2GE4A

High-resolution solution structure of outer membrane protein a transmembrane domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
177
structure length
177
Chain Sequence
MAPKDNTWYTGAKLGFSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDFLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVFRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQFTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the accuracy of solution NMR structures of membrane proteins by application of residual dipolar couplings. High-resolution structure of outer membrane protein A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein A
total genus 17
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01389 OmpA_membrane OmpA-like transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2ge4A00
1MM5A 2LHFA 2MHLA 1MM4A 2ERVA 1QJ8A 1Q9FA 2GE4A 2N2MA 1QJ9A 2MNHA 1BXWA 2F1TA 2M06A 4PUXA 1P4TA 2JMMA 2K0LA 2N2LA 2X27X 3G7GA 3GP6A 1ORMA 3C5OA 2F1VA 1G90A 1QJPA 4RLCA 3QRCA 1THQA 1Q9GA 2M07A 3QRAA
chains in the Genus database with same CATH superfamily
4GF4A 4FUVA 3WI5A 3AAEB 5AFUK 3HWBA 3T20A 4XNKA 2KDYA 1GFQA 4O3WA 1H6S1 4LSEA 4E1TA 5JDPA 3SZDA 1HXTA 2XE2A 4FRXA 5ADXK 4FT6A 5DL8A 3DA3A 3LK2B 4GHBA 4N74A 2AXTO 4O4UA 3AA7A 5E79O 1E54A 2KXPB 4PR7A 4FZLA 2XTRA 3K19A 4PUXA 4C00A 4FMSA 2J4UP 2R8AA 4K3CA 3SYBA 4AYMC 5GV0A 2IWWA 4JFBA 7PRNA 4AYDC 1OPFA 4IL6O 5DL6A 3LK3A 3HOLA 2KZ7A 1ORMA 2WJQA 2ODJA 5T5FA 2K4TA 4D5UA 4U9CA 1MPFA 3C5OA 4GCSA 4LSHA 4AUIA 3T24A 4FSPA 2KXPA 3SY9A 3QRCA 4AFKA 5B66O 4D64A 1Q9GA 3HW9A 2J1NA 4FOZA 2LHFA 2MHLA 4O3XB 3WU2O 2F1CX 3A2SX 5TISO 3UU2A 2Y2XA 3NSGA 3BRZA 4KRAA 1Q9FA 3AAAB 2YPVA 1T1LA 3PQUA 4O3YA 4RJWA 3AA7B 2W81C 2X9KA 2N2MA 1GFOA 3BRYA 4FZNA 1QJ9A 4N59A 3PGSA 4N75A 5G3AA 2F1TA 3AA1A 3TZGA 5FVNA 4O3ZA 2Y0HA 4D65A 4LSFA 4AYEC 1BH3A 1ZHWA 4LSIA 5G26A 2X27X 3POQA 3SYSA 4AYNA 4N58A 3LK3B 3AA0B 1YS5A 3G7GA 4E1SA 2XE1A 2IWVA 2OMFA 2R4OA 2Y0LA 1HXUA 3UAQA 1T16A 3PQSA 3SY7A 5EE2A 2LFUA 4UB6O 3LK42 4RLCA 3AA6B 2KZ7B 2XG6A 3HOEA 