2GDWA

Solution structure of the b. brevis tycc3-pcp in a/h-state
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
85
structure length
85
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthetase III
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/transport protein
total genus 21
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdwA00
2EHTA 2FQ2A 1F80D 2N50A 2X2BA 5KP7B 2LTEA 4CA3A 2JU2A 2MR7A 2MVVA 1X3OA 2N5IA 2K2QA 4PXHB 2JQ4A 2PNGA 2AF8A 2GDXA 2XZ0D 2CG5B 2VSQA 2K94A 2KOOA 3EJBA 1NQ4A 4PWVB 2L4BA 2QNWA 2JU1A 2FADA 2MR8A 2K0YA 2JGPA 1HQBA 2M5RA 2KWLA 2KR5A 2CGQA 2FAEA 2XZ1C 2FHSC 1KLPA 1ACPA 5HV8A 2N6ZA 2L9FA 2KG9A 2N5HA 2MF4A 2FQ0A 3GZLA 3RG2A 2K0XA 2KGCA 4BPFA 2KORA 2KOSA 2FACA 2L0QA 3EJEA 3GZMA 2GDYA 2GDWA 2AFEA 1T8KA 2FVEA 2AFDA 4H2XC 2KOQA 4IZ6A 1HY8A 2DNWA 5EJDA 2KGDA 4H2YC 2KG6A 2EHSA 3EJDA 1VKUA 2LOLA 3LMOA 2FVAA 2KW2A 2LIWA 3CE7A 2K92A 2MVUA 2CQ8A 5KP8B 5HVCA 4R0MA 1AF8A 4NEOA 2LKIA 2KGAA 2FVFA 2N6YA 2MD9A 2KGEA 2LMLA 3NY7B 2ROQA 2KG8A 2L22A 4H2WC 4MRTC 2LIUA 1L0IA 5CZDB 1DNYA 2FQ1A 2LL8A 1OR5A 1L0HA 4HKGA 2MY5A 4BPGA 2AVAA 2N98A 2LPKA 1DV5A 4BPHA 4DG9A 5KP6B 2CNRA 2KOPA 2K93A
chains in the Genus database with same CATH superfamily
1EMVA 1GXGA 2N50A 5KP7B 4U0CA 1YIJP 2NO8A 2GYKA 2OTJP 2K2QA 1KC8Q 2PNGA 2AF8A 3G29A 2XZ0D 3CC2P 2PEQA 2K94A 3CPWO 1VQPP 1S72P 1Q81Q 2L4BA 1VQ5P 2JU1A 2MR8A 1HQBA 3G71P 1K8AQ 2CGQA 2FAEA 5HV8A 3OW2O 5I4TG 2N6ZA 2L9FA 2BUOA 2FQ0A 2PEMA 2QA4P 3GZLA 1UNKA 2KGCA 3E2DA 5HGLA 1YJ9P 4IZ6A 2GZJA 5EJDA 2KG6A 5F2KA 2OTLP 2OARA 2LIWA 2LF4A 3B4QA 3CE7A 1VQLP 4F37A 1EIAA 3G21A 2E1MA 4R0MA 4U0AA 2XT1A 1EOQA 2MD9A 2QEXP 1UJZA 1A8OA 3CCMP 2L22A 4MRTC 2LIUA 5F2NA 1VQ6P 1L0IA 3M1MA 2FQ1A 1OR5A 1JJ2O 1BAJA 1VQOP 4BPGA 1RO2A 5HGNA 2BHVA 4BPHA 5KP6B 3DS3A 2Z44A 1KD1Q 2FQ2A 1F80D 3H47A 3G28A 3G1IA 3WBHA 4PH0A 1KQSO 2PY8A 2GZGA 1X3OA 2N5IA 4PXHB 2JYLA 3I55P 3EJBA 5F2OA 1M1KQ 1Q82Q 4U0EA 2QNWA 2ERHA 2M5RA 1AYIA 2KWLA 1Z6MA 1K73Q 3G0VA 1AUMA 2PEIA 1KLPA 2L6EA 4XFYA 1RO0A 2K0XA 4UHPB 2KORA 2FACA 2L0QA 