2GDWA

Solution structure of the b. brevis tycc3-pcp in a/h-state
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/transport protein
molecule keywords Tyrocidine synthetase III
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdwA00
2FHSC 1F80D 2K0XA 2N5IA 2LIWA 2N50A 2JU2A 5HVCA 2FVFA 5HV8A 1DNYA 3RG2A 1L0HA 1HY8A 2FVAA 2XZ0D 2FADA 3CE7A 4IZ6A 2CG5B 5KP7B 2FQ0A 2GDYA 2JQ4A 2MY5A 1NQ4A 4H2YC 2JGPA 1OR5A 1AF8A 1DV5A 2N6ZA 2X2BA 3EJDA 2KG8A 2L9FA 4H2XC 2K0YA 4NEOA 5KP8B 2FQ2A 2MVUA 2L22A 2LOLA 2N6YA 1HQBA 2LL8A 2PNGA 2LKIA 2CQ8A 2KGDA 2XZ1C 4PWVB 2AFEA 2M5RA 2N98A 4HKGA 2LPKA 3EJEA 4MRTC 2KW2A 2LIUA 3NY7B 4PXHB 2KORA 2VSQA 4H2WC 2FAEA 2JU1A 2K2QA 1VKUA 2AVAA 2KWLA 2K92A 2FVEA 2MR7A 2EHTA 2MF4A 2K93A 2KOOA 2MD9A 3GZMA 1KLPA 2N5HA 2AF8A 2GDXA 2FACA 2CGQA 2KG6A 1T8KA 1ACPA 2DNWA 2KR5A 2KOPA 2ROQA 5EJDA 2MVVA 5KP6B 2LTEA 3LMOA 2L4BA 4CA3A 2KGAA 2MR8A 2AFDA 2GDWA 2QNWA 2KGCA 3GZLA 1X3OA 3EJBA 2CNRA 4BPGA 4R0MA 5CZDB 4BPHA 4BPFA 1L0IA 2K94A 2KG9A 2EHSA 2KOQA 2FQ1A 2KOSA 2L0QA 4DG9A 2KGEA 2LMLA
chains in the Genus database with same CATH superfamily
2EG5A 4U0EA 1KQSO 2JU2A 5HVCA 1Q86Q 1DNYA 3RG2A 1Z6MA 3I55P 1HY8A 2FVAA 3OW2O 1JJ2O 2GDYA 3RG6C 3G0VA 3G1GA 1VQ4P 1ZNVA 1DV5A 2N6ZA 2CWOA 2X2BA 3EJDA 4NEOA 2FQ2A 2N6YA 2PNGA 3G26A 1EMVA 2Z46A 2EIAA 1QVGO 1D1DA 2JB0A 2VLNA 1IMPA 2GZIA 1K9MQ 2GZGA 5HGMA 3NY7B 4PXHB 2KORA 4H2WC 2BUOA 2FAEA 2PENA 1S72P 3CCQP 3G28A 5BS1A 3CC7P 2K93A 4PH1A 3H0DA 1K8AQ 1GXHA 5DCKA 1EIAA 4PH0A 2AF8A 1FR2A 2JYGA 2JO0A 3CCVP 2L6EA 2MVVA 5BS2A 1Q81Q 2PEMA 5F2NA 2KGAA 1X3OA 4R0MA 4QKOA 5CZDB 2K0DX 4U0AA 1K30A 2ERHA 2EHSA 1F80D 2K0XA 1AYIA 2GYKA 4XFXA 3U43A 3H4EA 2NO8A 5KP7B 2JQ4A 3GKLC 1AF8A 3G1IA 1IMQA 2KG8A 4H2XC 4QNBA 2MVUA 1NJIQ 1HQBA 2LKIA 2OARA 1QRJA 1N8RQ 3P05A 2AFEA 1VQLP 2LPKA 4MRTC 1Q82Q 2LIUA 2GZEA 1QVFO 2M8PA 2GZJA 2K2QA 2AVAA 2MF4A 1VQMP 2KOOA 7CEIA 3M1MA 3HZQA 2M8NA 4COPA 1M6NA 1KD1Q 2CGQA 2KR5A 2KOPA 1GPJA 5EJDA 1UNKA 1GXGA 4COCA 1BAJA 2E1MA 2AFDA 2QNWA 2KGCA 3GZLA 1EOQA 3EJBA 