3AAAA 3UPGA 3A0HO 3LK41 1MM5A 1ZHYA 1MM4A 3VY8X 3SZVA 5DL5A 2ERVA 4GCQA 4AYID 2R4NA 1QJ8A 4PJ0O 1ZHZA 4BUMX 3JCUO 1S5LO 2GE4A 5KAFO 5ADXL 2PORA 4O49A 2MNHA 5GTHO 3VE1A 2PRNA 4AKMA 2R4LA 4Z3TA 1P4TA 2K0LA 3VZWX 4JCHA 3LK2A 4FZMA 4XNLA 3VE2A 2N2LA 4O4XA 3VZTX 3NJTA 4K3BA 3WI4A 3PORA 3AAEA 3EMNX 4RL9A 3GP6A 3T0SA 4C69X 1PHOA 4FESA 3PGUA 4RJXA 4B61A 2R4PA 3PGRA 2R89A 4CTDA 5AFUL 1G90A 2XTQA 6PRNA 2XE5A 4KR4A 4FRTA 1QJPA 2Y0KA 2KC0A 4QQ1A 5IYUA 1IZNA 4F4BA 5PRNA 3QRAA 3PRNA 3O0EA 4GCPA 2QTKA 1BT9A 3DWOX 4AKRB 2ZLDA 4AKRA 3BS0A 3PF1A 3A0BO 1ZHTA 5G38A 2WVPA 3POUA 2YNKA 2FGRA 2JQYA 4FSOA 5G39A 2FGQX 4FQEA 5KAIO 1IZNB 1OSMA 4AZLA 4C4VA 2XMXA 3AA6A 3VZUX 1BXWA 3FYXA 2M06A 5GTIO 3DZMA 2R88A 3POXA 2JMMA 4UB8O 5D5DA 4G75A 3RBHA 4G76A 3VY9X 5DL7A 3AA0A 3DWNA 2Y7SA 2ZFGA 1ZHXA 2XE3A 3KVDD 3DA4A 4KR8A 3JTYA 1PRNA 3V8UA 1GFNA 2F1VA 5B5EO 4C4VB 2WJRA 8PRNA 3AA1B 2W80C 1HXXA 2O4VA 1THQA 3KZIO 5H2FO 4RLBA 1GFPA 2M07A 1GFMA
chains in the Genus database with same CATH topology
4GF4A 4FUVA 3WI5A 3AAEB 5AFUK 3HWBA 3T20A 4XNKA 2KDYA 1GFQA 4O3WA 1H6S1 4LSEA 4E1TA 3SZDA 1HXTA 2XE2A 4FRXA 5ADXK 4FT6A 5DL8A 3DA3A 3LK2B 4GHBA 4O4UA 3UAQA 3AA7A 1E54A 2KXPB 4FZLA 2XTRA 3K19A 4PUXA 2J4UP 4FMSA 3SYBA 5GV0A 4JFBA 7PRNA 4AYDC 1OPFA 5DL6A 3LK3A 3HOLA 2KZ7A 1ORMA 5T5FA 2ODJA 2K4TA 4D5UA 4U9CA 1MPFA 3C5OA 4GCSA 4LSHA 3T24A 4FSPA 2KXPA 3SY9A 3QRCA 4AFKA 4D64A 1Q9GA 3HW9A 2J1NA 4FOZA 2LHFA 2MHLA 4O3XB 3A2SX 3UU2A 2Y2XA 3NSGA 4KRAA 1Q9FA 3AAAB 2YPVA 4O3YA 3PQUA 4RJWA 3AA7B 2W81C 4FZNA 2N2MA 1GFOA 5JDPA 4N59A 1QJ9A 3TZGA 2F1TA 3AA1A 5FVNA 4O3ZA 2Y0HA 4D65A 4LSFA 4AYEC 1BH3A 1ZHWA 4LSIA 5G26A 2X27X 3POQA 3SYSA 4AYNA 4N58A 3LK3B 3AA0B 1YS5A 3G7GA 4E1SA 2XE1A 2OMFA 2Y0LA 1HXUA 3PQSA 3SY7A 5EE2A 2LFUA 3LK42 4RLCA 3AA6B 2XG6A 2KZ7B 3HOEA 3AAAA 3UPGA 3LK41 1MM5A 1ZHYA 1MM4A 3VY8X 3SZVA 5DL5A 2ERVA 4GCQA 4AYID 1QJ8A 1ZHZA 4BUMX 2GE4A 5ADXL 2PORA 4O49A 2MNHA 3VE1A 2PRNA 4AKMA 4Z3TA 1P4TA 2K0LA 3VZWX 4JCHA 3LK2A 4FZMA 4XNLA 3VE2A 2N2LA 4O4XA 3VZTX 3WI4A 4AYMC 4B61A 3PORA 3AAEA 3EMNX 4RL9A 