2GE4A

High-resolution solution structure of outer membrane protein a transmembrane domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
177
structure length
177
Chain Sequence
b'MAPKDNTWYTGAKLGFSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDFLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVFRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQFTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein A
publication title Increasing the accuracy of solution NMR structures of membrane proteins by application of residual dipolar couplings. High-resolution structure of outer membrane protein A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 17
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01389 OmpA_membrane OmpA-like transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2ge4A00
2M07A 1Q9FA 2MHLA 2F1VA 2ERVA 2MNHA 4RLCA 2GE4A 1QJPA 1MM5A 1Q9GA 2N2MA 3C5OA 2LHFA 3QRCA 2X27X 1G90A 1ORMA 2K0LA 2F1TA 3GP6A 4PUXA 3G7GA 1P4TA 2JMMA 1QJ8A 1QJ9A 1THQA 1BXWA 2N2LA 2M06A 3QRAA 1MM4A
chains in the Genus database with same CATH superfamily
2M07A 1E54A 4K3CA 1HXXA 3AAAA 4KRAA 3HOEA 2XE1A 4RJWA 2R89A 1ZHTA 3DWOX 5AFUK 2R88A 4RLCA 3LK41 2W80C 2WJRA 2IWVA 2Y7SA 3AAEB 5FVNA 4D5UA 1Q9GA 2QTKA 2K4TA 2Y2XA 3POXA 4PJ0O 4AKMA 4RL9A 3VY8X 4FRTA 1T1LA 3AA0B 5DL5A 4FUVA 4LSIA 2W81C 5DL7A 2ZLDA 3T20A 3AA7A 1BH3A 5B5EO 2LFUA 1OSMA 3BS0A 3JCUO 4BUMX 4E1SA 5B66O 1PRNA 3A2SX 3PGSA 2KZ7A 4N75A 4O49A 4RJXA 4FRXA 1IZNA 3SYBA 1HXUA 2XMXA 4XNKA 5GTHO 3LK3B 3SZVA 4N58A 2JMMA 4RLBA 5PRNA 2XE5A 2N2LA 2YNKA 4FSOA 2WVPA 3LK2B 3PF1A 4KR8A 4AYEC 3RBHA 3JTYA 2KXPB 3NSGA 3PGRA 1Q9FA 4UB8O 4AKRB 3PQSA 2R4OA 4C69X 1QJPA 4UB6O 3VY9X 2R4PA 4GF4A 3VZTX 4CTDA 4JCHA 3UAQA 2N2MA 8PRNA 5IYUA 3WU2O 4D65A 4O4XA 3DA4A 3LK42 5G26A 5G39A 4FMSA 2K0LA 2ZFGA 3BRZA 3PRNA 4FQEA 2Y0LA 3SY7A 2WJQA 5DL8A 4FOZA 3SZDA 3G7GA 2R4LA 2R8AA 4GCQA 4C4VA 3LK3A 3EMNX 4FSPA 3HOLA 4C00A 3HW9A 4FZMA 3LK2A 3AA6B 5TISO 4U9CA 1MM4A 3WI5A 4AYDC 2KXPA 4O4UA 5EE2A 4Z3TA 2J1NA 5GV0A 2J4UP 2KC0A 