2GE4A

High-resolution solution structure of outer membrane protein a transmembrane domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
177
structure length
177
Chain Sequence
MAPKDNTWYTGAKLGFSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDFLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVFRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQFTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein A
publication title Increasing the accuracy of solution NMR structures of membrane proteins by application of residual dipolar couplings. High-resolution structure of outer membrane protein A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 17
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01389 OmpA_membrane OmpA-like transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2ge4A00
4RLCA 1ORMA 1Q9FA 2F1VA 2MHLA 2N2MA 3QRAA 1QJ9A 3QRCA 1QJPA 1QJ8A 3C5OA 1THQA 2LHFA 3G7GA 2GE4A 2MNHA 2JMMA 2M07A 2F1TA 2M06A 4PUXA 1MM5A 1Q9GA 1BXWA 1G90A 2K0LA 1MM4A 2ERVA 3GP6A 2X27X 1P4TA 2N2LA
chains in the Genus database with same CATH superfamily
3NJTA 3RBHA 3VE1A 4LSIA 4G76A 2N2MA 1MPFA 3PQUA 3QRAA 4FUVA 4FZNA 5E79O 4K3BA 3PGSA 5AFUL 1ZHZA 1QJPA 4JCHA 3VZWX 4O3ZA 2YNKA 3AA0B 3VY9X 4PJ0O 4O3YA 4O3XB 3G7GA 3NSGA 3UAQA 3WI4A 4AUIA 4AYID 3JCUO 4K3CA 4AYDC 2GE4A 3EMNX 5IYUA 2MNHA 4PR7A 2PORA 3AAAA 4N74A 1G90A 2FGRA 2K0LA 3LK3A 1T16A 4BUMX 3BS0A 2XE1A 4LSHA 3DZMA 1ZHYA 2Y0KA 5TISO 4U9CA 3SZDA 2X27X 3JTYA 2R89A 4AYEC 2W81C 2WJQA 3LK2B 4GCQA 2KZ7B 3BRZA 4QQ1A 5KAIO 3PF1A 4AFKA 2Y0HA 2X9KA 3O0EA 1Q9FA 2F1VA 1BT9A 1IZNB 2KC0A 3QRCA 3LK41 1GFNA 5DL8A 2XE3A 5AFUK 5FVNA 4FSPA 5JDPA 1S5LO 1T1LA 3AA7A 4FESA 4GHBA 2R4LA 2Y2XA 2AXTO 3AA1A 4KR8A 8PRNA 5H2FO 2FGQX 5GTHO 2KXPA 4O4UA 3FYXA 5DL6A 5GV0A 2F1CX 3AAEB 3KVDD 4AKRA 2F1TA 2M06A 4RJXA 3POQA 1Q9GA 4C4VA 2R8AA 3T0SA 1BXWA 3LK42 4O49A 2ZFGA 5ADXK 3SYBA 4CTDA 5G3AA 4AKMA 2ERVA 2Y0LA 4FRXA 5G38A 3HW9A 1PRNA 5G26A 2XTRA 4AYMC 3VZUX 3PORA 1GFQA 3A2SX 3AA6A 4RLCA 4C00A 3POXA 6PRNA 5D5DA 4FRTA 5B5EO 