 3AG2C 4CS3A 1K97A 1XMOB 2CK3G 2QKSA 4JI3O 2PUSA 4PA7A 3X2QB 2NR5A 2OTJV 3N2KB 3N2KA 1YJ9V 4ZOLB 4ZOLA 2ZNJA 1EN6A 3B77A 1IZ3A 2Y4UA 3OUSA 1QR8A 2QM4A 2UUAO 5H9CA 1TUEB 4PELA 4JI8O 4D7TA 4U7NA 4Z2WA 3W7WA 4KHPO 5LMUB 4PHZA 2EINC 3TETA 2FYUH 3SJQC 2HKOA 5J2UB 2XNDG 3RYIB 5A9GA 1R3LC 3ABTA 3RYIA 2YXHA 4OXSA 2XOKG 1Q81W 1SQXH 1NBMG 4MVSA 5LGNA 3FB8C 3P3NA 3AG3B 1L0LH 1FJGO 2N04A 3JASB 2R9RB 4PJ0Z 4WFBV 2ITDC 3NR7A 2PZSA 4LFAB 1GN4A 5IJ9B 5IJ9A 2HJDA 3JAKB 1SQPH 3JAKA 2IJKA 2XAQA 1Q6HA 1BZKA 1O9HA 1I5XA 4DR7B 3WB2A 1K5SA 4MVRA 4CS2A 4J41A 2H8PC 2QWOB 4QIWF 1IURA 4FIPC 3DSQA 1D5AA 4DUYO 1B06A 1XL6A 1F51A 1NTZH 4MVMA 1SS3A 3AK1A 3AK2A 1NKDA 4JI4O 1IBMB 3HR0A 3LSQA 1PL0A 4NTYA 2OCCC 3FB7C 3BA8A 1US6A 1N36B 1GM8A 1NR1A 3K5MA 2YIBD 3D3IA 4W4LA 3H1LH 1NVPD 1H5WA 3VQYA 3B8MA 1YJNV 4XDLA 1EN4A 2WLIB 2WLIA 1SQVH 2N74A 1PL4A 2Q73A 4UCRA 1IX9A 2EZPA 3K9SA 2CE4A 4H0LB 2Z5UA 3CP1A 2LW1A 1M57B 1Y76B 4GX2A 1G8MA 2OTLV 3JYCA 1V55C 4DYLA 2HFEC 2UXBO 2ZCEA 1H2LA 3R66A 3BEHA 2YC0A 1HNXO 1F4MA 2R9IA 3KG2A 4FFBB 4FFBA 3UCSC 4YHHB 4D7SA 1N0JA 5JCOC 4UVAA 3UT5B 4GT1A 4LFCB 3OE7G 3P32A 3ZMUA 1SQGA 4J7ZA 2FMLA 4IGGA 4LC1A 1M4UA 3IC9A 4X8AA 1HDJA 1S5HC 4U3FH 4UFZA 1VQLV 4H37A 3ZX6A 1DGSA 2UXNA 4FLXA 4JI7B 3CC2V 2AZ0A 1H2MA 5H2FZ 1THZA 2XAHA 4LFBO 5LXTB 1LUVA 5LXTA 3VQWA 3OFNG 1NT2B 2Q7HA 3K79A 4Q6GA 1EZVH 4JYCA 2LGQA 3ASNB 4MT8A 2IJHA 1TA8A 1XMQO 4R8CA 3ZHUA 3EVKA 1W2BU 1P7GA 4DV1O 4JZ2A 1N32B 3B4SA 4DR5B 2UUBO 3E86A 4JTCB 4B3MO 4JYAO 1YSCA 4RWUA 2FL4A 3AG7A 3JD0A 4IIJA 4IIJB 2JGDA 4DXWA 1OZ0A 2Q69A 3SDLA 1PNKA 5JH7B 1BQ0A 3L70H 3FB5C 3CXCU 2H3OA 2YS8A 4IYIA 1Q3EA 5B5EZ 4NKGB 1IBKO 2XUMA 3GVMA 3HKBB 4CH3A 2UU9O 2IW5A 2BOBC 2EIJC 5H5NA 1BT8A 3W7TA 1J5EB 1X4TA 3ABUA 1FFTB 4ASUG 3MHSC 1OCCB 3WFVA 4MVZA 4LNUB 3TK1A 2JGUA 4LNUA 1DF5A 4RQFA 1U96A 2QM7A 1M56B 3RWRD 5CMUA 1M1KW 2OIEA 2IM9A 3EFFK 1JR9A 2JDIG 2PI5A 2YI8A 3UQ8A 5HFLA 3FD9A 4B3SO 2OWOA 2ZXWC 2E3CA 3CYOA 1YEWA 1XNRB 4GKKB 2HEPA 2ZDIA 2Q9LA 3A0HZ 4GKJO 5KAFZ 4NXNO 1G6UA 1F4NA 3QO8A 3OR7C 4MVQA 4DR1B 4FZ1A 1S0VA 5L3GA 4JV5O 2X6CA 2H94A 2QWNB 2YUAA 1YDXA 1V9PA 4JF3A 3RN4A 1AR5A 1BSMA 3ETDA 3U11A 1CEZA 3E8BA 5B1BB 4JGSA 4BWAA 2JS5A 2P90A 2A0LA 5AG2A 1MNGA 4F6EA 3NXSA 4ZIBA 2A06H 1I5YA 4JAUA 4FM1A 2JRIA 3RT3C 4DV6B 3K08A 1GH6A 3A0RA 3E8GA 3JCUZ 2A9HA 1BHBA 4DV7O 1BQZA 1PKXA 1Y6XA 4X65O 1IDSA 1ZLZA 1FXHA 5L3CA 3ZN1A 1VQ6V 1XREA 4X1KB 4MTFA 5IJ0A 1ROPA 1GN3A 5DEDA 1YTFB 2Q7GA 1MG1A 3AG4B 2QE7G 4N23A 4KFMA 1GM9A 3OMIB 3DXRB 1VQ8V 3DXRA 4PA6A 1S72V 4YJ3A 4X62B 4B7KA 1VARA 1P4RA 2OIGA 2YXLA 3LNNA 3ZS8C 4WF9V 4TV8A 5B1AB 2V4DA 3QG5A 2K1EA 1HW7A 4R6ZA 4GX5A 4DK1A 5E79Z 2VQEB 2P4VA 4JI0B 3SR2C 1JA8A 4TWKA 3ZIAG 2IBZH 2QWRB 1VF6A 3D3QA 4LF8O 2BTOA 1M9NA 4MTOA 5BMVB 5BMVA 4WFEA 3JD3A 4I5SA 4DR6B 3SPGA 3BFRA 2IJJA 1YJWV 2JJ2G 2QWPB 3HKDB 3HKDA 2ZE8A 3JATB 3JATA 4F4LA 1FS0G 1P49A 3U10A 4KXRA 3QO5A 2JJ1G 1OCRB 1V54B 2X7RB 2E5LB 3ABLC 2ZKOA 3G67A 2ZR2A 2IU3A 3UKMA 3LDCA 4MTXA 5BR8B 1KUQA 1XL4A 1IBLB 1Q5OA 4X1YA 1SC5B 1BGYH 3SYCA 1K9MW 2EULA 4K35A 3ZMSA 4JYBA 4LWSB 4LWSA 1NTKH 3EHBB 3QO7A 3J81N 1PD3A 3OUFA 3E35A 4HNAB 4HNAA 3C3SA 5C8YB 2XAFA 5C8YA 1N33B 3PN1A 1K92A 1NTMH 4NXMB 5JJJB 3K5OA 