2GDWA

Solution structure of the b. brevis tycc3-pcp in a/h-state
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthetase III
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/transport protein
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdwA00
2AVAA 5CZDB 2N5HA 2K0YA 5KP7B 2EHSA 2PNGA 5KP8B 3GZLA 4H2WC 2CQ8A 2KOSA 2L0QA 2KGDA 2KOPA 2LOLA 2AF8A 4NEOA 2KWLA 2XZ1C 2LIUA 2FVEA 4IZ6A 2GDXA 2N98A 2KG9A 2MF4A 2X2BA 2JU2A 2AFEA 2K2QA 2FVAA 2K0XA 1HY8A 4H2YC 2K93A 2N6ZA 4PXHB 2L4BA 4HKGA 3GZMA 2FHSC 2CG5B 2KR5A 2JQ4A 2GDYA 5HVCA 1L0HA 2FACA 2KOOA 2LKIA 1OR5A 2KGAA 4PWVB 3EJEA 5KP6B 2MR8A 3LMOA 2AFDA 2JGPA 2N5IA 2KG8A 1AF8A 1DNYA 2KOQA 2N6YA 1KLPA 2CNRA 4CA3A 2K94A 2KGEA 2LMLA 2N50A 2XZ0D 4H2XC 1X3OA 2KGCA 2MR7A 2MVVA 2FADA 5EJDA 2MVUA 2JU1A 2M5RA 1NQ4A 2FQ2A 1HQBA 2ROQA 2L9FA 2FAEA 2MD9A 2LPKA 3EJBA 2LIWA 3EJDA 5HV8A 3RG2A 2KORA 2LTEA 1VKUA 1F80D 2KW2A 4MRTC 2L22A 2EHTA 4R0MA 2LL8A 4BPHA 1ACPA 1T8KA 2FQ1A 2K92A 2DNWA 1DV5A 2VSQA 3NY7B 2CGQA 3CE7A 4BPFA 1L0IA 2FVFA 2MY5A 2KG6A 4DG9A 2QNWA 4BPGA 2GDWA 2FQ0A
chains in the Genus database with same CATH superfamily
1KC8Q 1M1KQ 2K0YA 5KP7B 4U0CA 1AUMA 2PNGA 1KD1Q 5KP8B 1YITP 4XFXA 2BHVA 2PEQA 4QKOA 1K8AQ 2GYKA 2AF8A 4NEOA 4GR2A 2FVEA 2XV6A 3NTEA 2N98A 2X2BA 4M0IA 2K2QA 2M8PA 1MZ8A 1VQLP 2FHSC 2GDYA 3DS3A 2FACA 3U43A 2KGAA 1E0HA 3G21A 2KG8A 1ZMBA 5F2KA 2CNRA 1VQOP 1IUQA 2DGYA 1QVGO 4H2XC 2PEIA 2Z44A 2WPTA 2FADA 1RO2A 2OTLP 1VQPP 2MVUA 2JU1A 1Q86Q 3OW2O 4WYMA 3CCMP 2L9FA 3CXCO 2OARA 5F2OA 1ZNVA 2KORA 2EFJA 1IMQA 3G0VA 2L6EA 3CPWO 2JYGA 1M90Q 3CMEP 1DV5A 1EIAA 2VSQA 3NY7B 1GXGA 4DG9A 3DS5A 2QNWA 2CWOA 3GJNA 5HGNA 2AVAA 4U0FA 5CZDB 4COCA 3DS4A 1VQMP 2EHSA 4PH1A 2ERHA 3LRYA 2ONTA 2CQ8A 3H0DA 5JPAA 2KWLA 3VRLC 1GPJA 1N8RQ 1VQ9P 1VQ6P 3P05A 1K30A 2GDXA 2XXMA 4XFYA 3Q20A 2PEKA 4U0DA 2EG5A 2K93A 4PXHB 2JO0A 1D1DA 2CG5B 2KR5A 3HZQA 1JJ2O 2JQ4A 5HVCA 4PWVB 5BS2A 3EJEA 1BXIA 3CMAP 2KOQA 2N6YA 2QEXP 1Q82Q 2QA4P 1YJNP 3B4QA 1M6NA 4XROA 2PEOA 2N50A 1X3OA 2KGCA 2MR7A 4XFZA 