2GEDA

Signal recognition particle receptor beta-subunit in nucleotide-free dimerized form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
190
structure length
170
Chain Sequence
DGFKFANLEASVVAFEGSINKRKISQWREWIDEKLSYQPSIIIAGPQNSGKTSLLTLLTTDSVRDYDGSGVTLVDFPGHVKLRYKLSDYLKTRAKFVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESSCENGIDILIACNKSELFTARPPSKIKDALESEIQKVIERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor beta subunit
publication title Homodimerization of the G protein SR{beta} in the nucleotide-free state involves proline cis/trans isomerization in the switch II region.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport, signaling protein
total genus 52
structure length 170
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gedA00
5GJBA 1P7CA 2IWHA 1NN1A 1GITA 2G3YA 1YZGA 4HDCA 1OW3B 1LY1A 5SZIA 4FD2A 3HR7A 2Q9CA 5LD2B 5L3QB 5BWMA 3BWDD 2NO0A 1X1RA 2W6JD 2OZEA 3FMOB 3DHWC 4O2LA 3K0CC 3NHAA 5CLLA 3GLFE 1KJZA 2OXRA 4FN5A 4XWAA 4Q02A 4DCVA 4EPTA 5KSPA 1NKSA 5IF9A 2ODWA 5EP3A 4RJLA 4NL4H 3CH4B 5HKKA 1G18A 5D3MA 4PX9A 4C0HA 1G3MA 1N6OA 1NY5A 1CP2A 1H8HD 2QAGB 3BE4A 3I4LA 1KZGB 4FMCB 4WA7A 3RWOA 4AWXA 4YMVA 2WJJA 5FL3A 1S4QA 4KXFB 2OAQ1 4DLUA 1W7AA 3MJHA 3T5DA 3PR1A 1QHHA 1Z22A 4OK5A 3C15C 4LV6A 4O0MA 2V54A 3CPEA 3SJZA 8OHMA 2GF0A 5FBLB 1U0JA 2ZRBA 4UXIA 4XD7D 1E99A 1DOAA 2EWVA 1HY3A 2NO7A 5D3MB 3W6NA 2NPFA 3BD9A 1TPZA 2PZEA 4BFYA 4CEHA 4LSGA 3KUDA 3B78A 3QXXA 2OBMA 2HXYA 4TLAA 1OFIA 1M74A 4R71A 4Q01A 1HURA 5JBQA 5EXSA 4MA4A 5E3HA 3VAAA 1QHHB 2IXFA 3K70D 4B3GA 4C3ZA 1DG1G 1EFUA 3C7KA 5JS7A 2KJQA 4LJAA 2QROA 4B32A 1BO6A 3IPXA 2P6RA 3JZAA 1JR6A 1E9SA 3EIQA 1MRSA 4LRWA 2ZJ2A 3WP0A 4CEHB 1NN5A 3KTAB 1ZM9A 3DEFA 1G3RA 2JJ1A 4AC9A 3W6PA 3A4MA 3D6TB 4B48A 2EFDB 5HZKA 2DY1A 4M1SA 2AWNA 3VR2A 5KHOC 1Z0DA 2IUTA 2QPTA 3RRNA 3LA6A 2ZRAA 4D26A 2QMUA 2ZROA 1OIWA 1SXJE 4CF7A 3I32A 2G1KA 4G5QA 1CEEA 1EXMA 2HCBA 2X2FA 2IF0A 4PZZA 2DYKA 2AK3A 3ZVLA 3ND8A 1G6HA 1G3UA 2XNDA 2R6FA 1N5IA 2O8FB 1GRRA 3GLHE 1U99A 1GP2A 3OIUA 4DSUA 2YVUA 3CRRA 3OESA 5CB8A 2CVHA 3Q5EA 1JR3D 1VYTA 2V8OA 3SFVA 1LVGA 5JSZA 3BB1A 3CZQA 2OLKA 3WP1B 4LJYA 1TEVA 3OIWA 3Q7PA 4LX0A 4C0KA 3GLFA 2ZYVX 4U00A 2AR7A 1AKYA 2YZ2A 3VNUA 5JLJA 2QSZA 3QXCA 5LBIA 1XBTA 4DDVA 2ZSAA 1KO1A 1XJ0A 1AS0A 2CEAA 4TL6A 2D7DA 5FL7D 2PT7A 3KZ1E 3EIEA 4KYUA 5FTJA 1S0UA 2IYUA 3OE7A 1NI3A 4W5WA 3ZD7A 3R9WA 3ND9A 3LRPA 2F3TA 2C95A 3IGFA 3LDAA 3PUWA 2YJTD 3GLFB 4O2RA 2VHQA 3FPAA 5KNDA 3BFXA 1GOTA 3WXMA 5JJLA 1QF9A 2H92A 4Q1BA 3LWNA 3SR0A 4XTRA 2ZM5A 1PV4A 1XNJA 3HPRA 2IYLD 3F0TA 2QT1A 4ZIRA 1SVKA 3GEIA 3O47A 2F7SA 3EZFA 1YR8A 1ZNYA 1U0LA 1M7HA 3GD7A 4V0NA 3JVUA 3VKHA 1NLYA 2REOA 3CRVA 4JLBA 5E7IA 2IXEA 4JLNA 4LJ8A 1JPNA 4MH0R 1BMFA 3B7GA 3H1TA 4LBZA 5FH9A 2ZVPX 2PCLA 3G82C 1QHNA 3I1FA 5K8IA 1LS6A 1Q22A 1TX4B 4TL8A 4ZPXA 4ZIRB 3WRYC 3LV8A 2IEYA 3A1SA 1G7RA 2F1RA 4F93B 3C14C 4RZ3A 4AIIA 5DH9A 2HT1A 3AP1A 4B34A 2BIFA 3BC1A 1W4BA 3UG7A 2QTHA 2AD1A 2Q3HA 1GSIA 2RGGA 2QN6A 3E2IA 1R0XA 2XTZA 3WMGA 1FUUA 3OEHD 1D2EA 2FPLA 3IQXA 5CIQA 1KYIA 2FFAA 3F5FA 2R6CA 3CH5A 1ZC4A 2BMEA 3A37A 3TBKA 2Y8EA 4UNPA 5EXPA 3GLHA 4TSFA 3QKTA 3IIMA 2GBLC 3BS4A 3VR4A 3FKSA 2QBYA 1P9NA 3CO5A 1XTSA 4V0MA 5FPYA 4FW9A 5ANRB 4X8HA 4QL3A 4LC1A 1E2IA 1X1SA 2C9YA 1C1YA 4GI7A 4R2IA 1P2VA 4OHXA 1Q12A 3EG5A 2DFTA 5LD2C 4MKHA 1L2TA 3GLHB 2HEIA 2OM2A 3EX7C 2EQBA 1N5LA 3CPJB 1QVRA 4IFEA 1WMSA 2ZYWX 