1JNBA 1EBOA 3ZRXA 2EZOA 1WAZA 4J7JA 5EK0A 2QGNA 5B66Z 4DR3B 4O4JB 4O4JA 1NJIW 4RO2A 1XNQO 4EFEA 4FM0A 3T2MA 5LL6Y 3L73H 5IDJA 2WLMA 1AROP 2P7TC 3ZEDA 3IJ4A 3SYAA 3M8AA 3ICXA 4DV2B 1BL8A 4B08A 3FX7A 3IFXA 1FXKB 3RW0A 1FXKA 2P06A 1KP3A 5KMGA 4B3TO 1MABG 4ZI7B 4ZI7A 5B3SB 2M6YA 1WNSA 4J80A 3L71H 2DWEC 4PI2A 1TAEA 3F7YC 3ASOC 1K4CC 2LP7A 2ZR3A 1S5JA 1NU1H 4J7KA 2LO1A 1VF5B 4PA9A 4GYCB 5IE9A 1SETA 1Y4MA 3P3PA 5LGTA 4R50A 1XBLA 2WA3A 3BRCA 5IYDO 3LDDA 4CZZA 5D5PA 1I0HA 3ABKB 2GTAA 1WP8A 1B3QA 1MSDA 2ODMA 3ZMTA 4O4LB 2RDCA 4O4LA 1H2KA 3ETEA 4NB5A 3K3WA 5IWAO 3ZBHA 2Q5ZA 3QVNA 5KHJA 4FVMA 1PPJH 2DMXA 4GLXA 1EN5A 1KKCA 3E89A 1YHQV 1G4YB 2AHZA 4JPRA 3T1YO 2CGOA 1QHTA 4ZKIA 5FPOA 3S3WA 2QDOA 5IY5B 3G6EV 1WB8A 1RPRA 3ZRSA 5CA1B 4DRXB 5CA1A 4DRXA 1CPYA 3LDEA 3K03A 1R3KC 4MVOA 3SJCC 2F23A 3K0GA 1VEWA 1EM1A 1Q8IA 4BW5A 2AW9A 3OEHG 4P30A 4DUZB 5GTHZ 2VWKA 2LFSA 3BY6A 4TSFG 3CCRV 5CBFA 4WBNA 4LBEC 4DV0B 1R3IC 5LP6C 1OCOC 5TISZ 5H6QA 5KX5B 1ZUQA 4XBFA 5KX5A 3RFRA 1TVKA 4CS4A 4EB6B 2EIKC 4EB6A 1S3JA 1SQBH 1MZEA 4YY3O 4DV4B 3AG1C 3QF7A 1FYJA 1RM1B 4NVPA 4JI1O 1Q7YW 3CEIA 4HZ3A 5L3EA 1HR0B 3WG7B 5EBMC 4IT5A 2F1MA 2GHYA 3O65A 2GBOA 1KB9F 5B1NA 4K8XA 1B6QA 1SA0B 2WWWA 1SA0A 5LGUA 2EBOA 1R1BA 1WPBA 3OGIB 5LMNO 1NR7A 4AHCA 3HPLC 1QVFU 4J9YB 4LF4B 2QTOA 1YITV 3X2QC 1KU9A 1HNZO 1OV9A 3CRCA 4GUNA 4KUMA 3CX5F 2GTSA 2ZM6O 5GTIZ 4DR4B 3ZHSA 1K33A 1QCEA 1NH2B 1I94O 5BZBA 1KQSU 4CH5A 1WN7A 1DLBA 3PJSK 4ZHQB 4ZHQA 4DV5B 2CGNA 1WLEA 3SJBC 2Y0PA 2DYSB 1EZJA 3CCLV 4MS2A 3KDRA 4QPJA 3UM7A 2X0LA 2YICA 2ADPA 1E79G 5L3BA 4TQFA 2E74B 3N27A 1HNWO 3ZN0A 2UXCO 3RYFB 4IL6Z 3RYFA 1XHXA 1UFIA 3AG3C 4DR2B 2R72A 5JVDA 1R6TA 1M93A 2ITCC 1IJGA 1W0KG 1WA8B 1WA8A 3VQXA 4I55A 4JI2O 4L87A 5DM6V 4AI8A 1JJ2U 2VQFO 1L8DA 5CBHA 3H01A 2O57A 4LF5B 2QR4A 2WLLB 2WLLA 5LYJA 2W0XA 3BABA 4GX1A 3T1HB 4XDKA 2HP8A 1R6KA 5LHGA 4UCSA 2UXDB 3RYCA 3LSSA 2LW7A 1MSWD 1BS3A 2HHHB 3OGCC 1EFRG 4ICGA 4JYYA 3CB2A 2VRZA 4UB8Z 4J10A 1ZAUA 1HP8A 3OTOB 1YF2A 4JZGA 5KA5A 2BOCC 3ABMB 2Q7EA 1VF7A 2IJIA 1MOFA 2WLJA 5KHHA 4JI6B 3SPIA 1S5LZ 1WB7A 3H1IH 1K4DC 1AR4A 1QQCA 5GONB 1VQ4V 5GONA 4LF7B 1AJQA 3STLC 2RNBA 4U3JB 2D2CB 4U3JA 4I50A 4TT3G 1XHZA 3A8TA 3UO2A 4UCVA 3K5NA 5IYZB 4K0KO 5IYZA 4TQDA 2EIMB 1VQ7V 2WA4A 1BCCH 1TUBA 2P22C 4JI3B
chains in the Genus database with same CATH topology
1EN5A 1KKCA 1GN3A 1AVMA 1BT8A 1AP6A 1XILA 1D5NA 1AP5A 1GN6A 1WB8A 1GN4A 2P4KA 1VARA 3AK3A 1SZXA 2QKCA 1VEWA 1EM1A 2ADQB 2AW9A 4YIPA 2CDYA 3C3TA 1QNMA 1JR9A 1N0JA 3OT7A 4YIOA 4E4EA 3LSUA 3KKYA 1PM9A 1JA8A 3DC5A 1ZUQA 1XDCA 3IC9A 1ZTEA 4FFKA 3CEIA 4C7UA 3BFRA 2RCVA 1B06A 1Y67A 1LUVA 1BS3A 3RN4A 1AR5A 1BSMA 2GDSA 4JYYA 3AK1A 3AK2A 1IXBA 1I08A 4X9QA 5AG2A 1MNGA 3EVKA 4F6EA 1P7GA 1MMMA 4JZ2A 4JZGA 1EN6A 4GUNA 1N0NA 1GN2A 3DC6A 4BR6A 1WB7A 1I0HA 1AR4A 1MA1A 1MSDA 1EN4A 3MDSA 1IDSA 1ZLZA 1ZSPA 1PL4A 2QKAA 1IX9A 1XREA 3K9SA 2CE4A 3QVNA 3KDRA 5A9GA 1LUWA 3TJTA 2ADPA 3C3SA 1XUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EN5 A;  1KKC A;  1GN3 A;  1AVM A;  1BT8 A;  1AP6 A;  1XIL A;  1D5N A;  1AP5 A;  1GN6 A;  1WB8 A;  1GN4 A;  2P4K A;  1VAR A;  3AK3 A;  1SZX A;  2QKC A;  1VEW A;  1EM1 A;  2ADQ B;  2AW9 