2GEDA

Signal recognition particle receptor beta-subunit in nucleotide-free dimerized form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
190
structure length
170
Chain Sequence
b'DGFKFANLEASVVAFEGSINKRKISQWREWIDEKLSYQPSIIIAGPQNSGKTSLLTLLTTDSVRDYDGSGVTLVDFPGHVKLRYKLSDYLKTRAKFVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESSCENGIDILIACNKSELFTARPPSKIKDALESEIQKVIERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor beta subunit
publication title Homodimerization of the G protein SR{beta} in the nucleotide-free state involves proline cis/trans isomerization in the switch II region.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport, signaling protein
total genus 52
structure length 170
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gedA00
221PA 2ZRMA 2ONKA 4PTLA 1ZUIA 2C95A 1DVRA 1OXVA 4E5UA 2Q3HA 1R2QA 1Z6XA 2PX0A 1MO5A 4M8NE 4BECA 1OHHD 4MDEA 3ADKA 4MRSA 4NYIQ 4GI7A 4URZR 1D9XA 2GJAA 2DFKB 1GP2A 3KJIA 3CPEA 4QJ3A 3UIEA 3UWKA 4BLSA 2FX3A 1U98A 2AX4A 2FEMA 3SEAA 4IOJA 1KO5A 4KYIB 2G88A 1N25A 2O5VA 4TTRA 2QQEA 3X1YA 4AKHA 2QL6A 3E5HA 3U3RA 5JZVA 3VNUA 2I4IA 1U94A 3CPHA 5KOYA 3L8ZA 4RZ2A 3IEUA 3WNBA 2EFGA 2CK3D 2ZJOA 4NU0A 1XMSA 1E3MA 2VSOA 1J8YF 4DLXA 5HPYB 2ZSBA 5JRZA 1LS6A 5JWOA 4N0DA 4EPRA 4BLTA 1IJEA 5CIWA 1CR0A 1YZGA 2CL0X 4MKFA 4YDHB 3FOZA 4A82A 4DLUA 3V4FA 4D2IA 1W4BA 3AF3A 4DSNA 1KI7A 3T12A 1BS1A 1XFAA 1GUAA 4QBIA 4D4JA 4QKQA 3GLFB 3GLFA 4IDNA 1MH1A 2WPDA 3AGQA 4LHZA 2C8VA 4QBFA 4HZUB 5CM8B 2PL3A 4HZUA 1YR7A 1R0YA 3B82A 1YR9A 3QF7A 2BJWA 4FN5A 1W0JD 4BEBA 1KTVA 5L8VA 4NHOA 4D80A 2ATXA 2ZRCA 5LBIA 4M21A 2VLIA 2Q9CA 4PC2A 3RS0A 4F93B 3B9PA 2H8KA 2R6AA 4PZYA 1G64A 5EXPA 3RS3A 2IC5A 2NPFA 4DEXA 2RGEA 2P6NA 2ZRDA 4DWJA 4KJZA 2D7DA 2WICA 3NBYC 1XWIA 2BKEA 1P72A 2BM0A 2ZREA 2ZITA 2H18A 2J46A 2YWGA 3NC1C 2EYQA 3Q7QA 3S1AA 4P3YA 4Q1FA 1RRPA 4V0KA 3WYGA 1GIAA 1HA3A 4TLEA 2X77A 1IXZA 3EZFA 1MRSA 4MRVA 2IYUA 4G5QA 3HPRA 3D7MA 4QG7A 3TUIC 4TLAA 2FFAA 4US2R 4ZIRB 1UM8A 3O8CA 4ZIRA 1LW7A 3CF6R 4LBVA 5FBLB 1ZP6A 5JS8A 3L82B 4IVQA 1FZQA 2QAGC 5FFMA 4TMWA 2GF0A 4EJSC 2OFOA 2YVUA 4G01B 1ZW6A 2JJ2D 2G83A 2E1RA 2KI5A 3MWYW 1H8EA 3O8RA 3PV0A 5IF9A 2YC2C 1SVIA 3ASZA 5JFGA 5K8LA 2IYLD 5FBQB 4DXAA 4W5WA 4DLVA 4HATA 1GKYA 2WJHA 2D74A 5CDFE 1Z6YA 3EG5A 3FMFA 3HPQA 4O2RA 3DEFA 3ZZ0A 1QG4A 4DBLC 2DB3A 3PEVA 5A4JA 1XXHE 1KHTA 2AD1A 4OQMA 1Q1EA 5FBVB 5FBWB 2Q6TA 1D2MA 1KKLA 2FF7A 4NBSA 1W0KD 5B64A 3GJXC 1KJWA 2MSDB 4W7SA 2L0XA 1DO2A 4TSFD 5TY0A 1TX4B 3DPUA 4XSHA 1E9AA 1QHIA 2ZRBA 5TDHA 3EIEA 2QENA 2ZUBA 3A4LA 1VG9B 1ZRHA 1UBCA 3H4MA 4PQFA 1OE0A 5DE3A 1Q3HA 2ZRHA 1N6IA 1IHUA 4E03A 2JLZA 4MYTA 1G8FA 1OH6A 1D2NA 3CW2A 4JKYA 4CYMA 1UKEA 4R71A 3CZQA 1ZNWA 4L4UA 1OIVA 1J7KA 5SZHB 4MUBA 4OQXA 3ADDA 1KO4A 1KDTA 1CS4C 3C8UA 3OAAD 4PZZA 2XGJA 2R6CA 2REBA 1KOFA 4YXWD 2HJGA 4LOAA 4Z1MD 2VP9A 3BH7A 1CRQA 2IYQA 5FTMA 5LD2B 3EC1A 3KXKA 3NH6A 3T1OA 2P6RA 2CLSA 4Q1AA 4P32A 4Q66C 3AVXA 1RIFA 1NKTA 2YOGA 3U7EB 1ZNYA 2ECKA 4IOKA 2R6DA 3M1IA 2ZUDA 1P2SA 2E9SA 4JMPA 2JDID 1DEKA 2OCBA 1CLUA 2ERYA 5D3QA 2GZAA 4K46A 3SNHA 3U60B 2GWHA 2XJ9A 1S8FA 5JJIA 5EE9A 3SJBA 2P67A 4LJ7A 4OQNA 4W5JA 3W8RA 3MWKA 2LWIA 3AV0B 1SXJC 2RGNC 4A6XA 3GLHE 3P4XA 4H1VA 3B13B 5CB6A 3SYLA 1EX7A 3FKSD 2WM9B 3A1UA 4N1AA 3TAHA 2OCAA 2GTPA 4R2IA 5GVSA 1YZNA 5KDDA 5KPJA 3FMPB 1G3MA 3MWLA 2DFNA 3WY9A 1VIAA 1EFHA 3CF0A 3D31A 3EPLA 3ICQB 1N5LA 1HY3A 4GMXA 2Q3FA 2W58A 2PCJA 3GJ3A 3REGA 3BORA 2F3TA 4EPWA 4TYWA 4LYHA 2A5DA 2QE7A 3VX3A 2ZVPX 4LBYA 1RRCA 4M9ZA 2WIBA 4R2HA 3I8XA 1E1RD 1II0A 3UMFA 1LNZA 4DDUA 1NVVQ 3K0FB 1K8RA 4Q02A 4B73A 3I5XA 2VHTA 3K0FA 2BMFA 2G9NA 1NN3A 3DOEA 4HLUA 2CNWD 4QC2A 2CL6X 5TVKA 2YOHA 2ZS7A 3BGWA 1E2KA 3IBYA 4N3NA 4OI0A 5ELXA 1DG3A 1KZ7B 3GJ7A 3HU1A 3UG6A 4P4SB 4KVAA 2BKUA 4P4SA 5JMTA 3PJRA 4GZMA 1IN5A 2R62A 3RC8A 3NTUA 4Z8YA 1SVSA 1JI0A 2FFQA 1P73A 2OESA 2FZLA 3EWSA 4Q7MB 5EE1A 2OAP1 3AVOA 4S2EA 4UXJA 1A7JA 1TUIA 1VYTA 2ZEJA 1HTWA 2ODNA 1FQKA 1N5IA 5DGXA 1IJFA 4DLZA 2JLSA 3QXSA 4HLCA 4DT1B 1YE8A 2QP3A 3I8SA 1W2HA 2IYSA 4DT1A 3TSOA 4DCSA 3KB1A 2ZRPA 2RMKA 3U7FB 3ND8A 2VF7A 3IO3A 1AM4D 3ZS9A 1CJMA 1OIWA 2J45A 3AVVA 3GLGE 1QHNA 2PMDA 1UBFA 4UNSA 3VX4A 3N70A 2BBSA 4JLAA 4OHXA 1NN1A 1AN0A 4L15A 1XTKA 4B3GA 2HLDA 2REOA 4US0R 421PA 1OFIA 2P3SA 2JLRA 4I1UA 2QM8A 5DN6A 3BWDD 1W4RA 3TK1A 1Z0FA 5J47A 4LPSA 2Y8EA 4LX0A 4B2IA 2CL7X 3IILA 1I4TD 5F3WB 2Z4RA 2ZYWX 4YMUA 1WCV1 2OV2A 5AWFC 2WJIA 3RWOA 3K0EA 2IYTA 1Q20A 1W5SA 3Q5EA 4NE2A 5CM9C 3VHLB 1T0JB 5KU1A 2WJVA 4DB2A 1A82A 2AD5A 4LI0A 3SU8A 4Q9KA 3TLXA 2CCGA 3PUZA 1QRAA 2JASA 1NLYA 3BC1A 2PZGA 3FMOB 1KSJA 2IS1A 4Q5IA 1RZ3A 2GXUA 4C9BA 4Q9JA 4DRZA 2V8OA 2V3CC 3EA5A 4L9SA 3PFIA 1OFTA 3U7HB 3U6BA 1QHYA 3QVVA 1S2MA 3SR0A 1XMJA 3TVTA 1I2MA 2GVDC 2WAXA 4YMVA 4FW9A 1RE0A 1G16A 1U8YA 3FMIA 1MOZA 2JCSA 2I1VB 5DLQC 1RPZA 2RHMA 1IN8A 4JBXA 4Q1CA 1KMHB 2IX3A 4HI0E 1KO1A 5D3MB 1KMHA 4QBGB 5D3MA 2H57A 1Z47A 4AWXA 3QKUA 4E07A 1U90A 4JLMA 3SHFA 3TJZA 1E2DA 1E0KA 3VR2A 2YWHA 4KBFA 4UNQA 3ZGXA 4LSGA 2YWFA 2VQSA 1G3IA 1XP8A 2SHKA 1AQYA 1R10A 4PX9A 1HH4A 1OF1A 2Z43A 1GG2A 