2GDWA

Solution structure of the b. brevis tycc3-pcp in a/h-state
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
b'MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthetase III
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/transport protein
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdwA00
1F80D 2AFDA 4MRTC 2CGQA 4IZ6A 2L9FA 1DNYA 2KORA 4H2XC 2KG6A 4NEOA 2K0XA 5HVCA 5EJDA 1L0HA 2FVFA 4BPGA 2QNWA 2KW2A 2KGEA 3GZLA 2LIWA 1KLPA 3EJBA 5KP6B 2MVUA 5CZDB 2KG9A 1L0IA 2PNGA 2K2QA 2X2BA 4CA3A 2FACA 2K93A 2LKIA 2KGAA 2JU1A 2MD9A 4H2YC 1AF8A 2CNRA 4DG9A 2LTEA 2N50A 2MF4A 2N5IA 2JQ4A 4BPFA 3LMOA 2KGDA 2MY5A 2AVAA 2JU2A 2KR5A 2FQ1A 2LPKA 4PXHB 2AF8A 2DNWA 2XZ1C 2FVAA 2GDXA 2FVEA 1X3OA 1T8KA 2AFEA 2KOQA 4HKGA 2GDWA 2MR7A 2N98A 2FQ0A 2MVVA 2XZ0D 4H2WC 3RG2A 4BPHA 2JGPA 1HY8A 2CQ8A 3EJEA 2N5HA 5HV8A 2EHSA 2LIUA 1HQBA 4R0MA 2FADA 1ACPA 2KOSA 2K94A 3CE7A 3EJDA 2K92A 5KP7B 2N6ZA 2FQ2A 2LMLA 2L22A 2LL8A 4PWVB 2FHSC 3GZMA 2KOOA 2L4BA 2K0YA 2GDYA 2ROQA 2CG5B 2LOLA 1NQ4A 2MR8A 2FAEA 2N6YA 2KOPA 2KWLA 1VKUA 2M5RA 3NY7B 1DV5A 2KG8A 5KP8B 2L0QA 2KGCA 1OR5A 2EHTA 2VSQA
chains in the Genus database with same CATH superfamily
2AFDA 2CGQA 5JPAA 3CCMP 2L9FA 1VQ6P 2KORA 3CC7P 4NEOA 1VQNP 2EFJA 5EJDA 4XFYA 1L0HA 3DS0A 2EG5A 3GZLA 4F37A 2LIWA 1A8OA 1YJNP 1KLPA 2DGYA 3EJBA 2MVUA 1N8RQ 1KQSO 4U0DA 3G1GA 2X2BA 2FACA 2XV6A 5BS2A 1M90Q 2LKIA 1QVFO 1EOQA 2GZFA 3H47A 1GXHA 4DG9A 4QNBA 2QA4P 1VQ9P 5F2NA 2JQ4A 4U0BA 3NTEA 4BPFA 3G0VA 2JU2A 4PXHB 2KR5A 2AF8A 2GZIA 2FVEA 1X3OA 3CXCO 2VLNA 2FQ0A 1EMVA 1HY8A 4GR2A 2N5HA 1Q82Q 2LIUA 3RG6C 1IMQA 1NJIQ 1YITP 1VQ7P 3G26A 2K94A 3EJDA 4M0IA 5KP7B 2LMLA 2FHSC 7CEIA 2ERHA 1UNKA 1RNIA 2CG5B 2LOLA 1NQ4A 4IPYA 2FAEA 1Q7YQ 1VKUA 2EHTA 2VSQA 1K30A 1IMPA 3G71P 3CPWO 1M6NA 3HYBA 4H2XC 2JBGA 1JJ2O 1M74A 2JB0A 1M6EX 3G4SP 2PY8A 1KC8Q 2VLQA 1M1KQ 5CZDB 2KG9A 1L0IA 3P05A 2K2QA 2WPTA 3GKLC 2KGAA 4H2YC 1S72P 2PEJA 3CCQP 1YJ9P 3DS2A 2N50A 1VHNA 4GR6A 2N5IA 2PEQA 3CC4P 1YIJP 1K9MQ 1GXGA 2NO8A 3CCJP 2AVAA 1FR2A 