A;  4YIP A;  2CDY A;  3C3T A;  1QNM A;  1JR9 A;  1N0J A;  3OT7 A;  4YIO A;  4E4E A;  3LSU A;  3KKY A;  1PM9 A;  1JA8 A;  3DC5 A;  1ZUQ A;  1XDC A;  3IC9 A;  1ZTE A;  4FFK A;  3CEI A;  4C7U A;  3BFR A;  2RCV A;  1B06 A;  1Y67 A;  1LUV A;  1BS3 A;  3RN4 A;  1AR5 A;  1BSM A;  2GDS A;  4JYY A;  3AK1 A;  3AK2 A;  1IXB A;  1I08 A;  4X9Q A;  5AG2 A;  1MNG A;  3EVK A;  4F6E A;  1P7G A;  1MMM A;  4JZ2 A;  4JZG A;  1EN6 A;  4GUN A;  1N0N A;  1GN2 A;  3DC6 A;  4BR6 A;  1WB7 A;  1I0H A;  1AR4 A;  1MA1 A;  1MSD A;  1EN4 A;  3MDS A;  1IDS A;  1ZLZ A;  1ZSP A;  1PL4 A;  2QKA A;  1IX9 A;  1XRE A;  3K9S A;  2CE4 A;  3QVN A;  5A9G A;  1LUW A;  3TJT A;  2ADP A;  3C3S A;  1XUQ A; 
#chains in the Genus database with same CATH topology
 3ZHR A;  1M57 C;  2XT9 A;  1AVM A;  3HKC A;  5KUK A;  3T4Z A;  2WLH A;  1YCI A;  2JGD B;  3KZI Z;  4WFF A;  4LH6 A;  1VIB A;  1VQ5 V;  2UUA B;  1AJP A;  4JI8 B;  3FYI B;  2HG5 C;  4KHP B;  2QSA A;  4AIL C;  2HR3 A;  4YIP A;  3ZHQ A;  4AQY O;  2OCH A;  3VQV A;  3CCV V;  4E4E A;  3K58 A;  1LNQ A;  3RYH A;  1DK1 A;  2EIL B;  2UXX A;  1XDC A;  4JAV A;  3DGE A;  4EFB A;  4HAM A;  4OX9 O;  4LH7 A;  4MVU A;  4FFK A;  1FJG B;  2PF4 E;  4L8J A;  4X66 O;  3CCJ V;  4O4H B;  4DV3 O;  4O4H A;  3APO A;  5DN6 G;  3APQ A;  3ZRW B;  4OPA A;  3ZRW A;  3A0B Z;  1O9G A;  1XI1 A;  5K1X A;  4LF9 O;  3CJH A;  1Z5V A;  4DV2 O;  4Z1M G;  5CA0 B;  5CA0 A;  3ASN C;  3RBZ A;  1SES A;  3K0D A;  4UCO A;  4GX0 A;  4TUY B;  2UUC O;  4TUY A;  1NI8 A;  1N0N A;  4FMT A;  1QVG U;  1N34 O;  4LF6 O;  2ZIN A;  2C2A A;  3SGI A;  3SJA C;  2CTW A;  2HVK C;  4X64 O;  1RPO A;  4J9Z B;  2BTQ B;  2BTQ A;  2P67 A;  3K59 A;  1KYO F;  4DUY B;  4JI5 O;  2KKW A;  1JMK C;  2QKA A;  4IYH A;  3W7U A;  4X89 A;  3RVZ A;  2PYL A;  5DEC A;  3TJT A;  1OCZ B;  1SRY A;  2YI9 A;  4JI4 B;  2PI4 A;  3CCS V;  3I55 V;  3B40 A;  4MW8 A;  1T5E A;  2XAG A;  3CRM A;  1D5N A;  2DW4 A;  1H8E G;  1AP5 A;  2Q0A A;  1GN6 A;  1OCC C;  1ZX3 A;  1KP2 A;  1YVW A;  2B9Z A;  2F4V O;  3JAR B;  1W0J G;  3JAR A;  3THO A;  1M56 C;  3BHP A;  1XMO O;  4FM2 A;  5IJ0 B;  1UPG A;  1VQ9 V;  1QR9 A;  2YXY A;  2EJ7 A;  4NYK A;  3CRA A;  3LSU A;  4LP8 A;  1AI5 A;  5FL7 G;  3AEI A;  4B3R B;  3LNM B;  2XHB A;  4CC6 A;  2DWD C;  2YSU B;  2ZDI C;  4TV9 B;  4TV9 A;  1QLE B;  4YJ3 B;  5KA6 A;  2DQ3 A;  2WSS G;  4TV8 B;  2UXB B;  4WCE V;  4MSW C;  1HNX B;  3KCX A;  5LMU O;  5LBQ A;  1H2N A;  3H1J H;  2AHY A;  4ABM A;  4BIU A;  4I7Z B;  1ENV A;  3B8N A;  3ETQ A;  1K8A W;  4FPP A;  2JS3 A;  1JCH A;  5LA6 A;  3E83 A;  3H1K H;  4FK5 C;  3F7V C;  1F7Y A;  3CD6 V;  2DQ0 A;  5B1B C;  4QJF B;  1Q6U A;  2ZIM A;  1MMM A;  1RFY A;  3CE2 A;  3QTC A;  5K1P A;  1AI7 A;  4LFA O;  1GN2 A;  1KEC A;  4X1I A;  4RQE A;  4Z1V A;  1Q82 W;  2DE0 X;  4FZ0 A;  1BMF G;  3IGA C;  3OAA G;  3KCY A;  3K06 A;  4PDR A;  4PI0 A;  1NZ6 A;  4KL1 A;  4LFB B;  2KQX A;  2Z0A A;  4NTX A;  3CME V;  5CA3 A;  1FXV A;  2DYR B;  4DR7 O;  3OW2 U;  4BIZ A;  2RMK B;  3R65 A;  2RN9 A;  4X1Y B;  4Q20 A;  5KLV H;  2Y69 B;  1XMQ B;  1AP6 A;  4YXW G;  3AG4 C;  4DV1 B;  2A79 B;  2UUB B;  4B3M B;  2KSD A;  3AK3 A;  4JYA B;  4DR4 O;  