1X86B 3MUFA 2H17A 4DLSA 1G17A 3WMFA 4LJ4A 4CT5A 2F7SA 3FB4A 3DKVA 4MKGA 4A0GA 4Q4LA 4A0RA 4CVNA 3IQWA 4OK5A 3QEJA 2Q9AA 3BERA 4Z54A 5FOXA 1KI3A 4DCNA 3K0SA 5BXQC 1GILA 1VPLA 4LJ5A 1YZTA 4BZQA 1S9HA 4Q1EA 2X1VA 3AVUA 3ONWA 2PBRA 5H68A 1AS0A 3LBHA 2YV5A 3KQKA 4NYMQ 3OHMA 3PEUA 3A1TA 4KI0A 5KSPA 1ODFA 1OPXA 2NOAA 1DAKA 1XTIA 3C15C 4KO8A 1OHHA 3DMDA 2WTUA 2AFHE 1RRGA 2OHFA 821PA 4WXPA 1O3YA 3CRMA 2B7CA 2FFBA 1US8B 2OSBA 1US8A 4D4KA 2IT1A 4WW0A 1GITA 4LWZA 2BEKA 3IPYA 5F9FA 1N6HA 4F38A 1JPNA 2JATA 3WMEA 3THYB 4G3XA 4QNMA 3W3ZB 1SZPA 3O8DA 3SI7A 2ZR9A 2A30A 2BV3A 2BVNA 2OO7A 2GBLA 3SJZA 4Q4HB 2YJTD 1GRNA 4Q4HA 1E2NA 4MGIR 1SKYE 3H1TA 1VCOA 4M4SA 4PAQA 1M2OB 1IXSB 4LPKA 1JAHA 2H92A 3OEEA 1FMJA 3EIHA 3OFND 2CLCX 4XWOA 2QP9X 4Q9LA 4B74A 2F3RA 4ILEA 3M4YA 2CHVA 4Q7JB 1W36D 2IYWA 2OEPA 2ERXA 2F1JA 3NXSA 5SZKB 1XJ0A 2QE7D 2CEAA 5B30A 1XMVA 3CWZA 4Q1BA 2FG5A 4B32A 2WWYA 3NKVA 1WDTA 2XZPA 2QA5A 3LD9A 3ZVRA 2QPAA 4B76A 1AJEA 5C4MA 4GP6A 3AP1A 1X1SA 1BOFA 1EXMA 2XNSA 4W9MC 1DARA 4DUGA 4OI2A 4G5GA 4A8JB 5BN4A 4X8LA 4A8JA 1HQYE 4PAOA 1J70A 1T3HA 3W90A 3QG5A 2W2VA 5EP4A 3RSOA 1IY1A 4LHXA 1M7BA 1KY3A 1E32A 3HR8A 2D7CA 3KL4A 3QKTA 4TWZA 4QNRA 2IF2A 2ZVQX 4GBMA 3CRQA 1GDDA 3WNDA 2QU8A 1P5ZB 3MFYA 5FUXA 1XF9A 5J4KA 4PPQA 1GRQA 2QRNA 1CF4A 3X2SA 2QM7A 4DIDA 5K8TA 2QNRA 4AK9A 4TZ6A 1N6OA 4ZDJA 4RY2A 1CJKC 2QSYA 1JQLB 4V0LA 3QF4B 1U0JA 2IBMA 2J3EA 3U3OA 1R8QA 3HU2A 3QF4A 3LA6A 2N1BA 4ACBA 4DKXA 4FD2A 2GXAA 2FPMA 3QKSB 1UPTA 4UJ3A 3QKSA 1XEFA 2JJ2A 2XB4A 4A4DA 1CJVC 1NVUQ 1KJYA 2O8BB 4JLOA 4M1KA 2ZE5A 3PENA 4KFTA 4M1OA 4M1WA 3ZYCA 4MKIA 3KFVA 1JB1A 5DO9A 1DAHA 1U99A 3LW7A 5EP1A 4V0NA 4JT2A 4OHWA 2JLVA 3PQCA 3CX6A 4LK2A 2NPIA 3KTAB 2ZRKA 4LV5B 2WKPA 5FOWA 3BAFA 3KTAA 1CR1A 2BCJQ 2I3BA 4KXFB 2FNAA 1S1CA 1Q3TA 5DIFA 5FPYA 1P61B 1QF9A 1R0ZA 1FP7A 1XBTA 1S9DA 1E9SA 1ZD9A 5AUNB 3GD7A 3GP8A 4PPGA 1U8AA 2GK6A 3EARA 1CP2A 4M9QA 4BFXA 3QQ5A 5FR1A 4TZ0A 4MDFA 1JEDA 3FGNA 1HURA 4O25A 1E2PA 1P7CA 4GOKA 4NCJA 2PH1A 3MMPA 1KI9A 1E98A 3QEOA 4AC9A 4UJ5A 2UVQA 2QI9C 5C2JB 2ZU0C 2VP0A 2BJVA 4JIMA 2ZSFA 2W0MA 1OB2A 4RFSB 2QSZA 4EPYA 2MSCB 4RFSA 5BN5A 3LVQE 2CCKA 4HB3A 1TQ4A 1ZM4A 2R9VA 1KI1A 2JLWA 4QFMA 2CHQA 4LRWA 3LV8A 4QM6A 4L9WA 1D9ZA 3PXGA 1EFUA 3CX8A 3SE0A 1JJVA 2OFXA 2W83A 3OAAA 4MRNA 3B5JA 3DOFA 1NLFA 1EX6A 3QSYA 4OJQA 1BO6A 4MQBA 5EXSA 1WA5A 4Z1MA 1DE0A 1VMAA 2YNMA 2RGGA 5EQTA 2LKDA 3PCRB 2QGZA 2WWWA 1YRAA 3ZLJA 2Z0MA 2J7KA 1GL9B 3BK7A 3VU9B 4F92B 2Z6VA 4KODA 4CRWB 1YZUA 3VU9A 5H1YA 2OBMA 3KJGA 4TT3D 5FI1B 3K0CA 5JJLA 3AKCA 3RNLA 5JLJA 3SFZA 1XXHB 3ZVNA 1XXHA 2R6FA 2UKDA 2JDIA 1Z22A 2FWRA 1QHSA 1ZCBA 3THOA 3AGPA 3AM1A 3PR1A 3WNCA 2WJJA 2KBEA 3BFXA 1LS1A 3QBVA 1WQ1R 4BLQA 4BRUA 1U9IA 4R7ZA 2QZ4A 1COWA 1I4LD 2P2LA 1PVOA 3R8FA 3FKSA 3AVWA 1T0HB 4X8HA 4G5SA 1JAIA 2GXQA 1NI3A 1R6BX 3PUVA 2CXXA 3I92A 1Z0JA 4M0LA 3K0AB 4ITRC 4RD6A 4XOIA 4PPNA 3K0AA 1Z0DA 2WKQA 2ZRAA 4KYUA 2QMHA 4WVFA 3AH8A 3I3SR 1ZU5A 2GCOB 3R20A 1KNQA 1NRJB 1GM5A 2W0SA 2GCOA 1BMFD 4LBZA 4TL9A 5J40A 1VG0B 4BLRA 1OXXK 3UK6A 1KK1A 1P9RA 1Q1QA 4TYPA 4AKIA 3EAQA 2B7BA 1V5WA 2RGDA 2AXNA 4H9GA 3RS5A 2ODEA 4CZ2A 3IGFA 4MUAA 3DKPA 1OH5A 1KI2A 1E1RA 2HT6A 3QE0A 2C5LA 2WWXA 4RFVA 2QT1A 4C3ZA 2EQBA 4Q01A 3H86A 4C0KA 3NC0C 3WXMA 2FE4A 3EW9A 2CNWA 5EP2A 1G8HA 5LD2C 2ZAMA 4P4TA 1TF7A 2GAOA 1XTQA 3KUCA 3GFTA 4PZLA 1KSHA 5FL3A 1G4UR 1XMIA 2CVHA 3BB3A 1G8YA 3K53A 3ZZTA 3GLHB 1ZM3A 4HAXA 2XEXA 4RD3A 3GLHA 3RYTC 3TQCA 1U2RA 4M1YA 3JZAA 2IYZA 4GOXA 2ORWA 1MKYA 2OAQ1 1ETUA 2FPLA 3U2QA 4XVRA 4M9SA 1FNMA 1ZC3A 3H2YA 2ZS8A 1XEWX 4LCBA 1EWQA 5JWRA 3OEED 3ADCA 3ZIAD 4D4LA 1QHHB 1PJRA 2KSQA 1QHHA 4OL0A 3EPKA 4PO9A 2YC4C 4GDFA 5M04A 1FTSA 2OXRA 5E7JA 1G8PA 1VHTA 4I4LA 3B1WA 4Q21A 3UWOA 4ACAA 1E2HA 3CRW1 3MCAA 1XZQA 4RCZA 5GVRA 2VP6A 4BLPA 2ZYUX 4JZKA 2OCPA 4Q4AB 4Q4AA 2W6IA 4DUGD 2D4HA 4H1UA 1X3SA 4KFUA 2NGRA 1UJ2A 1XJQA 4MGZR 4YMTA 4YMWA 3QVUA 4TYYA 4ON9A 4DCTA 1DBSA 1NMXA 3NH9A 1F6BA 1VIYA 2CLDX 1TUEA 2PZFA 3UG7A 1F48A 1G4AE 4HLUC 1SULA 2KBFA 2WSMA 2VTKA 4BFSA 5J5CA 3SZRA 4J0QA 4MKHA 2NG1A 4IFEA 1ZMXA 2YOFA 3VR1A 4EIWA 1G3UA 2CJWB 3QXHA 3PUXA 4C0BA 2ZRLA 2CJWA 1KDPA 2A3RA 4ZCLA 1GFIA 4QGFA 3QIAA 2P5SA 4A6PA 3T1TA 1CULC 2AFIE 3KKMA 1OFUX 1NBME 2OE2A 3BOSA 2BMJA 3LQQA 2RAPA 4A36A 4WZAE 2XNDD 3EZ2A 1FPMA 3AF1A 1EG7A 1DG1G 1EFCA 1MO3A 2OBNA 4OJKA 3R9IA 1UKVY 1JR6A 3R9XA 3CUEF 4RVCA 3VMFA 3E1SA 2N46A 1E9FA 4XD7D 5AUOB 3GLGB 4C7OB 3VKGA 3L43A 3GLGA 4C7OA 4EPTA 2QORA 3ECCA 1G19A 1SVMA 3NEJA 1AQUA 4M1TA 2XITA 1W47A 4YC7A 1LY1A 3MAAC 3WHLA 1WBDA 3K09A 4PQRA 2GZDA 1G5PA 1OLOA 3LH5A 4WOPA 2G6BA 2YYZA 1ELOA 1QHXA 1G3RA 2C78A 5G3ZA 5BYJA 2WZQA 4BFWA 1GOTA 1NL3A 4JLKA 1KMQA 1T9HA 5L3VA 1TU4A 3QXXA 3Q3JB 3D8BA 2P5TB 4R98A 4E09A 5LDDC 3TW4A 1Z8FA 1SKQA 4RKFA 4LYJA 2QBYB 4C2TA 4ZPXA 1FQJA 1SVOA 4Z51A 2QBYA 4HSEA 2GXSA 4LJ8A 4OQFA 2IS6A 3TSWA 3ZQJA 4MGYR 5HZHA 2RGCA 2EVWX 3OF5A 4U7DA 2BM1A 4JSTA 4GMDA 1G7TA 3AP2A 1NBMD 4V0ME 4UXHA 3QPVA 5JBQA 3TH5A 4JJZA 1IOZA 2Z5FA 4OHVA 1B0UA 2EFEB 1EGAA 3VTKA 1D2EA 3LY5A 1L8QA 5EZ5A 2HYDA 1DPFA 1QZXA 2GVZC 4ZO4A 2OT3B 4NMMA 1E4VA 4LJYA 3W6PA 