2LPKA 2XZ1C 2FVAA 2ONTA 1K73Q 1T8KA 2PENA 2AFEA 4HKGA 2GDWA 2MR7A 5F2OA 2XZ0D 3RG2A 1K8AQ 5HGNA 3CCSP 2CQ8A 2GYKA 5EW5E 2VLOA 2M8PA 3G6EP 1ACPA 2Z46A 3CCEP 5F2KA 2N6ZA 2L22A 1E0HA 2LL8A 4PWVB 2L4BA 3VRLC 2PEOA 1RO2A 2GDYA 3B5IA 1QVGO 1RO0A 2N6YA 2M5RA 5HGLA 3DS5A 2KG8A 5KP8B 3CD6P 1YHQP 4R0MA 1MZ8A 1F80D 4UHPB 2OARA 3G29A 4COPA 2KG6A 5HVCA 2M8LA 2PEIA 4BPGA 2QNWA 3CCUP 4XFXA 1D1DA 2KW2A 2KGEA 2K0DX 2L6EA 3GJNA 1Z6MA 3CMEP 3MGEA 2JU1A 2MD9A 1AF8A 2CNRA 2LTEA 3HZQA 1YI2P 3LMOA 2K5XA 4WYMA 2FQ1A 3M1MA 2DNWA 1ZNVA 4PH1A 2GDXA 2GZJA 1VQ8P 2PEKA 1IUQA 2KOQA 2N98A 3Q20A 4BPHA 3EJEA 3WBHA 1UJZA 3DS3A 3B4QA 2JYGA 2EHSA 1GPJA 2FADA 1VQ4P 2JAZA 2Z45A 1E6JP 3G1IA 2KOSA 2M8NA 5DCKA 3CE7A 3DPHA 2K92A 3CCLP 1AUMA 3GZMA 2XXMA 4XRQA 2K0YA 2BHVA 2E1MA 3H0DA 2GZEA 2ROQA 5HGMA 2OTJP 2MR8A 3CCVP 3DS1A 4U0FA 3DS4A 1DV5A 3CC2P 3NY7B 2L0QA 2MY5A 3G21A 4MRTC 4IZ6A 2Z44A 1DNYA 3G28A 2EIAA 2K0XA 4XROA 2FVFA 2VLPA 5I4TG 2QEXP 1BXIA 5KP6B 2GZGA 2JO0A 1ZMBA 2PNGA 4CA3A 2K93A 2PEMA 2JYLA 2P9XA 1AYIA 2XT1A 1A43A 3CCRP 2MF4A 1CEIA 1VQOP 2KGDA 1VQKP 3OW2O 3CMAP 4U0CA 3LRYA 1Q81Q 1BAJA 2KODA 3H4EA 2LF4A 2MVVA 4H2WC 1VQLP 2JGPA 2CWOA 5HV8A 2BUOA 4COCA 1HQBA 1W2BO 1QRJA 2OTLP 1YJWP 3I55P 4XFZA 1VQPP 3E2DA 2FQ2A 4U0EA 1Q86Q 5HGOA 2KOOA 4U0AA 5BS1A 1VQ5P 1KD1Q 1VQMP 3I56P 3U43A 2KOPA 1EIAA 2KWLA 2KGCA 4PH0A 4QKOA 1OR5A 3DTJA
chains in the Genus database with same CATH topology
1F80D 2AFDA 4MRTC 2CGQA 4IZ6A 2L9FA 1DNYA 2KORA 4H2XC 2KG6A 4NEOA 2K0XA 5HVCA 5EJDA 1L0HA 2FVFA 4BPGA 2QNWA 2KW2A 2KGEA 3GZLA 2LIWA 1KLPA 3EJBA 5KP6B 2MVUA 5CZDB 2KG9A 1L0IA 2PNGA 2K2QA 2X2BA 4CA3A 2FACA 2K93A 2LKIA 2KGAA 2JU1A 2MD9A 4H2YC 1AF8A 2CNRA 4DG9A 2LTEA 2N50A 2MF4A 2N5IA 2JQ4A 4BPFA 3LMOA 2KGDA 2MY5A 2AVAA 2JU2A 2KR5A 2FQ1A 2LPKA 4PXHB 2AF8A 2DNWA 2XZ1C 2FVAA 2GDXA 2FVEA 1X3OA 1T8KA 2AFEA 2KOQA 4HKGA 2GDWA 2MR7A 2N98A 2FQ0A 2MVVA 2XZ0D 4H2WC 3RG2A 4BPHA 2JGPA 1HY8A 2CQ8A 3EJEA 2N5HA 5HV8A 2EHSA 2LIUA 1HQBA 4R0MA 2FADA 1ACPA 2KOSA 2K94A 3CE7A 3EJDA 2K92A 5KP7B 2N6ZA 2FQ2A 2LMLA 