4GR6A 2M5RA 2FQ2A 3CC4P 2ROQA 3G71P 2MD9A 1VHNA 3EJDA 3CCJP 3RG2A 1VKUA 1YIJP 3CCVP 2KW2A 1W2BO 5EW5E 5HGMA 2FQ1A 3CCUP 2DNWA 1FR2A 2CGQA 3CE7A 3G6EP 2MY5A 2GDWA 1EMVA 2BUOA 2N5HA 3DS2A 3I55P 2VLNA 1VQNP 1Q7YQ 2L0QA 2KGDA 2KOPA 4F37A 2LOLA 3GKLC 1K9MQ 3CCQP 2XT1A 2M8LA 2XZ1C 3DTJA 2LIUA 3G28A 2NO8A 1VQ4P 2E1MA 3CCLP 2MF4A 3G1IA 2VLQA 2JU2A 1A43A 1IMPA 2FVAA 2N6ZA 1YJWP 4U0AA 5I4TG 1M74A 3H4EA 3RG6C 2K5XA 3DPHA 2GZGA 1L0HA 2LKIA 1OR5A 2GZJA 1VQKP 2MR8A 1GXHA 1Q81Q 3LMOA 2AFDA 1DNYA 2OTJP 1S72P 1KLPA 3DS1A 4UHPB 1QRJA 1A8OA 3G29A 1RNIA 2EIAA 2KGEA 2JYLA 2M8NA 1VQ5P 2MVVA 2PENA 2GZIA 1NQ4A 4QNBA 2KODA 2VLOA 3G1GA 2FAEA 2LPKA 3CC7P 3I56P 2LF4A 2LTEA 3CCEP 1F80D 2EHTA 4R0MA 2LL8A 1T8KA 1Z6MA 2K92A 4U0BA 3H47A 5F2NA 2GZFA 3DS0A 1L0IA 2KG6A 4BPGA 1YI2P 2FQ0A 1VQ7P 1YJ9P 3GZLA 4H2WC 4U0EA 2KOSA 1BAJA 3G26A 1AYIA 4IZ6A 1QVFO 2KG9A 1YHQP 3CCRP 2PEJA 2AFEA 2K0XA 1HY8A 4H2YC 4XRQA 2L4BA 4HKGA 3GZMA 1KQSO 5DCKA 3G4SP 7CEIA 2KOOA 3MGEA 2VLPA 1K73Q 5KP6B 3CC2P 2P9XA 2JGPA 2N5IA 1AF8A 2JBGA 3E2DA 3B5IA 5HGOA 4CA3A 5HGLA 2K94A 2JB0A 2LMLA 3M1MA 1E6JP 3HYBA 2XZ0D 1CEIA 5EJDA 4PH0A 2K0DX 2PEMA 1HQBA 3CCSP 3EJBA 2LIWA 5HV8A 2JAZA 2PY8A 4MRTC 1UNKA 2L22A 2Z46A 4COPA 4BPHA 3CD6P 1ACPA 2GZEA 1RO0A 1EOQA 1NJIQ 1M6EX 5BS1A 1UJZA 1VQ8P 4IPYA 3WBHA 4BPFA 2FVFA 2Z45A
chains in the Genus database with same CATH topology
2AVAA 5CZDB 2N5HA 2K0YA 5KP7B 2EHSA 2PNGA 5KP8B 3GZLA 4H2WC 2CQ8A 2KOSA 2L0QA 2KGDA 2KOPA 2LOLA 2AF8A 4NEOA 2KWLA 2XZ1C 2LIUA 2FVEA 4IZ6A 2GDXA 2N98A 2KG9A 2MF4A 2X2BA 2JU2A 2AFEA 2K2QA 2FVAA 2K0XA 1HY8A 4H2YC 2K93A 2N6ZA 4PXHB 2L4BA 4HKGA 3GZMA 2FHSC 2CG5B 2KR5A 2JQ4A 2GDYA 5HVCA 1L0HA 2FACA 2KOOA 2LKIA 1OR5A 2KGAA 4PWVB 3EJEA 5KP6B 2MR8A 3LMOA 2AFDA 2JGPA 2N5IA 2KG8A 1AF8A 1DNYA 2KOQA 2N6YA 1KLPA 2CNRA 4CA3A 2K94A 2KGEA 2LMLA 2N50A 2XZ0D 4H2XC 1X3OA 2KGCA 2MR7A 2MVVA 2FADA 5EJDA 2MVUA 2JU1A 2M5RA 1NQ4A 2FQ2A 1HQBA 2ROQA 2L9FA 2FAEA 2MD9A 2LPKA 3EJBA 2LIWA 3EJDA 5HV8A 3RG2A 2KORA 2LTEA 1VKUA 1F80D 2KW2A 4MRTC 2L22A 2EHTA 