2GV9 A;  3I5D A;  1K34 A;  4WFH A;  1BHA A;  4ZBM A;  3J80 N;  4JAS A;  3JSL A;  2QA4 V;  2ZNI A;  1IVS A;  5B1A C;  3VOU A;  1QNM A;  4W4K A;  3K04 A;  3VBB A;  3BVO A;  1IBM O;  1FOU A;  3A2F A;  3DC5 A;  1IBK B;  2UU9 B;  2PYJ A;  1N36 O;  1VF6 C;  2HVJ C;  4RUE A;  4YJ2 B;  4YJ2 A;  3MHH C;  2W6J G;  3DTU B;  3K9A A;  1E1Q G;  5D5Q A;  5EBL C;  4GZR B;  3E2E A;  2MW2 B;  3AG2 B;  1GM7 A;  1VP7 A;  3D36 C;  3H1H H;  4RAI A;  5C93 A;  4PDM A;  1JJO A;  5CB4 B;  5CB4 A;  5KMG B;  1FAF A;  1OCR C;  1V54 C;  4X9Q A;  1PV0 A;  4B3S B;  2CH7 A;  5ITZ B;  1KBH A;  5ITZ A;  1JFF A;  4GKJ B;  4O4I A;  4P9P A;  1UJW B;  3G4S V;  3K5L A;  1CXZ B;  4NXN B;  1U97 A;  5EC2 C;  1K5Q A;  2YDE A;  2YEV A;  4QPK A;  2YIB A;  4QE9 A;  1NVP B;  4QGP A;  3MAQ A;  4JV5 B;  2EIN B;  4YHH O;  1B04 A;  2K9P A;  1ZSP A;  3BA9 A;  2WLN A;  1VQN V;  4KP4 A;  4LFC O;  1YZB A;  1Q6I A;  2R9A A;  3Q4H B;  1YTF D;  3Q4H A;  4BW9 A;  3OEE G;  1ORQ C;  4O2A B;  2XAS A;  3FB6 C;  4O2A A;  1A32 A;  2JK5 C;  3TXS A;  4JI7 O;  1S77 D;  4E2L A;  1HWY A;  2P4K A;  1X59 A;  5KAI Z;  2W0F C;  3EXA A;  2RJZ A;  4DV7 B;  1SZX A;  4X65 B;  4FLU A;  1GO3 F;  1KKD A;  2CDY A;  3BCC H;  3C3T A;  2Q68 A;  3SPJ A;  4U7O A;  5L3F A;  1MZF A;  3WU2 Z;  2QWQ B;  2WAM A;  1N32 O;  1D2D A;  4LCU C;  1FXK C;  3SYO A;  4DR5 O;  1WJZ A;  4MTG A;  4G2K A;  3M99 B;  5B3S C;  2F93 B;  2DN9 A;  3C90 A;  2XTA A;  2V7Q G;  2ZT9 B;  4WBN B;  1Z2G A;  5H6R A;  5EBW C;  1VQM V;  2G38 A;  2NLJ C;  2Q4P A;  1TVK B;  1JOY A;  1GK9 A;  2OCC B;  3G71 V;  4PD4 F;  5J2U A;  1J5E O;  4CBC A;  2JVD A;  4LF8 B;  5KHG A;  5HFM A;  2ARH A;  2Q67 A;  4HBN A;  3TCU A;  1QU7 A;  3E8F A;  2B1G A;  3JAS A;  1QBZ A;  3MDS A;  3ABK C;  1AJN A;  3IC7 A;  4JAA A;  4CH4 A;  3CCM V;  3HB3 B;  2A3Q A;  2CAZ C;  3L9D A;  3STZ C;  1F23 A;  1XNR O;  4GKK O;  1XUQ A;  3W7S A;  1FD9 A;  1V55 B;  5J9P C;  4PA3 A;  1M5I A;  2Y48 A;  1BE3 H;  4DR1 O;  4UXN A;  2A7W A;  3ETG A;  3SYQ A;  2OT5 A;  2BSK B;  5IY5 C;  2BSK A;  4DW0 A;  3SYP A;  2AZ2 A;  3GWK C;  2QKC A;  5JCO A;  3CHX A;  3ML0 A;  2NNU A;  1ZWI C;  5FLX N;  1VQO V;  4K8Z A;  3JCZ A;  1SF9 A;  2FKX A;  5JVD B;  1KC8 W;  2X6B A;  1KMI Z;  4OGQ B;  4FLV A;  4DV6 O;  1FPO A;  1TGO A;  3OM3 B;  1ZTE A;  4WFA V;  4WFG A;  2WPD G;  4I0X B;  4B7E A;  4I0X A;  1RM1 C;  1AIL A;  2R70 A;  3GB7 C;  3WG7 C;  1XNQ B;  2RCV A;  1SZT A;  4I55 B;  5B1O A;  1JQ0 A;  1Y66 A;  1G1X B;  2RQ6 A;  3JD1 A;  1Q86 W;  4X20 B;  4X20 A;  3ZRV A;  2D3O W;  3L72 H;  1H2G A;  3W7X A;  2DJV A;  4B3R O;  3MD0 A;  4EEQ A;  2PTM A;  5LYJ B;  3CPW U;  4UVB A;  1Y76 A;  5IYB O;  4B3T B;  4X62 O;  4UVC A;  3CCE V;  2HLD G;  3FAV B;  3FAV A;  3RYC B;  3JD4 A;  4DK0 A;  1MA1 A;  1H8H G;  3T4D A;  3LUT B;  2YID A;  3O9O A;  2E76 B;  5JQG B;  5JQG A;  1GRJ A;  3BPZ A;  2VQE O;  2NN4 A;  4JTA B;  4JI0 O;  2DYS C;  5EIB C;  5EZY B;  5EZY A;  3OR6 C;  2EIJ B;  3SPC A;  3E22 B;  3UT5 A;  3E22 A;  3GWO A;  1GMG A;  4DR6 O;  4UV8 A;  1QLN A;  4I50 B;  1GKF A;  3TXQ A;  3E8H A;  1DF4 A;  2L35 A;  1TUB B;  2JEX A;  1M90 W;  1URF A;  4R7C A;  1I7F A;  4X88 A;  4NTW A;  2ZXW