4JVMA 2RH5A 1MR3F 3MRSA 4AKEA 2QG6A 1P2UA 1EFRD 3B2EA 2NO7A 4BRWA 3RRMA 2C03A 1DO0A 1E6CA 4GT1A 2CHGA 4M2LA 2N42A 3RRZA 4PFSA 5A0FA 4RZ3A 2O0HA 2WSSA 4IOLA 4FMDB 1C4OA 1E2EA 3TMKA 4MH0R 5AK0A 2OBLA 3NEYA 3VR5A 2WJYA 3WP1B 2R2AA 1COWD 2ZI3A 3FWYA 2B8TA 2IHBA 1Z6TA 4MYUA 1MT0A 3AF2A 3V4RA 2ODWA 4JT4A 1E79A 3VR6A 3BBPA 3KQLA 2BEJA 4C0SA 2XZLA 1G7RA 3ASYA 4NCKA 4NYIR 3F0TA 3U3JA 4M1MA 2BWJA 3OFNA 4IXNA 5SZIA 1WMSA 3U44B 4KSBA 3U44A 4CEIB 1OIXA 1SHZA 3TNFA 5FOTA 1W36B 4BUJA 3K70B 4CEIA 2NO6A 2O8EB 2J7PA 1V43A 1G9XA 3SQXA 2O8EA 2J41A 3UMSA 4TYQA 1JALA 1TEXA 3CH5A 4B3FX 1NKSA 2XAUA 1R0WA 2AWOA 1T3SA 4KU4A 1ZIOA 4RCYA 1GL7A 3CM0A 4PC3A 3X1WA 4XTCS 2VA8A 1KAOA 1VYVA 5E7IA 3EZ6A 1U0LA 3Q5DA 4B2LA 3B85A 3EIQA 2JLYA 2BMDA 3TUJC 3KQUA 2HYIC 5JSZB 3B78A 5JSZA 3AEZA 3I73A 2ODBA 1HE8B 6Q21A 5JWHA 2ZJ5A 3LXRA 4TTQA 2FSFA 1TPZA 2C98A 3W6NA 3A1WA 3W3AA 1SKYB 4PC6A 1OH7A 4PO1A 4DDVA 3AF0A 4QL3A 4JL6A 4I81A 4BWYA 5HZKA 1GVNB 4RD1A 1EESA 2QAJA 5DI3B 4EKDA 4EPXA 2GBLC 4IDHA 2J0SA 1A2KC 5DI3A 2X8AA 5FOSA 4TQUS 1HUQA 1JR3E 1P2TA 2ZM5A 2V7QA 2WAYA 1AK2A 1AS2A 3KXIA 2QPOA 5BYKA 2F9MA 1MO4A 3AVTA 2FSHA 3R9WA 4JL8A 2JIZA 4KAXA 4QHYA 1E2MA 1UAAA 2K5UA 2OUKA 2ZJAA 2OCYC 2FEOA 1XCMA 2ZAOA 3DVLA 4Q00A 1RKBA 1YVDA 2G0NA 2X2EA 4D82A 2QPTA 1UKYA 1QBKC 5KYKA 5KNBA 5EE0A 2W6ID 2W00A 4E22A 3LX8A 2DFLA 3FFAA 3GJ0A 1FMLA 4TQ9A 5L3RA 4EDHA 1VCIA 2R6GA 3K9HA 3TSZA 3RVBA 4MRPA 3X1XA 1NG9A 5G3YA 2FH5B 1E2FA 3QJYA 4FXPA 1S3GA 1Z0IA 2NMVA 1XRJA 3CRRA 3I61A 1QVAA 4C0HA 2GCPA 2G1KA 4A8JC 1CRPA 1G18A 2MSEB 2W2XA 1KGDA 1CEEA 2W6JD 2C96A 4I99A 1ZM9A 3IQXA 4D6PA 621PA 2AR7A 1BKDR 5KSOA 2RGAA 1Z6GA 1E1QD 3EXAA 1D6JA 2EFHB 4NYJQ 1XTSA 3PEYA 3ND9A 5FOVA 3R7WB 4NDZA 3WRYC 2GEVA 2NZ8A 1T8UA 3KKQA 4NONA 1Q0UA 3R7WA 3HYRA 4FI3C 1W49A 4Y0VA 3L0IB 3LRPA 5F2EA 4ARZB 3KKNA 2I1QA 3EC2A 4GNKA 4ARZA 2DPXA 2ZRNA 4ASUD 4C0QC 3A1SA 5CB8A 4V0OA 4FWIB 3PEWA 2VHCA 3IHLA 4B6FA 2ZANA 1PZNA 3RRYA 3NIBA 3CLVA 4Y0AA 3U3KA 4ZDKA 4BQSA 4F4IA 4TMVA 3DHWC 5B58C 2ZYVX 4TT3A 4B3CA 2NZJA 1L4YA 2ATVA 4M1SA 2FZ4A 3ZD6A 1ZNXA 2YKGA 3T34A 1WBBA 2IL1A 2RKOA 8OHMA 5CLQA 1Q44A 1YHNA 4JBWA 3NG1A 2Q3MA 1GKUB 1M7HA 5CYOA 2XTMA 4DDTA 3RANA 2VEDA 3EPJA 3MLEA 2DWPA 3VR4A 4PSVA 5CJ2A 1GAJA 4DSUA 4Q1DA 5CK4A 1WB9A 1E0JA 1G1MA 4UNNA 3LWNA 3LX5A 5EXTA 3GEHA 1T91A 4JLDA 2GJ8A 3PG5A 1NN5A 1NP6A 4JKIA 5HCNA 3WYAA 2F6RA 2WOOA 3GJ5A 4EFMA 4FCVA 4OQLA 3ETLA 4PR0A 4ZKEA 2V1UA 4HLDA 2ZPTX 3AVYA 4P33A 3L2OB 3CR8A 1TQ6A 1DAEA 2DR3A 3B7GA 1BMFA 5FPTA 3RS2A 1AA9A 1TL7C 2KJQA 4JYBA 4EAQA 5DYIA 1M74A 3MG9A 4JVSB 5H70A 1LB1B 4X8MA 1DAMA 2WBLC 5JI3E 2IW3A 5K8UA 1ZAKA 2D3WA 3U4QB 4XVQA 1M7GA 3U4QA 2O8CB 3SHWA 3WRXC 1FFHA 2F43B 2F1HA 2V4ZA 2F43A 3IDQA 3B1VA 2FGKA 2PJZA 3JVVA 3Q72A 1L4UA 4ZDIA 1G6OA 1WXQA 4OYHA 3T06B 1ZYUA 4URXR 4Q9IA 4AYXA 1FNNA 4BEJA 2WSSD 1IY0A 1AZSC 1R8SA 4QHTA 5FOUA 4G1UC 2AN9A 3THYA 1YU9A 5CYPA 4CEHB 2QQ0A 3K0CC 3IPXA 4CEHA 3RLFA 2BCGY 1CJUC 1KZGB 2QRZA 1B23P 2GRJA 1TMKA 2OILA 1LV7A 3QENA 1ZNZA 1FW6A 3TE6A 4NZYA 2HV8A 1E79D 2YHSA 4B75A 1FUUA 1AZTA 3JZMA 4Q18A 1NNEA 5DHAA 1OSNA 3CBQA 2OLJA 3S1AB 4KBGA 1NVVR 2A9KA 1Z29A 1F5NA 1DS6A 4L8GA 1U9IC 4YQFA 4NCIA 3QI2A 1M1YE 5IDVA 3VR3A 1KI6B 3ZIAA 1S0UA 3G0HA 2WMNB 1KI6A 1IN7A 4RD4A 1Z83A 3EASA 1TEVA 2DYKA 3P32A 2WWIA 4GFDA 4V02A 4XSGA 1WP9A 3K70D 1FP6A 1TQDA 2J7PD 4B34A 2ZI9A 1S3SA 5FH9A 4M22A 4KVGA 2EYUA 4DC9A 3T5GA 2ANCA 1ANKA 1YZLA 3R8CA 4EQ6B 4IEEA 2ASEA 1HQCA 3OIVA 4EQ6A 3ZZUA 2GZHA 4D25A 2ZQ5A 2GEDA 1S1MA 2VL7A 3AKYA 5CK5A 5CJPA 3RWMB 1UFQA 2C9YA 2AL7A 4O2LA 4RD0A 2XOKA 2HF8A 3LLMA 1IY2A 2QMUA 2JEOA 4DJTA 3BB4A 2IYVA 2JJ1A 1KO8A 1R0XA 2IXEA 2G1JA 4B71A 3B8HA 1YZKA 3BE4A 1SGWA 3CIOA 2ZTSA 4ZKDA 5H8WA 1QDEA 2O8FB 2FJUA 4HB4A 2O8FA 1U8ZA 4DCVA 1U81A 3I1FA 3GJ6A 3SBEA 3G5UA 521PA 4CT4B 4U02A 4DLWA 3LDAA 1OV4A 4YMSA 4B6EA 2ZU6A 2CVFA 1Z3IX 4AYWA 2B92A 1FL9A 3LW8A 1WRBA 1N6RA 2FN4A 2ZJ8A 4YDSA 1G3QA 1AS3A 2ZRIA 2V7QD 4NKRA 3LVRE 4GPTA 4MA4A 1J99A 2QY9A 2XNDA 4ESVA 2DHRA 2JIZD 2FDCA 3LAWA 2VP4A 3W34A 2IXFA 3EZ9A 2PMKA 2O8BA 2NQ2C 2XSZA 4IFBA 1MV5A 5FTLA 5E95A 5KSYA 3CKLA 1QVRA 5HTKA 2PX3A 4TLCA 1E4YA 1R4AA 2Q9BA 5AJWA 4BFTA 4XD7A 2E87A 5LB4A 3N2IA 4P4UA 2J0VA 4A9AA 5JHGB 3TR0A 2J0QA 2IYYA 4KHZA 3WMGA 1NLZA 2CDNA 3HDTA 1N0UA 4QJ5A 1KSGA 4I1OA 1RYHA 3I5YA 3X1DA 1ZCAA 2ZI7A 2ZUCA 1UBEA 2HUPA 4KLNA 4JVLA 3TGPA 1T6NA 2XTZA 4LJAA 2ZYTX 4BFZA 2WIAA 1BIFA 1KY2A 5G41A 4DDWA 2HEIA 4XWAA 3KUDA 1F2UB 2OZEA 3M0EA 5EP3A 1Y3AA 3C4JA 1F2UA 2P0EA 4ZDWA 3WHKA 2EFDB 4IDQA 4Q03A 3C7KA 3DZDA 1IXRC 3OIYA 2YWEA 1G41A 2IYRA 4BE7B 5HR5A 5HKKA 3JVUA 2NIPA 3U5ZB 1SXJE 4A0HA 1DAFA 2FMXA 4GOJA 4AD8A 4NCNA 3BRWD 3RABA 5BN3A 1W44A 3I62A 3QNUA 4BFUA 1AKEA 1LFDB 4B3BA 1NBMA 3DM9B 1I2DA 1VG8A 1XCGB 4CIDA 1SVWA 2J9RA 2PLFA 3I32A 3NHBA 2XB2A 3U6KA 4MRRA 3TUZC 1NSTA 3A6PC 1G8GA 3FTQA 4Q48A 2EWVA 3CRVA 3TRFA 2IWHA 4BZPA 1TU3A 3K9GA 1HT2E 4O3MA 1UADA 2BBOA 4LDJA 1LF0A 1XPUA 4DSOA 4QM7A 5DI9A 3MWJA 2Z83A 5AUQA 3C41J 3CNOA 2R65A 4JBYA 5CDFA 4IXMA 4Q7LA 1N6NA 3J81k 2C77A 1EFRA 3BS4A 1K5DA 3EPHA 1Q22A 5DYGA 4POAA 4DB4A 1G20E 2PT5A 1GTVA 2WMOB 3TBKA 2TMKA 4FMDF 