2GDWA

Solution structure of the b. brevis tycc3-pcp in a/h-state
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/transport protein
molecule keywords Tyrocidine synthetase III
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdwA00
2DNWA 2MR8A 2LOLA 3EJEA 2JQ4A 2CNRA 1HY8A 2EHTA 2N5HA 2N6ZA 1AF8A 1HQBA 1L0IA 2XZ0D 4CA3A 5EJDA 5CZDB 5KP6B 3LMOA 2FVFA 2LMLA 2N50A 4BPGA 2JU1A 2GDYA 2AFEA 2FQ2A 2FVEA 2KG6A 1L0HA 4H2WC 2CGQA 4PXHB 4R0MA 4BPFA 2FQ0A 1T8KA 2MY5A 2KOPA 2KG9A 3GZMA 1NQ4A 1DNYA 2K94A 2M5RA 2MVVA 2AF8A 4H2YC 2KGDA 2ROQA 1OR5A 3EJBA 3RG2A 4H2XC 2XZ1C 4BPHA 2KR5A 2FAEA 2MF4A 2GDWA 2KOSA 4DG9A 1KLPA 2JGPA 2KGEA 2FADA 4IZ6A 2L22A 2FVAA 2KOOA 3EJDA 2L0QA 4MRTC 2JU2A 2LIUA 2LTEA 2N6YA 5HVCA 3NY7B 2MD9A 1F80D 2LL8A 2KW2A 2CG5B 4HKGA 2FQ1A 2KOQA 2L9FA 3CE7A 2VSQA 4PWVB 2KG8A 2MVUA 2K0YA 2KORA 1VKUA 5HV8A 4NEOA 2K92A 2FHSC 2AFDA 2QNWA 2KGCA 2FACA 2LIWA 2GDXA 2KGAA 5KP8B 2LPKA 2MR7A 3GZLA 2KWLA 5KP7B 2K0XA 2AVAA 1ACPA 1DV5A 1X3OA 2N5IA 2K93A 2CQ8A 2EHSA 2X2BA 2K2QA 2N98A 2L4BA 2LKIA 2PNGA
chains in the Genus database with same CATH superfamily
1D1DA 3G26A 2CNRA 1HY8A 2N5HA 1VQ9P 1YIJP 1AF8A 1M6EX 1HQBA 2JAZA 1L0IA 4CA3A 5F2NA 4IPYA 2PEJA 5F2OA 3G1IA 3G29A 4XFXA 2AFEA 2FVEA 2JBGA 2KG6A 4PXHB 2OTJP 2PEQA 1GPJA 2GZIA 3G71P 2MVVA 4H2YC 2L6EA 2KGDA 2ROQA 1OR5A 5BS1A 3EJBA 5HGLA 2XZ1C 5JPAA 2FAEA 2Z45A 1E6JP 2KOSA 4DG9A 2JYLA 2JGPA 1IUQA 3CCRP 3B5IA 2KOOA 2PEKA 2OTLP 1IMQA 2LTEA 3DPHA 3NY7B 3DS4A 1F80D 4XFZA 3CCLP 3LRYA 2JO0A 1BAJA 1K8AQ 2VSQA 2KG8A 3Q20A 2XT1A 1VKUA 1AYIA 2ERHA 4COCA 1S72P 2KGAA 2LIWA 3CCJP 3I55P 3G21A 1EIAA 1KQSO 2LPKA 3GZLA 2AVAA 2CWOA 5EW5E 2OARA 1N8RQ 1VQKP 1JJ2O 2K93A 2Z44A 2K2QA 2JB0A 3CCVP 3CC2P 2DNWA 2MR8A 4GR6A 5I4TG 3RG6C 2LOLA 2ONTA 3OW2O 4GR2A 2DGYA 5CZDB 3LMOA 1KD1Q 2EIAA 2NO8A 2K5XA 1M1KQ 2EG5A 2CGQA 2Z46A 4R0MA 2FQ0A 2KOPA 2KG9A 1NQ4A 1VQ7P 2K94A 3DS1A 5HGOA 2AF8A 4PH0A 2M8NA 3RG2A 1RO0A 2KODA 3CC4P 1ZMBA 4H2XC 3GKLC 1Q81Q 2GDWA 1Q82Q 3MGEA 1KLPA 2KGEA 1YHQP 2FVAA 2PEMA 4XROA 