B;  2CTP A;  5IWA B;  2E5L O;  4I9W A;  3OD4 A;  3HKC B;  2PY5 A;  3CRQ A;  5BR8 O;  1E1R G;  1IBL O;  2KG7 B;  1R3J C;  2KG7 A;  1SQQ H;  3T1Y B;  3HKE B;  3HKE A;  5JJN B;  4CH6 A;  5LHI A;  3ZHT A;  3ZMZ A;  1PNL A;  4FLZ A;  2P6J A;  5KHI A;  1LR1 A;  1Y67 A;  2ETN A;  5FNV B;  5FNV A;  1AB3 A;  3RYH B;  4TOI A;  1RP3 B;  5JH7 A;  2IH3 C;  2ZE6 A;  3WB1 A;  1N33 O;  3ZJZ A;  1IXB A;  5GW7 A;  3FKS G;  4NXM O;  4I4T B;  4I4T A;  3HKB A;  3N2G B;  3N2G A;  4DR3 O;  1K3E A;  3IAY A;  3DC6 A;  3ABM C;  4YY3 B;  4BR6 A;  4UCT A;  4JI1 B;  1NH2 D;  3CC7 V;  1Y74 B;  1Y74 A;  3RVY A;  5EIB D;  2M7W A;  3CJH B;  3T1C A;  2BCC H;  4PV1 B;  4HYO A;  2Q0O C;  1XQ8 A;  4XDJ A;  1AI4 A;  2EIM C;  4PA4 A;  1NQT A;  2P5O A;  3CSX A;  5LMN B;  1AR1 B;  2XAJ A;  4H13 B;  1IXM A;  5KHK A;  1HNZ B;  4BAY A;  2B5U A;  3CRR A;  2ZM6 B;  3JAM N;  5A2Q N;  2LGW A;  4EKW A;  1VQP V;  2DOS A;  5BXZ A;  2QJ1 A;  5IT9 N;  3CCQ V;  1I94 B;  1L0N H;  3JAW B;  3JAW A;  3OTF A;  4FLT A;  1S76 D;  2W6I G;  1K7D A;  1AI6 A;  3L75 H;  1N4C A;  5J2T B;  5J2T A;  1PM9 A;  1PNM A;  4G28 B;  3RGB A;  1K73 W;  1HNW B;  2EIL C;  3G80 A;  1Q90 D;  2L6L A;  2UXC B;  1YXB A;  1YI2 V;  4QNH B;  4C7U A;  2QM8 A;  4UCU A;  4G27 B;  4F6R B;  4F6R A;  4RUF A;  1ZL8 B;  1ZL8 A;  1SQF A;  4H33 A;  3CC4 V;  3D8C A;  2ZE7 A;  2FB5 A;  3ABL B;  2E75 B;  5EC1 C;  4JI2 B;  2LFR A;  1OHH G;  2ZIO A;  2VQF B;  4D6T H;  5E1A C;  4X1K A;  5JWP A;  1R73 A;  2ILM A;  2ZQM A;  3JAL B;  3JAL A;  4P2Z A;  3M7M X;  5LHH A;  1Q43 A;  2ZE5 A;  1OJH A;  4N21 A;  5LOV B;  5LOV A;  5LA6 B;  4DUZ O;  2KB1 A;  1N8R W;  2B1I A;  4K3A A;  1GTO A;  2IU0 A;  4DV0 O;  3CMA V;  3WB0 A;  5CBG A;  3OMA B;  2IH1 C;  1OCZ C;  4X1I B;  4J11 A;  1XIL A;  2JEU A;  4DV4 O;  2ZD9 A;  1HR0 O;  4NR1 A;  2X6A A;  2N05 A;  3FYE B;  1WP7 A;  2LJ2 A;  3P30 A;  4UUJ C;  3BAA A;  5KUM A;  3JSN A;  1DTO A;  2LQT A;  2ADQ B;  5F2V O;  1FKA O;  3OT7 A;  3D36 A;  2AXT Z;  4K0K B;  3KKY A;  3CXH F;  4LF4 O;  2JIZ G;  2WLK A;  4DO2 A;  1JPX A;  2QEX V;  2MK3 A;  2F43 G;  1KD1 W;  1QLE C;  2V1D A;  1XOU A;  3ASO B;  4BIO A;  1Z5W A;  3JD2 A;  4MW3 A;  4UV9 A;  2OYQ A;  4QE7 A;  1JX9 A;  1W59 A;  1P84 F;  4DV5 O;  1GAX A;  1J95 A;  3B2E E;  1WPX A;  3ZMV A;  1P7B A;  4AQY B;  4OPH A;  4J42 A;  4FLY A;  2GDS A;  3L74 H;  2CTR A;  2F66 C;  4GCZ A;  1I08 A;  1L1F A;  1CP9 A;  4DR2 O;  3J7A U;  4OX9 B;  3TGU H;  3I56 V;  1SKV A;  4O2B B;  1JVM A;  4O2B A;  1NS1 A;  5EYP B;  5EYP A;  2GUZ B;  2GUZ A;  2VS0 A;  4X66 B;  4DV3 B;  2Y0I A;  3F5T A;  3OMN B;  1VQK V;  3ZCC A;  2BE3 A;  4JTD B;  1LUW A;  2CH7 B;  4I9Q A;  1JFF B;  2Q8V A;  4O4I B;  3SPH A;  4LF9 B;  2PGG A;  1H2S B;  1PP9 H;  1SER A;  2F95 B;  2DYR C;  4PDV A;  4DW1 A;  4A5U B;  3G6B A;  4LF5 O;  2YEV B;  3CWB H;  2Y69 C;  3UO3 A;  1VMG A;  3B09 A;  2UUC B;  5L3D A;  3F5W C;  2QTS A;  3T1H O;  4H44 B;  1H38 A;  4FJC C;  4P9O A;  1N34 B;  3ZHV A;  4LF6 B;  5IYC O;  2UXD O;  1XEQ A;  1COW G;  4X64 B;  4FLW A;  1YIJ V;  3CS5 A;  2YIA A;  3H9V A;  2HHH O;  2HJF C;  4LR3 A;  2Z3Y A;  4JI5 B;  5BY1 A;  1R6N A;  4YIO A;  3U0Z A;  3FFQ A;  