4DZZA 4PHTA 3V9PA 1ZD1A 1FUKA 2IK8A 4URYR 2RB4A 2V54A 1QG2A 1UKZA 2JAQA 4B33A 3BB1A 3K09C 5FTKA 5EUMA 2HDNB 3GPLA 5ANRB 4GZLA 1JBKA 4HAWA 1E99A 3CO5A 4HUQB 3K1JA 5AUPB 4LJ9A 4HUQA 3N5CA 5E7MA 4HLQB 1BYIA 2XXAB 4NYMR 1SXJD 3T35A 2XXAA 2VIIA 3B1YA 4PC1A 1G5TA 1Y63A 3CR7A 5CLLA 3SYKA 1S4QA 3NBZC 4LBWA 4V0MA 1Z2AA 5FR2A 3L8YA 4CDGA 3RS4A 2A5FA 1G7SA 1L2TA 4MITA 2CBZA 4UNPA 3Q7PA 4L5BA 4LY6A 4MYCA 5J4LA 5EE5B 1A4RA 2ZSDA 5CIQA 2JLXA 2B8WA 1R5BA 2KWIA 3L0PA 1KAGA 2OG2A 4P31A 5HCIA 3VKHA 3QXCA 2XJ4A 4WXRA 2VBCA 4QGHA 4ZI3A 5E3HA 1NJFA 3DO6A 1M6NA 1IBRA 2OXCA 2D2FA 4D0LB 1NG1A 2UZIR 4I1SA 5FBRB 1Z2CA 5EE3A 5FL7D 1KK3A 2FSGA 1E69A 2JA1A 3CPJB 2AHOA 1A5TA 1YR6A 1EWRA 5AJXA 1CBUA 2LCFA 1FX0B 3OZXA 4NPHA 3NBXX 3HJNA 1FX0A 3P26A 4CGZA 3FHOA 2Q21A 2A2ZA 2X2FA 2IA5A 4ZI2A 4F4JA 1XPOA 2CMKA 1UBGA 2XX3A 3BFVA 2JLUA 3KJEA 3GLIE 3PVSA 2EFCB 4L16A 4IW3B 2HCJB 4K8OA 1P60A 4FCTA 1S96A 1E9RA 4FMCF 3F3YA 5FPSA 1OXUA 5BW8A 4M53A 1QHGA 1N3BA 1YR8A 1LTQA 2ZETA 3DM5A 4C4PA 3C5CA 2F9LA 4Z8XA 2VSXA 3CB4A 3BD9A 5FUWA 4CW7A 3ZH9B 5IK2A 3TQFA 4A2QA 1T4GA 1JXMA 3OIUA 1W36C 1OT3A 2FSIA 3KX2A 4RZUA 3K70C 4FIDA 1YJ5A 4ZV4A 1VYUA 2IXGA 5J4HA 2XOKD 3FDIA 3SS8A 2HT1A 3ZDQA 3W5JA 1J90A 2DWOA 2JJ1D 2ZI6A 4JVNA 4QGAA 2QMEA 1EFTA 1Z0KA 3A37A 3AF4A 1ZVQA 4BGDA 1E96A 3L0OA 2FA9A 4QOSA 3ADBA 1NVWQ 2A78A 2QTHA 2QROA 1ZJ6A 2C9OA 2W6JA 4IVPA 4LV6A 2ZI4A 1FTNA 4UQOA 5FI0B 2J87A 5FUYA 4AG6A 4OK6A 1Z28A 3SBDA 2NO0A 4C2UA 4UKDA 1E1QA 2VSFA 3IUYA 2ZE8A 4RKEA 3WP0A 5GJCA 5F98A 2G0TA 1N2CE 4OHYA 3U3MA 4B44A 1GSIA 1JR3A 1E2IA 5JS7A 5KTYA 4HAVA 4LZZA 1KYIA 2GA8A 5P21A 2RGXA 4A2PA 1ZUHA 3BH0A 4IVRA 4ASUA 4IOMA 4Q47A 4DLYA 2NO9A 1VECA 2XSZD 4WBSA 1RRFA 3N2EA 1CR2A 1TQ2A 3VFDA 3CZPA 4OKSA 4AI6A 1Z6AA 3B1XA 3GFPA 3T1QA 5JHHB 1CU1A 2ZSEA 4TYNA 5FPHA 4C0LA 4ERNA 2HCBA 3NDBB 1F3OA 1VDZA 3SQWA 1JEEA 2BC9A 2PEZA 4KFSA 1T8TA 3WBKA 3A8TA 5SZJA 3CX7A 2W2TA 3I72A 4HUTA 4DLTA 4PAMA 1CR4A 1ZM7A 4WZ6A 1Z07A 5GJWC 2WWFA 3LFUA 4EPVA 5TMPA 1HT1E 4TMTA 3AKDA 3ZD7A 3VHXA 4TTPA 1OKKD 2EWWA 4PQYA 2XZOA 1OJLA 2ZR7A 5JECA 2YINC 5HKKD 2GEUA 2ORIA 2O52A 1P75A 5DNYB 1P9NA 2H1LA 3KKPA 3QPUA 4N0EA 4QRHA 3SYNA 4BFVA 4A0FA 4HDOB 4OK3A 4XTRA 1IN4A 5EXXA 1XTRA 2QTFA 4DLRA 5KUTA 2ZRJA 3GCGA 1N5KA 3PIRA 2D06A 1Z5ZA 2ZJBA 1E9CA 1XX6A 1NY5A 4Q7KA 1XD8A 4QHSA 2OLKA 4WIAA 3REFA 4BZXA 2DCUA 3TW8B 4C0AC 3GJ8A 2ANBA 1NN0A 1YQTA 4JLBA 1W7AA 4GSYA 4AURA 1N6LA 1X6VA 1Z06A 2J59A 1SVKA 4YLGA 5DH9A 2QT0A 5B57C 1RFLA 1M34E 2J5XA 2QN6A 3OE7D 1GZSA 4NCHA 2ZXUA 4II7A 4KV9A 3GEEA 4US1R 3GEIA 3EX7C 3QY0A 3RC3A 2PEYA 3SC3A 3H0KA 4LGMA 4HB0A 1SVLA 4IHQA 1XPRA 1ZUNB 4JJKA 4B2PA 3F8TA 2UZ3A 2VHUA 5C18A 3KXLA 1E94E 1H8HA 2J0UB 2V1XA 4U5XA 2J0UA 1JECA 1KIMA 1PLJA 4FINA 4NL4H 4TQAA 1VG1A 1XEWY 3WBJA 3W9YA 1BYUA 4TMZA 1FOEB 2G77B 4HDCA 1P3JA 4V03A 5G40A 4BLOA 3W6OA 2QTVB 1X1RA 1N0VC 3BH6A 4G0NA 3K8YA 1RW4A 3M6AA 3PUYA 5K8IA 1JNYA 1T3LA 1OB5A 3L0SA 4JSYA 1XZPA 2DWQA 3GFOA 1GWNA 2GHIA 1IN6A 1OYYA 1GL6A 1N6KA 4RSGA 1ESNA 3CNNA 1E9EA 2A5GA 5HE9A 1HE1C 2RGBA 4F4CA 1F60A 2AKYA 1MO6A 4KSCA 3VAAA 1HV8A 5LB2A 4JLVA 1H65A 2V6JA 2VP5A 4IKEA 4AKGA 1W1WA 1XD2B 2C2HA 3UMRA 1W2GA 1XD2A 3UKDA 3ZVMA 2GJ9A 5J4YA 2WJGA 1CIPA 1SQ5A 3VNVA 2HXSA 2C9CA 3GLFE 2D62A 4PXAA 3C5HA 5JI2E 4NTZA 3ZQ6A 2PZEA 2WKRA 1Z08A 1OXTA 2AWNA 1PUJA 4JS0A 3CF2A 5JEDA 1W5TA 3AP3A 3HU3A 3UATA 3U61B 2AK2A 5GADl 4TL8A 2QP4A 4B3DA 1OXSC 3LNCA 3Q9LA 4HZIA 1P9WA 4A2WA 3U7GA 4TN1A 1NJGA 5G53C 3LLUA 3P1JA 3HR7A 1VCNA 5TB5A 4TMKA 1G6HA 2IF0A 2MMGA 5DSZA 2BIFA 3D3QA 4FMCB 2QAGB 4C30A 4M9XA 4EJSB 1TNDA 2QAGA 2A5JA 3O8BA 2FPKA 4EJSA 2R8RA 1GNRA 1E0SA 1NSFA 4D81A 3MSXA 1W48A 1Q12A 3B60A 2V55B 1E9BA 3F5FA 1AGPA 4A1FA 2CE7A 3KB2A 5IK2D 2H7VA 3SFVA 2WV9A 2VPPA 2ZSAA 3OESA 2GESA 4MYHA 1Q21A 1Q1ZA 1KDRA 1ZINA 4KFRA 1KO7A 5AJVB 1JJ7A 3IHWA 4PO8A 4TLDA 1E9DA 2B21A 3W5IA 3UPUA 1D5CA 3QKRB 3A36A 1KK2A 2DY1A 3QKRA 3IIMA 1NF3A 4HDQB 2WPDD 4LV8B 1ZC4A 2DBYA 2CE2X 4LYFA 2JJ8A 4HEJA 3FKQA 2CCJA 4PSAA 5KSZA 4WZBE 3UANA 3OIWA 3QUSA 2ZROA 1AGRA 2GK7A 1LVGA 1A2BA 3RHFA 3CNLA 3B9QA 2PJRA 3P4YA 5UKDA 1JQJC 2BOVA 2VH5R 1VCMA 4IJMA 4FWTA 2ZRFA 1CTQA 2NTYC 4KITB 1IAQA 1JR3D 3O47A 2XTNA 3ZJYA 4JL5A 2ZS9A 4TL6A 3Q85A 1KDOA 2GF9A 4JLJA 3AUYA 5GJVC 4AY2A 3OEHA 4LC1A 4LHWA 1N5JA 5BWMA 1IQPA 2VO1A 1ESMA 3P27A 3PITA 1NMZA 1Q57A 3E2IA 3P20A 4EFNA 3KKOA 4O0MA 3TAUA 2VP2A 4XIGS 2WWHA 2VF8A 1M8PA 2EU8A 1DAGA 5A5GA 4HB2A 1PV4A 2X19A 4BASA 3LQRA 2FGJA 2ONJA 4DVGA 3RSLA 4GRAA 2GETA 5IT5A 1O87A 3SJCA 2GDJA 2QMOA 3ZS8A 3HYTA 4TMXA 2QGNA 3AQ4A 1MRNA 2P6UA 5TXGA 1H8ED 4Q19A 4XVUA 3NDPA 3QBTA 4Q4JB 2RCNA 2ZJ2A 4W5HA 3Q8XB 1D8TA 4Q4JA 3I4LA 2VRWA 4D0NA 1UDXA 5DISB 4MGKR 1U0HC 4RJLA 3AKEA 4HAYA 1XU4A 4EUNA 1N0WA 4PPFA 4IEIA 2F1RA 2ZE6A 1YKSA 3THXB 3TKLA 2MMCA 3THXA 1SXJB 3EA0A 3FFBA 1ZD8A 2JLQA 1SXJA 2RGNA 1NIJA 3MD0A 1E2JA 2AXPA 1C1YA 5EJEA 1BH2A 4B43A 3HP1A 5KDOA 1C9KA 3X1ZA 4NH0A 1CJTC 5JCZA 3A58B 3DMNA 3VKWA 4LHVA 1X8JA 1F2TB 4LHYA 5JRJA 3AVPA 1F2TA 3IKJA 3KJHA 2ZJYA 1XNJA 1RYFA 3LO5A 4I1VA 1P4SA 1E2QA 5KO2A 3KQHA 3DZ8A 2QUZA 3TIFA 1HYQA 2HJVA 1TADA 5FPKA 1UF9A 1KK0A 2O8CA 