3FYHA 3MSXA 4Q1AA 3CLVA 2FN4A 4U02A 4B6FA 1WBBA 4C0AC 2GXSA 4FWIB 4EFMA 1II9A 5FOVA 3SNHA 3BH0A 5JZVA 1W0KA 2QORA 2QAGC 3ZQ6A 2QQEA 3IHWA 1E2LA 3AF4A 2VQSA 4EFLA 3AKYA 4EAQA 1UADA 1IBRA 1W4CA 1H8ED 2PEZA 2OXCA 5CM9C 1NJGA 1ZYUA 3U7HB 3AKCA 1CJKC 2PBRA 2ZRIA 3FFBA 1Q3HA 3OZXA 1WXQA 4NP6A 1Z6AA 1XPOA 2O8EB 1G4UR 4D2IA 2IYZA 1T9HA 4AG6A 5KNCA 2BJVA 3QVVA 1M1YE 1E0SA 4DCNA 2BVNA 1Z0IA 2G0NA 1RRGA 4PXAA 4BZPA 4HLUC 1DPFA 2W58A 3IEVA 1F5NA 3AGPA 5CYOA 3KKOA 1J2JA 1CR2A 5KPJA 5IK2A 3SU8A 1MO5A 2ZIAA 1Y3AA 4NPHA 1W36B 2YC4C 4EPXA 2NTYC 1A2KC 2B7BA 1ZVQA 4XVRA 1I2MA 4I99A 1KTVA 5AUOB 4QNRA 4EJSB 5CDFA 4OI4A 1DAKA 3THXA 4IVPA 4OHZA 3CWQA 2E87A 3VFDA 3DL0A 4ESVA 2MMCA 3MCAA 3REGA 1LB1B 1P61B 4BLOA 3CIOA 2BDTA 3DMDA 1BOFA 2HLDD 1X6VA 4RZUA 1E0KA 1TU3A 1U8YA 3DMNA 1MRNA 4PC1A 4ZCIA 5A5GA 1T3LA 2XOKA 3EARA 1XCPA 2NO6A 3SBDA 3HPQA 3KKNA 2QM8A 4IOMA 4JKIA 2Q3MA 3ZZ0A 4U5XA 3RLFA 3X1YA 3THXB 1PUJA 4JLPA 1VIAA 3QPVA 3W3ZB 1UKVY 2YNMA 1KKLA 4K81B 2GJ9A 3KQHA 2RHDA 4BFUA 2O8DA 1OXSC 1QHXA 3KQNA 3IIKA 3ZYCA 3C8UA 1EFRA 1Z29A 5TB5A 4JLOA 4C0LA 4GMDA 4GOXA 4DSNA 3VKGA 3G5UA 4KSCA 4W7SA 2J45A 4QGFA 2F43B 3W8NA 2IEZA 1EK0A 4KLZA 3VQTA 2WWWA 1IM2A 1FNNA 5BYKA 4ASUD 1LF0A 2G0TA 5JWHA 4M9QA 3SDZA 1XD8A 4RKEA 5FUWA 3X1DA 4KJZA 3SJCA 1IY0A 1XMJA 2CK3D 4NCIA 4AI6A 3IUYA 3RS0A 1O87A 2G6BA 4HAYA 1R0ZA 2V6JA 1OSNA 2DFNA 2ERXA 4MDFA 4LK2A 2DCUA 2ZRKA 4ZKEA 1Z3IX 1KMQA 5C46F 2HDNB 1W0JA 4MGIR 4DWJA 5DYIA 4TTRA 3WHKA 1N6HA 4EIWA 1GWNA 2ORIA 3THWA 4AD8A 4B35A 1T0HB 1T3SA 3B1WA 1NVVR 4RCYA 5SZHB 4IHQA 5DGXA 2Z4RA 4QHSA 5JJIA 2XX3A 4QGGA 3CB4A 2ZJ5A 3BAFA 2GNOA 3V4FA 4P4UA 1R8QA 2UVQA 1KOFA 5KOYA 4KVAA 2NPIA 2IYYA 4D25A 2WHXA 2QE7D 1E1QA 1MV5A 1EFCA 4HLDA 5FUXA 2JIZA 4BGDA 5HCNA 2C2HA 1TNDA 3LBNA 4LZZA 4ERNA 3THWB 3K0CA 1FUKA 5FPHA 1JBKA 2LWIA 2EYUA 2WIAA 3ADCA 1KSGA 2OE2A 1M34E 1WE2A 1I2DA 3FVQA 4FMDF 2HT6A 4IVQA 1ZIOA 3RS7A 4LJ7A 2ZR9A 1PLJA 3VX4A 4A4DA 1U2RA 1XP8A 4TMKA 5FBRB 4ZDWA 2XGJA 3SQWA 4JVSB 3QPWA 3SZRA 2OCYC 4Q00A 3W90A 3I61A 1ZMXA 4Q9HA 2J0UA 2QZ4A 2AX4A 1TQDA 3VMFA 3GEEA 1KJWA 1RE0A 3B1XA 1FQKA 1HUQA 2ZANA 4PZLA 2QT0A 1SVMA 2G9NA 1N3BA 1YZUA 3W8RA 1E9FA 2PMDA 2R62A 3VR6A 3CF0A 4NBSA 1AKEA 5DE3A 3I5XA 2H18A 1Q20A 5TXGA 3WRXC 1VECA 5H68A 3TE6A 4NYIR 2PZFA 4PAMA 3UWOA 2J7PD 5AK0A 4US0R 1E9BA 1OHHD 3K0FA 5AJWA 3EZ6A 3TKLA 1MH1A 4K46A 4KO8A 5L3SA 1NIJA 1XXHA 2FH5B 1HT1E 1HE1C 1N6KA 3ONWA 1AQYA 1WRBA 2IW3A 2ZUBA 4C7OA 2VHUA 1NSFA 2QI9C 3IBGA 2VP4A 4LY6A 1Q0UA 3C16C 4PO8A 3TAHA 4Z1MA 3NDBB 1N25A 3MJRA 3NBZC 5A0FA 2BHRA 4JSTA 4YMWA 3B1YA 4HUQA 1NNEA 2H57A 5F3WB 3DM5A 5L3SB 2WPDA 1XXHB 1M7GA 3UPUA 1BIFA 4BPBA 1SVLA 2ZRDA 1IN7A 4AURA 4P32A 4US1R 1P9WA 1KI2A 4LV5B 4GT1A 4LBYA 4CEIA 1OYYA 4Q4AA 1Q3TA 4PSAA 4MRPA 3NWJA 4PANA 3SE0A 4XWOA 1YZQA 2RGCA 1OXVA 4IRUB 3SN6A 2J1LA 4GL2A 4HUQB 2ONKA 4RY2A 3C5HA 4JVLA 4QM7A 3B9PA 1FL9A 1QG4A 2NZ8A 3K9GA 4MKGA 2WSSD 1Q1QA 1CLUA 2JDIA 4LDJA 3X1ZA 1NBMA 2VTKA 2W00A 1E9DA 1UDWA 3UWKA 3AVYA 1WCV1 4G3XA 2V1UA 4M1OA 1DO2A 4H1UA 2IK8A 1OKKD 1QBKC 3U60B 1NG1A 1E79A 2OV2A 4CEIB 3IO5A 4LC0A 2CNWA 1W44A 2FPMA 4Q48A 5IHPA 1T0JB 3QOFA 3EZ2A 4DVGA 2DWOA 1W36C 1DBSA 1NMXA 3GLGA 2HV8A 1N0UA 3OAAA 2ONJA 2GF9A 2VP9A 4EJSC 3LX5A 4FXPA 1QG2A 2VIIA 1ZM7A 4KLNA 4FINA 3I8XA 3PXGA 4FCWA 3TH5A 4QNMA 4B6EA 2VEDA 3O8CA 2OSBA 2REXB 3KB1A 4HAWA 1A4RA 1ZUIA 4RD1A 5FPSA 2CVFA 2GTPA 2ZREA 1DAMA 5JWOA 3QI2A 3PCRB 1JEEA 5JJKA 5CK4A 