4GCPA 4QQ1A 2OMFA 4AYID 2MNHA 2JQYA 4KR4A 3AAEA 4FZLA 2FGRA 2LHFA 2YPVA 3DZMA 3QRCA 1PHOA 4XNLA 4AFKA 1ZHXA 4G75A 3KVDD 2ODJA 2AXTO 3AA0A 1G90A 3POQA 4AUIA 3HWBA 3POUA 2PRNA 2XG6A 3GP6A 1OPFA 3PGUA 4N74A 5G3AA 5T5FA 4PUXA 4AYMC 2F1CX 3DWNA 4AZLA 1S5LO 5KAFO 3AA1B 5E79O 5GTIO 6PRNA 1P4TA 2FGQX 3O0EA 5G38A 5AFUL 7PRNA 3NJTA 3VE1A 4AYNA 2PORA 1QJ9A 1THQA 1YS5A 1BXWA 2Y0KA 3FYXA 4IL6O 4O3YA 5ADXK 4LSEA 2IWWA 2XE3A 3AA6A 3DA3A 3K19A 4G76A 1GFMA 4O3XB 3A0HO 3AAAB 3TZGA 2MHLA 4GCSA 4E1TA 4F4BA 4AKRA 4GHBA 1HXTA 2F1VA 2ERVA 1ZHWA 4FESA 4N59A 5JDPA 2GE4A 3SYSA 3VE2A 1MM5A 4LSFA 4PR7A 3PQUA 3C5OA 2KDYA 3SY9A 3A0BO 1ZHYA 4FT6A 4FZNA 3T24A 2X9KA 1GFOA 2X27X 2XTQA 3V8UA 5D5DA 3VZWX 2XE2A 4O3ZA 1ORMA 1GFPA 1MPFA 2R4NA 3AA7B 4K3BA 2XTRA 4O3WA 5H2FO 4LSHA 2F1TA 3PORA 5KAIO 1H6S1 1T16A 3WI4A 4B61A 3UPGA 2KZ7B 4C4VB 3AA1A 1IZNB 4D64A 5DL6A 1GFQA 3UU2A 1BT9A 3KZIO 3T0SA 1QJ8A 2O4VA 5ADXL 4JFBA 3VZUX 1GFNA 1ZHZA 2M06A 2Y0HA 3BRYA 3QRAA
chains in the Genus database with same CATH topology
2M07A 1E54A 1HXXA 3AAAA 4KRAA 3HOEA 2XE1A 4RJWA 1ZHTA 5AFUK 4RLCA 8PRNA 3LK41 2W80C 2Y7SA 4D5UA 3AAEB 5FVNA 1Q9GA 2QTKA 2K4TA 2Y2XA 3POXA 4AKMA 4RL9A 3VY8X 4FRTA 3AA0B 5DL5A 4FUVA 4LSIA 2W81C 5DL7A 2ZLDA 3T20A 3AA7A 1BH3A 2LFUA 1OSMA 4BUMX 4E1SA 1PRNA 3A2SX 4O49A 2KZ7A 4RJXA 3SYBA 4FRXA 1IZNA 1HXUA 2XMXA 4XNKA 3LK3B 3SZVA 4N58A 2JMMA 4RLBA 5PRNA 2XE5A 2N2LA 2YNKA 4FSOA 3LK2B 4KR8A 4AYEC 3RBHA 3JTYA 2KXPB 3NSGA 4AKRB 1Q9FA 3PQSA 4C69X 1QJPA 3VY9X 3VZTX 4GF4A 4JCHA 3UAQA 2N2MA 4D65A 4O4XA 3DA4A 3LK42 5G26A 4FMSA 2K0LA 2ZFGA 3PRNA 2Y0LA 3SY7A 3SZDA 5DL8A 4FOZA 3G7GA 4GCQA 3LK3A 3EMNX 4FSPA 3HOLA 3HW9A 4FZMA 3LK2A 3AA6B 4U9CA 1MM4A 3WI5A 4AYDC 2KXPA 4O4UA 5EE2A 4Z3TA 2J1NA 5GV0A 2J4UP 2KC0A 4GCPA 4QQ1A 2OMFA 4AYID 2MNHA 4KR4A 3AAEA 4FZLA 2FGRA 2LHFA 2YPVA 3QRCA 4XNLA 1PHOA 4AFKA 1ZHXA 4G75A 3KVDD 2ODJA 3AA0A 1G90A 3POQA 4AUIA 3HWBA 3POUA 2PRNA 2XG6A 3GP6A 1OPFA 4AYMC 5ADXL 5T5FA 5IYUA 4PUXA 4AZLA 3AA1B 6PRNA 1P4TA 2FGQX 3O0EA 5AFUL 7PRNA 3VE1A 4AYNA 2PORA 1QJ9A 1THQA 1YS5A 1BXWA 