4R0MA 2LL8A 4BPHA 1ACPA 1T8KA 2FQ1A 2K92A 2DNWA 1DV5A 2VSQA 3NY7B 2CGQA 3CE7A 4BPFA 1L0IA 2FVFA 2MY5A 2KG6A 4DG9A 2QNWA 4BPGA 2GDWA 2FQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVA A;  5CZD B;  2N5H A;  2K0Y A;  5KP7 B;  2EHS A;  2PNG A;  5KP8 B;  3GZL A;  4H2W C;  2CQ8 A;  2KOS A;  2L0Q A;  2KGD A;  2KOP A;  2LOL A;  2AF8 A;  4NEO A;  2KWL A;  2XZ1 C;  2LIU A;  2FVE A;  4IZ6 A;  2GDX A;  2N98 A;  2KG9 A;  2MF4 A;  2X2B A;  2JU2 A;  2AFE A;  2K2Q A;  2FVA A;  2K0X A;  1HY8 A;  4H2Y C;  2K93 A;  2N6Z A;  4PXH B;  2L4B A;  4HKG A;  3GZM A;  2FHS C;  2CG5 B;  2KR5 A;  2JQ4 A;  2GDY A;  5HVC A;  1L0H A;  2FAC A;  2KOO A;  2LKI A;  1OR5 A;  2KGA A;  4PWV B;  3EJE A;  5KP6 B;  2MR8 A;  3LMO A;  2AFD A;  2JGP A;  2N5I A;  2KG8 A;  1AF8 A;  1DNY A;  2KOQ A;  2N6Y A;  1KLP A;  2CNR A;  4CA3 A;  2K94 A;  2KGE A;  2LML A;  2N50 A;  2XZ0 D;  4H2X C;  1X3O A;  2KGC A;  2MR7 A;  2MVV A;  2FAD A;  5EJD A;  2MVU A;  2JU1 A;  2M5R A;  1NQ4 A;  2FQ2 A;  1HQB A;  2ROQ A;  2L9F A;  2FAE A;  2MD9 A;  2LPK A;  3EJB A;  2LIW A;  3EJD A;  5HV8 A;  3RG2 A;  2KOR A;  2LTE A;  1VKU A;  1F80 D;  2KW2 A;  4MRT C;  2L22 A;  2EHT A;  4R0M A;  2LL8 A;  4BPH A;  1ACP A;  1T8K A;  2FQ1 A;  2K92 A;  2DNW A;  1DV5 A;  2VSQ A;  3NY7 B;  2CGQ A;  3CE7 A;  4BPF A;  1L0I A;  2FVF A;  2MY5 A;  2KG6 A;  4DG9 A;  2QNW A;  4BPG A;  2GDW A;  2FQ0 A; 
#chains in the Genus database with same CATH topology
 1KC8 Q;  1M1K Q;  2K0Y A;  5KP7 B;  4U0C A;  1AUM A;  2PNG A;  1KD1 Q;  5KP8 B;  1YIT P;  4XFX A;  2BHV A;  2PEQ A;  4QKO A;  1K8A Q;  2GYK A;  2AF8 A;  4NEO A;  4GR2 A;  2FVE A;  2XV6 A;  3NTE A;  2N98 A;  2X2B A;  4M0I A;  2K2Q A;  2M8P A;  1MZ8 A;  1VQL P;  2FHS C;  2GDY A;  3DS3 A;  2FAC A;  3U43 A;  2KGA A;  1E0H A;  3G21 A;  2KG8 A;  1ZMB A;  5F2K A;  2CNR A;  1VQO P;  1IUQ A;  2DGY A;  1QVG O;  4H2X C;  2PEI A;  2Z44 A;  2WPT A;  2FAD A;  1RO2 A;  2OTL P;  1VQP P;  2MVU A;  2JU1 A;  1Q86 Q;  3OW2 O;  4WYM A;  3CCM P;  2L9F A;  3CXC O;  