3GLGB 3ICEA 5KSYA 2AXNA 5LDDC 3TNFA 3FDIA 3CNLA 1UF9A 1N0WA 1K5GA 4P3YA 2BC9A 1Z2CA 4KODA 2QTFA 3P26A 2JJ2D 5JECA 2WKPA 3TSOA 2JATA 2FZLA 4RD4A 4K8OA 1R5NA 2QPOA 4ESHA 1X86B 1XD9A 1FNMA 3VTKA 4KFUA 2XXAB 1G21E 2WM9B 4S2EA 2A5FA 5C2JB 4Z51A 4XVUA 3T12A 1D2MA 1G17A 4LHXA 4CW7A 4GP6A 4M9ZA 2V1XA 4E09A 1IN8A 5H70A 4EKDA 4UXHA 2XJ9A 3I73A 3KDSE 2ZAMA 2AN9A 1SKYE 1R5BA 1GL7A 4HAZA 2F9LA 1UBCA 3LVRE 1FTNA 2YOHA 3GJ6A 1COWA 4HAXA 1ZIPA 2DFLA 3BOSA 4N0DA 1Z8FA 4A2QA 3JZMA 2FOLA 4OQNA 3WY9A 1SVWA 5HZHA 1QZXA 3W6OA 4POAA 1D2NA 4JT4A 5JEDA 1ZAKA 1VYVA 5ELXA 4BQSA 4P4TA 2QMOA 2R65A 4DLTA 2WAYA 2OFXA 4KV9A 2HJVA 1AK2A 3RABA 3WNDA 1JPJA 1KJYA 1FX0A 2C96A 1G8HA 1E1RA 4NYJR 2GJKA 1KNXA 2OHFA 3EWSA 1Q57A 4BECA 4N1AA 5G40A 2J5XA 1KO4A 3P4YA 4A2PA 3T5GA 4PPNA 2R8RA 1GG2A 2JLQA 3QKRA 4UXJA 3KXKA 1RRCA 5AUQA 5G53C 3T06B 2IHBA 2D4HA 2XJ4A 3T1OA 3MWJA 3QF4A 4IW3B 1SHKA 4BEBA 5KYKA 4F4IA 1WF3A 3B5JA 4OK3A 2X2EA 4B3DA 3C41J 4U7DA 1FX0B 4ARZA 2C99A 3QXSA 5P21A 3GFOA 3FTQA 2X1VA 3NEJA 2DWPA 1U8AA 4JIMA 4BFVA 4XOIA 1R6BX 1RPZA 1Q1ZA 4MQBA 2QAGA 1E2JA 3CRMA 2Z43A 3QKRB 3QEOA 3B2EA 4D4JA 5FUVA 4GOKA 3ZQJA 1DARA 4G5SA 4IOJA 5HKKD 3RNLA 1G5TA 3AVUA 1C4OA 3QF4B 2RGBA 3A4LA 2CLDX 5AJYA 1P62B 1TL7C 4Q9JA 4ZCLA 1AS3A 2W2VA 3KX2A 5DNYB 2B8TA 4ARZB 1YQTA 4NYMR 3UIEA 5J4KA 4ACAA 4JBYA 1RC8A 2F6RA 1BYUA 2VBCA 2VHCA 1M7BA 4B3XA 4A8JA 4FCTA 2AKAB 2FFQA 4ZDIA 1QRAA 4LPSA 4DHEA 3ZVMA 2D2EA 3Q3JB 3FHCB 1CS4C 4DKXA 1NG9A 1C9KA 1G64A 4D4KA 5F98A 2J41A 2ZSDA 4E07A 3OEED 3E70C 5DI3A 4HLUA 5F9HA 4DLRA 2CL6X 2IYTA 3T61A 4JLMA 5EE3A 1P60A 5BYJA 3WNCA 1CRPA 1ZNXA 3P32A 3DO6A 3K0SA 4B3CA 1PVOA 4P0TA 1JR3E 3CPHA 2VRWA 3T15A 2C98A 3C4JA 4A8JB 1II8A 2JLUA 3EC2A 2OT3B 4GFDA 4PFSA 3KTAA 4Q4HA 2FFBA 4LHZA 1PZNA 1VKJA 2W2XA 1W1WA 4GDFA 3ZLJA 3IQWA 1EFHA 2CDNA 4TMWA 1SKQA 4KITB 2IT1A 5DI3B 2QGNA 1GNRA 2A5GA 1DAGA 3OIVA 1H8HA 1M2OB 2JJ1D 1G4AE 4OQMA 1E96A 2P6UA 4QRHA 1ZU4A 5FTKA 4A1FA 1YU9A 1SKYB 1G5PA 4W5HA 2WJYA 1YRBA 2IX3A 3CBQA 5HE9A 1SVSA 3IO3A 1II8B 4Q9IA 3AH8A 1E9RA 1BKDR 4HAVA 1RYFA 4Q4HB 4EDHA 4JLJA 2GWHA 2B92A 1R8SA 4DLZA 5FI1B 2XAUA 4QXAA 2O8FA 3H86A 4DIEA 4F91B 1N5JA 1YR9A 4BLRA 5IRCD 4Q1CA 1N0VC 4JYCA 1NL3A 2XZPA 4AKIA 4B44A 1EESA 3HP1A 2AFIE 2XNDD 3FMPB 1QVAA 2LCFA 2GJAA 3DPUA 3V9PA 2OILA 2C9OA 3U4QA 4Z8YA 3LQRA 4GOJA 1KAOA 1RFLA 4QBGB 3IDQA 1X8JA 3IKJA 2BCGY 1TUEA 2EVWX 3AUXA 4NZYA 1R10A 1AGRA 4B76A 1NRJB 3HYRA 2JLWA 2XZOA 2VHJA 2GZHA 2GAOA 4L16A 4LJ4A 1VG8A 4HZUA 3J81k 3ZD6A 4TT3A 3ASZA 1P9RA 4MYHA 3L0PA 5C4GB 1KZ7B 4GZMA 2BBWA 3CX8A 4IDPA 3U4QB 2OFOA 3TVTA 2EU8A 3OE7D 3OFNA 2NOAA 2RAPA 3K70B 3RS4A 2P65A 4PC7A 2OFWA 1KI4A 4E5UA 1Z6YA 3AVQA 3ADBA 3LXRA 1G291 1RJ9A 1L8QA 1VDZA 4HZUB 5E7JA 4YQFA 1SGWA 1SQ5A 4X8MA 4RCZA 1VCOA 2EFHB 4XSHA 4BRUA 3RC8A 2WBLC 1JXMA 2RGDA 2YINC 4TZ6A 4ILEA 4ON9A 2VO1A 3ZH9B 2FZ4A 1QHYA 3AKDA 2ZRPA 1GM5A 1DS6A 1OXTA 1D6JA 3W9YA 1SULA 1Z5ZA 1LFDB 1IY1A 1S1MA 5C4MA 1ZNZA 1XX6A 1HQYE 3L0OA 5DN6A 3GPLA 1BMFD 1RJ9B 3NXSA 4MRNA 2Z4SA 4QHYA 1UKZA 3U3JA 3UMRA 1RVDA 1XTKA 3TSZA 4EUNA 2GCPA 4HSEA 3CNNA 5IDVA 1NLFA 4IXNA 4B3BA 3CKLA 1TU4A 4HUTA 1G7SA 5FL7A 3SC3A 4BFWA 4IEEA 4WZBE 4BLQA 4MUAA 4ZKDA 3K09A 4A0HA 4PQRA 2H7VA 4A82A 4TYWA 3BRWD 2D7CA 4XIGS 4UJ3A 4L9WA 4M22A 1LNZA 2WOJA 3B82A 5EUQB 3QNUA 1M6NA 2RMKA 5E7MA 3ZS9A 2Z83A 1LTQA 4QM6A 2OG2A 3N2EA 4AK9A 1VYUA 2H8KA 1G8GA 2G1JA 1SXJA 4A15A 3K0AA 2DPXA 3WNBA 1EWRA 2CCJA 1I4TD 2ZRMA 4KAXA 