4BPHA 1E0HA 3HYBA 3LRYA 2KG9A 1BXIA 3NTEA 1ZMBA 3DTJA 2KGEA 2EFJA 5F2KA 2XT1A 2LIWA 1VQ6P 2FVFA 5HV8A 3DS2A 2DGYA 2FADA 3CE7A 3CCJP 2MY5A 1NQ4A 5F2OA 5HGLA 2JGPA 2VLOA 2KODA 1OR5A 2ONTA 1YIJP 1K73Q 2JBGA 2L9FA 5KP8B 1IUQA 1VQ5P 2L22A 1RO2A 5JPAA 1RO0A 2KGDA 2PEQA 1VQOP 3B5IA 3CC2P 2N98A 2QA4P 2PEJA 1A43A 3DS3A 3H47A 4XROA 3EJEA 2KW2A 5HGNA 1YJ9P 2VSQA 4U0CA 4GR2A 1RNIA 1VKUA 1M1KQ 2FVEA 2MR7A 1YJWP 2PEIA 1VQ7P 2MD9A 3DPHA 2GDXA 1VQ9P 4GR6A 4F37A 3CCUP 2Z44A 3CXCO 1VQPP 2KG6A 1T8KA 1ACPA 2DNWA 1YI2P 3MGEA 5I4TG 5KP6B 2BHVA 4UHPB 2L4BA 4WYMA 3G29A 1A8OA 4BPGA 2JYLA 1W2BO 3G6EP 4BPFA 2Z45A 1VHNA 1M74A 2FQ1A 2KOQA 1AUMA 1M90Q 2WPTA 2LMLA 2FHSC 4XFZA 2N5IA 2M8LA 2N50A 1VQNP 1L0HA 3CCEP 2XZ0D 1MZ8A 2QEXP 1Q7YQ 4IZ6A 2GZFA 2CG5B 2FQ0A 4U0FA 1YHQP 3CMAP 4H2YC 1KC8Q 3DS5A 3CC4P 4XFYA 2OTLP 2K0YA 2XV6A 3CCMP 2LOLA 2LL8A 1E6JP 2CQ8A 2XZ1C 3CCLP 4PWVB 2M5RA 1CEIA 4HKGA 3DS4A 2P9XA 3Q20A 3G4SP 2JU1A 2KWLA 2K92A 2VLQA 3E2DA 2EHTA 2XXMA 3CD6P 3DS0A 3I56P 3G71P 3GZMA 1KLPA 1YJNP 2N5HA 3CCSP 4M0IA 3WBHA 2FACA 3G21A 1VQKP 2K5XA 4U0BA 3B4QA 3GJNA 2ROQA 2PY8A 4XRQA 2LTEA 3LMOA 1M6EX 3CPWO 3CMEP 4CA3A 2MR8A 2GDWA 4IPYA 3DS1A 4U0DA 1UJZA 1VQ8P 3CCRP 2CNRA 2VLPA 2JAZA 3VRLC 1YITP 1L0IA 2PEOA 2K94A 2PEKA 2OTJP 5EW5E 2LF4A 5HGOA 2KOSA 2L0QA 4DG9A
chains in the Genus database with same CATH topology
2FHSC 1F80D 2K0XA 2N5IA 2LIWA 2N50A 2JU2A 5HVCA 2FVFA 5HV8A 1DNYA 3RG2A 1L0HA 1HY8A 2FVAA 2XZ0D 2FADA 3CE7A 4IZ6A 2CG5B 5KP7B 2FQ0A 2GDYA 2JQ4A 2MY5A 1NQ4A 4H2YC 2JGPA 1OR5A 1AF8A 1DV5A 2N6ZA 2X2BA 3EJDA 2KG8A 2L9FA 4H2XC 2K0YA 4NEOA 5KP8B 2FQ2A 2MVUA 2L22A 2LOLA 2N6YA 1HQBA 2LL8A 2PNGA 2LKIA 2CQ8A 2KGDA 2XZ1C 4PWVB 2AFEA 2M5RA 2N98A 4HKGA 2LPKA 3EJEA 4MRTC 2KW2A 2LIUA 3NY7B 4PXHB 2KORA 2VSQA 4H2WC 2FAEA 2JU1A 2K2QA 1VKUA 2AVAA 2KWLA 2K92A 2FVEA 2MR7A 2EHTA 2MF4A 2K93A 2KOOA 2MD9A 3GZMA 1KLPA 2N5HA 2AF8A 2GDXA 2FACA 2CGQA 2KG6A 1T8KA 1ACPA 2DNWA 2KR5A 2KOPA 2ROQA 5EJDA 2MVVA 5KP6B 2LTEA 3LMOA 2L4BA 4CA3A 2KGAA 2MR8A 2AFDA 2GDWA 2QNWA 