5DHFA 3TR5A 2FOLA 3A4NA 4LC0A 1P62B 2AKAB 2PCLA 1E0AA 1T5IA 4G5RA 4RZXA 5TARA 5L3SB 1EK0A 2ZJZA 1UEJA 5L3SA 3IIKA 4HAZA 5KPDA 5FL7A 1LF5A 2IUTA 2BMEA 4HYYA 1W4AA 1OH8A 1XJCA 4DCUA 2ZR0A 4IDOA 3LXXA 3SDZA 2DFTA 1W46A 5IRCD 3KZ1E 1H8HD 5EZ6B 2KE5A 2H5EA 1R5OA 1WF3A 4URUR 4P0TA 5C4GB 5GJBA 1XCPA 3A4MA 1KI4A 3QG1A 1R7RA 1ZIPA 1Z0AA 3FHTA 4OI1A 4LYAA 3FE2A 1NY6A 1HEIA 1II9A 2NO1A 3CWQA 3EZ7A 4YONB 3NHAA 1AKYA 2OFWA 3DDCA 3PUWA 4DEYA 1CXZA 5FUVA 2ZI5A 2JGNA 4WAUA 1DADA 2CK3A 1KKMA 4NP6A 4QBHA 1A1VA 1VHLA 4A15A 3QPWA 5LPNA 4FMBB 2GAAA 5F9HA 2O8DB 1G5RA 3A1VA 2O8DA 4A92A 1ZBDA 5C46F 1GNQA 4OI4A 2IUSA 3EWAA 3RAPR 3UXMA 4DSTA 1DAIA 3T15A 2HXYA 4PHFA 4LJ6A 4XH9B 3H84A 3GMTA 1UEIA 1XB2A 1WE2A 1Z63A 3AVQA 4PC7A 2HF9A 2GKSA 2WVJA 3NBFA 1W0JA 4LUCA 4HAUA 3ICEA 4WA7A 4JLPA 4QGGA 1J2JA 3GLIB 2ZRGA 3GLIA 2H16A 5JCPA 3WYFA 2WOJA 2BHRA 2ZE7A 4KLZA 1JXOA 2B6HA 1XTJA 4TL7A 3BXZA 2IYXA 3TVDA 1AIPA 2ORVA 3NVAA 2C04A 2IS4A 2BDTA 3THWB 2WWGA 3THWA 5CITA 3SJAA 2Z4SA 4EFLA 1KSFX 3IBGA 5JJKA 2GNOA 1XEXB 4IDPA 1XEXA 4XJXA 4BFYA 5BQ5A 2KB0A 3FVQA 4AG5A 5HE8A 4URVR 4NYJR 3E70C 1R5NA 5J4VA 2GJKA 3T1VA 2A7QA 1YZQA 2VHJA 1G291 1UDWA 4D4MA 4DIEA 4ZCIA 1RC8A 3IEVA 1IONA 4FCWA 1PLLA 4RD2A 3BFKA 1ONBA 4X8OA 3AUXA 2P65A 1P2VA 1OKKA 4ZCMA 4OHZA 2IEYA 2EW1A 5E4FA 1E2LA 2V9PA 3KQNA 4C0JA 4F7WA 3K9NA 1Q1BA 1J8MF 2AK3A 1DELA 3VQTA 2HLDD 1E2GA 4CF7A 4Q9HA 1I4DD 5DN6D 4AIIA 1N6PA 4GL2A 3QXJA 4U00A 2C99A 3QOFA 3FHCB 1II8B 2LKCA 1T5LA 3FPAA 1II8A 1W0KA 2D2EA 1OYWA 3OEHD 5KNDA 1XD9A 4QJ4A 4JYCA 1L7VC 4D0GA 4TSFA 1X8KA 4GP7A 2FU5C 3MJHA 4AYTA 4TLBA 2J1LA 3AB3A 2BBTA 4URWR 4PSKA 1TTTA 2O0JA 5TV2A 2F1IA 3SOPA 1MABB 4F91B 1DTSA 4UNRA 5FTNA 1MABA 4B47A 4ESHA 2QEQA 3CH4B 4G5OA 1VKJA 121PA 1IM2A 5KNCA 3BIFA 4PANA 2IWRA 3LBNA 3B6EA 4BPBA 3V00A 1X8LA 3OE7A 1ZM2A 5B2ZA 1NVXQ 1K6MA 3NWJA 4D26A 1SHKA 4YXWA 1TF2A 3CONA 2IUUA 1JPJA 5AJYA 1P6XA 1GKIA 5KDLA 4CEJB 1W4CA 3MJRA 4UXIA 4CEJA 2FV8A 4DHEA 2PLRA 3C14C 1DOAA 3KFXA 2GILA 4PHHA 2R44A 2PT7A 2IHYA 1ZU4A 1NIPA 2GJSA 4K81B 1CKEA 3RDPA 4B35A 2Q0HA 2YZ2A 1KNXA 1YRBA 3W8NA 2BBWA 3G82C 5JEEA 4ABYA 1OW3B 1G21E 2OM2A 4KCGA 4B48A 4PHGA 1XDBA 1PUIA 3LBIA 1GRRA 2V6IA 3C16C 2IEZA 3RRNA 1NMYA 5C1BA 1RJ9B 4XWKA 1TAGA 1RJ9A 3IO5A 5AR1A 3ZVLA 5IHPA 3RS7A 721PA 4QXAA 2A5YB 3T61A 4S35A 1KJZA 1OFHA 1RVDA 2WHXA 2ZIAA 5L3QB 1GNPA 2RHDA 5L3QA 4R9UC 3DL0A 5EUQB 2F55A 2REXB 2GCNA 1KI8A 2G3YA 4IRUB 3GJ4A 2VHQA 1K5GA 2O0KA 5KHOC 3BJIC 4B3XA 4JLNA 3K9LA 3SN6A 1G7CA 1VTKA 1PLKA 3GQBA 5FTJA 2IS2A 2VYFA 3HWSA 3IIJA 1TF5A 3B1ZA 3D6TB 3KDSE 5AJZA 3T5DA 4OBEA 3FYHA 3MGCA 2FFHA
chains in the Genus database with same CATH superfamily
2ONKA 5K3BA 1DVRA 1JE0A 2IXAA 2PZMA 1OXVA 2Z98A 3IOEA 5J23A 1R6TA 1B4DA 2A84A 1DWOA 1Z6XA 3T0GA 2FW0A 3M83A 4DNPA 1J23A 3ADKA 2COKA 2ZJ3A 1USUA 4NYIQ 2BW0A 4GI7A 4P7JA 3FCCA 4M7RA 4X20B 1Z5VA 1RHMA 4AWAA 2DFKB 2EP8A 4X20A 4GE0A 2KYRA 1DRJA 1LTKA 3CPEA 4OTZA 3BXFA 3UWKA 1PRYA 4BLSA 4QZVA 4X90A 2FEXA 2AX4A 4EHHA 3OQ1A 1ISMA 4QJIA 2G88A 1N25A 2O5VA 2IHUA 3VNUA 1WKVA 4EG5A 2HW8A 5KOYA 1UR5A 3IVAA 4L1KA 4RZ2A 4M7PA 5A4FS 1X1TA 2YZMA 3WNBA 2EKLA 2ZJOA 1G55A 4OLFA 2F3UA 5H8WA 1XMSA 2WIDA 3JQ9C 3PXAA 2E4WA 3KELA 2APJA 3QELB 4UATA 2R5FA 5JRZA 5JWOA 3QELA 5CIWA 3WSWA 1H2HA 3RFVA 2R4UA 2GHTA 2BI8A 3BILA 3FPSA 4YALA 4GLLA 1TDJA 4UU7A 3VNSA 1WCXA 1R9MA 4DLUA 3DZCA 3SSMA 5KTTA 3AF3A 2J6BA 1S7CA 4IILA 4DSNA 4FFLA 1BS1A 1XFAA 1GUAA 3PC7A 3R09A 4NZNA 4QBIA 4D4JA 2NTNA 2EEPA 1OXMA 2IRWA 3C87A 3A2LA 3BREA 2PFGA 2WPDA 3MUEA 4LHZA 4MX8A 5LA6F 4XUGB 3ER8A 4HZUB 5CM8B 4FDMA 3WV5A 4HZUA 4H7IA 2JNWA 2IODA 5EEHA 1QWSA 4U2GA 4Z0PA 3TZQA 4EY3A 4BEBA 3EDCA 4NHOA 1KETA 2JAWA 5LZ7A 3GHHA 4J0JA 3T3EA 1ADYA 1YH3A 2JBWA 4INJA 1GUFA 3ZDAA 3HKBB 5CFRA 2IYPA 1T5OA 4H7PA 1XLUA 5TGZA 2H8KA 4PZYA 3RS3A 5EXDA 2NPFA 4DWVA 2NM0A 4IWXA 4Y2VA 2ZRDA 1SC1A 1W5BA 2NQTA 2D7DA 3NBYC 1XWIA 2EOAA 1YHZA 2ZREA 1IIRA 2ZITA 2H18A 1SXHA 4I66A 4JC0A 3CURA 4KQMA 5HF8A 3FOFC 2JG3A 4MUNA 3M1LA 1GIAA 4ZREA 4JOQA 1IXZA 1K0UA 1RQPA 1ZKDA 2BPOA 3EZFA 5TF0A 1MRSA 5IMBA 1G66A 3R3YA 3HPRA 3D7MA 4V2IA 2ECQA 4R3UC 4TLAA 5KX5B 2PX4A 3Q0TA 3NVDA 1J1ZA 1FP4B 5K3FB 4A73A 5KX5A 1FP4A 1P5FA 3CF6R 2Q5QA 2FR8C 4LBVA 4JVOA 5FBLB 4RF4A 4IVQA 3R7FA 3S2SA 1C0LA 1RBMA 1Y3BE 2Y1DA 5G0TA 3RUFA 3GVCA 2OFOA 4E46A 4EJSC 4CF3A 2QX9A 3GZNB 2A9QA 3OZ7A 5EJ6A 2DSTA 1I4OA 2JJ2D 3GZNA 2GM3A 2E1RA 2NUAB 4JQYA 2KI5A 4ALLA 2NUAA 3IPRA 4URHA 3MWYW 5JXWA 1RAFA 1KAQA 1M2WA 4YJ2F 3WIOA 2IYLD 2F8LA 3OECA 1USVA 2G76A 4DLVA 2WZBA 2QF7A 3T9DA 1NW3A 1D1SA 2ID9A 1E92A 1NFRA 2DFDA 2WJHA 1KRHA 3EQ7A 1FFYA 4ND4A 3HPQA 2EAUA 1ODIA 1U1IA 1NMSA 1OLSB 1QX3A 4G1MB 3ZZ0A 3L8HA 1OLSA 4BNIA 3NAQA 5I7EA 1L5YA 2AD1A 1KHTA 2HADA 4OQMA 4YAOA 4C29A 4LGYA 2POQX 2Q6TA 1KKLA 2QN3A 4XSVA 2YS6A 2CMDA 2Y3IA 3N8DA 3RBAA 1P80A 3HHPA 1N9ZA 4Y3UA 1JPVA 3S8YA 1JYEA 5JVDB 4Z4HA 1N77A 1DO2A 5DBIA 1TX4B 5JVDA 1D1TA 1HNNA 1M1ZA 3U7JA 1E9AA 2A4MA 3LXUX 2FPWA 2QENA 2ZUBA 2EGHA 1E3JA 4CXMA 1UBCA 2E49A 5KYTA 5JAIA 4AJJA 1HOTA 1V5EA 2O6HA 3VZPA 3QX3A 1CPYA 1PJAA 1D2NA 4IRXA 4JKYA 1MUUA 1EQUA 4WY2A 5K6AA 1UKEA 1ISHA 