3EJEA 2GDYA 4H2XC 2KOQA 3HYBA 3CD6P 4PH1A 2EFJA 1VQMP 2EHSA 2JO0A 1GPJA 3CCEP 2VLOA 2JB0A 5HVCA 4NEOA 3CC4P 1VQKP 1YITP 2FVFA 2N6YA 2LMLA 3CMAP 2CWOA 1QVGO 4M0IA 4WYMA 2LL8A 1VQ9P 1YJNP 5JPAA 4HKGA 3CCRP 1YJWP 2AVAA 3HZQA 1E0HA 2PEOA 2EIAA 1M6NA 2LPKA 4XROA 3H0DA 2P9XA 3MGEA 1VQ8P 2KOPA 2K93A 1AF8A 3NTEA 2EHTA 2X2BA 2XV6A 2LTEA 4CA3A 2WPTA 4IPYA 2JQ4A 3U43A 2GDXA 3CC7P 2CG5B 3DTJA 2VSQA 3CCLP 3DS2A 2KOOA 1NQ4A 3LRYA 1M74A 2K0YA 4QNBA 1CEIA 1Q86Q 2XZ1C 2FHSC 1RNIA 5HGOA 1ACPA 2KG9A 3B5IA 2MF4A 1MZ8A 2GZIA 3RG2A 4QKOA 5HGMA 4U0BA 3CMEP 2AFDA 2PEJA 3G26A 1IMQA 2KGDA 4H2YC 7CEIA 4GR6A 1ZNVA 2VLPA 2LOLA 2KODA 2KW2A 2K0DX 3DS1A 2JYGA 1BXIA 2K92A 2MVUA 1NJIQ 1N8RQ 4XRQA 2GZEA 2KGEA 3RG6C 3VRLC 1VQ4P 3NY7B 5DCKA 2M8LA 2KG8A 5CZDB 1K30A 1YI2P 3GKLC 2VLQA 1GXHA 5BS2A 4XFZA 4COCA 1E6JP 3I56P 2PENA 1QVFO 2JU2A 1ZMBA 3P05A 1QRJA 3DPHA 2MR7A 2MVVA 1D1DA 3CCQP 3CCVP 2K5XA 3Q20A 4XFXA 4PWVB 1M90Q 3DS0A 5EW5E 2FADA 3G6EP 2JGPA 2KR5A 5BS1A 1VQ7P 2JAZA 4U0FA 1IUQA 2N5HA 3DS5A 4U0DA 3DS4A 4BPFA 2Z45A 2DGYA 2KOSA 3GZMA 2VLNA 2GDWA 2AFEA 1T8KA 2FVEA 4GR2A 1A43A 2M8PA 1HY8A 2DNWA 1IMPA 3EJDA 1VKUA 3LMOA 2FVAA 1M6EX 2JBGA 3CCSP 2EG5A 1Q7YQ 2CQ8A 5KP8B 2LKIA 1FR2A 2KGAA 2Z46A 1YHQP 2ROQA 2PEKA 1K9MQ 4H2WC 3CCUP 2M8NA 1VQNP 2XXMA 1DNYA 3H4EA 1W2BO 1L0HA 2ONTA 2MY5A 1VHNA 2GZFA 2N98A 4COPA 3CXCO 3G1GA 3G4SP 3CCJP 1DV5A 4DG9A 2CNRA 3GJNA
chains in the Genus database with same CATH topology
2EHTA 2FQ2A 1F80D 2N50A 2X2BA 5KP7B 2LTEA 4CA3A 2JU2A 2MR7A 2MVVA 1X3OA 2N5IA 2K2QA 4PXHB 2JQ4A 2PNGA 2AF8A 2GDXA 2XZ0D 2CG5B 2VSQA 2K94A 2KOOA 3EJBA 1NQ4A 4PWVB 2L4BA 2QNWA 2JU1A 2FADA 2MR8A 2K0YA 2JGPA 1HQBA 2M5RA 2KWLA 2KR5A 2CGQA 2FAEA 2XZ1C 2FHSC 1KLPA 1ACPA 5HV8A 2N6ZA 2L9FA 2KG9A 2N5HA 2MF4A 2FQ0A 3GZLA 3RG2A 2K0XA 2KGCA 4BPFA 2KORA 2KOSA 2FACA 2L0QA 3EJEA 3GZMA 2GDYA 2GDWA 2AFEA 1T8KA 2FVEA 2AFDA 4H2XC 2KOQA 4IZ6A 1HY8A 2DNWA 5EJDA 2KGDA 4H2YC 2KG6A 2EHSA 3EJDA 1VKUA 2LOLA 3LMOA 2FVAA 2KW2A 2LIWA 3CE7A 2K92A 2MVUA 2CQ8A 5KP8B 5HVCA 4R0MA 1AF8A 4NEOA 2LKIA 2KGAA 