2W80C 4FT6A 3SY9A 1QJ9A 4XNKA 4GCPA 3WI5A 3BRYA 4KRAA 5PRNA 3VZTX 2WJRA 1BH3A 4AYNA 3HWBA 1THQA 2O4VA 2XE5A 2XG6A 4FSOA 4N58A 4F4BA 5B66O 2XMXA 2J4UP 4RL9A 3V8UA 3T20A 3WU2O 3AAAB 1YS5A 3PGUA 4KR4A 2Y7SA 3AA0A 2K4TA 3LK3B 2JMMA 2M07A 2R4PA 4FZMA 4RLBA 5T5FA 3VE2A 4UB6O 2LFUA 4PUXA 2IWVA 4FOZA 1GFOA 3SYSA 1OSMA 2WVPA 4C69X 4D5UA 2XE2A 4LSEA 4AZLA 1MM4A 4IL6O 5KAFO 3PRNA 7PRNA 2R88A 3DA3A 2QTKA 4FZLA 3DWNA 4G75A 1ZHXA 1GFMA 3DA4A 3GP6A 3K19A 4RJWA 4O4XA 3DWOX 3HOLA 4UB8O 1ORMA 1H6S1 1HXXA 3AA7B 3POUA 2MHLA 1GFPA 4FMSA 3HOEA 2R4OA 3AA1B 3PGRA 1ZHTA 3KZIO 3LK2A 2KZ7A 4D64A 1QJ8A 3C5OA 4JFBA 1ZHWA 2OMFA 4XNLA 2KXPB 2KDYA 4GF4A 3SY7A 1IZNA 2LHFA 3UU2A 4AKRB 2IWWA 2ODJA 2JQYA 4C4VB 2R4NA 3A0HO 4N59A 1HXUA 3T24A 3A0BO 4LSFA 1OPFA 4B61A 4O3WA 5ADXL 1HXTA 4N75A 5DL7A 1MM5A 5G39A 1PHOA 3UPGA 2PRNA 2XTQA 5DL5A 2ZLDA 3PQSA 4D65A 3TZGA 3AAEA 4Z3TA 2J1NA 3AA6B 2YPVA 4E1SA 3VY8X 4GCSA 1P4TA 2N2LA 4FQEA 3SZVA 1E54A 4E1TA 5EE2A 5GTIO
chains in the Genus database with same CATH topology
3RBHA 3VE1A 4LSIA 4G76A 2N2MA 1MPFA 3PQUA 3QRAA 4FUVA 4FZNA 5AFUL 1ZHZA 1QJPA 4JCHA 3VZWX 4O3ZA 2YNKA 3AA0B 3VY9X 4O3YA 4O3XB 3G7GA 3NSGA 3UAQA 3WI4A 4AUIA 4AYID 4AYDC 2GE4A 3EMNX 5IYUA 2MNHA 2PORA 3AAAA 1G90A 2FGRA 2K0LA 3LK3A 4BUMX 4LSHA 2XE1A 1ZHYA 2Y0KA 4U9CA 3SZDA 2X27X 3JTYA 4AYEC 2W81C 3LK2B 4GCQA 4QQ1A 2KZ7B 4AFKA 2Y0HA 3O0EA 1Q9FA 2F1VA 1BT9A 1IZNB 2KC0A 3QRCA 3LK41 1GFNA 5DL8A 2XE3A 5AFUK 5FVNA 4FSPA 5JDPA 3AA7A 4FESA 4GHBA 2Y2XA 3AA1A 8PRNA 4KR8A 2FGQX 5GV0A 2KXPA 4O4UA 3FYXA 5DL6A 3AAEB 3KVDD 4AKRA 2F1TA 2M06A 4RJXA 3POQA 1Q9GA 3T0SA 1BXWA 3LK42 4O49A 2ZFGA 5ADXK 3SYBA 4AKMA 2ERVA 2Y0LA 4FRXA 3HW9A 1PRNA 5G26A 2XTRA 4AYMC 3VZUX 3PORA 1GFQA 3A2SX 3AA6A 4RLCA 3POXA 6PRNA 5D5DA 4FRTA 2W80C 4FT6A 3SY9A 1QJ9A 4XNKA 4GCPA 3WI5A 4KRAA 5PRNA 3VZTX 1BH3A 4AYNA 3HWBA 1THQA 2O4VA 2XE5A 2XG6A 4FSOA 4N58A 4F4BA 2J4UP 2XMXA 3T20A 4RL9A 3V8UA 3AAAB 1YS5A 4KR4A 2Y7SA 3AA0A 2K4TA 3LK3B 2JMMA 2M07A 3VE2A 4FZMA 4RLBA 5T5FA 2LFUA 4PUXA 4FOZA 1GFOA 3SYSA 1OSMA 4C69X 4D5UA 2XE2A 4LSEA 