3GP6A 3T0SA 4C69X 1PHOA 4FESA 4RJXA 5AFUL 1G90A 2XTQA 6PRNA 2XE5A 4KR4A 4FRTA 1QJPA 2Y0KA 2KC0A 4QQ1A 5IYUA 1IZNA 4F4BA 5PRNA 3QRAA 3PRNA 3O0EA 4GCPA 2QTKA 1BT9A 4AKRB 2ZLDA 4AKRA 4AUIA 1ZHTA 3POUA 4FSOA 2YNKA 2FGRA 2FGQX 1IZNB 1OSMA 4AZLA 2XMXA 3AA6A 3VZUX 1BXWA 3FYXA 2M06A 3POXA 2JMMA 5D5DA 4G75A 3RBHA 4G76A 3VY9X 5DL7A 3AA0A 2Y7SA 2ZFGA 1ZHXA 2XE3A 3KVDD 3DA4A 4KR8A 3JTYA 1PRNA 3V8UA 1GFNA 2F1VA 8PRNA 3AA1B 2W80C 1HXXA 2O4VA 1THQA 4RLBA 1GFPA 2M07A 1GFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM5 A;  2LHF A;  2MHL A;  1MM4 A;  2ERV A;  1QJ8 A;  1Q9F A;  2GE4 A;  2N2M A;  1QJ9 A;  2MNH A;  1BXW A;  2F1T A;  2M06 A;  4PUX A;  1P4T A;  2JMM A;  2K0L A;  2N2L A;  2X27 X;  3G7G A;  3GP6 A;  1ORM A;  3C5O A;  2F1V A;  1G90 A;  1QJP A;  4RLC A;  3QRC A;  1THQ A;  1Q9G A;  2M07 A;  3QRA A; 
#chains in the Genus database with same CATH topology
 4GF4 A;  4FUV A;  3WI5 A;  3AAE B;  5AFU K;  3HWB A;  3T20 A;  4XNK A;  2KDY A;  1GFQ A;  4O3W A;  1H6S 1;  4LSE A;  4E1T A;  5JDP A;  3SZD A;  1HXT A;  2XE2 A;  4FRX A;  5ADX K;  4FT6 A;  5DL8 A;  3DA3 A;  3LK2 B;  4GHB A;  4N74 A;  2AXT O;  4O4U A;  3AA7 A;  5E79 O;  1E54 A;  2KXP B;  4PR7 A;  4FZL A;  2XTR A;  3K19 A;  4PUX A;  4C00 A;  4FMS A;  2J4U P;  2R8A A;  4K3C A;  3SYB A;  4AYM C;  5GV0 A;  2IWW A;  4JFB A;  7PRN A;  4AYD C;  1OPF A;  4IL6 O;  5DL6 A;  3LK3 A;  3HOL A;  2KZ7 A;  1ORM A;  2WJQ A;  2ODJ A;  5T5F A;  2K4T A;  4D5U A;  4U9C A;  1MPF A;  3C5O A;  4GCS A;  4LSH A;  4AUI A;  3T24 A;  4FSP A;  2KXP A;  3SY9 A;  3QRC A;  4AFK A;  5B66 O;  4D64 A;  1Q9G A;  3HW9 A;  2J1N A;  4FOZ A;  2LHF A;  2MHL A;  4O3X B;  3WU2 O;  2F1C X;  3A2S X;  5TIS O;  3UU2 A;  2Y2X A;  3NSG A;  3BRZ A;  4KRA A;  1Q9F A;  3AAA B;  2YPV A;  1T1L A;  3PQU A;  4O3Y A;  4RJW A;  3AA7 B;  2W81 C;  2X9K A;  2N2M A;  1GFO A;  3BRY A;  4FZN A;  1QJ9 A;  4N59 A;  3PGS A;  4N75 A;  5G3A A;  2F1T A;  3AA1 A;  3TZG A;  5FVN A;  4O3Z A;  2Y0H A;  4D65 A;  4LSF A;  4AYE C;  1BH3 A;  1ZHW A;  4LSI A;  5G26 A;  