3CZQA 4CNBA 2I71A 1J7KA 3G9XA 2Z08A 1QU2A 2FYTA 4R1PA 5DCLA 1KAEA 2XGOA 3ORHA 2W42A 4RIFA 1ZH0A 4TLLB 4WNYA 2D8MA 1ODJA 2HTEA 2QVXX 4AN1A 4BATA 2XGJA 2REBA 2AXEA 2H6EA 5K0EA 4ZXFA 3KLNA 5AKGA 4BJ1A 2FJ0A 4BNMA 1ECLA 4MCAA 5K8CA 4G5XA 1ZRSA 1U1CA 3EC1A 4FHZA 3NH6A 2HA0A 2YFKA 3G6WA 4MGEA 1I3CA 2CLSA 4ND8B 3I5MA 1RACA 4UTPA 3FSGA 4ND8A 4CIBA 1NKTA 1RC0A 3CEJA 4EMSA 4ECEA 1UINA 1ZNYA 1RWNA 2OLEA 4I5FA 4UHBA 1VP9A 4C78A 4RA6B 5IVKA 1C3XA 1THMA 1MC8A 1LZKA 1MIHA 2ODQA 1YT5A 4L3VA 4RA6A 4EYQA 5CVJA 2DZDA 5BVHB 4JA0A 1DRUA 5BVHA 3ACDA 1DEKA 4ES6A 2QQFA 2GZAA 1JQBA 4RZQA 3U60B 2GWHA 4CM8B 3M6IA 1FP2A 3SJBA 4CM8A 2GZSA 4UBKA 4W5JA 2C3UA 3W8RA 3MWKA 2LWIA 5G0VA 1CZHA 3KQSA 1KRWA 5I5GA 3H9BA 1QQ5A 2HUNA 3OZAA 4DN6A 5CB6A 3Q10A 4CPDA 5MF6A 1WLYA 4ITVA 4RL4A 1VMKA 2PGAA 3BIWA 3L6CA 3A1UA 5GVSA 4R2IA 4M86A 2FE1A 2VJBA 2YWBA 3U4GA 1EKXA 2X15A 3NDJA 3NHSA 1RJEA 1FRNA 4V24A 4J6FA 2H1HA 1LFAA 2P91A 3FMPB 5AKZA 2C5GA 1E2BA 3MWLA 4DUPA 3SVZA 2G5CA 2VYVD 2EL9A 2ZTVA 3H8WA 3EVBA 5ALQA 2WLSA 3O7MA 2VJOA 1O95C 4WY8A 3ANLA 5JFOA 5DYTA 2PVSA 2IOHA 3NM4A 3C6MA 1NQVA 4M54A 1QG6A 2FR1A 3FWKA 4TVKA 1YS9A 2PCJA 3GJ3A 3S6JA 1W87A 1WEHA 4J7XA 1A5BB 3I8OA 4OIMA 4CCWA 5JU6A 3PQ2A 2IYEA 1O9HA 2VUHB 1RRCA 3ZC3A 5FQNA 3E5MA 2WIBA 1KQNA 4AJ9A 4B5LA 3I8XA 3ZQUA 2H3EA 4ZMSA 3UMFA 2FW9A 2Y67A 1LNZA 4D3DA 1Y6RA 4CV1A 2HPAA 3K0FB 4P1ZA 5A5VA 3D0QA 3K0FA 1IC6A 2EF1A 1NF9A 2G9NA 5HK9A 1J0BA 3DOEA 4HLUA 4CCYB 4E70A 4X5OA 1J5EB 2YOHA 4CCYA 3CVVA 3BGWA 3I9MA 4N3NA 4OSPA 4PBRA 2FDRA 4ZAZA 3ILSA 4XIJA 3RU3A 5ELXA 4OI0A 4O4JF 3A9UA 5IG2A 5FA6A 3PJRA 5JMTA 1ZG3A 2AGVA 1XJ5A 1P1JA 3LRTA 1XV5A 2XUGA 1Y3DE 3C3KA 1IN5A 2I6FA 3VPHA 3AERB 1UXKA 5HJ7A 3UK7A 3AERA 1C3JA 1HLDA 1YGPA 2P6MA 2QVYX 1R0RE 4MW1A 4QFDA 4QSHA 4AJIA 3KR1A 1AB6A 1SB8A 3UMVA 3JATB 4B4UA 3EWSA 3RFTA 4KQ6A 3JATA 2CT8A 5H7XA 2OAP1 1BXGB 4S2EA 1JP7A 4UXJA 2FRVA 1TUIA 1VYTA 1O9BA 3C7DB 3G2LA 4MMXB 2IY9A 1QNLA 5JS6A 1JSCA 3GROA 3WL8A 2Q8PA 4ENQA 4PW0A 4KQWA 5AHRA 3SM3A 4EYOA 2IFTA 1N5IA 2A67A 1OXKB 2JGAA 4MLCA 4IIDA 4BGIA 3RVDA 3V4LA 1P3DA 5TS3A 4DT1B 1YE8A 1QQTA 4TTTS 4DT1A 4D6XA 1Y0BA 2Z9DA 6REQB 2WU1A 2XOEA 5EHXA 3YASA 4C22A 2FUKA 3D43A 1KZ9A 4MWSA 5DHQA 1VJTA 2EFJA 3HB1A 4G09A 4ZU3A 3GG2A 3ZCQA 3U7FB 3ZS9A 2EDAA 3ZCTA 1VJDA 2J45A 4BQEA 4F72A 3LLVA 3HL4A 2VT6A 1GL3A 4UNSA 3SX0A 3VX4A 3TMYA 4B7XA 4E15A 5KQLA 4BMVA 4WD3A 1DJOA 1Y4SA 2XTJA 3OA2A 1XTKA 3HEBA 4IGIA 1MLDA 4LZOA 1OFIA 2N47A 2P3SA 2WV7A 4PIMA 2JLRA 2Q49A 4LJKA 3V2HA 5FUMA 3SMQA 4I1UA 3C4QA 3ECSA 4INAA 3GW8A 1W4RA 3KQPA 1J39A 3TK1A 3BDIA 5CD9A 5J47A 1KMCA 4LPSA 2B3TA 2Y8EA 5K03A 4AQYB 3BZUA 4IZIA 1VCHA 1NUQA 3OPYI 3IILA 1I4TD 2EIXA 4C7JA 1Z16A 1CNEA 3L02A 1HRDA 3OZBA 5BNTA 5BXYA 1CUUA 1WCV1 2VBIA 5B1YA 1SCIA 5EIHA 1SZCA 1XTBA 2YVKA 3MWDB 1F0NA 4MV7A 3ZBUA 3DYBA 3MWDA 4YT8A 3N0TA 3UW1A 4NE2A 4G24A 4J1QA 3EMVA 5CM9C 1T0JB 1PEYA 4UMVA 3SBOA 5KYGA 3EFEA 2RI0A 1C1HA 1W6UA 5IP5A 1PX0A 1ZK4A 4Q9KA 1P19A 5AHWA 5TMBA 1K6IA 1QRAA 1XYVA 1NLYA 2PK3A 2HLHA 3LJKA 4N5MA 3U40A 2Q41A 3AG6A 3WLOA 1I3MA 1A9OA 5BNFA 4DRZA 4FFSA 4UTOA 3UWPA 2WWRA 3PFIA 4ARUA 2BFCB 1BFDA 1GPAA 2HM7A 2ZBEA 2BFCA 2JIBA 1KYZA 1MA0A 2I2WA 3U7HB 1T5TA 1NUTA 2RG1A 3D6NB 2XBUA 1EVZA 2EF0A 1XMJA 3UJ8A 2D00A 3I2GA 3F7OA 1Q0ZA 4GR9A 3MRXA 1Y4DE 5I7SA 3FMIA 1PR1A 4UM9D 1DKRA 1A9YA 1MOZA 2J5BA 2N3ZA 3P9KA 5EESA 2JD0A 2YMPA 5SYNA 5DLQC 2XRZA 5CLFA 2DTXA 1RPZA 1GQRA 4WDQA 4LTDA 4Q1CA 1KMHB 3HDJA 2IX3A 4HI0E 1KR5A 4ZQIA 1BDHA 1KMHA 2FRXA 3RTCA 4IQFA 2H57A 4RE6A 1T1EA 3WZLA 3SHFA 2PKWA 3ZE2B 3BCSA 5JAHA 1TTHA 3HRKA 2YWHA 3HWX1 3QBDA 3JAKB 1TLLA 2N9UA 2ZB4A 4JDUA 1UPAA 1BDJA 1CE8B 2IVFA 3JAKA 2Q8NA 3L6RA 4GYWA 2YWFA 4LSGA 1BEZA 1CE8A 4I50F 3V4PB 4ZEMA 4HTFB 1XP8A 4XJTA 2PGDA 4HTFA 3CZAA 2XCOA 3T5CA 3D0KA 1BHSA 1PFVA 1EGMB 1OF1A 1C3OB 1ZRMA 3ZTTA 4YRKA 4KR9A 4TKUB 1C3OA 1VXRA 3GZTB 2FR0A 2PH5A 3CN9A 4PGGA 1PW5A 4TKUA 4YHBA 4AZVA 4DLSA 2PUBA 3WMFA 2V58A 4IAOA 3CJQA 3FB4A 4JB3A 2D1RA 4ENRA 5LMCA 3V1UA 3DFFA 4GWLA 4JIGA 2FY8A 2ZAYA 4Q4LA 4ZAVA 1JL3A 5I7OA 1ESCA 4OK5A 3ZJ5A 1RU3A 4ND2A 1AKQA 3CE9A 3S8EA 2Q9AA 1YVPA 3V1YA 4DJAA 1KYWA 5BXQC 2GS9A 1TM5E 3DXFA 3U26A 3OE5A 4FZRA 2ZT5A 3E7DA 1AMUA 1LLDA 4Q1EA 2D0DA 3VDMA 4LJLA 2PD6A 1AS0A 1ATIA 4NU5A 1BE6A 1DKOA 2WTMA 3GRUA 3DEIA 4UFOA 1XQ1A 1K92A 3KALA 1XTIA 4JC4A 3C15C 1OHHA 3JQBA 3F8SA 1JT2A 821PA 1E4OA 1O3YA 3RRJA 5J1SB 1US8B 3IAM1 1G21B 5K0NA 1US8A 1G21A 2IT1A 4WW0A 4HLNA 2X4LA 2Q5FA 3C3WA 2PBLA 2BEKA 4N9QA 3H65A 3K7EA 2R6ZA 5J2UF 5GIPE 5F9FA 4X3CA 3THYB 4KZPA 4HO1X 3FPFA 4Y9RA 1NONA 4OA8A 2Q1TA 2B1GA 3DF9A 1DIOB 1O94A 4NK5A 2NP6A 3RWBA 4EG4A 2YWRA 2BVNA 2VRBA 2CUTA 2GBLA 3QWBA 4KXUA 5B3AA 3SJZA 3M5CA 4ARVA 1E2NA 1T35A 4LF9B 4GX5A 2YJ6A 3L77A 4MGIR 4LVUA 1QO0A 2CD9A 4FR0A 3KYIB 1LEHA 2A35A 3VR6D 4B9AA 2MWMA 3H1TA 4KBYA 1BTOA 1D0SA 2VHWA 2XHZA 4MVXA 4M4SA 4PAQA 2IOFK 4Y18A 4DQDA 4OQZA 3FZGA 5BOSB 1IXSB 2OV8A 3RSQA 5BOSA 1U8XX 4YCCA 3VBCA 1CUDA 2H0RA 3EIHA 1SD2A 2CXOA 2VDUE 2CLCX 3OFND 3PPWA 3SKVA 2QP9X 5J9FA 4BE9A 2D4AA 5HG0A 4KQJA 5B5SA 4RQBA 2YHAA 4FC6A 3VNRA 1ZL0A 1W36D 2VPXA 1PQWA 2ZRQA 4BB6A 5CDSA 