4BLTA 4UQOA 2FSGA 4S35A 1Z06A 3W5IA 2ZJYA 2ZXUA 1YRAA 5CIWA 1E94E 3RANA 1WP9A 3RRMA 1CXZA 1E2QA 2VH5R 2IYVA 3MWYW 1P2UA 2AXPA 2J3EA 4UNQA 3D31A 4DZZA 2ZUCA 1AM4D 4BFXA 1QHGA 2ASEA 1Z07A 3RRZA 1Q44A 2CJWA 4IVRA 4OHWA 3VU9B 1G5RA 1HV8A 5FR2A 1SXJB 3L8ZA 4N0EA 4BLPA 3A1UA 1Z0FA 3A4NA 3K0AB 3REFA 4P33A 3ADDA 2RHMA 5DSZA 4C0BA 1G20E 4DLYA 2BWJA 3D7MA 3SS8A 1ZM2A 5H1YA 1VG1A 4DC9A 4LHVA 1Z63A 121PA 2W6IA 4IJMA 5KDDA 4ZDJA 4BUJA 4NCJA 4F38A 2WOOA 4Y0VA 1U90A 3TGPA 2BKUA 1W0KD 2GJSA 2B8WA 4URWR 2CJWB 2XZLA 4ZO4A 4RZXA 2OO7A 3OEHA 1G3QA 4JJZA 2GRJA 621PA 2O8EA 3PEWA 2AFHE 3UK6A 3A8TA 3NC1C 1IN5A 2JCSA 4DSTA 1GILA 1VIYA 2H1LA 4LCBA 2WMNB 3PENA 2O8CA 5L3RA 1P75A 4LV8B 3RHFA 2IC5A 1IHUA 2B6HA 1IXZA 3FE2A 1T4GA 5TVKA 4DLSA 1E2KA 2JASA 3K53A 3BGWA 1CF4A 4JYBA 2FJUA 3U6KA 1W36D 5K8TA 4LYJA 1S96A 2FSFA 1XEWY 1IN4A 2BBTA 2ZE7A 4RD3A 1Q21A 2QENA 1KK2A 1OFHA 4UJ5A 3VKWA 3QBTA 1IAQA 4JL6A 3P1JA 2IA5A 5JCPA 1NN0A 3IILA 5CK5A 2QUZA 5FPTA 1U0HC 2A2ZA 3H84A 4L9SA 3HWSA 3LAWA 1FTSA 4KSBA 4URZR 2O8CB 4A8JC 1A7JA 1KK1A 3EZ9A 4EJSA 4KYIB 1V5WA 2KE5A 3Q72A 2ZU0C 5IK2D 1BYIA 2BBOA 3EXAA 2FGKA 2YKGA 2Q3FA 2V9PA 1W2GA 1BS1A 1I4LD 1YKSA 3LQQA 2D2FA 5HR5A 3KQUA 4HB4A 1OFUX 1MKYA 4B47A 1KI8A 2N42A 1U8ZA 4RD0A 2GETA 3LLUA 2FMXA 1P6XA 3SJAA 3PEUA 4M9SA 2A78A 1KI6B 1IQPA 4QGHA 2J0SA 2WSMA 4PPGA 5B64A 4R2HA 1QHSA 3FKQA 3I72A 4PQFA 1KHTA 2X8AA 1J99A 3A1TA 3GLIE 2OLJA 2ZAOA 5EQTA 4KFTA 3AP2A 3LNCA 4M1MA 1F6BA 4LBVA 3H4MA 3I8SA 1OE0A 1VHLA 2IF2A 3ADKA 1GUAA 2QRZA 4TQUS 2J9RA 1Y63A 2OUKA 4BFZA 1L4UA 3ZVNA 4CDGA 1D9ZA 1XTJA 4WBSA 3NH9A 3TRFA 4D0LB 1SVOA 2V7QD 1P2TA 1DELA 1UBFA 3L43A 2F43A 3DKPA 1NN3A 2GK7A 3TR0A 1P5ZB 2QSYA 3AQ4A 3M1IA 4YXWA 2JLRA 2IWRA 5A4JA 5EP1A 1EFRD 3EA0A 1FP6A 1EWQA 1N6NA 1US8B 1R7RA 4E22A 2DB3A 1T6NA 6Q21A 3QENA 5JRJA 5EE0A 3A6PC 1F48A 4NCHA 4Q21A 3B60A 5TARA 4DLWA 1KI1A 2GA8A 2ODBA 4PSKA 4EPWA 3KFXA 3K70C 2JLSA 3WBJA 3MUFA 1CU1A 4Z54A 4L5BA 1GTVA 5FOWA 4E03A 1OLOA 1SVIA 1Q1EA 1GZSA 5HE8A 5KPDA 721PA 2W0SA 4MGZR 2EYQA 1LF5A 4WXPA 3V00A 1Z0KA 4NMMA 2P2LA 3GEHA 3MWKA 2QP3A 4HATA 4I1UA 1IXSB 1DEKA 1NP6A 1JAIA 2KBEA 1TF2A 3C5CA 3KKQA 1IOZA 3QE0A 4MKIA 2ZR7A 4Q1EA 5GVSA 3MLEA 1ZJ6A 1CR1A 1E9AA 4MUBA 4B71A 2NG1A 1F60A 1MT0A 3OIYA 3PIRA 3ZS8A 4URUR 2FG5A 3U3OA 4GNKA 4XH9B 4BE7B 1RZ3A 2Q0HA 2DFKB 4B2IA 2JIZD 2LKCA 4Q7LA 5FBVB 2I3BA 1XCMA 3QBVA 4KBFA 1VPLA 4JLKA 1MABA 4B2LA 4NH0A 1E69A 4AY2A 1KI9A 4HLQB 4L15A 4V0LA 5CLQA 1E2HA 3RS5A 2WWHA 4PAQA 5EP2A 1S2MA 2J46A 3Q85A 4MITA 1GKUB 2WVJA 2D74A 2GK6A 1XEWX 5GJWC 2AK2A 4EPVA 1A82A 1D8TA 1W48A 2V4ZA 4D0NA 3GLIA 1AQUA 3I62A 1MABB 3R20A 3NKVA 2QL6A 1MR3F 2E1RA 2I4IA 2J87A 3CONA 3LD9A 2IYWA 3K09C 3QUSA 2ZI6A 4FCVA 2HF9A 2OCBA 3T35A 3U7FB 4ZCMA 3FHTA 1W47A 4Q1DA 3MG9A 4IXMA 4C9BA 3U7EB 4BLSA 1G6OA 1VCNA 2UZIR 4GZLA 4Q19A 1N5KA 2FE4A 2ZRCA 3P20A 2CHVA 1ESNA 4DDTA 2QE7A 4D81A 3GLIB 4JVNA 2GESA 1SXJC 4PC3A 2FDCA 1Z0AA 4QBIA 1GFIA 2ZPTX 4QKQA 2QA5A 1AZSC 2RB4A 4CEJA 2FSIA 5J40A 4MGYR 1VCMA 2XB4A 1AGPA 3WBKA 3ZVRA 1TQ4A 4WAUA 1JNYA 3MAAC 3K0EA 4C30A 4M8NE 4Z1MD 5TMPA 2UKDA 2IUSA 4IEIA 5KSZA 2MSEB 3AF1A 4Q7JB 4EQ6B 4DDUA 4JJKA 4AKEA 3GQBA 4Q4JA 1E0AA 1KKMA 3GJ3A 2XB2A 1JI0A 1QHIA 2ZI7A 4YLGA 5EP4A 4NONA 1S3SA 4BFSA 2HUPA 4RZ2A 4WZ6A 3ZIAD 4CEJB 2BJWA 1W5SA 3PUVA 3PFIA 2FGJA 3SYKA 3KJGA 2EWWA 3U3KA 1KDOA 1W46A 2C8VA 4R9UC 1EG7A 4Q1FA 2ZVQX 2C04A 4DBLC 1FMJA 2ZRHA 4Q4JB 5KSOA 4D0GA 1E98A 2J7PA 