2X27 X;  3POQ A;  3SYS A;  4AYN A;  4N58 A;  3LK3 B;  3AA0 B;  1YS5 A;  3G7G A;  4E1S A;  2XE1 A;  2IWV A;  2OMF A;  2R4O A;  2Y0L A;  1HXU A;  3UAQ A;  1T16 A;  3PQS A;  3SY7 A;  5EE2 A;  2LFU A;  4UB6 O;  3LK4 2;  4RLC A;  3AA6 B;  2KZ7 B;  2XG6 A;  3HOE A;  3AAA A;  3UPG A;  3A0H O;  3LK4 1;  1MM5 A;  1ZHY A;  1MM4 A;  3VY8 X;  3SZV A;  5DL5 A;  2ERV A;  4GCQ A;  4AYI D;  2R4N A;  1QJ8 A;  4PJ0 O;  1ZHZ A;  4BUM X;  3JCU O;  1S5L O;  2GE4 A;  5KAF O;  5ADX L;  2POR A;  4O49 A;  2MNH A;  5GTH O;  3VE1 A;  2PRN A;  4AKM A;  2R4L A;  4Z3T A;  1P4T A;  2K0L A;  3VZW X;  4JCH A;  3LK2 A;  4FZM A;  4XNL A;  3VE2 A;  2N2L A;  4O4X A;  3VZT X;  3NJT A;  4K3B A;  3WI4 A;  3POR A;  3AAE A;  3EMN X;  4RL9 A;  3GP6 A;  3T0S A;  4C69 X;  1PHO A;  4FES A;  3PGU A;  4RJX A;  4B61 A;  2R4P A;  3PGR A;  2R89 A;  4CTD A;  5AFU L;  1G90 A;  2XTQ A;  6PRN A;  2XE5 A;  4KR4 A;  4FRT A;  1QJP A;  2Y0K A;  2KC0 A;  4QQ1 A;  5IYU A;  1IZN A;  4F4B A;  5PRN A;  3QRA A;  3PRN A;  3O0E A;  4GCP A;  2QTK A;  1BT9 A;  3DWO X;  4AKR B;  2ZLD A;  4AKR A;  3BS0 A;  3PF1 A;  3A0B O;  1ZHT A;  5G38 A;  2WVP A;  3POU A;  2YNK A;  2FGR A;  2JQY A;  4FSO A;  5G39 A;  2FGQ X;  4FQE A;  5KAI O;  1IZN B;  1OSM A;  4AZL A;  4C4V A;  2XMX A;  3AA6 A;  3VZU X;  1BXW A;  3FYX A;  2M06 A;  5GTI O;  3DZM A;  2R88 A;  3POX A;  2JMM A;  4UB8 O;  5D5D A;  4G75 A;  3RBH A;  4G76 A;  3VY9 X;  5DL7 A;  3AA0 A;  3DWN A;  2Y7S A;  2ZFG A;  1ZHX A;  2XE3 A;  3KVD D;  3DA4 A;  4KR8 A;  3JTY A;  1PRN A;  3V8U A;  1GFN A;  2F1V A;  5B5E O;  4C4V B;  2WJR A;  8PRN A;  3AA1 B;  2W80 C;  1HXX A;  2O4V A;  1THQ A;  3KZI O;  5H2F O;  4RLB A;  1GFP A;  2M07 A;  1GFM A; 
#chains in the Genus database with same CATH homology