2L22A 2LL8A 4PWVB 2FHSC 3GZMA 2KOOA 2L4BA 2K0YA 2GDYA 2ROQA 2CG5B 2LOLA 1NQ4A 2MR8A 2FAEA 2N6YA 2KOPA 2KWLA 1VKUA 2M5RA 3NY7B 1DV5A 2KG8A 5KP8B 2L0QA 2KGCA 1OR5A 2EHTA 2VSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F80 D;  2AFD A;  4MRT C;  2CGQ A;  4IZ6 A;  2L9F A;  1DNY A;  2KOR A;  4H2X C;  2KG6 A;  4NEO A;  2K0X A;  5HVC A;  5EJD A;  1L0H A;  2FVF A;  4BPG A;  2QNW A;  2KW2 A;  2KGE A;  3GZL A;  2LIW A;  1KLP A;  3EJB A;  5KP6 B;  2MVU A;  5CZD B;  2KG9 A;  1L0I A;  2PNG A;  2K2Q A;  2X2B A;  4CA3 A;  2FAC A;  2K93 A;  2LKI A;  2KGA A;  2JU1 A;  2MD9 A;  4H2Y C;  1AF8 A;  2CNR A;  4DG9 A;  2LTE A;  2N50 A;  2MF4 A;  2N5I A;  2JQ4 A;  4BPF A;  3LMO A;  2KGD A;  2MY5 A;  2AVA A;  2JU2 A;  2KR5 A;  2FQ1 A;  2LPK A;  4PXH B;  2AF8 A;  2DNW A;  2XZ1 C;  2FVA A;  2GDX A;  2FVE A;  1X3O A;  1T8K A;  2AFE A;  2KOQ A;  4HKG A;  2GDW A;  2MR7 A;  2N98 A;  2FQ0 A;  2MVV A;  2XZ0 D;  4H2W C;  3RG2 A;  4BPH A;  2JGP A;  1HY8 A;  2CQ8 A;  3EJE A;  2N5H A;  5HV8 A;  2EHS A;  2LIU A;  1HQB A;  4R0M A;  2FAD A;  1ACP A;  2KOS A;  2K94 A;  3CE7 A;  3EJD A;  2K92 A;  5KP7 B;  2N6Z A;  2FQ2 A;  2LML A;  2L22 A;  2LL8 A;  4PWV B;  2FHS C;  3GZM A;  2KOO A;  2L4B A;  2K0Y A;  2GDY A;  2ROQ A;  2CG5 B;  2LOL A;  1NQ4 A;  2MR8 A;  2FAE A;  2N6Y A;  2KOP A;  2KWL A;  1VKU A;  2M5R A;  3NY7 B;  1DV5 A;  2KG8 A;  5KP8 B;  2L0Q A;  2KGC A;  1OR5 A;  2EHT A;  2VSQ A; 
#chains in the Genus database with same CATH topology
 2AFD A;  2CGQ A;  5JPA A;  3CCM P;  2L9F A;  1VQ6 P;  2KOR A;  3CC7 P;  4NEO A;  1VQN P;  2EFJ A;  5EJD A;  4XFY A;  1L0H A;  3DS0 A;  2EG5 A;  3GZL A;  4F37 A;  2LIW A;  1A8O A;  1YJN P;  1KLP A;  2DGY A;  3EJB A;  2MVU A;  1N8R Q;  1KQS O;  4U0D A;  3G1G A;  2X2B A;  2FAC A;  2XV6 A;  5BS2 A;  1M90 Q;  2LKI A;  1QVF O;  1EOQ A;  2GZF A;  3H47 A;  1GXH A;  4DG9 A;  4QNB A;  2QA4 P;  1VQ9 P;  5F2N A;  2JQ4 A;  4U0B A;  3NTE A;  4BPF A;  3G0V A;  2JU2 A;  4PXH B;  2KR5 A;  2AF8 A;  2GZI A;  2FVE A;  1X3O A;  3CXC O;  2VLN