4JL8A 3U3RA 2YOGA 1NBMD 1ZRHA 2Q21A 1IONA 2FSHA 2ZRLA 4FMBB 1YVDA 2GCNA 1E4VA 5DHFA 2WWYA 3CUEF 1LV7A 5JFGA 1A5TA 3QXJA 2CNWD 5BXQC 4M4SA 2CE2X 3AF0A 2PL3A 1P3JA 1ZM4A 2R44A 4I1OA 4YONB 1U9IC 4NTZA 1JJVA 1N6PA 2ZRGA 1YR7A 2RGNC 1DAIA 2RKOA 2A5YB 3OAAD 1KSFX 1RKBA 2KB0A 1NLZA 3L0IB 4CYMA 5FPKA 4YMUA 2N1BA 1X3SA 3LXXA 1OPXA 2FX3A 4GPTA 3E5HA 1GIAA 4DUGA 5EJEA 2ZSBA 3BIFA 3Q9LA 2ANCA 1N6RA 2GKSA 1JAHA 3KJEA 2G83A 4HB0A 4MRSA 3X2SA 1ZP6A 4Z8XA 3SHFA 4D6PA 2BBSA 4O3MA 2O8BA 2JA1A 3PUXA 5FTNA 1J90A 4URVR 3L8YA 2KI5A 5EXTA 1MO4A 2CHQA 3MRSA 5D3QA 5LPNA 2WAXA 2R6DA 2PH1A 4TYPA 3BJIC 4PC6A 2C77A 1UDXA 2JLYA 1KY2A 1TUIA 2FFHA 3SYLA 2XXAA 2NGRA 2X19A 4Q7MB 4OQXA 1ZC3A 4P4SB 1YZLA 4TMTA 3ZGXA 5K8LA 3TVDA 3LBHA 4F92B 1NSTA 5CJPA 5FUYA 1UFQA 2GILA 3UG6A 2O8BB 5F2EA 3PEYA 2C78A 2HJGA 3O8RA 4WIAA 221PA 1FMLA 1KGDA 2BEJA 2C9CA 3WHLA 2ZU6A 3CRW1 1OXUA 3UXMA 3WYFA 3QF7A 4BASA 1ANKA 1IN6A 4G1UC 3BORA 1E2EA 4TTPA 3FHOA 2FU5C 4PO9A 2GXUA 4IOKA 2ZTSA 3QJYA 4PC2A 4LUCA 2CHGA 1XDBA 3OHMA 3Q7QA 2JAQA 1COWD 2CL0X 1GVNB 4F4CA 2P3SA 5UKDA 4R7ZA 3QEJA 2VF7A 1NVXQ 1WA5A 1L7VC 1SHZA 3A36A 3GFTA 5FOXA 1CJTC 3VR5A 3KKPA 5FOSA 2ATVA 2REBA 3PUYA 2D3WA 2AHOA 1M8PA 3GJ5A 3AUYA 1BH2A 3EAQA 1NVUQ 1E2DA 1NMYA 4C0QC 1LS1A 3L2OB 1ONBA 4GBMA 4LJ6A 4KVGA 1DAEA 1ODFA 1ZD8A 5EE5B 1E0JA 4J0QA 3RSLA 1E1RD 1G16A 4X8OA 4DLVA 3AGQA 1DO0A 2PCJA 1KO7A 1R0YA 4KBGA 4G5GA 1T3HA 2MSCB 1XJQA 2YWFA 3ASYA 2A9KA 3THOA 3X1XA 2FEOA 3K1JA 3TW8B 1ZINA 2GJ8A 4M2LA 3PG5A 3QKSB 2ORVA 1OT3A 3K9HA 2V3CC 4Q03A 4CZ2A 1S1CA 1XMIA 4QOSA 4PSVA 4ABYA 1V43A 4B73A 3EPJA 1Z47A 3SFZA 3TW4A 2ZS9A 1RIFA 1L4YA 4TLCA 1VTKA 5JWRA 1G9XA 3Q8XB 4A0RA 1FW6A 1F2TA 2K5UA 1ZCBA 3IHLA 1MO6A 3B85A 3ECCA 3NVAA 1HQCA 3RYTC 1Z2AA 4RD6A 1E2GA 2ANBA 2QP4A 1OB5A 5CITA 4Q9KA 1VHTA 4JMPA 3THYA 1AZTA 2J0VA 4TMZA 4OBEA 3EA5A 4W9MC 5AUPB 2FV8A 1DVRA 5DLQC 2ZI9A 1G19A 2YHSA 4JL5A 3ZJYA 2WWXA 3VX3A 5EZ5A 2ORWA 4OI2A 1F2TB 1E4YA 2CXXA 4V03A 5G3ZA 1PJRA 4OI1A 2WV9A 3MFYA 4LGMA 3CX7A 2QM7A 4QJ4A 4TLEA 4RFSA 4IDQA 5FTMA 1P2SA 4JKYA 5GADl 1SZPA 3THYB 2ZJAA 3RVBA 1NIPA 4DEYA 5TY0A 1KNQA 2XSZA 2WICA 3S1AB 4OL0A 4C0SA 1HA3A 2N46A 4GSYA 1W4RA 4UKDA 3BH7A 5J4YA 4DRZA 3D8BA 3ZZTA 4ACBA 1F2UB 1W49A 1YZTA 1DG3A 3KFVA 3WYGA 2W6JA 4M1YA 4PQYA 3T1TA 3PJRA 4MKFA 4A2WA 4RFSB 1G3IA 1UEJA 4WW0A 4G5RA 1II0A 2WIBA 3D3QA 4OJQA 4UNNA 1XPRA 3DZ8A 3IEUA 2BMFA 4QHTA 4L8GA 3HDTA 1OFTA 4OYHA 2AKYA 4CVNA 4I1SA 2PX0A 2GVZC 2VLIA 2R9VA 1YJ5A 2YOFA 5FOTA 2B7CA 2RGEA 3IBYA 4PPQA 3NIBA 1DTSA 3MMPA 3OEEA 2ZJZA 2IS4A 3N2IA 2IBMA 2BMJA 5HCIA 2ODNA 1GAJA 2XITA 3W3AA 4HYYA 4OJKA 4XD7A 5KDLA 4C0JA 1B23P 2VP2A 5KNBA 4I1VA 3ETLA 3L0SA 1JJ7A 1T8TA 4PHHA 3HU3A 4LYAA 3R8CA 4URYR 3RRYA 1NVVQ 1R2QA 2ZJ8A 3AVPA 4QGAA 3QG1A 3AVWA 1ZBDA 4ZV4A 1XU4A 2VSFA 2W0MA 3QVUA 4JLAA 4KHZA 4TT3D 4A6XA 2PT5A 3BFKA 1P73A 4V0OA 4DXAA 1HEIA 2BCJQ 2FF7A 4JLDA 2GXAA 3U5ZB 4HEJA 3CR8A 3OFND 2NZJA 1E2MA 4CRWB 2OCAA 1G7CA 4GMXA 5J4HA 521PA 3SOPA 4PZYA 2H16A 1YR6A 1UJ2A 5L3VA 3EPKA 1X8LA 3A1WA 4HB3A 5C1BA 1X8KA 3BK7A 3V4RA 2IS1A 1KDPA 4O25A 1QDEA 1FQJA 3LX8A 1J8MF 4QG7A 2CL7X 2O5VA 3LVQE 3OF5A 5J5CA 4Q47A 3KXIA 1GRNA 3AVTA 4M1KA 4UNSA 4HI0E 1ZD9A 2ZYUX 3FB4A 4WZAE 1ZUHA 3DDCA 3W5JA 3QIAA 5JHHB 4V0ME 2ZUDA 3TUIC 1PLKA 3PUZA 1S3GA 2DBYA 2WWIA 5DN6D 5AWFC 4AYWA 2V6IA 3I3SR 3F8TA 4CGZA 5L8VA 2J7KA 4M21A 3N70A 1JR3A 4QBFA 1WBDA 3MWLA 2F1IA 1UBEA 1G8PA 3AVXA 4PR0A 2PZGA 1PLLA 2V55B 