4RJJA 1X7XB 1YIOA 4TV9B 1JSRA 1RKVA 2ZSKA 4BV9A 3HM9A 1X7XA 1XJ0A 3GDGA 4MS1B 1NV8A 4TV9A 2XT6A 1G2IA 3CWZA 4MS1A 4OMUA 1E1MA 4ARAA 1A8PA 2P9FA 1QIEA 3OLXA 1XVLA 4HN9A 3RIHA 5HJ5A 1UWVA 4HS4A 3NV7A 3X1JA 4EYGA 5JR3A 4OVKA 4RHEA 1JE1A 2VAWA 5CRIA 1XLVA 4YGXB 5BN4B 3MELA 4G5GA 4A8JB 5C7IO 5BN4A 4X8LA 4A8JA 4U2KA 2PUTA 1AHPA 2QI9F 3W90A 3G3EA 3RSOA 3QKIA 4YPVA 1E32A 1IULA 2D7CA 1LVHA 4TWZA 2OYRA 2L19A 3DVSX 3OEYA 4ID9A 4DJFC 2DVMA 2B99A 3V97A 2VJCA 3E4CA 2YHUA 4GBMA 2OVFA 2Z58A 3IAEA 3SM9A 1U8CB 1T13A 2QU8A 3PWKA 4FDTA 4B6RA 4P83A 1YBMA 4I9GA 4XM1A 5GZ6A 3NMUF 4PPQA 5IKXA 1GRQA 1CF4A 3FDFA 2QM7A 4BDTA 4BO4A 1POXA 3B20A 5D5QA 2LRHA 4GXQA 4ZXPA 2QSYA 3SF0A 3HCOA 4EL0A 1GDTA 4V0LA 2I7DA 2IIQA 1U0JA 2J3EA 1NOKA 1Q0HA 2OYSA 2DJIA 3HU2A 5BORA 4J4TA 1K63A 4MINA 2XZDA 1EA5A 2YJ4A 2EBWA 3R4CA 4GAEA 4N0PA 3ILXA 2Y1GA 4UJ3A 5EZYB 4A4DA 2QN9A 4EGJA 1QF7A 5EZYA 5I48A 3U0BA 5KQGA 2A1TR 1LBTA 5E38A 4DGSA 1J97A 2XIJA 2ZE5A 4TVSA 2VNAA 5P8WA 1C3LA 1X74A 4FX2A 1WXWA 3LW7A 1T9CA 2XMPA 4JT2A 3OZRA 5A05A 1R12A 2IELA 2MYTA 4NSNA 3T7SA 3FCEA 1ZN7A 2FMKA 3OJFA 2CMGA 2FNAA 3TLGB 3SQNA 2P2GA 3TLGA 2VWGA 3OFSA 3D1JA 1R0ZA 5GV7A 1FP7A 1XBTA 1BXKA 1S9DA 2OPBA 3MCZA 3EF3A 4R8VA 4BLUA 3V1MA 1Y7PA 3A6DA 4BKOA 3PP8A 1LQUA 3LF1A 4H35A 1L5KA 1H4VB 3AHHA 5DNDA 2I4NA 4M9QA 4BFXA 4B7AA 4D9KA 4TKLA 3QQ5A 5HIIA 4MVCA 5JS1A 5JQGB 1SFRA 4RTPA 1KIFA 3ILYA 1P7CA 3PF9A 4GOKA 4N0MA 4E2WA 5AI0A 1QFYA 5JQGA 2GD6A 4UJ5A 2JVIA 3L4JA 5J58A 2VPTA 1GPNA 2ZU0C 3G9UA 2VP0A 3ESAA 2HO5A 5DLDA 4ALJA 1QGZA 2W0MA 2AH5A 4KOEC 3VHQA 1RWBA 4AZ0A 4DMUB 4EPYA 3U4QB 2MSCB 4DJEC 5DLPA 2RBEA 5K1ZA 2CCKA 2JFXA 1X7DA 5LDHA 1LSUA 1WXHA 2E5LB 4C20A 2Y66A 3BJEA 3V2GA 3H2IA 4M9CA 5DKFA 1BNCA 1E3TA 5EJ4A 3OEWA 7REQB 3D5EA 3CX8A 1WD7A 7REQA 2B1QA 4AMVA 3VH4A 4N41A 1EX6A 2XB9A 4U9IS 2X0NA 4YQZA 3QSYA 4Z1MA 3K73O 1L1QA 2PG3A 4PZEA 1T6YA 4QQKA 1VMAA 2YNMA 3OX1A 4RVNA 1V71A 2RGGA 3HDGA 2LKDA 3DZKA 5EQTA 3UT5B 2QGZA 3V7YA 3UT5A 4PXYA 3TVYA 2ZDQA 3FWNA 2Z0MA 1IHPA 4KODA 4CRWB 3I23A 1FRVA 3TIXB 5B1EA 3QU5A 4TT3D 3ED5A 4WCFB 4QAQA 2R8PA 4WCFA 5T6MA 3G7NA 3MINB 4K9KA 4UUBA 1DXQA 1SURA 3T94A 3MINA 5GZ1A 2ERCA 1KP9A 2UKDA 3CH7A 4UPVA 1O4VA 2JDIA 2FWRA 2VQ3A 3ITEA 2FQXA 2OHXA 3OJXA 4BC0A 4D4IA 3FTEA 1E6LA 2A0UA 1FTWA 3THOA 3AM1A 1W85B 3WNCA 2IIPA 5LQCA 4KUHA 3EDQA 3NWPA 1XDDA 1QO7A 1ZA1A 4LMPA 3L1UA 1COWA 3MYYA 3VR4D 2J31A 4MVJM 4RIHA 1JMYA 3R8FA 3R1IA 1TW2A 3CUTA 3FKSA 3BIJA 4DY6A 3OZEA 3DMRA 4X8HA 4RTSA 3AFIA 3AVWA 4K1LA 3FA2A 3PUVA 1E7QA 2CXXA 3UB3A 2IKSA 3GGPA 3KS9A 1UK6A 2M6KA 1I0IA 4RTMA 3K0AB 4ITRC 1LDBA 3OIDA 4PPNA 4J4BA 3K0AA 1A71A 5KNCH 2WKQA 1R00A 3S1SA 2WEKA 5ENDA 1C30B 3QHAA 1ZK0A 2IY7A 1C30A 2BGMA 3ET5A 3GLRA 3OPQA 4LBZA 4V0SA 1ULZA 1JHOA 3K1AB 3R7BA 1WM1A 3NX4A 5EIOA 8ATCA 1KK1A 3K1AA 3FTCA 1Q1QA 1T0IA 1YAHA 3I30X 2OGWA 3WLPA 3STTA 3FHJA 1PJ3A 4ZYLA 3GA0A 3HNPA 4XIIA 2Z8YA 1FQOA 4K9OA 3HZRA 1OH5A 2IQ5A 1KI2A 1R0CA 2WWXA 2NVWA 1TA9A 3WJ7A 4MGHA 4R9VA 1AV7A 2QT1A 2PWPA 1R0LA 2V6GA 4B6SA 4C3ZA 3H86A 4YYZA 1MW8X 2AEFA 2O48X 4D8UA 2B6NA 1I94B 2VKTA 3WXMA 4F06A 5EP2A 1G8HA 3KVOA 4P4TA 3TBFA 2GAOA 1EFAA 4DV5B 1F4LA 3GFTA 1ITZA 3JV7A 3TLJA 3UGKA 2QD1A 1SIWA 2PKQO 3MBKA 5FL3A 3BB3A 3RK4A 2FFJA 3N6RA 3K53A 4WECA 4C2BA 2WDPA 5AHKA 5EGSA 2JFOA 4JC8A 3KQMA 4MZDA 5C0OE 2XEXA 5TPWB 2JAOA 1O5TA 2HRDA 1UWCA 3DV9A 4PICA 5TPWA 4GOXA 2Q1YA 2RHGB 2AFRA 1Q7RA 3AHGA 3PHGA 1P1FA 3ZTYA 3U2QA 2JKZA 3HB7A 4XVRA 4J1SA 4M9SA 3H2YA 1ZC3A 2XNKA 1EWVA 2PT6A 1XLTA 5A1JA 4OYLA 1SUEA 5L4NA 4U39A 1EXVA 3ISTA 3ADCA 3ZIAD 1ZD4A 1KJ9A 4DG8A 2PUHA 3IDOA 2XVZA 1Q0PA 3L5KA 4DRYA 4MUFA 4PNZA 3KO8A 5M04A 3KSMA 2HRZA 4XIYA 1DXYA 1OFUA 2BL4A 3RU2A 2DT5A 2GQ0A 3UGTA 4BMZA 5IDWA 1HG0A 4HNHA 4I4LA 1KEZA 2RBKA 1CY0A 4EF6A 1T8RA 1E2HA 3CRW1 3MCAA 5GVRA 2ILVA 4ER7A 4FYYA 2G70A 3QMMA 1RYDA 5JJBA 1TT5B 4Q37A 3EGWA 3SSNA 1IDOA 1TT5A 1CEXA 3L07A 1UBNA 2D4HA 1NVAA 1RAAA 1L6RA 4WCVA 3X3HA 3VU1A 4KFUA 4NOJA 1UJ2A 4MGZR 3VC3A 3KL2A 4YMWA 5EVCA 3JPYA 3ASUA 3V4ZA 6ABPA 1H4TA 2PX5A 4L5AA 3HI6A 4PLGA 3ZLUA 1FU8A 1MFZA 2B34A 4PSDA 3PDHA 2PFKA 5JSYA 3NH9A 2CV1A 1F6BA 4XASA 3R8XA 2CLDX 5CYFA 1CRLA 3BQNB 3K1TA 3BVPA 3UG7A 1G4AE 3AIOA 1SULA 3AX6A 5BSTA 4EOGA 3WGUA 1VE9A 2Y1XA 1PKEA 2WSMA 3SX2A 5K05A 1KMIY 3KWJA 5I7AA 1T5DX 5J5CA 4J0QA 2HMVA 3INRA 4DY4A 4MKHA 1VJCA 2NG1A 4IFEA 4S24A 5AM0A 4G2NA 1G3UA 3RT7A 2C5AA 2GWRA 1K0FA 3PUXA 3CEMA 4Q3LA 1KDYA 4OJMX 5AW8A 4W8HA 1IH8A 3QIAA 5D8DA 1GYRA 1CULC 3KKMA 2WPNA 3EOBI 3DEZA 1YBVA 1OFUX 4OHKA 1NXQA 1M8JA 2BEUB 3BOSA 2BEUA 3QGMA 2BMJA 2C8JA 1W59A 3RU9A 4HVCA 4EB8A 1HDOA 1FPMA 2O1WA 1WMAA 5AVOA 2P9EA 5D01A 4M8SA 1JRLA 2W6CX 3N3AC 2IV2X 5FWNA 2WSYB 1TC1A 1A9QA 2YZKA 3EYWA 1KPHA 2GFHA 2LTAA 4QWWA 2C8LA 3CW8X 3BF8A 3PFCA 4U3JB 4DR7B 3VOBA 4U3JA 4QWMA 1GA4A 2ZSHA 1E9FA 1I7LA 1ISSA 4C7OB 3VKGA 4JUDX 4H6XA 4EPTA 4C7OA 4M1TA 4DZTA 1LY1A 3IB6A 3WHLA 4WWHA 1G60A 1VE5A 1G5PA 2ZOSA 4GH5A 5G1NA 3UGQA 2YYZA 3S99A 1HSOA 3CC8A 2XB6A 2WZQA 4OFWA 4IUBS 2FRDC 1KMQA 3H16A 4X7PA 1TU4A 4B3MB 2GK3A 2LW7A 3TG2A 4HBGA 3TW4A 4RKFA 2JFVA 3IPLA 3WDSA 1GXSB 2XD9A 2Y2VA 4LYJA 4XZ3A 1UBUS 5CA0B 