3DTJA 4MRTC 1NJIQ 2LIUA 2N6YA 3VRLC 2MD9A 2KW2A 2FQ1A 2KOQA 4PWVB 2E1MA 4NEOA 2AFDA 2QNWA 3HYBA 1CEIA 2BUOA 2KGCA 2GDXA 1VQLP 1UNKA 3G1GA 2MR7A 1M6NA 4F37A 1DV5A 1X3OA 2N5IA 4QNBA 2EHSA 2N98A 2L4BA 4XFYA 1IMPA 3G4SP 1VQPP 1K30A 3EJEA 2JQ4A 1GXGA 2EHTA 2P9XA 3CPWO 1A43A 1VQ4P 2FVFA 2N50A 4BPGA 4U0EA 1ZNVA 2GDYA 1BXIA 2FQ2A 3CC7P 5DCKA 4WYMA 4BPFA 2MY5A 2GZJA 3GZMA 4U0BA 1DNYA 2M8LA 2M5RA 2BHVA 2K0DX 3NTEA 3HZQA 1VQ5P 2LF4A 2QEXP 2PENA 5HGMA 4BPHA 4XRQA 2GYKA 2WPTA 2PEIA 3P05A 1YITP 1AUMA 3DS5A 2FADA 1YJ9P 1VQOP 4IZ6A 2VLPA 1K9MQ 3EJDA 2XV6A 2L0QA 1RO2A 2JU2A 3H47A 3CCMP 3H4EA 2LL8A 1EMVA 4HKGA 2L9FA 1M74A 2M8PA 3CCEP 3CE7A 1VQNP 1UJZA 2MVUA 2K0YA 2KORA 2EFJA 1Z6MA 7CEIA 2FHSC 2K92A 4U0CA 1M90Q 2FACA 2VLNA 3U43A 2QA4P 3DS0A 2PY8A 5KP8B 4QKOA 3GJNA 1EOQA 2KWLA 1Q86Q 1ACPA 1KC8Q 2VLOA 3DS3A 3CMEP 2X2BA 3M1MA 1VQMP 1Q7YQ 3CCUP 1FR2A 1YI2P 2LKIA 2PNGA 1MZ8A 3CCQP 4UHPB 3DS2A 2VLQA 3CCSP 4U0FA 3H0DA 2N6ZA 3CD6P 1E0HA 2XZ0D 5EJDA 5KP6B 1QVGO 2LMLA 1W2BO 4COPA 2JU1A 3CMAP 2JYGA 1L0HA 4H2WC 3G28A 1QRJA 1T8KA 2GZFA 2GZGA 1A8OA 2PEOA 2KR5A 2GZEA 2MF4A 1VQ8P 1GXHA 2L22A 3CXCO 3WBHA 5HVCA 2CG5B 1YJNP 5HGNA 1K73Q 3I56P 5F2KA 4U0AA 3B4QA 4PH1A 1RNIA 5HV8A 3G6EP 4U0DA 3G0VA 1VHNA 1YJWP 5BS2A 1VQ6P 5KP7B 2K0XA 4M0IA 2CQ8A 2XXMA 1QVFO 3E2DA
chains in the Genus database with same CATH topology
2DNWA 2MR8A 2LOLA 3EJEA 2JQ4A 2CNRA 1HY8A 2EHTA 2N5HA 2N6ZA 1AF8A 1HQBA 1L0IA 2XZ0D 4CA3A 5EJDA 5CZDB 5KP6B 3LMOA 2FVFA 2LMLA 2N50A 4BPGA 2JU1A 2GDYA 2AFEA 2FQ2A 2FVEA 2KG6A 1L0HA 4H2WC 2CGQA 4PXHB 4R0MA 4BPFA 2FQ0A 1T8KA 2MY5A 2KOPA 2KG9A 3GZMA 1NQ4A 1DNYA 2K94A 2M5RA 2MVVA 2AF8A 4H2YC 2KGDA 2ROQA 1OR5A 3EJBA 3RG2A 4H2XC 2XZ1C 4BPHA 2KR5A 2FAEA 2MF4A 2GDWA 2KOSA 4DG9A 1KLPA 2JGPA 2KGEA 2FADA 4IZ6A 2L22A 2FVAA 2KOOA 3EJDA 2L0QA 4MRTC 2JU2A 2LIUA 2LTEA 2N6YA 5HVCA 3NY7B 2MD9A 1F80D 2LL8A 2KW2A 2CG5B 4HKGA 2FQ1A 2KOQA 2L9FA 3CE7A 2VSQA 4PWVB 2KG8A 2MVUA 2K0YA 2KORA 1VKUA 5HV8A 4NEOA 2K92A 2FHSC 2AFDA 2QNWA 2KGCA 2FACA 2LIWA 2GDXA 2KGAA 