A;  2FQ0 A;  1EMV A;  1HY8 A;  4GR2 A;  2N5H A;  1Q82 Q;  2LIU A;  3RG6 C;  1IMQ A;  1NJI Q;  1YIT P;  1VQ7 P;  3G26 A;  2K94 A;  3EJD A;  4M0I A;  5KP7 B;  2LML A;  2FHS C;  7CEI A;  2ERH A;  1UNK A;  1RNI A;  2CG5 B;  2LOL A;  1NQ4 A;  4IPY A;  2FAE A;  1Q7Y Q;  1VKU A;  2EHT A;  2VSQ A;  1K30 A;  1IMP A;  3G71 P;  3CPW O;  1M6N A;  3HYB A;  4H2X C;  2JBG A;  1JJ2 O;  1M74 A;  2JB0 A;  1M6E X;  3G4S P;  2PY8 A;  1KC8 Q;  2VLQ A;  1M1K Q;  5CZD B;  2KG9 A;  1L0I A;  3P05 A;  2K2Q A;  2WPT A;  3GKL C;  2KGA A;  4H2Y C;  1S72 P;  2PEJ A;  3CCQ P;  1YJ9 P;  3DS2 A;  2N50 A;  1VHN A;  4GR6 A;  2N5I A;  2PEQ A;  3CC4 P;  1YIJ P;  1K9M Q;  1GXG A;  2NO8 A;  3CCJ P;  2AVA A;  1FR2 A;  2LPK A;  2XZ1 C;  2FVA A;  2ONT A;  1K73 Q;  1T8K A;  2PEN A;  2AFE A;  4HKG A;  2GDW A;  2MR7 A;  5F2O A;  2XZ0 D;  3RG2 A;  1K8A Q;  5HGN A;  3CCS P;  2CQ8 A;  2GYK A;  5EW5 E;  2VLO A;  2M8P A;  3G6E P;  1ACP A;  2Z46 A;  3CCE P;  5F2K A;  2N6Z A;  2L22 A;  1E0H A;  2LL8 A;  4PWV B;  2L4B A;  3VRL C;  2PEO A;  1RO2 A;  2GDY A;  3B5I A;  1QVG O;  1RO0 A;  2N6Y A;  2M5R A;  5HGL A;  3DS5 A;  2KG8 A;  5KP8 B;  3CD6 P;  1YHQ P;  4R0M A;  1MZ8 A;  1F80 D;  4UHP B;  2OAR A;  3G29 A;  4COP A;  2KG6 A;  5HVC A;  2M8L A;  2PEI A;  4BPG A;  2QNW A;  3CCU P;  4XFX A;  1D1D A;  2KW2 A;  2KGE A;  2K0D X;  2L6E A;  3GJN A;  1Z6M A;  3CME P;  3MGE A;  2JU1 A;  2MD9 A;  1AF8 A;  2CNR A;  2LTE A;  3HZQ A;  1YI2 P;  3LMO A;  2K5X A;  4WYM A;  2FQ1 A;  3M1M A;  2DNW A;  1ZNV A;  4PH1 A;  2GDX A;  2GZJ A;  1VQ8 P;  2PEK A;  1IUQ A;  2KOQ A;  2N98 A;  3Q20 A;  4BPH A;  3EJE A;  3WBH A;  1UJZ A;  3DS3 A;  3B4Q A;  2JYG A;  2EHS A;  1GPJ A;  2FAD A;  1VQ4 P;  2JAZ A;  2Z45 A;  1E6J P;  3G1I A;  2KOS A;  2M8N A;  5DCK A;  3CE7 A;  3DPH A;  2K92 A;  3CCL P;  1AUM A;  3GZM A;  2XXM A;  4XRQ A;  2K0Y A;  2BHV A;  2E1M A;  3H0D A;  2GZE A;  2ROQ A;  5HGM A;  2OTJ P;  2MR8 A;  3CCV P;  3DS1 A;  4U0F A;  3DS4 A;  1DV5 A;  3CC2 P;  3NY7 B;  2L0Q A;  2MY5 A;  3G21 A;  4MRT