2KGCA 3GZLA 1X3OA 3EJBA 2CNRA 4BPGA 4R0MA 5CZDB 4BPHA 4BPFA 1L0IA 2K94A 2KG9A 2EHSA 2KOQA 2FQ1A 2KOSA 2L0QA 4DG9A 2KGEA 2LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHS C;  1F80 D;  2K0X A;  2N5I A;  2LIW A;  2N50 A;  2JU2 A;  5HVC A;  2FVF A;  5HV8 A;  1DNY A;  3RG2 A;  1L0H A;  1HY8 A;  2FVA A;  2XZ0 D;  2FAD A;  3CE7 A;  4IZ6 A;  2CG5 B;  5KP7 B;  2FQ0 A;  2GDY A;  2JQ4 A;  2MY5 A;  1NQ4 A;  4H2Y C;  2JGP A;  1OR5 A;  1AF8 A;  1DV5 A;  2N6Z A;  2X2B A;  3EJD A;  2KG8 A;  2L9F A;  4H2X C;  2K0Y A;  4NEO A;  5KP8 B;  2FQ2 A;  2MVU A;  2L22 A;  2LOL A;  2N6Y A;  1HQB A;  2LL8 A;  2PNG A;  2LKI A;  2CQ8 A;  2KGD A;  2XZ1 C;  4PWV B;  2AFE A;  2M5R A;  2N98 A;  4HKG A;  2LPK A;  3EJE A;  4MRT C;  2KW2 A;  2LIU A;  3NY7 B;  4PXH B;  2KOR A;  2VSQ A;  4H2W C;  2FAE A;  2JU1 A;  2K2Q A;  1VKU A;  2AVA A;  2KWL A;  2K92 A;  2FVE A;  2MR7 A;  2EHT A;  2MF4 A;  2K93 A;  2KOO A;  2MD9 A;  3GZM A;  1KLP A;  2N5H A;  2AF8 A;  2GDX A;  2FAC A;  2CGQ A;  2KG6 A;  1T8K A;  1ACP A;  2DNW A;  2KR5 A;  2KOP A;  2ROQ A;  5EJD A;  2MVV A;  5KP6 B;  2LTE A;  3LMO A;  2L4B A;  4CA3 A;  2KGA A;  2MR8 A;  2AFD A;  2GDW A;  2QNW A;  2KGC A;  3GZL A;  1X3O A;  3EJB A;  2CNR A;  4BPG A;  4R0M A;  5CZD B;  4BPH A;  4BPF A;  1L0I A;  2K94 A;  2KG9 A;  2EHS A;  2KOQ A;  2FQ1 A;  2KOS A;  2L0Q A;  4DG9 A;  2KGE A;  2LML A; 
#chains in the Genus database with same CATH topology
 2EG5 A;  4U0E A;  1KQS O;  2JU2 A;  5HVC A;  1Q86 Q;  1DNY A;  3RG2 A;  1Z6M A;  3I55 P;  1HY8 A;  2FVA A;  3OW2 O;  1JJ2 O;  2GDY A;  3RG6 C;  3G0V A;  3G1G A;  1VQ4 P;  1ZNV A;  1DV5 A;  2N6Z A;  2CWO A;  2X2B A;  3EJD A;  4NEO A;  2FQ2 A;  2N6Y A;  2PNG A;  3G26 A;  1EMV A;  2Z46 A;  2EIA A;  1QVG O;  1D1D A;  2JB0 A;  2VLN A;  1IMP A;  2GZI A;  1K9M Q;  2GZG A;  5HGM A;  3NY7 B;  4PXH B;  2KOR A;  4H2W C;  2BUO A;  2FAE A;  2PEN A;  1S72 P;  3CCQ P;  3G28 A;  5BS1 A;  3CC7 P;  2K93 A;  4PH1 A;  3H0D A;  1K8A Q;  1GXH A;  5DCK A;  1EIA A;  4PH0 A;  