2FVFA 2N6YA 2MD9A 2KGEA 2LMLA 3NY7B 2ROQA 2KG8A 2L22A 4H2WC 4MRTC 2LIUA 1L0IA 5CZDB 1DNYA 2FQ1A 2LL8A 1OR5A 1L0HA 4HKGA 2MY5A 4BPGA 2AVAA 2N98A 2LPKA 1DV5A 4BPHA 4DG9A 5KP6B 2CNRA 2KOPA 2K93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHT A;  2FQ2 A;  1F80 D;  2N50 A;  2X2B A;  5KP7 B;  2LTE A;  4CA3 A;  2JU2 A;  2MR7 A;  2MVV A;  1X3O A;  2N5I A;  2K2Q A;  4PXH B;  2JQ4 A;  2PNG A;  2AF8 A;  2GDX A;  2XZ0 D;  2CG5 B;  2VSQ A;  2K94 A;  2KOO A;  3EJB A;  1NQ4 A;  4PWV B;  2L4B A;  2QNW A;  2JU1 A;  2FAD A;  2MR8 A;  2K0Y A;  2JGP A;  1HQB A;  2M5R A;  2KWL A;  2KR5 A;  2CGQ A;  2FAE A;  2XZ1 C;  2FHS C;  1KLP A;  1ACP A;  5HV8 A;  2N6Z A;  2L9F A;  2KG9 A;  2N5H A;  2MF4 A;  2FQ0 A;  3GZL A;  3RG2 A;  2K0X A;  2KGC A;  4BPF A;  2KOR A;  2KOS A;  2FAC A;  2L0Q A;  3EJE A;  3GZM A;  2GDY A;  2GDW A;  2AFE A;  1T8K A;  2FVE A;  2AFD A;  4H2X C;  2KOQ A;  4IZ6 A;  1HY8 A;  2DNW A;  5EJD A;  2KGD A;  4H2Y C;  2KG6 A;  2EHS A;  3EJD A;  1VKU A;  2LOL A;  3LMO A;  2FVA A;  2KW2 A;  2LIW A;  3CE7 A;  2K92 A;  2MVU A;  2CQ8 A;  5KP8 B;  5HVC A;  4R0M A;  1AF8 A;  4NEO A;  2LKI A;  2KGA A;  2FVF A;  2N6Y A;  2MD9 A;  2KGE A;  2LML A;  3NY7 B;  2ROQ A;  2KG8 A;  2L22 A;  4H2W C;  4MRT C;  2LIU A;  1L0I A;  5CZD B;  1DNY A;  2FQ1 A;  2LL8 A;  1OR5 A;  1L0H A;  4HKG A;  2MY5 A;  4BPG A;  2AVA A;  2N98 A;  2LPK A;  1DV5 A;  4BPH A;  4DG9 A;  5KP6 B;  2CNR A;  2KOP A;  2K93 A; 
#chains in the Genus database with same CATH topology
 1EMV A;  1GXG A;  2N50 A;  5KP7 B;  4U0C A;  1YIJ P;  2NO8 A;  2GYK A;  2OTJ P;  2K2Q A;  1KC8 Q;  2PNG A;  2AF8 A;  3G29 A;  2XZ0 D;  3CC2 P;  2PEQ A;  2K94 A;  3CPW O;  1VQP P;  1S72 P;  1Q81 Q;  2L4B A;  1VQ5 P;  2JU1 A;  2MR8 A;  1HQB A;  3G71 P;  1K8A Q;  2CGQ A;  2FAE A;  5HV8 A;  3OW2 O;  5I4T G;  2N6Z A;  2L9F A;  2BUO A;  2FQ0 A;  2PEM A;  2QA4 P;  3GZL A;  1UNK A;  2KGC A;  3E2D A;  5HGL A;  1YJ9 P;  4IZ6 A;  2GZJ A;  5EJD A;  2KG6 A;  5F2K A;  2OTL P;  2OAR A;  2LIW A;  2LF4 A;  3B4Q A;  3CE7 A;  