4NYIQ 1WDTA 2YWHA 2IS2A 1Z0JA 4F7WA 4A0FA 3TIFA 1J7KA 2AL7A 3RWMB 2R6GA 1YHNA 3GCGA 4FI3C 4A6PA 2ERYA 5JSZB 2YC2C 3AKEA 1HH4A 2WJVA 2EFCB 3SQXA 1RW4A 2YYZA 5JI2E 1OYWA 1AIPA 1E9EA 1EX6A 3LBIA 3LW7A 4RVCA 2RGXA 4NDZA 1UBGA 3DOFA 4ZDKA 2QNRA 4NE2A 2HCJB 3U3MA 1SXJD 4LPKA 1JB1A 3AM1A 2QG6A 1ZUNB 4FMDB 3PITA 2VP0A 1N2CE 3IIJA 5TDHA 5JMTA 5KUTA 5E4FA 1T91A 4C2TA 1JEDA 1XFAA 5HTKA 4ZI2A 1KDRA 3VU9A 3KKMA 4EPRA 4D80A 3DZDA 4DIDA 3AB3A 1GL9B 2NIPA 2FPKA 4TSFD 3DKVA 1O3YA 2QGZA 3FKSD 4JT2A 3LW8A 4DB4A 1VMAA 3NEYA 4DB2A 1TEXA 2A5DA 2Q9BA 3I5YA 3TJZA 4V02A 1KAGA 4TTQA 2DR3A 3NG1A 3FOZA 2QMEA 2B21A 1UKEA 5B58C 2W6ID 2QAJA 3GJ7A 4B74A 5KDOA 5JEEA 4P31A 3K8YA 1CBUA 1CR0A 1DAHA 5CM8B 4TYQA 2MMGA 2IHYA 5CDFE 2BM1A 1EX7A 5FOUA 2WMOB 3KL4A 2KSQA 2ZS8A 4NCKA 2A5JA 3WYAA 4XJXA 4BRWA 5DI9A 1MO3A 3BB4A 4WVFA 2GZDA 5FI0B 1CKEA 4URXR 2ZJBA 1T5LA 2XEXA 4RSGA 2ZQ5A 3LLMA 1IJEA 2F1HA 3R7WA 1RRFA 2IUUA 2WKQA 4BEJA 2ZI3A 4LWZA 4XVQA 3O8BA 2PEYA 2VSXA 2KWIA 4I4LA 4TYYA 5TV2A 1H65A 1JXOA 3CNOA 1U9IA 3CR7A 1GKYA 2QPAA 4AYXA 1UM8A 2P5SA 5H8WA 3R9XA 5SZKB 1J8YF 1GKIA 3UMSA 1MOZA 4LHYA 3T34A 2RGNA 2EW1A 4FIDA 1Z83A 2QBYB 4M1WA 1OIXA 3L82B 3R7WB 5FBWB 1U94A 2ZYTX 4B2PA 4KCGA 1XJCA 3B1ZA 4MYUA 2ECKA 2FWRA 1KI6A 4A36A 3DM9B 2Z5FA 4B33A 2DHRA 2XTMA 2VP5A 4GRAA 2HXSA 2CMKA 2ZI4A 2ZRNA 3VR3A 3GFPA 4PTLA 5GJVC 2IYXA 3NHBA 1YZNA 4JLVA 4BZXA 4FMCF 1HT2E 2W83A 4TZ0A 3KQLA 4QBHA 1HYQA 3BERA 3PV0A 4TWZA 4YMSA 4OHVA 2A30A 1W2HA 4AKGA 3NDPA 4HZIA 4M0LA 1ZD1A 1KI3A 2F55A 2QEQA 3AP3A 4RD2A 4LYHA 1KMHA 3EW9A 1H8EA 2HF8A 2ZETA 4DLXA 4DSOA 4DCTA 3EC1A 1TTTA 3AVVA 1JQJC 2OBLA 4Q5IA 2W2TA 5AJXA 4KI0A 2XOKD 4D4LA 2I1QA 4TYNA 4ZI3A 1K6MA 1NKTA 3P4XA 5DYGA 1US8A 2ZR0A 2VHTA 3B9QA 4X8LA 1JALA 1E9CA 1I4DD 2WJGA 4JS0A 3WMEA 4YXWD 4CT4B 4A0GA 5SZJA 1Z6GA 1KMHB 4IDOA 4LI0A 3CW2A 4NYJQ 4TL7A 3NTUA 1K8RA 1D9XA 3F3YA 4Q18A 3FWYA 2VPPA 1N6LA 2D06A 1D5CA 1XEFA 3KQKA 2E9SA 1UKYA 2PLFA 2ZRJA 3LO5A 3QKUA 2CCKA 4YDSA 4TLBA 2OESA 4OQFA 1XD2A 3U44A 4TMXA 4DT1A 4FWTA 2O52A 4M9XA 4TLDA 4OKSA 3ZDQA 5AUNB 3EPLA 3NBYC 3FGNA 2ODEA 4RKFA 3TR5A 1XPUA 1KSHA 2QP9X 2JLVA 4UNRA 4I81A 1S8FA 3QQ5A 3NBXX 4HDQB 3FMIA 4XSGA 3SYNA 2H5EA 3HYTA 2A3RA 4W5JA 1U81A 1XMVA 1HE8B 2HLDA 3VR1A 3ZZUA 1TQ2A 1S9HA 1FZQA 4EFNA 4TL9A 1XD2B 3U44B 1XCGB 3TUJC 4LYFA 4LBWA 1ZCAA 1F3OA 1OXXK 3NH6A 4DT1B 4AG5A 4LHWA 5CYPA 2ZSEA 1NMZA 1KDTA 1YE8A 2GXQA 4G5OA 2NMVA 1Z28A 1FOEB 2V7QA 1W0JD 4IOLA 3GJ0A 2BMDA 1E2FA 4NYMQ 2HYIC 3UKDA 3W34A 4XWKA 2QMHA 1ZM3A 2P67A 1XXHE 2FNAA 5E95A 1XEXA 2IXGA 5EE9A 2H17A 1FPMA 3RSOA 5K8UA 1OH8A 2WJHA 2OBNA 1KY3A 1DAFA 2KBFA 3RS3A 3H2YA 2WKRA 2ZSFA 1E1QD 2O8DB 5B2ZA 3TLXA 3SEAA 1G8FA 3GP8A 1AJEA 4OI0A 2F3RA 5BN3A 2X77A 5LB2A 2EFGA 4DJTA 4MDEA 4JZKA 1K5DA 4RFVA 2FA9A 2Z6VA 2ZE8A 3FMFA 4ASUA 2CBZA 5GVRA 2VP6A 1XEXB 3SHWA 3M4YA 2ZI5A 2CK3A 2NO1A 3CX6A 2JEOA 4CIDA 2IL1A 2IS6A 2QY9A 5EZ6B 4US2R 3H0KA 3TUZC 3CWZA 4DEXA 3BBPA 3HJNA 2R2AA 3HU2A 5DIFA 4A92A 4BFTA 1Z08A 2L0XA 4PHGA 4LOAA 1CRQA 4Q66C 1OH7A 4PHFA 4B43A 3LFUA 3EZ7A 1NY6A 1XTQA 1OV4A 2CCGA 2QU8A 1S9DA 3WMFA 1NBME 2C03A 3R8FA 1KI7A 3EIHA 4H9GA 4B75A 4WOPA 2ZITA 4KFSA 3O8DA 3MGCA 5JHGB 1W4AA 4Q7KA 1G1MA 2DWQA 3AF2A 3HR8A 3R9IA 4EPYA 4EQ6A 821PA 2YWEA 3KJIA 2LKDA 1VG9B 5J47A 2RGAA 3TSWA 2XNSA 5FR1A 2QTVB 3GLGE 3T1QA 4YC7A 3SBEA 4QJ3A 3VNVA 2BKEA 3RS2A 5G3YA 2YV5A 4OHYA 2I1VB 1Z6XA 4MRVA 4LJ5A 4CT5A 2RH5A 1IY2A 1E2NA 1OJLA 3P27A 4QFMA 4PO1A 