C;  4IZ6 A;  2Z44 A;  1DNY A;  3G28 A;  2EIA A;  2K0X A;  4XRO A;  2FVF A;  2VLP A;  5I4T G;  2QEX P;  1BXI A;  5KP6 B;  2GZG A;  2JO0 A;  1ZMB A;  2PNG A;  4CA3 A;  2K93 A;  2PEM A;  2JYL A;  2P9X A;  1AYI A;  2XT1 A;  1A43 A;  3CCR P;  2MF4 A;  1CEI A;  1VQO P;  2KGD A;  1VQK P;  3OW2 O;  3CMA P;  4U0C A;  3LRY A;  1Q81 Q;  1BAJ A;  2KOD A;  3H4E A;  2LF4 A;  2MVV A;  4H2W C;  1VQL P;  2JGP A;  2CWO A;  5HV8 A;  2BUO A;  4COC A;  1HQB A;  1W2B O;  1QRJ A;  2OTL P;  1YJW P;  3I55 P;  4XFZ A;  1VQP P;  3E2D A;  2FQ2 A;  4U0E A;  1Q86 Q;  5HGO A;  2KOO A;  4U0A A;  5BS1 A;  1VQ5 P;  1KD1 Q;  1VQM P;  3I56 P;  3U43 A;  2KOP A;  1EIA A;  2KWL A;  2KGC A;  4PH0 A;  4QKO A;  1OR5 A;  3DTJ A; 
#chains in the Genus database with same CATH homology
 1F80 D;  2AFD A;  4MRT C;  2CGQ A;  4IZ6 A;  2L9F A;  1DNY A;  2KOR A;  4H2X C;  2KG6 A;  4NEO A;  2K0X A;  5HVC A;  5EJD A;  1L0H A;  2FVF A;  4BPG A;  2QNW A;  2KW2 A;  2KGE A;  3GZL A;  2LIW A;  1KLP A;  3EJB A;  5KP6 B;  2MVU A;  5CZD B;  2KG9 A;  1L0I A;  2PNG A;  2K2Q A;  2X2B A;  4CA3 A;  2FAC A;  2K93 A;  2LKI A;  2KGA A;  2JU1 A;  2MD9 A;  4H2Y C;  1AF8 A;  2CNR A;  4DG9 A;  2LTE A;  2N50 A;  2MF4 A;  2N5I A;  2JQ4 A;  4BPF A;  3LMO A;  2KGD A;  2MY5 A;  2AVA A;  2JU2 A;  2KR5 A;  2FQ1 A;  2LPK A;  4PXH B;  2AF8 A;  2DNW A;  2XZ1 C;  2FVA A;  2GDX A;  2FVE A;  1X3O A;  1T8K A;  2AFE A;  2KOQ A;  4HKG A;  2GDW A;  2MR7 A;  2N98 A;  2FQ0 A;  2MVV A;  2XZ0 D;  4H2W C;  3RG2 A;  4BPH A;  2JGP A;  1HY8 A;  2CQ8 A;  3EJE A;  2N5H A;  5HV8 A;  2EHS A;  2LIU A;  1HQB A;  4R0M A;  2FAD A;  1ACP A;  2KOS A;  2K94 A;  3CE7 A;  3EJD A;  2K92 A;  5KP7 B;  2N6Z A;  2FQ2 A;  2LML A;  2L22 A;  2LL8 A;  4PWV B;  2FHS C;  3GZM A;  2KOO A;  2L4B A;  2K0Y A;  2GDY A;  2ROQ A;  2CG5 B;  2LOL A;  1NQ4 A;  2MR8 A;  2FAE A;  2N6Y A;  2KOP A;  2KWL A;  1VKU A;  2M5R A;  3NY7 B;  1DV5 A;  2KG8 A;  5KP8 B;  2L0Q A;  2KGC A;  1OR5 A;  2EHT A;  2VSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...