2OAR A;  5F2O A;  1ZNV A;  2KOR A;  2EFJ A;  1IMQ A;  3G0V A;  2L6E A;  3CPW O;  2JYG A;  1M90 Q;  3CME P;  1DV5 A;  1EIA A;  2VSQ A;  3NY7 B;  1GXG A;  4DG9 A;  3DS5 A;  2QNW A;  2CWO A;  3GJN A;  5HGN A;  2AVA A;  4U0F A;  5CZD B;  4COC A;  3DS4 A;  1VQM P;  2EHS A;  4PH1 A;  2ERH A;  3LRY A;  2ONT A;  2CQ8 A;  3H0D A;  5JPA A;  2KWL A;  3VRL C;  1GPJ A;  1N8R Q;  1VQ9 P;  1VQ6 P;  3P05 A;  1K30 A;  2GDX A;  2XXM A;  4XFY A;  3Q20 A;  2PEK A;  4U0D A;  2EG5 A;  2K93 A;  4PXH B;  2JO0 A;  1D1D A;  2CG5 B;  2KR5 A;  3HZQ A;  1JJ2 O;  2JQ4 A;  5HVC A;  4PWV B;  5BS2 A;  3EJE A;  1BXI A;  3CMA P;  2KOQ A;  2N6Y A;  2QEX P;  1Q82 Q;  2QA4 P;  1YJN P;  3B4Q A;  1M6N A;  4XRO A;  2PEO A;  2N50 A;  1X3O A;  2KGC A;  2MR7 A;  4XFZ A;  4GR6 A;  2M5R A;  2FQ2 A;  3CC4 P;  2ROQ A;  3G71 P;  2MD9 A;  1VHN A;  3EJD A;  3CCJ P;  3RG2 A;  1VKU A;  1YIJ P;  3CCV P;  2KW2 A;  1W2B O;  5EW5 E;  5HGM A;  2FQ1 A;  3CCU P;  2DNW A;  1FR2 A;  2CGQ A;  3CE7 A;  3G6E P;  2MY5 A;  2GDW A;  1EMV A;  2BUO A;  2N5H A;  3DS2 A;  3I55 P;  2VLN A;  1VQN P;  1Q7Y Q;  2L0Q A;  2KGD A;  2KOP A;  4F37 A;  2LOL A;  3GKL C;  1K9M Q;  3CCQ P;  2XT1 A;  2M8L A;  2XZ1 C;  3DTJ A;  2LIU A;  3G28 A;  2NO8 A;  1VQ4 P;  2E1M A;  3CCL P;  2MF4 A;  3G1I A;  2VLQ A;  2JU2 A;  1A43 A;  1IMP A;  2FVA A;  2N6Z A;  1YJW P;  4U0A A;  5I4T G;  1M74 A;  3H4E A;  3RG6 C;  2K5X A;  3DPH A;  2GZG A;  1L0H A;  2LKI A;  1OR5 A;  2GZJ A;  1VQK P;  2MR8 A;  1GXH A;  1Q81 Q;  3LMO A;  2AFD A;  1DNY A;  2OTJ P;  1S72 P;  1KLP A;  3DS1 A;  4UHP B;  1QRJ A;  1A8O A;  3G29 A;  1RNI A;  2EIA A;  2KGE A;  2JYL A;  2M8N A;  1VQ5 P;  2MVV A;  2PEN A;  2GZI A;  1NQ4 A;  4QNB A;  2KOD A;  2VLO A;  3G1G A;  2FAE A;  2LPK A;  3CC7 P;  3I56 P;  2LF4 A;  2LTE A;  3CCE P;  1F80 D;  2EHT A;  4R0M A;  2LL8 A;  1T8K A;  1Z6M A;  2K92 A;  4U0B A;  3H47 A;  5F2N A;  2GZF A;  3DS0 A;  1L0I A;  2KG6 A;  4BPG A;  1YI2 P;  2FQ0 A;  1VQ7 P;  1YJ9 P;  3GZL A;  4H2W C;  4U0E A;  2KOS A;  1BAJ A;  