4IHJ B;  4IHJ A;  1OCO B;  5LP6 B;  5LP6 A;  2VWJ A;  2FTK A;  2Q6A A;  4UB6 Z;  5CN0 A;  2EX3 A;  2GSM B;  5FPR A;  2EIK B;  3OTO O;  4PDL A;  3QNE A;  2ATK C;  3AG1 B;  5JJE B;  4JI6 O;  3CCU V;  1RSO B;  1RSO A;  2CTQ A;  2CUG A;  4LF7 O;  3S3X A;  2AGA A;  1FFX B;  1FFX A;  2EJR A;  2F4V B;  4CC5 A;  3K57 A;  2Y4T A;  3AG2 C;  4CS3 A;  1K97 A;  1XMO B;  2CK3 G;  2QKS A;  4JI3 O;  2PUS A;  4PA7 A;  3X2Q B;  2NR5 A;  2OTJ V;  3N2K B;  3N2K A;  1YJ9 V;  4ZOL B;  4ZOL A;  2ZNJ A;  1EN6 A;  3B77 A;  1IZ3 A;  2Y4U A;  3OUS A;  1QR8 A;  2QM4 A;  2UUA O;  5H9C A;  1TUE B;  4PEL A;  4JI8 O;  4D7T A;  4U7N A;  4Z2W A;  3W7W A;  4KHP O;  5LMU B;  4PHZ A;  2EIN C;  3TET A;  2FYU H;  3SJQ C;  2HKO A;  5J2U B;  2XND G;  3RYI B;  5A9G A;  1R3L C;  3ABT A;  3RYI A;  2YXH A;  4OXS A;  2XOK G;  1Q81 W;  1SQX H;  1NBM G;  4MVS A;  5LGN A;  3FB8 C;  3P3N A;  3AG3 B;  1L0L H;  1FJG O;  2N04 A;  3JAS B;  2R9R B;  4PJ0 Z;  4WFB V;  2ITD C;  3NR7 A;  2PZS A;  4LFA B;  1GN4 A;  5IJ9 B;  5IJ9 A;  2HJD A;  3JAK B;  1SQP H;  3JAK A;  2IJK A;  2XAQ A;  1Q6H A;  1BZK A;  1O9H A;  1I5X A;  4DR7 B;  3WB2 A;  1K5S A;  4MVR A;  4CS2 A;  4J41 A;  2H8P C;  2QWO B;  4QIW F;  1IUR A;  4FIP C;  3DSQ A;  1D5A A;  4DUY O;  1B06 A;  1XL6 A;  1F51 A;  1NTZ H;  4MVM A;  1SS3 A;  3AK1 A;  3AK2 A;  1NKD A;  4JI4 O;  1IBM B;  3HR0 A;  3LSQ A;  1PL0 A;  4NTY A;  2OCC C;  3FB7 C;  3BA8 A;  1US6 A;  1N36 B;  1GM8 A;  1NR1 A;  3K5M A;  2YIB D;  3D3I A;  4W4L A;  3H1L H;  1NVP D;  1H5W A;  3VQY A;  3B8M A;  1YJN V;  4XDL A;  1EN4 A;  2WLI B;  2WLI A;  1SQV H;  2N74 A;  1PL4 A;  2Q73 A;  4UCR A;  1IX9 A;  2EZP A;  3K9S A;  2CE4 A;  4H0L B;  2Z5U A;  3CP1 A;  2LW1 A;  1M57 B;  1Y76 B;  4GX2 A;  1G8M A;  2OTL V;  3JYC A;  1V55 C;  4DYL A;  2HFE C;  2UXB O;  2ZCE A;  1H2L A;  3R66 A;  3BEH A;  2YC0 A;  1HNX O;  1F4M A;  2R9I A;  3KG2 A;  4FFB B;  4FFB A;  3UCS C;  4YHH B;  4D7S A;  1N0J A;  5JCO C;  4UVA A;  3UT5 B;  4GT1 A;  4LFC B;  3OE7 G;  3P32 A;  3ZMU A;  1SQG A;  4J7Z A;  2FML A;  4IGG A;  4LC1 A;  1M4U A;  3IC9 A;  4X8A A;  1HDJ A;  1S5H C;  4U3F H;  4UFZ A;  1VQL V;  4H37 A;  3ZX6 A;  1DGS A;  2UXN A;  4FLX A;  4JI7 B;  3CC2 V;  2AZ0 A;  1H2M A;  5H2F Z;  1THZ A;  2XAH A;  4LFB O;  5LXT B;  1LUV A;  5LXT A;  3VQW A;  3OFN G;  1NT2 B;  2Q7H A;  3K79 A;  4Q6G A;  1EZV H;  4JYC A;  2LGQ A;  3ASN B;  4MT8 A;  2IJH A;  1TA8 A;  1XMQ O;  4R8C A;  3ZHU A;  3EVK A;  1W2B U;  1P7G A;  4DV1 O;  4JZ2 A;  1N32 B;  3B4S A;  4DR5 B;  2UUB O;  3E86 A;  4JTC B;  4B3M O;  4JYA O;  1YSC A;  4RWU A;  2FL4 A;  3AG7 A;  3JD0 A;  4IIJ A;  4IIJ B;  2JGD A;  4DXW A;  1OZ0 A;  2Q69 A;  3SDL A;  1PNK A;  5JH7 B;  1BQ0 A;  3L70 H;  3FB5 C;  3CXC U;  2H3O A;  2YS8 A;  4IYI A;  1Q3E A;  5B5E Z;  4NKG B;  1IBK O;  2XUM A;  3GVM A;  3HKB B;  4CH3 A;  2UU9 O;  2IW5 A;  2BOB C;  2EIJ C;  5H5N A;  1BT8 A;  3W7T A;  1J5E B;  1X4T A;  3ABU A;  1FFT B;  4ASU G;  3MHS C;  1OCC B;  3WFV A;  4MVZ A;  4LNU B;  3TK1 A;  2JGU A;  4LNU A;  1DF5 A;  4RQF A;  1U96 A;  2QM7 A;  1M56 B;  3RWR D;  5CMU A;  1M1K W;  2OIE A;  2IM9 A;  3EFF K;  1JR9 A;  2JDI G;  2PI5 A;  2YI8 A;  3UQ8 