1VQL P;  4F37 A;  1EIA A;  3G21 A;  2E1M A;  4R0M A;  4U0A A;  2XT1 A;  1EOQ A;  2MD9 A;  2QEX P;  1UJZ A;  1A8O A;  3CCM P;  2L22 A;  4MRT C;  2LIU A;  5F2N A;  1VQ6 P;  1L0I A;  3M1M A;  2FQ1 A;  1OR5 A;  1JJ2 O;  1BAJ A;  1VQO P;  4BPG A;  1RO2 A;  5HGN A;  2BHV A;  4BPH A;  5KP6 B;  3DS3 A;  2Z44 A;  1KD1 Q;  2FQ2 A;  1F80 D;  3H47 A;  3G28 A;  3G1I A;  3WBH A;  4PH0 A;  1KQS O;  2PY8 A;  2GZG A;  1X3O A;  2N5I A;  4PXH B;  2JYL A;  3I55 P;  3EJB A;  5F2O A;  1M1K Q;  1Q82 Q;  4U0E A;  2QNW A;  2ERH A;  2M5R A;  1AYI A;  2KWL A;  1Z6M A;  1K73 Q;  3G0V A;  1AUM A;  2PEI A;  1KLP A;  2L6E A;  4XFY A;  1RO0 A;  2K0X A;  4UHP B;  2KOR A;  2FAC A;  2L0Q A;  3EJE A;  2GDY A;  4H2X C;  2KOQ A;  3HYB A;  3CD6 P;  4PH1 A;  2EFJ A;  1VQM P;  2EHS A;  2JO0 A;  1GPJ A;  3CCE P;  2VLO A;  2JB0 A;  5HVC A;  4NEO A;  3CC4 P;  1VQK P;  1YIT P;  2FVF A;  2N6Y A;  2LML A;  3CMA P;  2CWO A;  1QVG O;  4M0I A;  4WYM A;  2LL8 A;  1VQ9 P;  1YJN P;  5JPA A;  4HKG A;  3CCR P;  1YJW P;  2AVA A;  3HZQ A;  1E0H A;  2PEO A;  2EIA A;  1M6N A;  2LPK A;  4XRO A;  3H0D A;  2P9X A;  3MGE A;  1VQ8 P;  2KOP A;  2K93 A;  1AF8 A;  3NTE A;  2EHT A;  2X2B A;  2XV6 A;  2LTE A;  4CA3 A;  2WPT A;  4IPY A;  2JQ4 A;  3U43 A;  2GDX A;  3CC7 P;  2CG5 B;  3DTJ A;  2VSQ A;  3CCL P;  3DS2 A;  2KOO A;  1NQ4 A;  3LRY A;  1M74 A;  2K0Y A;  4QNB A;  1CEI A;  1Q86 Q;  2XZ1 C;  2FHS C;  1RNI A;  5HGO A;  1ACP A;  2KG9 A;  3B5I A;  2MF4 A;  1MZ8 A;  2GZI A;  3RG2 A;  4QKO A;  5HGM A;  4U0B A;  3CME P;  2AFD A;  2PEJ A;  3G26 A;  1IMQ A;  2KGD A;  4H2Y C;  7CEI A;  4GR6 A;  1ZNV A;  2VLP A;  2LOL A;  2KOD A;  2KW2 A;  2K0D X;  3DS1 A;  2JYG A;  1BXI A;  2K92 A;  2MVU A;  1NJI Q;  1N8R Q;  4XRQ A;  2GZE A;  2KGE A;  3RG6 C;  3VRL C;  1VQ4 P;  3NY7 B;  5DCK A;  2M8L A;  2KG8 A;  5CZD B;  1K30 A;  1YI2 P;  3GKL C;  2VLQ A;  1GXH A;  5BS2 A;  4XFZ A;  4COC A;  1E6J P;  3I56 P;  2PEN A;  1QVF O;  2JU2 A;  1ZMB A;  3P05 A;  1QRJ A;  3DPH A;  2MR7 A;  2MVV A;  1D1D A;  3CCQ P;  3CCV P;  