4AZLA 1MM4A 7PRNA 3PRNA 3DA3A 2QTKA 4FZLA 4G75A 1ZHXA 1GFMA 3DA4A 3GP6A 3K19A 4RJWA 4O4XA 3HOLA 1ORMA 1H6S1 1HXXA 3AA7B 3POUA 2MHLA 1GFPA 4FMSA 3HOEA 3AA1B 1ZHTA 3LK2A 4D64A 2KZ7A 1QJ8A 3C5OA 4JFBA 1ZHWA 2OMFA 4XNLA 2KXPB 2KDYA 4GF4A 3SY7A 1IZNA 2LHFA 3UU2A 4AKRB 2ODJA 4N59A 1HXUA 3T24A 4LSFA 1OPFA 4B61A 4O3WA 5ADXL 1HXTA 5DL7A 1MM5A 1PHOA 3UPGA 2PRNA 2XTQA 5DL5A 2ZLDA 3PQSA 4D65A 3TZGA 3AAEA 4Z3TA 2J1NA 3AA6B 2YPVA 4E1SA 3VY8X 4GCSA 1P4TA 2N2LA 3SZVA 1E54A 4E1TA 5EE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RLC A;  1ORM A;  1Q9F A;  2F1V A;  2MHL A;  2N2M A;  3QRA A;  1QJ9 A;  3QRC A;  1QJP A;  1QJ8 A;  3C5O A;  1THQ A;  2LHF A;  3G7G A;  2GE4 A;  2MNH A;  2JMM A;  2M07 A;  2F1T A;  2M06 A;  4PUX A;  1MM5 A;  1Q9G A;  1BXW A;  1G90 A;  2K0L A;  1MM4 A;  2ERV A;  3GP6 A;  2X27 X;  1P4T A;  2N2L A; 
#chains in the Genus database with same CATH topology
 3NJT A;  3RBH A;  3VE1 A;  4LSI A;  4G76 A;  2N2M A;  1MPF A;  3PQU A;  3QRA A;  4FUV A;  4FZN A;  5E79 O;  4K3B A;  3PGS A;  5AFU L;  1ZHZ A;  1QJP A;  4JCH A;  3VZW X;  4O3Z A;  2YNK A;  3AA0 B;  3VY9 X;  4PJ0 O;  4O3Y A;  4O3X B;  3G7G A;  3NSG A;  3UAQ A;  3WI4 A;  4AUI A;  4AYI D;  3JCU O;  4K3C A;  4AYD C;  2GE4 A;  3EMN X;  5IYU A;  2MNH A;  4PR7 A;  2POR A;  3AAA A;  4N74 A;  1G90 A;  2FGR A;  2K0L A;  3LK3 A;  1T16 A;  4BUM X;  3BS0 A;  2XE1 A;  4LSH A;  3DZM A;  1ZHY A;  2Y0K A;  5TIS O;  4U9C A;  3SZD A;  2X27 X;  3JTY A;  2R89 A;  4AYE C;  2W81 C;  2WJQ A;  3LK2 B;  4GCQ A;  2KZ7 B;  3BRZ A;  4QQ1 A;  5KAI O;  3PF1 A;  4AFK A;  2Y0H A;  2X9K A;  3O0E A;  1Q9F A;  2F1V A;  1BT9 A;  1IZN B;  2KC0 A;  3QRC A;  3LK4 1;  1GFN A;  5DL8 A;  2XE3 A;  5AFU K;  5FVN A;  4FSP A;  5JDP A;  1S5L O;  1T1L A;  3AA7 A;  4FES A;  4GHB A;  2R4L A;  2Y2X A;  2AXT O;  3AA1 A;  4KR8 A;  8PRN A;  5H2F O;  2FGQ X;  5GTH O;  2KXP A;  4O4U A;  3FYX A;  5DL6 A;  5GV0 A;  2F1C X;  3AAE B;  3KVD D;  4AKR A;  2F1T A;  2M06 A;  4RJX A;  3POQ A;  1Q9G A;  4C4V A;  2R8A A;  3T0S A;  1BXW A;  3LK4 2;  