 4GF4 A;  4FUV A;  3WI5 A;  3AAE B;  5AFU K;  3HWB A;  3T20 A;  4XNK A;  2KDY A;  1GFQ A;  4O3W A;  1H6S 1;  4LSE A;  4E1T A;  3SZD A;  1HXT A;  2XE2 A;  4FRX A;  5ADX K;  4FT6 A;  5DL8 A;  3DA3 A;  3LK2 B;  4GHB A;  4O4U A;  3UAQ A;  3AA7 A;  1E54 A;  2KXP B;  4FZL A;  2XTR A;  3K19 A;  4PUX A;  2J4U P;  4FMS A;  3SYB A;  5GV0 A;  4JFB A;  7PRN A;  4AYD C;  1OPF A;  5DL6 A;  3LK3 A;  3HOL A;  2KZ7 A;  1ORM A;  5T5F A;  2ODJ A;  2K4T A;  4D5U A;  4U9C A;  1MPF A;  3C5O A;  4GCS A;  4LSH A;  3T24 A;  4FSP A;  2KXP A;  3SY9 A;  3QRC A;  4AFK A;  4D64 A;  1Q9G A;  3HW9 A;  2J1N A;  4FOZ A;  2LHF A;  2MHL A;  4O3X B;  3A2S X;  3UU2 A;  2Y2X A;  3NSG A;  4KRA A;  1Q9F A;  3AAA B;  2YPV A;  4O3Y A;  3PQU A;  4RJW A;  3AA7 B;  2W81 C;  4FZN A;  2N2M A;  1GFO A;  5JDP A;  4N59 A;  1QJ9 A;  3TZG A;  2F1T A;  3AA1 A;  5FVN A;  4O3Z A;  2Y0H A;  4D65 A;  4LSF A;  4AYE C;  1BH3 A;  1ZHW A;  4LSI A;  5G26 A;  2X27 X;  3POQ A;  3SYS A;  4AYN A;  4N58 A;  3LK3 B;  3AA0 B;  1YS5 A;  3G7G A;  4E1S A;  2XE1 A;  2OMF A;  2Y0L A;  1HXU A;  3PQS A;  3SY7 A;  5EE2 A;  2LFU A;  3LK4 2;  4RLC A;  3AA6 B;  2XG6 A;  2KZ7 B;  3HOE A;  3AAA A;  3UPG A;  3LK4 1;  1MM5 A;  1ZHY A;  1MM4 A;  3VY8 X;  3SZV A;  5DL5 A;  2ERV A;  4GCQ A;  4AYI D;  1QJ8 A;  1ZHZ A;  4BUM X;  2GE4 A;  5ADX L;  2POR A;  4O49 A;  2MNH A;  3VE1 A;  2PRN A;  4AKM A;  4Z3T A;  1P4T A;  2K0L A;  3VZW X;  4JCH A;  3LK2 A;  4FZM A;  4XNL A;  3VE2 A;  2N2L A;  4O4X A;  3VZT X;  3WI4 A;  4AYM C;  4B61 A;  3POR A;  3AAE A;  3EMN X;  4RL9 A;  3GP6 A;  3T0S A;  4C69 X;  1PHO A;  4FES A;  4RJX A;  5AFU L;  1G90 A;  2XTQ A;  6PRN A;  2XE5 A;  4KR4 A;  4FRT A;  1QJP A;  2Y0K A;  2KC0 A;  4QQ1 A;  5IYU A;  1IZN A;  4F4B A;  5PRN A;  3QRA A;  3PRN A;  3O0E A;  4GCP A;  2QTK A;  1BT9 A;  4AKR B;  2ZLD A;  4AKR A;  4AUI A;  1ZHT A;  3POU A;  4FSO A;  2YNK A;  2FGR A;  2FGQ X;  1IZN B;  1OSM A;  4AZL A;  2XMX A;  3AA6 A;  3VZU X;  1BXW A;  3FYX A;  2M06 A;  3POX A;  2JMM A;  5D5D A;  4G75 A;  3RBH A;  4G76 A;  3VY9 X;  5DL7 A;  3AA0 A;  2Y7S A;  2ZFG A;  1ZHX A;  2XE3 A;  3KVD D;  3DA4 A;  4KR8 A;  3JTY A;  1PRN A;  3V8U A;  1GFN A;  2F1V A;  8PRN A;  3AA1 B;  2W80 C;  1HXX A;  2O4V A;  1THQ A;  4RLB A;  1GFP A;  2M07 A;  1GFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...