5KP8B 2LPKA 2MR7A 3GZLA 2KWLA 5KP7B 2K0XA 2AVAA 1ACPA 1DV5A 1X3OA 2N5IA 2K93A 2CQ8A 2EHSA 2X2BA 2K2QA 2N98A 2L4BA 2LKIA 2PNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNW A;  2MR8 A;  2LOL A;  3EJE A;  2JQ4 A;  2CNR A;  1HY8 A;  2EHT A;  2N5H A;  2N6Z A;  1AF8 A;  1HQB A;  1L0I A;  2XZ0 D;  4CA3 A;  5EJD A;  5CZD B;  5KP6 B;  3LMO A;  2FVF A;  2LML A;  2N50 A;  4BPG A;  2JU1 A;  2GDY A;  2AFE A;  2FQ2 A;  2FVE A;  2KG6 A;  1L0H A;  4H2W C;  2CGQ A;  4PXH B;  4R0M A;  4BPF A;  2FQ0 A;  1T8K A;  2MY5 A;  2KOP A;  2KG9 A;  3GZM A;  1NQ4 A;  1DNY A;  2K94 A;  2M5R A;  2MVV A;  2AF8 A;  4H2Y C;  2KGD A;  2ROQ A;  1OR5 A;  3EJB A;  3RG2 A;  4H2X C;  2XZ1 C;  4BPH A;  2KR5 A;  2FAE A;  2MF4 A;  2GDW A;  2KOS A;  4DG9 A;  1KLP A;  2JGP A;  2KGE A;  2FAD A;  4IZ6 A;  2L22 A;  2FVA A;  2KOO A;  3EJD A;  2L0Q A;  4MRT C;  2JU2 A;  2LIU A;  2LTE A;  2N6Y A;  5HVC A;  3NY7 B;  2MD9 A;  1F80 D;  2LL8 A;  2KW2 A;  2CG5 B;  4HKG A;  2FQ1 A;  2KOQ A;  2L9F A;  3CE7 A;  2VSQ A;  4PWV B;  2KG8 A;  2MVU A;  2K0Y A;  2KOR A;  1VKU A;  5HV8 A;  4NEO A;  2K92 A;  2FHS C;  2AFD A;  2QNW A;  2KGC A;  2FAC A;  2LIW A;  2GDX A;  2KGA A;  5KP8 B;  2LPK A;  2MR7 A;  3GZL A;  2KWL A;  5KP7 B;  2K0X A;  2AVA A;  1ACP A;  1DV5 A;  1X3O A;  2N5I A;  2K93 A;  2CQ8 A;  2EHS A;  2X2B A;  2K2Q A;  2N98 A;  2L4B A;  2LKI A;  2PNG A; 
#chains in the Genus database with same CATH topology
 1D1D A;  3G26 A;  2CNR A;  1HY8 A;  2N5H A;  1VQ9 P;  1YIJ P;  1AF8 A;  1M6E X;  1HQB A;  2JAZ A;  1L0I A;  4CA3 A;  5F2N A;  4IPY A;  2PEJ A;  5F2O A;  3G1I A;  3G29 A;  4XFX A;  2AFE A;  2FVE A;  2JBG A;  2KG6 A;  4PXH B;  2OTJ P;  2PEQ A;  1GPJ A;  2GZI A;  3G71 P;  2MVV A;  4H2Y C;  2L6E A;  2KGD A;  2ROQ A;  1OR5 A;  5BS1 A;  3EJB A;  5HGL A;  2XZ1 C;  5JPA A;  2FAE A;  2Z45 A;  1E6J P;  2KOS A;  4DG9 A;  2JYL A;  2JGP A;  1IUQ A;  3CCR P;  3B5I A;  2KOO A;  2PEK A;  2OTL P;  1IMQ A;  2LTE A;  3DPH A;  3NY7 B;  3DS4 A;  1F80 D;  4XFZ A;  3CCL P;  