4O49 A;  2ZFG A;  5ADX K;  3SYB A;  4CTD A;  5G3A A;  4AKM A;  2ERV A;  2Y0L A;  4FRX A;  5G38 A;  3HW9 A;  1PRN A;  5G26 A;  2XTR A;  4AYM C;  3VZU X;  3POR A;  1GFQ A;  3A2S X;  3AA6 A;  4RLC A;  4C00 A;  3POX A;  6PRN A;  5D5D A;  4FRT A;  5B5E O;  2W80 C;  4FT6 A;  3SY9 A;  1QJ9 A;  4XNK A;  4GCP A;  3WI5 A;  3BRY A;  4KRA A;  5PRN A;  3VZT X;  2WJR A;  1BH3 A;  4AYN A;  3HWB A;  1THQ A;  2O4V A;  2XE5 A;  2XG6 A;  4FSO A;  4N58 A;  4F4B A;  5B66 O;  2XMX A;  2J4U P;  4RL9 A;  3V8U A;  3T20 A;  3WU2 O;  3AAA B;  1YS5 A;  3PGU A;  4KR4 A;  2Y7S A;  3AA0 A;  2K4T A;  3LK3 B;  2JMM A;  2M07 A;  2R4P A;  4FZM A;  4RLB A;  5T5F A;  3VE2 A;  4UB6 O;  2LFU A;  4PUX A;  2IWV A;  4FOZ A;  1GFO A;  3SYS A;  1OSM A;  2WVP A;  4C69 X;  4D5U A;  2XE2 A;  4LSE A;  4AZL A;  1MM4 A;  4IL6 O;  5KAF O;  3PRN A;  7PRN A;  2R88 A;  3DA3 A;  2QTK A;  4FZL A;  3DWN A;  4G75 A;  1ZHX A;  1GFM A;  3DA4 A;  3GP6 A;  3K19 A;  4RJW A;  4O4X A;  3DWO X;  3HOL A;  4UB8 O;  1ORM A;  1H6S 1;  1HXX A;  3AA7 B;  3POU A;  2MHL A;  1GFP A;  4FMS A;  3HOE A;  2R4O A;  3AA1 B;  3PGR A;  1ZHT A;  3KZI O;  3LK2 A;  2KZ7 A;  4D64 A;  1QJ8 A;  3C5O A;  4JFB A;  1ZHW A;  2OMF A;  4XNL A;  2KXP B;  2KDY A;  4GF4 A;  3SY7 A;  1IZN A;  2LHF A;  3UU2 A;  4AKR B;  2IWW A;  2ODJ A;  2JQY A;  4C4V B;  2R4N A;  3A0H O;  4N59 A;  1HXU A;  3T24 A;  3A0B O;  4LSF A;  1OPF A;  4B61 A;  4O3W A;  5ADX L;  1HXT A;  4N75 A;  5DL7 A;  1MM5 A;  5G39 A;  1PHO A;  3UPG A;  2PRN A;  2XTQ A;  5DL5 A;  2ZLD A;  3PQS A;  4D65 A;  3TZG A;  3AAE A;  4Z3T A;  2J1N A;  3AA6 B;  2YPV A;  4E1S A;  3VY8 X;  4GCS A;  1P4T A;  2N2L A;  4FQE A;  3SZV A;  1E54 A;  4E1T A;  5EE2 A;  5GTI O; 
#chains in the Genus database with same CATH homology