A;  5HFL A;  3FD9 A;  4B3S O;  2OWO A;  2ZXW C;  2E3C A;  3CYO A;  1YEW A;  1XNR B;  4GKK B;  2HEP A;  2ZDI A;  2Q9L A;  3A0H Z;  4GKJ O;  5KAF Z;  4NXN O;  1G6U A;  1F4N A;  3QO8 A;  3OR7 C;  4MVQ A;  4DR1 B;  4FZ1 A;  1S0V A;  5L3G A;  4JV5 O;  2X6C A;  2H94 A;  2QWN B;  2YUA A;  1YDX A;  1V9P A;  4JF3 A;  3RN4 A;  1AR5 A;  1BSM A;  3ETD A;  3U11 A;  1CEZ A;  3E8B A;  5B1B B;  4JGS A;  4BWA A;  2JS5 A;  2P90 A;  2A0L A;  5AG2 A;  1MNG A;  4F6E A;  3NXS A;  4ZIB A;  2A06 H;  1I5Y A;  4JAU A;  4FM1 A;  2JRI A;  3RT3 C;  4DV6 B;  3K08 A;  1GH6 A;  3A0R A;  3E8G A;  3JCU Z;  2A9H A;  1BHB A;  4DV7 O;  1BQZ A;  1PKX A;  1Y6X A;  4X65 O;  1IDS A;  1ZLZ A;  1FXH A;  5L3C A;  3ZN1 A;  1VQ6 V;  1XRE A;  4X1K B;  4MTF A;  5IJ0 A;  1ROP A;  1GN3 A;  5DED A;  1YTF B;  2Q7G A;  1MG1 A;  3AG4 B;  2QE7 G;  4N23 A;  4KFM A;  1GM9 A;  3OMI B;  3DXR B;  1VQ8 V;  3DXR A;  4PA6 A;  1S72 V;  4YJ3 A;  4X62 B;  4B7K A;  1VAR A;  1P4R A;  2OIG A;  2YXL A;  3LNN A;  3ZS8 C;  4WF9 V;  4TV8 A;  5B1A B;  2V4D A;  3QG5 A;  2K1E A;  1HW7 A;  4R6Z A;  4GX5 A;  4DK1 A;  5E79 Z;  2VQE B;  2P4V A;  4JI0 B;  3SR2 C;  1JA8 A;  4TWK A;  3ZIA G;  2IBZ H;  2QWR B;  1VF6 A;  3D3Q A;  4LF8 O;  2BTO A;  1M9N A;  4MTO A;  5BMV B;  5BMV A;  4WFE A;  3JD3 A;  4I5S A;  4DR6 B;  3SPG A;  3BFR A;  2IJJ A;  1YJW V;  2JJ2 G;  2QWP B;  3HKD B;  3HKD A;  2ZE8 A;  3JAT B;  3JAT A;  4F4L A;  1FS0 G;  1P49 A;  3U10 A;  4KXR A;  3QO5 A;  2JJ1 G;  1OCR B;  1V54 B;  2X7R B;  2E5L B;  3ABL C;  2ZKO A;  3G67 A;  2ZR2 A;  2IU3 A;  3UKM A;  3LDC A;  4MTX A;  5BR8 B;  1KUQ A;  1XL4 A;  1IBL B;  1Q5O A;  4X1Y A;  1SC5 B;  1BGY H;  3SYC A;  1K9M W;  2EUL A;  4K35 A;  3ZMS A;  4JYB A;  4LWS B;  4LWS A;  1NTK H;  3EHB B;  3QO7 A;  3J81 N;  1PD3 A;  3OUF A;  3E35 A;  4HNA B;  4HNA A;  3C3S A;  5C8Y B;  2XAF A;  5C8Y A;  1N33 B;  3PN1 A;  1K92 A;  1NTM H;  4NXM B;  5JJJ B;  3K5O A;  1JNB A;  1EBO A;  3ZRX A;  2EZO A;  1WAZ A;  4J7J A;  5EK0 A;  2QGN A;  5B66 Z;  4DR3 B;  4O4J B;  4O4J A;  1NJI W;  4RO2 A;  1XNQ O;  4EFE A;  4FM0 A;  3T2M A;  5LL6 Y;  3L73 H;  5IDJ A;  2WLM A;  1ARO P;  2P7T C;  3ZED A;  3IJ4 A;  3SYA A;  3M8A A;  3ICX A;  4DV2 B;  1BL8 A;  4B08 A;  3FX7 A;  3IFX A;  1FXK B;  3RW0 A;  1FXK A;  2P06 A;  1KP3 A;  5KMG A;  4B3T O;  1MAB G;  4ZI7 B;  4ZI7 A;  5B3S B;  2M6Y A;  1WNS A;  4J80 A;  3L71 H;  2DWE C;  4PI2 A;  1TAE A;  3F7Y C;  3ASO C;  1K4C C;  2LP7 A;  2ZR3 A;  1S5J A;  1NU1 H;  4J7K A;  2LO1 A;  1VF5 B;  4PA9 A;  4GYC B;  5IE9 A;  1SET A;  1Y4M A;  3P3P A;  5LGT A;  4R50 A;  1XBL A;  2WA3 A;  3BRC A;  5IYD O;  3LDD A;  4CZZ A;  5D5P A;  1I0H A;  3ABK B;  2GTA A;  1WP8 A;  1B3Q A;  1MSD A;  2ODM A;  3ZMT A;  4O4L B;  2RDC A;  4O4L A;  1H2K A;  3ETE A;  4NB5 A;  3K3W A;  5IWA O;  3ZBH A;  2Q5Z A;  3QVN A;  5KHJ A;  4FVM A;  1PPJ H;  2DMX A;  4GLX A;  1EN5 A;  1KKC A;  3E89 A;  1YHQ V;  1G4Y B;  2AHZ A;  4JPR A;  3T1Y O;  2CGO A;  1QHT A;  4ZKI A;  5FPO A;  3S3W A;  2QDO A;  5IY5 B;  3G6E V;  1WB8 A;  1RPR A;  3ZRS A;  5CA1 B;  4DRX B;  5CA1 A;  4DRX A;  1CPY A;  3LDE A;  3K03 A;  1R3K C;  4MVO A;  3SJC C;  2F23 A;  3K0G A;  1VEW A;  