2Y0KA 3FYXA 5ADXK 4O3YA 4LSEA 2XE3A 3AA6A 3DA3A 3K19A 4G76A 1GFMA 4O3XB 3AAAB 3TZGA 2MHLA 4GCSA 4F4BA 4AKRA 4GHBA 1HXTA 2F1VA 2ERVA 1ZHWA 4FESA 4N59A 5JDPA 2GE4A 3SYSA 3VE2A 1MM5A 4LSFA 3PQUA 3C5OA 2KDYA 3SY9A 3T24A 1ZHYA 4FT6A 4FZNA 3V8UA 2XTQA 1GFOA 2X27X 3VZWX 4E1TA 5D5DA 2XE2A 4O3ZA 1ORMA 1GFPA 1MPFA 3AA7B 4O3WA 2XTRA 4LSHA 2F1TA 3PORA 4B61A 1H6S1 3UPGA 3WI4A 2KZ7B 3AA1A 1IZNB 4D64A 5DL6A 1GFQA 3UU2A 1BT9A 3T0SA 1QJ8A 2O4VA 4JFBA 3VZUX 1GFNA 1ZHZA 2M06A 2Y0HA 3QRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M07 A;  1Q9F A;  2MHL A;  2F1V A;  2ERV A;  2MNH A;  4RLC A;  2GE4 A;  1QJP A;  1MM5 A;  1Q9G A;  2N2M A;  3C5O A;  2LHF A;  3QRC A;  2X27 X;  1G90 A;  1ORM A;  2K0L A;  2F1T A;  3GP6 A;  4PUX A;  3G7G A;  1P4T A;  2JMM A;  1QJ8 A;  1QJ9 A;  1THQ A;  1BXW A;  2N2L A;  2M06 A;  3QRA A;  1MM4 A; 
#chains in the Genus database with same CATH topology
 2M07 A;  1E54 A;  4K3C A;  1HXX A;  3AAA A;  4KRA A;  3HOE A;  2XE1 A;  4RJW A;  2R89 A;  1ZHT A;  3DWO X;  5AFU K;  2R88 A;  4RLC A;  3LK4 1;  2W80 C;  2WJR A;  2IWV A;  2Y7S A;  3AAE B;  5FVN A;  4D5U A;  1Q9G A;  2QTK A;  2K4T A;  2Y2X A;  3POX A;  4PJ0 O;  4AKM A;  4RL9 A;  3VY8 X;  4FRT A;  1T1L A;  3AA0 B;  5DL5 A;  4FUV A;  4LSI A;  2W81 C;  5DL7 A;  2ZLD A;  3T20 A;  3AA7 A;  1BH3 A;  5B5E O;  2LFU A;  1OSM A;  3BS0 A;  3JCU O;  4BUM X;  4E1S A;  5B66 O;  1PRN A;  3A2S X;  3PGS A;  2KZ7 A;  4N75 A;  4O49 A;  4RJX A;  4FRX A;  1IZN A;  3SYB A;  1HXU A;  2XMX A;  4XNK A;  5GTH O;  3LK3 B;  3SZV A;  4N58 A;  2JMM A;  4RLB A;  5PRN A;  2XE5 A;  2N2L A;  2YNK A;  4FSO A;  2WVP A;  3LK2 B;  3PF1 A;  4KR8 A;  4AYE C;  3RBH A;  3JTY A;  2KXP B;  3NSG A;  3PGR A;  1Q9F A;  4UB8 O;  4AKR B;  3PQS A;  2R4O A;  4C69 X;  1QJP A;  4UB6 O;  3VY9 X;  2R4P A;  4GF4 A;  3VZT X;  4CTD A;  4JCH A;  3UAQ A;  2N2M A;  8PRN A;  5IYU A;  3WU2 O;  4D65 A;  4O4X A;  3DA4 A;  3LK4 2;  5G26 A;  5G39 A;  4FMS A;  2K0L A;  2ZFG A;  3BRZ A;  3PRN A;  4FQE A;  2Y0L A;  3SY7 A;  2WJQ A;  5DL8 A;  4FOZ A;  