3LRY A;  2JO0 A;  1BAJ A;  1K8A Q;  2VSQ A;  2KG8 A;  3Q20 A;  2XT1 A;  1VKU A;  1AYI A;  2ERH A;  4COC A;  1S72 P;  2KGA A;  2LIW A;  3CCJ P;  3I55 P;  3G21 A;  1EIA A;  1KQS O;  2LPK A;  3GZL A;  2AVA A;  2CWO A;  5EW5 E;  2OAR A;  1N8R Q;  1VQK P;  1JJ2 O;  2K93 A;  2Z44 A;  2K2Q A;  2JB0 A;  3CCV P;  3CC2 P;  2DNW A;  2MR8 A;  4GR6 A;  5I4T G;  3RG6 C;  2LOL A;  2ONT A;  3OW2 O;  4GR2 A;  2DGY A;  5CZD B;  3LMO A;  1KD1 Q;  2EIA A;  2NO8 A;  2K5X A;  1M1K Q;  2EG5 A;  2CGQ A;  2Z46 A;  4R0M A;  2FQ0 A;  2KOP A;  2KG9 A;  1NQ4 A;  1VQ7 P;  2K94 A;  3DS1 A;  5HGO A;  2AF8 A;  4PH0 A;  2M8N A;  3RG2 A;  1RO0 A;  2KOD A;  3CC4 P;  1ZMB A;  4H2X C;  3GKL C;  1Q81 Q;  2GDW A;  1Q82 Q;  3MGE A;  1KLP A;  2KGE A;  1YHQ P;  2FVA A;  2PEM A;  4XRO A;  3DTJ A;  4MRT C;  1NJI Q;  2LIU A;  2N6Y A;  3VRL C;  2MD9 A;  2KW2 A;  2FQ1 A;  2KOQ A;  4PWV B;  2E1M A;  4NEO A;  2AFD A;  2QNW A;  3HYB A;  1CEI A;  2BUO A;  2KGC A;  2GDX A;  1VQL P;  1UNK A;  3G1G A;  2MR7 A;  1M6N A;  4F37 A;  1DV5 A;  1X3O A;  2N5I A;  4QNB A;  2EHS A;  2N98 A;  2L4B A;  4XFY A;  1IMP A;  3G4S P;  1VQP P;  1K30 A;  3EJE A;  2JQ4 A;  1GXG A;  2EHT A;  2P9X A;  3CPW O;  1A43 A;  1VQ4 P;  2FVF A;  2N50 A;  4BPG A;  4U0E A;  1ZNV A;  2GDY A;  1BXI A;  2FQ2 A;  3CC7 P;  5DCK A;  4WYM A;  4BPF A;  2MY5 A;  2GZJ A;  3GZM A;  4U0B A;  1DNY A;  2M8L A;  2M5R A;  2BHV A;  2K0D X;  3NTE A;  3HZQ A;  1VQ5 P;  2LF4 A;  2QEX P;  2PEN A;  5HGM A;  4BPH A;  4XRQ A;  2GYK A;  2WPT A;  2PEI A;  3P05 A;  1YIT P;  1AUM A;  3DS5 A;  2FAD A;  1YJ9 P;  1VQO P;  4IZ6 A;  2VLP A;  1K9M Q;  3EJD A;  2XV6 A;  2L0Q A;  1RO2 A;  2JU2 A;  3H47 A;  3CCM P;  3H4E A;  2LL8 A;  1EMV A;  4HKG A;  2L9F A;  1M74 A;  2M8P A;  3CCE P;  3CE7 A;  1VQN P;  1UJZ A;  2MVU A;  2K0Y A;  2KOR A;  2EFJ A;  1Z6M A;  7CEI A;  2FHS C;  2K92 A;  4U0C A;  1M90 Q;  2FAC A;  2VLN A;  3U43 A;  2QA4 P;  3DS0 A;  2PY8 A;  5KP8 B;  4QKO A;  3GJN A;  1EOQ A;  2KWL A;  1Q86 Q;  1ACP A;  1KC8 Q;  