3G26 A;  1AYI A;  4IZ6 A;  1QVF O;  2KG9 A;  1YHQ P;  3CCR P;  2PEJ A;  2AFE A;  2K0X A;  1HY8 A;  4H2Y C;  4XRQ A;  2L4B A;  4HKG A;  3GZM A;  1KQS O;  5DCK A;  3G4S P;  7CEI A;  2KOO A;  3MGE A;  2VLP A;  1K73 Q;  5KP6 B;  3CC2 P;  2P9X A;  2JGP A;  2N5I A;  1AF8 A;  2JBG A;  3E2D A;  3B5I A;  5HGO A;  4CA3 A;  5HGL A;  2K94 A;  2JB0 A;  2LML A;  3M1M A;  1E6J P;  3HYB A;  2XZ0 D;  1CEI A;  5EJD A;  4PH0 A;  2K0D X;  2PEM A;  1HQB A;  3CCS P;  3EJB A;  2LIW A;  5HV8 A;  2JAZ A;  2PY8 A;  4MRT C;  1UNK A;  2L22 A;  2Z46 A;  4COP A;  4BPH A;  3CD6 P;  1ACP A;  2GZE A;  1RO0 A;  1EOQ A;  1NJI Q;  1M6E X;  5BS1 A;  1UJZ A;  1VQ8 P;  4IPY A;  3WBH A;  4BPF A;  2FVF A;  2Z45 A; 
#chains in the Genus database with same CATH homology
 2AVA A;  5CZD B;  2N5H A;  2K0Y A;  5KP7 B;  2EHS A;  2PNG A;  5KP8 B;  3GZL A;  4H2W C;  2CQ8 A;  2KOS A;  2L0Q A;  2KGD A;  2KOP A;  2LOL A;  2AF8 A;  4NEO A;  2KWL A;  2XZ1 C;  2LIU A;  2FVE A;  4IZ6 A;  2GDX A;  2N98 A;  2KG9 A;  2MF4 A;  2X2B A;  2JU2 A;  2AFE A;  2K2Q A;  2FVA A;  2K0X A;  1HY8 A;  4H2Y C;  2K93 A;  2N6Z A;  4PXH B;  2L4B A;  4HKG A;  3GZM A;  2FHS C;  2CG5 B;  2KR5 A;  2JQ4 A;  2GDY A;  5HVC A;  1L0H A;  2FAC A;  2KOO A;  2LKI A;  1OR5 A;  2KGA A;  4PWV B;  3EJE A;  5KP6 B;  2MR8 A;  3LMO A;  2AFD A;  2JGP A;  2N5I A;  2KG8 A;  1AF8 A;  1DNY A;  2KOQ A;  2N6Y A;  1KLP A;  2CNR A;  4CA3 A;  2K94 A;  2KGE A;  2LML A;  2N50 A;  2XZ0 D;  4H2X C;  1X3O A;  2KGC A;  2MR7 A;  2MVV A;  2FAD A;  5EJD A;  2MVU A;  2JU1 A;  2M5R A;  1NQ4 A;  2FQ2 A;  1HQB A;  2ROQ A;  2L9F A;  2FAE A;  2MD9 A;  2LPK A;  3EJB A;  2LIW A;  3EJD A;  5HV8 A;  3RG2 A;  2KOR A;  2LTE A;  1VKU A;  1F80 D;  2KW2 A;  4MRT C;  2L22 A;  2EHT A;  4R0M A;  2LL8 A;  4BPH A;  1ACP A;  1T8K A;  2FQ1 A;  2K92 A;  2DNW A;  1DV5 A;  2VSQ A;  3NY7 B;  2CGQ A;  3CE7 A;  4BPF A;  1L0I A;  2FVF A;  2MY5 A;  2KG6 A;  4DG9 A;  2QNW A;  4BPG A;  2GDW A;  2FQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...