3SZD A;  3G7G A;  2R4L A;  2R8A A;  4GCQ A;  4C4V A;  3LK3 A;  3EMN X;  4FSP A;  3HOL A;  4C00 A;  3HW9 A;  4FZM A;  3LK2 A;  3AA6 B;  5TIS O;  4U9C A;  1MM4 A;  3WI5 A;  4AYD C;  2KXP A;  4O4U A;  5EE2 A;  4Z3T A;  2J1N A;  5GV0 A;  2J4U P;  2KC0 A;  4GCP A;  4QQ1 A;  2OMF A;  4AYI D;  2MNH A;  2JQY A;  4KR4 A;  3AAE A;  4FZL A;  2FGR A;  2LHF A;  2YPV A;  3DZM A;  3QRC A;  1PHO A;  4XNL A;  4AFK A;  1ZHX A;  4G75 A;  3KVD D;  2ODJ A;  2AXT O;  3AA0 A;  1G90 A;  3POQ A;  4AUI A;  3HWB A;  3POU A;  2PRN A;  2XG6 A;  3GP6 A;  1OPF A;  3PGU A;  4N74 A;  5G3A A;  5T5F A;  4PUX A;  4AYM C;  2F1C X;  3DWN A;  4AZL A;  1S5L O;  5KAF O;  3AA1 B;  5E79 O;  5GTI O;  6PRN A;  1P4T A;  2FGQ X;  3O0E A;  5G38 A;  5AFU L;  7PRN A;  3NJT A;  3VE1 A;  4AYN A;  2POR A;  1QJ9 A;  1THQ A;  1YS5 A;  1BXW A;  2Y0K A;  3FYX A;  4IL6 O;  4O3Y A;  5ADX K;  4LSE A;  2IWW A;  2XE3 A;  3AA6 A;  3DA3 A;  3K19 A;  4G76 A;  1GFM A;  4O3X B;  3A0H O;  3AAA B;  3TZG A;  2MHL A;  4GCS A;  4E1T A;  4F4B A;  4AKR A;  4GHB A;  1HXT A;  2F1V A;  2ERV A;  1ZHW A;  4FES A;  4N59 A;  5JDP A;  2GE4 A;  3SYS A;  3VE2 A;  1MM5 A;  4LSF A;  4PR7 A;  3PQU A;  3C5O A;  2KDY A;  3SY9 A;  3A0B O;  1ZHY A;  4FT6 A;  4FZN A;  3T24 A;  2X9K A;  1GFO A;  2X27 X;  2XTQ A;  3V8U A;  5D5D A;  3VZW X;  2XE2 A;  4O3Z A;  1ORM A;  1GFP A;  1MPF A;  2R4N A;  3AA7 B;  4K3B A;  2XTR A;  4O3W A;  5H2F O;  4LSH A;  2F1T A;  3POR A;  5KAI O;  1H6S 1;  1T16 A;  3WI4 A;  4B61 A;  3UPG A;  2KZ7 B;  4C4V B;  3AA1 A;  1IZN B;  4D64 A;  5DL6 A;  1GFQ A;  3UU2 A;  1BT9 A;  3KZI O;  3T0S A;  1QJ8 A;  2O4V A;  5ADX L;  4JFB A;  3VZU X;  1GFN A;  1ZHZ A;  2M06 A;  2Y0H A;  3BRY A;  3QRA A; 
#chains in the Genus database with same CATH homology