1EM1 A;  1Q8I A;  4BW5 A;  2AW9 A;  3OEH G;  4P30 A;  4DUZ B;  5GTH Z;  2VWK A;  2LFS A;  3BY6 A;  4TSF G;  3CCR V;  5CBF A;  4WBN A;  4LBE C;  4DV0 B;  1R3I C;  5LP6 C;  1OCO C;  5TIS Z;  5H6Q A;  5KX5 B;  1ZUQ A;  4XBF A;  5KX5 A;  3RFR A;  1TVK A;  4CS4 A;  4EB6 B;  2EIK C;  4EB6 A;  1S3J A;  1SQB H;  1MZE A;  4YY3 O;  4DV4 B;  3AG1 C;  3QF7 A;  1FYJ A;  1RM1 B;  4NVP A;  4JI1 O;  1Q7Y W;  3CEI A;  4HZ3 A;  5L3E A;  1HR0 B;  3WG7 B;  5EBM C;  4IT5 A;  2F1M A;  2GHY A;  3O65 A;  2GBO A;  1KB9 F;  5B1N A;  4K8X A;  1B6Q A;  1SA0 B;  2WWW A;  1SA0 A;  5LGU A;  2EBO A;  1R1B A;  1WPB A;  3OGI B;  5LMN O;  1NR7 A;  4AHC A;  3HPL C;  1QVF U;  4J9Y B;  4LF4 B;  2QTO A;  1YIT V;  3X2Q C;  1KU9 A;  1HNZ O;  1OV9 A;  3CRC A;  4GUN A;  4KUM A;  3CX5 F;  2GTS A;  2ZM6 O;  5GTI Z;  4DR4 B;  3ZHS A;  1K33 A;  1QCE A;  1NH2 B;  1I94 O;  5BZB A;  1KQS U;  4CH5 A;  1WN7 A;  1DLB A;  3PJS K;  4ZHQ B;  4ZHQ A;  4DV5 B;  2CGN A;  1WLE A;  3SJB C;  2Y0P A;  2DYS B;  1EZJ A;  3CCL V;  4MS2 A;  3KDR A;  4QPJ A;  3UM7 A;  2X0L A;  2YIC A;  2ADP A;  1E79 G;  5L3B A;  4TQF A;  2E74 B;  3N27 A;  1HNW O;  3ZN0 A;  2UXC O;  3RYF B;  4IL6 Z;  3RYF A;  1XHX A;  1UFI A;  3AG3 C;  4DR2 B;  2R72 A;  5JVD A;  1R6T A;  1M93 A;  2ITC C;  1IJG A;  1W0K G;  1WA8 B;  1WA8 A;  3VQX A;  4I55 A;  4JI2 O;  4L87 A;  5DM6 V;  4AI8 A;  1JJ2 U;  2VQF O;  1L8D A;  5CBH A;  3H01 A;  2O57 A;  4LF5 B;  2QR4 A;  2WLL B;  2WLL A;  5LYJ A;  2W0X A;  3BAB A;  4GX1 A;  3T1H B;  4XDK A;  2HP8 A;  1R6K A;  5LHG A;  4UCS A;  2UXD B;  3RYC A;  3LSS A;  2LW7 A;  1MSW D;  1BS3 A;  2HHH B;  3OGC C;  1EFR G;  4ICG A;  4JYY A;  3CB2 A;  2VRZ A;  4UB8 Z;  4J10 A;  1ZAU A;  1HP8 A;  3OTO B;  1YF2 A;  4JZG A;  5KA5 A;  2BOC C;  3ABM B;  2Q7E A;  1VF7 A;  2IJI A;  1MOF A;  2WLJ A;  5KHH A;  4JI6 B;  3SPI A;  1S5L Z;  1WB7 A;  3H1I H;  1K4D C;  1AR4 A;  1QQC A;  5GON B;  1VQ4 V;  5GON A;  4LF7 B;  1AJQ A;  3STL C;  2RNB A;  4U3J B;  2D2C B;  4U3J A;  4I50 A;  4TT3 G;  1XHZ A;  3A8T A;  3UO2 A;  4UCV A;  3K5N A;  5IYZ B;  4K0K O;  5IYZ A;  4TQD A;  2EIM B;  1VQ7 V;  2WA4 A;  1BCC H;  1TUB A;  2P22 C;  4JI3 B; 
#chains in the Genus database with same CATH homology
 1EN5 A;  1KKC A;  1GN3 A;  1AVM A;  1BT8 A;  1AP6 A;  1XIL A;  1D5N A;  1AP5 A;  1GN6 A;  1WB8 A;  1GN4 A;  2P4K A;  1VAR A;  3AK3 A;  1SZX A;  2QKC A;  1VEW A;  1EM1 A;  2ADQ B;  2AW9 A;  4YIP A;  2CDY A;  3C3T A;  1QNM A;  1JR9 A;  1N0J A;  3OT7 A;  4YIO A;  4E4E A;  3LSU A;  3KKY A;  1PM9 A;  1JA8 A;  3DC5 A;  1ZUQ A;  1XDC A;  3IC9 A;  1ZTE A;  4FFK A;  3CEI A;  4C7U A;  3BFR A;  2RCV A;  1B06 A;  1Y67 A;  1LUV A;  1BS3 A;  3RN4 A;  1AR5 A;  1BSM A;  2GDS A;  4JYY A;  3AK1 A;  3AK2 A;  1IXB A;  1I08 A;  4X9Q A;  5AG2 A;  1MNG A;  3EVK A;  4F6E A;  1P7G A;  1MMM A;  4JZ2 A;  4JZG A;  1EN6 A;  4GUN A;  1N0N A;  1GN2 A;  3DC6 A;  4BR6 A;  1WB7 A;  1I0H A;  1AR4 A;  1MA1 A;  1MSD A;  1EN4 A;  3MDS A;  1IDS A;  1ZLZ A;  1ZSP A;  1PL4 A;  2QKA A;  1IX9 A;  1XRE A;  3K9S A;  2CE4 A;  3QVN A;  3KDR A;  5A9G A;  1LUW A;  3TJT A;  2ADP A;  3C3S A;  1XUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...