2K5X A;  3Q20 A;  4XFX A;  4PWV B;  1M90 Q;  3DS0 A;  5EW5 E;  2FAD A;  3G6E P;  2JGP A;  2KR5 A;  5BS1 A;  1VQ7 P;  2JAZ A;  4U0F A;  1IUQ A;  2N5H A;  3DS5 A;  4U0D A;  3DS4 A;  4BPF A;  2Z45 A;  2DGY A;  2KOS A;  3GZM A;  2VLN A;  2GDW A;  2AFE A;  1T8K A;  2FVE A;  4GR2 A;  1A43 A;  2M8P A;  1HY8 A;  2DNW A;  1IMP A;  3EJD A;  1VKU A;  3LMO A;  2FVA A;  1M6E X;  2JBG A;  3CCS P;  2EG5 A;  1Q7Y Q;  2CQ8 A;  5KP8 B;  2LKI A;  1FR2 A;  2KGA A;  2Z46 A;  1YHQ P;  2ROQ A;  2PEK A;  1K9M Q;  4H2W C;  3CCU P;  2M8N A;  1VQN P;  2XXM A;  1DNY A;  3H4E A;  1W2B O;  1L0H A;  2ONT A;  2MY5 A;  1VHN A;  2GZF A;  2N98 A;  4COP A;  3CXC O;  3G1G A;  3G4S P;  3CCJ P;  1DV5 A;  4DG9 A;  2CNR A;  3GJN A; 
#chains in the Genus database with same CATH homology
 2EHT A;  2FQ2 A;  1F80 D;  2N50 A;  2X2B A;  5KP7 B;  2LTE A;  4CA3 A;  2JU2 A;  2MR7 A;  2MVV A;  1X3O A;  2N5I A;  2K2Q A;  4PXH B;  2JQ4 A;  2PNG A;  2AF8 A;  2GDX A;  2XZ0 D;  2CG5 B;  2VSQ A;  2K94 A;  2KOO A;  3EJB A;  1NQ4 A;  4PWV B;  2L4B A;  2QNW A;  2JU1 A;  2FAD A;  2MR8 A;  2K0Y A;  2JGP A;  1HQB A;  2M5R A;  2KWL A;  2KR5 A;  2CGQ A;  2FAE A;  2XZ1 C;  2FHS C;  1KLP A;  1ACP A;  5HV8 A;  2N6Z A;  2L9F A;  2KG9 A;  2N5H A;  2MF4 A;  2FQ0 A;  3GZL A;  3RG2 A;  2K0X A;  2KGC A;  4BPF A;  2KOR A;  2KOS A;  2FAC A;  2L0Q A;  3EJE A;  3GZM A;  2GDY A;  2GDW A;  2AFE A;  1T8K A;  2FVE A;  2AFD A;  4H2X C;  2KOQ A;  4IZ6 A;  1HY8 A;  2DNW A;  5EJD A;  2KGD A;  4H2Y C;  2KG6 A;  2EHS A;  3EJD A;  1VKU A;  2LOL A;  3LMO A;  2FVA A;  2KW2 A;  2LIW A;  3CE7 A;  2K92 A;  2MVU A;  2CQ8 A;  5KP8 B;  5HVC A;  4R0M A;  1AF8 A;  4NEO A;  2LKI A;  2KGA A;  2FVF A;  2N6Y A;  2MD9 A;  2KGE A;  2LML A;  3NY7 B;  2ROQ A;  2KG8 A;  2L22 A;  4H2W C;  4MRT C;  2LIU A;  1L0I A;  5CZD B;  1DNY A;  2FQ1 A;  2LL8 A;  1OR5 A;  1L0H A;  4HKG A;  2MY5 A;  4BPG A;  2AVA A;  2N98 A;  2LPK A;  1DV5 A;  4BPH A;  4DG9 A;  5KP6 B;  2CNR A;  2KOP A;  2K93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...