2AF8 A;  1FR2 A;  2JYG A;  2JO0 A;  3CCV P;  2L6E A;  2MVV A;  5BS2 A;  1Q81 Q;  2PEM A;  5F2N A;  2KGA A;  1X3O A;  4R0M A;  4QKO A;  5CZD B;  2K0D X;  4U0A A;  1K30 A;  2ERH A;  2EHS A;  1F80 D;  2K0X A;  1AYI A;  2GYK A;  4XFX A;  3U43 A;  3H4E A;  2NO8 A;  5KP7 B;  2JQ4 A;  3GKL C;  1AF8 A;  3G1I A;  1IMQ A;  2KG8 A;  4H2X C;  4QNB A;  2MVU A;  1NJI Q;  1HQB A;  2LKI A;  2OAR A;  1QRJ A;  1N8R Q;  3P05 A;  2AFE A;  1VQL P;  2LPK A;  4MRT C;  1Q82 Q;  2LIU A;  2GZE A;  1QVF O;  2M8P A;  2GZJ A;  2K2Q A;  2AVA A;  2MF4 A;  1VQM P;  2KOO A;  7CEI A;  3M1M A;  3HZQ A;  2M8N A;  4COP A;  1M6N A;  1KD1 Q;  2CGQ A;  2KR5 A;  2KOP A;  1GPJ A;  5EJD A;  1UNK A;  1GXG A;  4COC A;  1BAJ A;  2E1M A;  2AFD A;  2QNW A;  2KGC A;  3GZL A;  1EOQ A;  3EJB A;  4BPH A;  1E0H A;  3HYB A;  3LRY A;  2KG9 A;  1BXI A;  3NTE A;  1ZMB A;  3DTJ A;  2KGE A;  2EFJ A;  5F2K A;  2XT1 A;  2LIW A;  1VQ6 P;  2FVF A;  5HV8 A;  3DS2 A;  2DGY A;  2FAD A;  3CE7 A;  3CCJ P;  2MY5 A;  1NQ4 A;  5F2O A;  5HGL A;  2JGP A;  2VLO A;  2KOD A;  1OR5 A;  2ONT A;  1YIJ P;  1K73 Q;  2JBG A;  2L9F A;  5KP8 B;  1IUQ A;  1VQ5 P;  2L22 A;  1RO2 A;  5JPA A;  1RO0 A;  2KGD A;  2PEQ A;  1VQO P;  3B5I A;  3CC2 P;  2N98 A;  2QA4 P;  2PEJ A;  1A43 A;  3DS3 A;  3H47 A;  4XRO A;  3EJE A;  2KW2 A;  5HGN A;  1YJ9 P;  2VSQ A;  4U0C A;  4GR2 A;  1RNI A;  1VKU A;  1M1K Q;  2FVE A;  2MR7 A;  1YJW P;  2PEI A;  1VQ7 P;  2MD9 A;  3DPH A;  2GDX A;  1VQ9 P;  4GR6 A;  4F37 A;  3CCU P;  2Z44 A;  3CXC O;  1VQP P;  2KG6 A;  1T8K A;  1ACP A;  2DNW A;  1YI2 P;  3MGE A;  5I4T G;  5KP6 B;  2BHV A;  4UHP B;  2L4B A;  4WYM A;  3G29 A;  1A8O A;  4BPG A;  2JYL A;  1W2B O;  3G6E P;  4BPF A;  2Z45 A;  1VHN A;  1M74 A;  2FQ1 A;  2KOQ A;  1AUM A;  1M90 Q;  2WPT A;  2LML A;  2FHS C;  4XFZ A;  2N5I A;  2M8L A;  2N50 A;  1VQN P;  1L0H A;  3CCE P;  2XZ0 D;  1MZ8 A;  2QEX P;  1Q7Y Q;  4IZ6 A;  2GZF A;  2CG5 B;  2FQ0 A;  4U0F A;  1YHQ P;  3CMA P;  4H2Y C;  1KC8 Q;  3DS5 A;  3CC4 P;  4XFY A;  