 3RBH A;  3VE1 A;  4LSI A;  4G76 A;  2N2M A;  1MPF A;  3PQU A;  3QRA A;  4FUV A;  4FZN A;  5AFU L;  1ZHZ A;  1QJP A;  4JCH A;  3VZW X;  4O3Z A;  2YNK A;  3AA0 B;  3VY9 X;  4O3Y A;  4O3X B;  3G7G A;  3NSG A;  3UAQ A;  3WI4 A;  4AUI A;  4AYI D;  4AYD C;  2GE4 A;  3EMN X;  5IYU A;  2MNH A;  2POR A;  3AAA A;  1G90 A;  2FGR A;  2K0L A;  3LK3 A;  4BUM X;  4LSH A;  2XE1 A;  1ZHY A;  2Y0K A;  4U9C A;  3SZD A;  2X27 X;  3JTY A;  4AYE C;  2W81 C;  3LK2 B;  4GCQ A;  4QQ1 A;  2KZ7 B;  4AFK A;  2Y0H A;  3O0E A;  1Q9F A;  2F1V A;  1BT9 A;  1IZN B;  2KC0 A;  3QRC A;  3LK4 1;  1GFN A;  5DL8 A;  2XE3 A;  5AFU K;  5FVN A;  4FSP A;  5JDP A;  3AA7 A;  4FES A;  4GHB A;  2Y2X A;  3AA1 A;  8PRN A;  4KR8 A;  2FGQ X;  5GV0 A;  2KXP A;  4O4U A;  3FYX A;  5DL6 A;  3AAE B;  3KVD D;  4AKR A;  2F1T A;  2M06 A;  4RJX A;  3POQ A;  1Q9G A;  3T0S A;  1BXW A;  3LK4 2;  4O49 A;  2ZFG A;  5ADX K;  3SYB A;  4AKM A;  2ERV A;  2Y0L A;  4FRX A;  3HW9 A;  1PRN A;  5G26 A;  2XTR A;  4AYM C;  3VZU X;  3POR A;  1GFQ A;  3A2S X;  3AA6 A;  4RLC A;  3POX A;  6PRN A;  5D5D A;  4FRT A;  2W80 C;  4FT6 A;  3SY9 A;  1QJ9 A;  4XNK A;  4GCP A;  3WI5 A;  4KRA A;  5PRN A;  3VZT X;  1BH3 A;  4AYN A;  3HWB A;  1THQ A;  2O4V A;  2XE5 A;  2XG6 A;  4FSO A;  4N58 A;  4F4B A;  2J4U P;  2XMX A;  3T20 A;  4RL9 A;  3V8U A;  3AAA B;  1YS5 A;  4KR4 A;  2Y7S A;  3AA0 A;  2K4T A;  3LK3 B;  2JMM A;  2M07 A;  3VE2 A;  4FZM A;  4RLB A;  5T5F A;  2LFU A;  4PUX A;  4FOZ A;  1GFO A;  3SYS A;  1OSM A;  4C69 X;  4D5U A;  2XE2 A;  4LSE A;  4AZL A;  1MM4 A;  7PRN A;  3PRN A;  3DA3 A;  2QTK A;  4FZL A;  4G75 A;  1ZHX A;  1GFM A;  3DA4 A;  3GP6 A;  3K19 A;  4RJW A;  4O4X A;  3HOL A;  1ORM A;  1H6S 1;  1HXX A;  3AA7 B;  3POU A;  2MHL A;  1GFP A;  4FMS A;  3HOE A;  3AA1 B;  1ZHT A;  3LK2 A;  4D64 A;  2KZ7 A;  1QJ8 A;  3C5O A;  4JFB A;  1ZHW A;  2OMF A;  4XNL A;  2KXP B;  2KDY A;  4GF4 A;  3SY7 A;  1IZN A;  2LHF A;  3UU2 A;  4AKR B;  2ODJ A;  4N59 A;  1HXU A;  3T24 A;  4LSF A;  1OPF A;  4B61 A;  4O3W A;  5ADX L;  1HXT A;  5DL7 A;  1MM5 A;  1PHO A;  3UPG A;  2PRN A;  2XTQ A;  5DL5 A;  2ZLD A;  3PQS A;  4D65 A;  3TZG A;  3AAE A;  4Z3T A;  2J1N A;  3AA6 B;  2YPV A;  4E1S A;  3VY8 X;  4GCS A;  1P4T A;  2N2L A;  3SZV A;  1E54 A;  4E1T A;  5EE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...