1NJFA 2F1JA 2JGNA 2SHKA 2ATXA 3GJXC 1RRPA 5CB6A 2WTUA 1ZU5A 1XF9A 5M04A 4JSYA 2P6NA 1DE0A 4NKRA 1LW7A 1A2BA 2WPDD 4DDWA 2JLZA 2AD5A 4H1VA 1R5OA 3KB2A 5FTLA 4A9AA 3AEZA 1KO8A 4IKEA 1W5TA 1TMKA 1T5IA 1WB9A 1FP7A 4NCNA 2O0KA 2J0UB 1B0UA 4G0NA 4GP7A 1NVWQ 2MSDB 4MYCA 5J4VA 1YZKA 2PLRA 1Q1BA 4TMVA 2AWOA 3IPYA 2ZE6A 3UATA 3TK1A 5DISB 4IFBA 1KK3A 3AF3A 5GJCA 2HYDA 4R98A 2J59A 3KJHA 1OHHA 4MRRA 2JDID 3BFVA 5LB4A 1CJMA 1XWIA 4LJ9A 5CJ2A 2G77B 4HDOB 2XTNA 2VF8A 3HU1A 1OH6A 3KXLA 1E79D 2R6AA 1TF5A 2WWFA 3MD0A 3QPUA 4D4MA 1ETUA 3K0FB 4D82A 1E6CA 1OB2A 4B3FX 3CF2A 1FFHA 4DUGD 3GMTA 2CE7A 3LY5A 4OK6A 1XZPA 1GL6A 1OF1A 3ZIAA 2PMKA 1GNQA 4DCUA 1NF3A 5KU1A 2A7QA 1IXRC 1XRJA 4C7OB 1PUIA 1T8UA 2IYRA 1AS2A 5AJZA 1KIMA 2C5LA 4QC2A 3EWAA 5EE1A 3B13B 4TQ9A 4P4SA 2BM0A 2ZS7A 2NO9A 5IT5A 2FEMA 1EGAA 1XTIA 1UEIA 2VSOA 3AVOA 3QY0A 4L4UA 4QJ5A 3JVVA 1CULC 3PQCA 2J0QA 1ESMA 2D62A 2QRNA 1OH5A 2EFEB 4YMTA 2Z0MA 4KU4A 4XTCS 3E1SA 2F9MA 5G41A 1UAAA 3U2QA 1TAGA 2CLCX 5JI3E 2PX3A 4Q4AB 5FFMA 2Q6TA 3M0EA 2WSSA 4Y0AA 1E3MA 3CF6R 1XTRA 3A1VA 5BN4A 4F4JA 5F9FA 5FBQB 1G8YA 2CLSA 1A1VA 1J70A 3UANA 1IJFA 4G01B 1OKKA 4JBXA 3PEVA 4YDHB 4C4PA 3QSYA 2NQ2C 3B8HA 4HB2A 4C2UA 4II7A 1CJVC 2GEDA 1KK0A 2UZ3A 3CZPA 1KSJA 3N5CA 5AJVB 2BEKA 2P5TB 3NC0C 1G41A 2IYSA 5BN5A 5HPYB 2OCPA 1VCIA 5B57C 1EFTA 3T1VA 3B6EA 3VHLB 2GAAA 5KTYA 2RCNA 4PPFA 3ICQB 1JQLB 3GJ8A 3TQFA 3RC3A 2BOVA 3DOEA 4NHOA 3RDPA 4M1TA 3TMKA 4M53A 2GZAA 2GVDC 3EASA 4TN1A 3UMFA 1R0WA 1TF7A 2JLXA 2O0HA 2VYFA 4DCSA 2IYQA 2QQ0A 2ZEJA 1CR4A 3Q5DA 5JCZA 2GCOA 2PJZA 2JJ8A 3QG5A 1AN0A 3SI7A 1UPTA 3B1VA 2ZE5A 4Q9LA 1E32A 2OEPA 3LH5A 2ZRFA 1ZNWA 1ELOA 4PAOA 2JJ2A 5KO2A 3U7GA 1E2PA 2GHIA 3K9NA 3M6AA 4HLCA 3QKSA 1RYHA 3X1WA 4BWYA 5AR1A 1KO5A 1HTWA 5EUMA 5BQ5A 2GEUA 1U98A 1TQ6A 4IDHA 1R4AA 3K9LA 4ITRC 4MYTA 3G0HA 1TADA 2GCOB 4V0KA 2YWGA 4MGKR 5JRZA 1JECA 2P0EA 3GJ4A 5C18A 1DADA 2Q9AA 3CM0A 2O0JA 3SJBA 5J4LA 1XZQA 1Z6TA 4JVMA 1CIPA 1CJUC 4BZQA 2VA8A 3AV0B 1GRQA 1P4SA 2G88A 3TQCA 4KFRA 1WQ1R 5BW8A 5DHAA 2ZJOA 1XMSA 1N6IA 3NBFA 2GEVA 2BV3A 3FFAA 4AYTA 3A58B 3RAPR 3TAUA 3BH6A 421PA 3U61B 3BB3A 4AKHA 2GBLA 1ZW6A 4PHTA 3BXZA 4WXRA 5EXXA 3U6BA 5DO9A 3I92A 1P72A 3CRQA 3VHXA 1G7TA 4HAUA 2OAP1 3EPHA 3KUCA 2GDJA 1XB2A 1GDDA 1CTQA 4Q4LA 4NU0A 1VG0B 5L3QA 2WJIA 3QXHA 4TQAA 3DVLA 2WZQA 3S1AA 4OQLA 2PJRA 5B30A 1GNPA 2TMKA 4IDNA 4JBWA 4N3NA 2WWGA 1AA9A 5JS8A 1OIVA 3PVSA 1F2UA 2XSZD 2VL7A
chains in the Genus database with same CATH superfamily
2K2QB 2H5IA 1DC4A 4QQRA 5JZ9A 3PKJA 1Y5RA 2C5HA 1AKQA 2H00A 5BSHA 2G72A 1LY1A 2FSVC 4FD2A 1R16A 6GPBA 1XMOB 1XCOA 2Q9CA 5L3QB 2H1CA 2X2PA 4CG0A 5TLSA 2XBUA 4RVHA 2HJRA 4DR6B 4F6RB 4NABA 5A1JA 5K0NA 2XBLA 3VXKA 5ALSA 3P9XA 3NHAA 3U3XA 1T2VA 1Z4NA 1NNUA 1RBMA 1UZLA 2ODTX 2P78A 3ZBUA 4DOMA 5IFKA 1G42A 1W25A 1A9ZA 3R5XA 2ODWA 3TW6A 3AEYA 3EVNA 1MG5A 3ASVA 2DTXA 1G3MA 3C3EA 1N5DA 1ZN2A 3BE4A 3UOGA 1KZGB 1X42A 2FKNA 4M7PA 1YO6A 3AR9A 1A4XA 1MJGM 1F4LA 1S4QA 3SSMA 1MLDA 3E1GA 4Q3AA 5D1HA 3BHMA 3IVRA 3VKUA 3E5MA 1QSGA 3KQMA 1K3UB 4DLUA 1EUYA 4UTRA 3PEFA 3T5DA 1JA0A 1E6MA 4B3HA 1QHHA 3U4MA 3E9EA 2R6JA 1WD5A 2EX0A 5IU6A 5FBLB 1U0JA 3I2JA 3LDFA 4XD7D 1DOAA 1YVEI 1WXDA 1U28C 3W3AD 4BX0A 4ERXA 5F3RA 4DW8A 3NXKA 5EZSA 2FQXA 4IIHA 3ISVA 1O03A 4TWJA 1U0EA 3DPIA 4XLZA 2NPFA 3ROGA 4BFYA 1N3IA 3OFVA 4EF4A 3B78A 3PA6A 2O8NA 3FM9A 4EG4A 3OCZA 3QXXA 4X62B 1YL5A 2X40A 1SHJA 4F2PA 1U3DA 3VOSA 3UCFA 3FNHA 