2OTL P;  2K0Y A;  2XV6 A;  3CCM P;  2LOL A;  2LL8 A;  1E6J P;  2CQ8 A;  2XZ1 C;  3CCL P;  4PWV B;  2M5R A;  1CEI A;  4HKG A;  3DS4 A;  2P9X A;  3Q20 A;  3G4S P;  2JU1 A;  2KWL A;  2K92 A;  2VLQ A;  3E2D A;  2EHT A;  2XXM A;  3CD6 P;  3DS0 A;  3I56 P;  3G71 P;  3GZM A;  1KLP A;  1YJN P;  2N5H A;  3CCS P;  4M0I A;  3WBH A;  2FAC A;  3G21 A;  1VQK P;  2K5X A;  4U0B A;  3B4Q A;  3GJN A;  2ROQ A;  2PY8 A;  4XRQ A;  2LTE A;  3LMO A;  1M6E X;  3CPW O;  3CME P;  4CA3 A;  2MR8 A;  2GDW A;  4IPY A;  3DS1 A;  4U0D A;  1UJZ A;  1VQ8 P;  3CCR P;  2CNR A;  2VLP A;  2JAZ A;  3VRL C;  1YIT P;  1L0I A;  2PEO A;  2K94 A;  2PEK A;  2OTJ P;  5EW5 E;  2LF4 A;  5HGO A;  2KOS A;  2L0Q A;  4DG9 A; 
#chains in the Genus database with same CATH homology
 2FHS C;  1F80 D;  2K0X A;  2N5I A;  2LIW A;  2N50 A;  2JU2 A;  5HVC A;  2FVF A;  5HV8 A;  1DNY A;  3RG2 A;  1L0H A;  1HY8 A;  2FVA A;  2XZ0 D;  2FAD A;  3CE7 A;  4IZ6 A;  2CG5 B;  5KP7 B;  2FQ0 A;  2GDY A;  2JQ4 A;  2MY5 A;  1NQ4 A;  4H2Y C;  2JGP A;  1OR5 A;  1AF8 A;  1DV5 A;  2N6Z A;  2X2B A;  3EJD A;  2KG8 A;  2L9F A;  4H2X C;  2K0Y A;  4NEO A;  5KP8 B;  2FQ2 A;  2MVU A;  2L22 A;  2LOL A;  2N6Y A;  1HQB A;  2LL8 A;  2PNG A;  2LKI A;  2CQ8 A;  2KGD A;  2XZ1 C;  4PWV B;  2AFE A;  2M5R A;  2N98 A;  4HKG A;  2LPK A;  3EJE A;  4MRT C;  2KW2 A;  2LIU A;  3NY7 B;  4PXH B;  2KOR A;  2VSQ A;  4H2W C;  2FAE A;  2JU1 A;  2K2Q A;  1VKU A;  2AVA A;  2KWL A;  2K92 A;  2FVE A;  2MR7 A;  2EHT A;  2MF4 A;  2K93 A;  2KOO A;  2MD9 A;  3GZM A;  1KLP A;  2N5H A;  2AF8 A;  2GDX A;  2FAC A;  2CGQ A;  2KG6 A;  1T8K A;  1ACP A;  2DNW A;  2KR5 A;  2KOP A;  2ROQ A;  5EJD A;  2MVV A;  5KP6 B;  2LTE A;  3LMO A;  2L4B A;  4CA3 A;  2KGA A;  2MR8 A;  2AFD A;  2GDW A;  2QNW A;  2KGC A;  3GZL A;  1X3O A;  3EJB A;  2CNR A;  4BPG A;  4R0M A;  5CZD B;  4BPH A;  4BPF A;  1L0I A;  2K94 A;  2KG9 A;  2EHS A;  2KOQ A;  2FQ1 A;  2KOS A;  2L0Q A;  4DG9 A;  2KGE A;  2LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...