 2M07 A;  1E54 A;  1HXX A;  3AAA A;  4KRA A;  3HOE A;  2XE1 A;  4RJW A;  1ZHT A;  5AFU K;  4RLC A;  8PRN A;  3LK4 1;  2W80 C;  2Y7S A;  4D5U A;  3AAE B;  5FVN A;  1Q9G A;  2QTK A;  2K4T A;  2Y2X A;  3POX A;  4AKM A;  4RL9 A;  3VY8 X;  4FRT A;  3AA0 B;  5DL5 A;  4FUV A;  4LSI A;  2W81 C;  5DL7 A;  2ZLD A;  3T20 A;  3AA7 A;  1BH3 A;  2LFU A;  1OSM A;  4BUM X;  4E1S A;  1PRN A;  3A2S X;  4O49 A;  2KZ7 A;  4RJX A;  3SYB A;  4FRX A;  1IZN A;  1HXU A;  2XMX A;  4XNK A;  3LK3 B;  3SZV A;  4N58 A;  2JMM A;  4RLB A;  5PRN A;  2XE5 A;  2N2L A;  2YNK A;  4FSO A;  3LK2 B;  4KR8 A;  4AYE C;  3RBH A;  3JTY A;  2KXP B;  3NSG A;  4AKR B;  1Q9F A;  3PQS A;  4C69 X;  1QJP A;  3VY9 X;  3VZT X;  4GF4 A;  4JCH A;  3UAQ A;  2N2M A;  4D65 A;  4O4X A;  3DA4 A;  3LK4 2;  5G26 A;  4FMS A;  2K0L A;  2ZFG A;  3PRN A;  2Y0L A;  3SY7 A;  3SZD A;  5DL8 A;  4FOZ A;  3G7G A;  4GCQ A;  3LK3 A;  3EMN X;  4FSP A;  3HOL A;  3HW9 A;  4FZM A;  3LK2 A;  3AA6 B;  4U9C A;  1MM4 A;  3WI5 A;  4AYD C;  2KXP A;  4O4U A;  5EE2 A;  4Z3T A;  2J1N A;  5GV0 A;  2J4U P;  2KC0 A;  4GCP A;  4QQ1 A;  2OMF A;  4AYI D;  2MNH A;  4KR4 A;  3AAE A;  4FZL A;  2FGR A;  2LHF A;  2YPV A;  3QRC A;  4XNL A;  1PHO A;  4AFK A;  1ZHX A;  4G75 A;  3KVD D;  2ODJ A;  3AA0 A;  1G90 A;  3POQ A;  4AUI A;  3HWB A;  3POU A;  2PRN A;  2XG6 A;  3GP6 A;  1OPF A;  4AYM C;  5ADX L;  5T5F A;  5IYU A;  4PUX A;  4AZL A;  3AA1 B;  6PRN A;  1P4T A;  2FGQ X;  3O0E A;  5AFU L;  7PRN A;  3VE1 A;  4AYN A;  2POR A;  1QJ9 A;  1THQ A;  1YS5 A;  1BXW A;  2Y0K A;  3FYX A;  5ADX K;  4O3Y A;  4LSE A;  2XE3 A;  3AA6 A;  3DA3 A;  3K19 A;  4G76 A;  1GFM A;  4O3X B;  3AAA B;  3TZG A;  2MHL A;  4GCS A;  4F4B A;  4AKR A;  4GHB A;  1HXT A;  2F1V A;  2ERV A;  1ZHW A;  4FES A;  4N59 A;  5JDP A;  2GE4 A;  3SYS A;  3VE2 A;  1MM5 A;  4LSF A;  3PQU A;  3C5O A;  2KDY A;  3SY9 A;  3T24 A;  1ZHY A;  4FT6 A;  4FZN A;  3V8U A;  2XTQ A;  1GFO A;  2X27 X;  3VZW X;  4E1T A;  5D5D A;  2XE2 A;  4O3Z A;  1ORM A;  1GFP A;  1MPF A;  3AA7 B;  4O3W A;  2XTR A;  4LSH A;  2F1T A;  3POR A;  4B61 A;  1H6S 1;  3UPG A;  3WI4 A;  2KZ7 B;  3AA1 A;  1IZN B;  4D64 A;  5DL6 A;  1GFQ A;  3UU2 A;  1BT9 A;  3T0S A;  1QJ8 A;  2O4V A;  4JFB A;  3VZU X;  1GFN A;  1ZHZ A;  2M06 A;  2Y0H A;  3QRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...