2VLO A;  3DS3 A;  3CME P;  2X2B A;  3M1M A;  1VQM P;  1Q7Y Q;  3CCU P;  1FR2 A;  1YI2 P;  2LKI A;  2PNG A;  1MZ8 A;  3CCQ P;  4UHP B;  3DS2 A;  2VLQ A;  3CCS P;  4U0F A;  3H0D A;  2N6Z A;  3CD6 P;  1E0H A;  2XZ0 D;  5EJD A;  5KP6 B;  1QVG O;  2LML A;  1W2B O;  4COP A;  2JU1 A;  3CMA P;  2JYG A;  1L0H A;  4H2W C;  3G28 A;  1QRJ A;  1T8K A;  2GZF A;  2GZG A;  1A8O A;  2PEO A;  2KR5 A;  2GZE A;  2MF4 A;  1VQ8 P;  1GXH A;  2L22 A;  3CXC O;  3WBH A;  5HVC A;  2CG5 B;  1YJN P;  5HGN A;  1K73 Q;  3I56 P;  5F2K A;  4U0A A;  3B4Q A;  4PH1 A;  1RNI A;  5HV8 A;  3G6E P;  4U0D A;  3G0V A;  1VHN A;  1YJW P;  5BS2 A;  1VQ6 P;  5KP7 B;  2K0X A;  4M0I A;  2CQ8 A;  2XXM A;  1QVF O;  3E2D A; 
#chains in the Genus database with same CATH homology
 2DNW A;  2MR8 A;  2LOL A;  3EJE A;  2JQ4 A;  2CNR A;  1HY8 A;  2EHT A;  2N5H A;  2N6Z A;  1AF8 A;  1HQB A;  1L0I A;  2XZ0 D;  4CA3 A;  5EJD A;  5CZD B;  5KP6 B;  3LMO A;  2FVF A;  2LML A;  2N50 A;  4BPG A;  2JU1 A;  2GDY A;  2AFE A;  2FQ2 A;  2FVE A;  2KG6 A;  1L0H A;  4H2W C;  2CGQ A;  4PXH B;  4R0M A;  4BPF A;  2FQ0 A;  1T8K A;  2MY5 A;  2KOP A;  2KG9 A;  3GZM A;  1NQ4 A;  1DNY A;  2K94 A;  2M5R A;  2MVV A;  2AF8 A;  4H2Y C;  2KGD A;  2ROQ A;  1OR5 A;  3EJB A;  3RG2 A;  4H2X C;  2XZ1 C;  4BPH A;  2KR5 A;  2FAE A;  2MF4 A;  2GDW A;  2KOS A;  4DG9 A;  1KLP A;  2JGP A;  2KGE A;  2FAD A;  4IZ6 A;  2L22 A;  2FVA A;  2KOO A;  3EJD A;  2L0Q A;  4MRT C;  2JU2 A;  2LIU A;  2LTE A;  2N6Y A;  5HVC A;  3NY7 B;  2MD9 A;  1F80 D;  2LL8 A;  2KW2 A;  2CG5 B;  4HKG A;  2FQ1 A;  2KOQ A;  2L9F A;  3CE7 A;  2VSQ A;  4PWV B;  2KG8 A;  2MVU A;  2K0Y A;  2KOR A;  1VKU A;  5HV8 A;  4NEO A;  2K92 A;  2FHS C;  2AFD A;  2QNW A;  2KGC A;  2FAC A;  2LIW A;  2GDX A;  2KGA A;  5KP8 B;  2LPK A;  2MR7 A;  3GZL A;  2KWL A;  5KP7 B;  2K0X A;  2AVA A;  1ACP A;  1DV5 A;  1X3O A;  2N5I A;  2K93 A;  2CQ8 A;  2EHS A;  2X2B A;  2K2Q A;  2N98 A;  2L4B A;  2LKI A;  2PNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...