1GXSA 3QLVC 5CA0A 4Z51A 3VR0A 2P4EA 2BFAA 2GXSA 1RQGA 2FLWA 4G4SP 2PSFA 1E8MA 1JYSA 1H3NA 2CXTA 3WADA 2FDXA 4YS6A 1NJ8A 2GPTA 3KP1A 1Y7HA 4MGYR 4BU0A 1SCUB 4UHEA 5C8XA 4U7DA 4XCQA 1SCUA 4PY2A 2BM1A 4F84A 2O57A 3LUDA 7AT1A 4GMDA 1G7TA 1C1DB 1BGWA 3GQVA 4PYMA 4V0ME 5DWVA 4UXHA 1C1DA 2WSLA 3H75A 5CPBA 1E63A 5HS6A 1HDYA 1A0OA 1R4NB 3LIIA 4CT0A 3E35A 1R4NA 4MA5A 5ICSA 5LJLA 2Z5FA 2H2FA 3GA5A 1P4JA 5K4AA 3KETA 3LBFA 2EFEB 4NZPA 1D2EA 5EZ5A 4XWTA 2ZT6A 3H8JA 3IQIX 4WPGA 1DPFA 2CFTA 1PHPA 3HYLA 1N7GA 4XEHA 2O7SA 3SP1A 1A8QA 2GVZC 3UZUA 4NMMA 3IURA 1BKYA 4MB6A 4W7IA 5BMOA 1M0EA 4HRVA 1JEAA 3IP1A 3W6PA 4JVMA 5CVDA 1P2UA 3KPJA 5LWQA 1JQDA 3CZCA 5HKLA 5ADVA 2NO7A 4PGHA 2FOXA 2CXSA 4GT1A 2RHHA 4GZ5A 2SKDA 3WGQA 1RJGA 2M32A 4FOSA 2CY0A 4FU0A 5SV2A 5AICA 2OO5A 2O2DA 4JUCA 1HO3A 1ACLA 2J33A 6YASA 1IM8A 3OM8A 4OHOA 2JRCA 3S40A 4UCQA 2PIDA 4HWRA 8LDHA 1GFWA 2A9OA 1XK7A 4J7UA 3E8XA 3RROA 1GHTA 4IIBA 1DX4A 1O96B 1Z6TA 1EVJA 2AYXA 4PBSA 3AF2A 3B53X 4XOUA 1O96A 1ZWLA 3H2GA 5CB4B 1E79A 2A5LA 3IP5A 3NB0A 3OD5A 3TSAA 3BBPA 2VPZA 1H5QA 2BEJA 4JLWA 3ZI4A 2Q29A 3KQLA 3OO0A 1I13A 4WLVA 1ZK1A 3KZOA 3LT5A 2NZXA 3U3JA 2ZIUB 1GAWA 1E7SA 4M1MA 2VQDA 4ZCSA 4E6EA 1N2EA 3JX9A 1WMSA 3K5PA 2E21A 2RH9B 4KH1A 4KSBA 1MJGM 3U44B 5EL0A 3LS2A 3U44A 4CEIB 1WWKA 2R1VB 1XXLA 3O93A 2F17A 1N1EA 1Z35A 4CEIA 2R1VA 1P81A 3AOEC 3ZBTA 4LZAA 2O8EB 2B36A 3TZBA 2W2OA 4K9PA 2O8EA 3ZHOA 1BX0A 2O3UA 2G1PA 3SLRA 3T54A 3PJEA 4H15A 3UMSA 1TEXA 3DMTA 2WKSA 4EWLA 4EI9A 4RCYA 4WT7A 4F12A 1ZIOA 1GL7A 4PC3A 3QXGA 2YVQA 4MKRA 2VA8A 3L8MA 4ZOEA 1PNVA 3L40A 5KIAA 3IBSA 4U63A 1RAIA 1VZ2A 4QEDA 3SIPA 3EIQA 3I04M 3KPUA 4PZ0A 4CBVA 3M81A 2V96A 2HYIC 2CJXA 4JC5A 1L7XA 5CDGA 1L5GB 4J90A 2IHZA 4JJIA 1SOUA 4QUGA 1KL7A 3OJCA 1O7JA 1EK1A 3GDWA 2ZYGA 4BNKA 3I73A 5KTNA 1NJ1A 4L51A 1VL6A 1B6TA 4N65A 3ZU3A 3LXRA 5LU9A 4PYIA 4L0DA 1EYZA 4L57A 1KE2A 3W3AA 3RF7A 2AW5A 3FUTA 4QELA 1TIPA 3AF0A 1TT7A 3GRVA 1K06A 4RWEA 4F85A 5LWHA 1XTZA 5EPEA 1WJGA 2AG6A 4I81A 4EMUA 5EFZA 4LC9A 1GVNB 2QAJA 5DI3B 4B81A 3OZTA 4MUIA 5DI3A 2EZUA 1UPXA 1HUQA 1JR3E 1W52X 4L75A 4R68A 4UEWA 5EZYF 2V7QA 3FSEA 1AK2A 1IFXA 2G7ZA 4Z2AA 2HK7A 3SJ7A 2QPOA 5BYKA 3E9EA 3ODGA 2XE8A 2V8BA 2EP5A 4QD3A 2FSHA 4I0WB 5L7WA 1NP7A 3CS3A 3KOYA 4JL8A 3GFBA 4QHYA 4JMLA 4RADA 1TZMA 1EG2A 4UAVA 3B2NA 4EHAA 4FDAA 4HFMA 2K5UA 2OUKA 3NYQA 2G5PA 3DVLA 4FP9A 4Q00A 3ISJA 1EQAA 4Y2JA 5ARBA 3GFFA 4IZOA 1RZRD 3R4VA 1YVDA 2QHXA 2X2EA 2QPTA 5CURA 3CBGA 3ROMA 3WGVA 5JXGA 1SKMA 3EVDA 2W6ID 2W00A 3KAQA 4QASA 4ZAYA 4DBZA 4KREA 1VCIA 4YRQA 3TN7A 1LK7A 1VJGA 3JRNA 4GMFA 3X1XA 3WFIA 4GX0A 3CSDA 4NRDA 1NG9A 1E2FA 1NW9B 4KIGA 1IRIA 1YTUA 5KYNA 1M75A 1AY0A 1Z73A 4CQMD 1RMYA 5JQGF 2RAVA 3CSUA 4ZO9A 2GCPA 3IP8A 2AI2A 2VRCA 4KQ1A 1G18A 4IH1A 1ODSA 3GUZA 2W6JD 2JFYA 4I99A 4IZ6A 621PA 5K09A 5E1DA 4JOCA 2HREA 2HFKA 5BWCA 1NUHA 3N3BC 5KYYB 1FSSA 1PSDA 3SZ3A 5IT9A 1Z6GA 3P9XA 5KYYA 2WUFA 3CMCO 2EFHB 2HMSA 2E3JA 1YKGA 2HLNA 3LHDA 4NYJQ 3C7AA 2DETA 2C5SA 3H6GA 2V7BA 1T8UA 3HYRA 4UFNA 1IUKA 1W49A 4X1YB 1I0LA 4NBTA 5ALRA 2TMYA 3NV9A 2B94A 2HI0A 3PLNA 4OXXA 4X1YA 3JYHA 5TPZA 1YFZA 5KNLA 2DPXA 3AF5A 3C6QA 5IPFA 1B8NA 3SD7A 2VSYA 1GA1A 2MJLA 4FWIB 3PEWA 2Z3ZA 4KHPB 3HVHA 1AKNA 3WB1A 3RRYA 3DE6X 1CY1A 2WJPA 2DLNA 4Y0AA 4BO8A 3AR9A 3K0HA 5TIIA 5AW4A 2OXFA 2BZ0A 1EB9A 2PR7A 4WKPA 4JNCA 3A6EA 3TIVA 2ATVA 3D4NA 2K7FA 3ZD6A 1V1MB 2YKGA 3RVRA 1V1MA 2WF7A 5T4HA 1SOAA 5F7OA 3NT2A 4ZQGA 2RKOA 1PJ8A 8OHMA 5IULC 1PEKE 4JBWA 2MT9A 3C3PA 1GZDA 5CYOA 4DDTA 1FSFA 5JDIA 1S8AA 1ODLA 3LL4A 1SU6A 1Y3FE 4F5EA 3WL5A 2GAFA 3GO4A 5H16A 5JCOC 1C0IA 1XDZA 3S55A 1FDIA 3DVRX 3E7XA 1ENYA 2WD9A 4JLDA 1MQ8B 1T91A 3BYZA 4IIGA 4K9DA 5HCNA 5CFQA 3EXFB 4K3UA 2F6RA 2FPIB 4UD6A 3GJ5A 1T6BY 2FPIA 2B0CA 3MJTA 4OQLA 5DULA 1H85A 2MR6A 3PTAA 2ISSD 2WP8J 3PRHA 4P33A 3GAAA 3IEIA 3L2OB 1V8ZA 1I3KA 3CR8A 1TQ6A 5F5NA 2DR3A 1ULBA 3R2JA 4J3JA 4X60A 5DBFA 2VZ8A 2XRYA 5ALKA 5ARDA 5TF4A 1M74A 3MIIA 2Z1NA 4OKIA 1SMKA 2G0AA 4Q16A 5AKXA 4RKYA 2O9JA 3PBKA 5JI3E 5JSQA 3I39X 1XDWA 1ZAKA 2CKMA 2D3WA 2ZSJA 4L8VA 4XVQA 3SHQA 1M7GA 3W2TA 4F97A 3CF4A 3KKEA 4XCVA 1H5UA 3SHWA 1JHAA 4X62B 2DLCX 3P2EA 5FHRA 2F43B 4PYRA 2GPNA 3N53A 2F43A 5A71A 4CL2A 3IDQA 1I7NA 1L4UA 1X7ZB 3QRWA 1G6OA 1QZUA 3RFFA 3T06B 3A9TA 1ZYUA 1X7ZA 3K2BA 3QMWA 4URXR 1FNNA 1GNVA 2VZEA 3ETEA 3OIFA 4L74A 2A9FA 2XWJI 4XYMA 4QHTA 5FOUA 4G1UC 3OJWA 4FW8A 1YU9A 1WCIB 3A04A 3IERA 5CBPB 4ETIA 3K0CC 4ZTZB 1TM4E 1WCIA 3P4UA 3UAYA 4DW8A 5CBPA 5HOEA 1NJ2A 4I1PA 2AG1A 1RFGE 2WYUA 1R50A 1QRTA 3CT6A 1CJUC 3ICOA 3QENA 1LV7A 3AFGA 4B75A 2ODAA 3MGKA 3ND6A 3Q8WA 3JZMA 2QKYA 5CXXA 5DHAA 3ZXSA 1RKQA 3I0MA 2C2KA 2Q7OE 3OU2A 4KBGA 4FNGA 1NVVR 3CV3A 3F9IA 1YIDA 1M2EA 3PGMA 3C3MA 1KP2A 4JX8A 3KAJA 4YQFA 4MLDA 1TGVA 1KI6B 4ZVQA 1MOPA 1KI6A 3HB0A 5J59A 2RK6A 1RABA 3LDFA 2E89A 1K7YA 3EASA 5B6PA 2HHCA 4OH7A 4FHGA 3AEYA 1ABEA 3CU5A 4H0NA 1FP6A 1HYEA 1TQDA 2J7PD 4YRPA 3RIEA 4B34A 3GH1A 2ZI9A 2E48A 4LIPD 2A0YA 5FLXA 1JSZA 1VM6A 4KVGA 2EYUA 4DC9A 2IOFA 3ZNOA 2ANCA 2PANA 1KDZA 4F1WA 1YZLA 5BO5A 3B9BA 3R8CA 4EKNB 4YAKA 1HQCA 5HRCA 1KU0A 4TKZA 4HY3A 4BN5A 4D97A