4EB6B 1B00A 3CHYA 1PHRA 5JBQA 5EXSA 4X7RA 1QF7A 1QHHB 1KVUA 1NF8A 1TYZA 1E1KA 2RI6A 4ZT3A 2C5EA 4F8YA 4C3ZA 4B3GA 4J3JA 2J3KA 5E9JA 4LJAA 5CU7A 5A3JA 1PJ2A 2CNLA 2ZTVA 2O19A 1WUIS 1YB6A 1NW6A 3GVCA 3IPXA 1V3VA 3ZE8A 1IK6A 5HOQA 5LUAA 1SZJG 4B4KA 1H2FA 3RUHA 2DX7A 3RFTA 3D1LA 4GNRA 1NN5A 4F6LA 3KTAB 3DEFA 2JJ1A 3ZQ4A 3LOPA 3A4MA 3D6TB 1M73E 4B48A 4M1SA 4WJZA 3VA7A 3JQFA 4DN6A 4KQ2A 4E33A 4Y2XA 2ZRAA 2JHPA 1KL7A 2ZROA 4TQGA 1FIUA 2QVYX 1SXJE 2WNSA 4CR7A 5HG0A 3OOSA 3I32A 3DQPA 3M83A 4R1TA 1S89A 2HCBA 2HQ1A 4YUZA 5L4NA 1BQ4A 2AK3A 2GT1A 3B12A 2XE4A 4FOLA 3IT0A 5F4BA 1FMFA 3I9JA 5BP7A 1WTCA 3WK5A 3ZBPA 1YQQA 2FW9A 4GQAA 3VH1A 4CU2A 4LVOA 4KVFA 2PSEA 4DSUA 2FUG1 3CRRA 3HKBA 4KXMA 2CVHA 5CB8A 3Q7IA 4ZZ0A 5AHRA 3NALA 1JLLA 2ZB2A 4KNWA 4Y6PA 4RMIA 4C03A 3NATA 2IOYA 4BNUA 3EFEA 1Y7LA 3GRUA 3BB1A 2XMCA 3GP5A 3K9FC 4WGFA 3Q7PA 4LX0A 4L4RA 2ZYVX 4OHFA 3UV6A 2AR7A 4N3CA 4RM2A 4F7DA 1KRXA 2Q4OA 2BUBA 4J29A 3G0OA 1XBTA 3DBLB 5LBIA 1XJ0A 1LRLA 4MEBA 1AS0A 2AF3C 1NAIA 5FV7A 2PT7A 4FQ5A 3EIEA 4DABA 3RTCA 2WYIA 4KSYA 4E2FA 2AUTA 4YCMA 2QD4A 1JLLB 4V2UA 1J4AA 1T9ZA 1EUCA 1S2DA 3ND9A 1DIGA 3GCZA 4KV7A 3NORA 3HS3A 3OQVA 2PGIA 2C95A 2XVAA 4P3PA 4YWHA 3LDAA 4TRNA 2YJTD 3P4UA 1Q6ZA 4O2RA 2VHQA 3S8MA 3GFFA 4DRXA 4JB3A 1GOTA 5JJLA 1QF9A 3IMFA 3LWNA 4U6NA 1PV4A 2YN4A 4PFJA 3S2SA 3AFGA 5H59A 1Q7EA 3GEIA 1Z34A 2IPLA 2NT3A 3O47A 1HRDA 1Y98A 1XZBA 1M67A 3OH8A 4O4JA 4V0NA 3SHOA 5CDYA 2G9ZA 1ZVKA 3JVUA 2DT5A 1KMCA 3CJRA 2REOA 3QLTA 1EUCB 4JLBA 4MW6A 4MWTA 1PG5A 1FFDA 2N9UA 2OOKA 1RS0A 4UVGA 2H1HA 2IQ5A 3K96A 1J8FA 5A7GA 5KX5A 3L8GA 3L04A 4XRRA 5KYXA 4MIEA 4DRXB 5FH9A 1XVTA 2EKPA 3L7LA 4K87A 3NASA 3DF9A 5DYNA 1QP4A 2JAHA 1ZA2A 4BEWA 5AVVA 5CCBA 3DV0B 2AR0A 2QL9A 1F7UA 3F6CA 2XMRA 1KMIY 4BNYA 1ZGCA 2IEYA 2F1RA 1R0CA 4O4JB 1V8ZA 4F93B 3C14C 3Q6IA 3QYFA 2VOEA 4KR0A 4KB5A 5D7BA 1LDBA 2EZTA 1LDGA 5IZCA 1D09A 3PXUA 3THSA 3TL2A 1N2ZA 3AP1A 2JH8A 3BRWA 1H1LA 3CX3A 4OUKX 5IBPA 4B34A 5KX5B 5KYXB 3J7AC 3RYHB 1W4BA 4DJEC 2QTHA 3KYJB 2AD1A 2QN6A 3K9WA 1KQPA 3PUHA 5TPZD 2YZGA 2VTBA 4NZOA 2FPSA 1KVRA 3TRKA 4R2JA 1FUUA 3L77A 4BQNA 3F2IA 2FFAA 1GJRA 5DULA 2R6CA 3CH5A 4RPKA 3TBKA 3DDUA 1ZGBA 1YJBA 2Y8EA 4UNPA 5J9FA 1GXSA 3G7SA 2DE0X 2ZSHA 3PYMA 4LCEA 4F8EA 3GLHA 1MU0A 3GOHA 4TSFA 2P9QA 4GI5A 3IIMA 1N9ZA 5BNFA 2GBLC 3V8MA 3VR4A 4QLBA 1H1LB 2XUDA 4B7AA 4UTPA 3CO5A 1XTSA 1LRKA 1KGSA 3EXFB 4UVHA 1V3QE 5IT9A 3BDVA 2NSLA 4Z0HO 1M2JA 1YMUA 3HDQA 3WGHA 2WIFA 1A8UA 1H2YA 5KVAA 3JWEA 4LOJA 1K75A 1RWWA 4XCVA 2VTBB 1P2VA 3BIXA 2P4SA 2PXCA 4BBJA 5HUQA 3ZXUB 5DYTA 4P3KA 1JG2A 1GXSB 1Y8RA 3EMBA 1L2TA 1ML4A 3GLHB 2E6KA 1K7SN 2OM2A 2A0WA 3G6WA 3EX7C 1ZL2A 3IVMA 3DOOA 1N5LA 1FMTA 3CPJB 3QLJA 1WMSA 4IMIB 2X3YA 4MYSA 4XIYA 3CLVA 3M3HA 4IDDA 1O94C 1EE1A 3D6UA 3FJOA 4NNOA 4KPFC 4DGSA 4DMFA 2JI6A 1HLDA 2R97A 4FWIB 4MV0A 2I9KA 1ZHHA 1VLHA 2TS1A 1II9A 1NVFA 1NUAA 5JZVA 1W0KA 2QORA 4BO0A 2VXCA 5DGIA 2QQEA 2D1TA 3AF4A 1ZBQA 5BUZA 4P5EA 1UADA 1M66A 2ACKA 4BB0A 2R0QC 3Q1LA 4UHDA 1G63A 1IBRA 3RT9A 1H8ED 2VYVD 1H42A 1ZYUA 4MLDA 1CJKC 3Q98A 1SKAA 2V45A 3KAKA 3AG5A 4JJ4A 1Z6AA 3L4SO 4K6OA 1G4UR 1N2CA 3QWBA 4ZVLA 4HX2A 4ZVOA 3TNJA 2RH4A 4D2IA 3RBVA 3G8AA 3FLEA 3F4BA 3IUEA 3COVA 1T9HA 5HKOA 4DPMA 2BJVA 2O7VA 2GD1O 3ZKWA 1R6AA 2QN3A 5CPFA 3VPFA 4KREA 3MTIA 4FILA 4QUBA 4DCNA 4RQTA 3AEKB 5LLTA 4NE9A 4PXAA 4J0GA 5C31A 4CM4B 2ZBRA 5M5BA 4JV5B 1GNLA 2Y1WA 2ZYAA 1OWOA 3CJQA 5KYUA 2FVXA 4IJWA 5KPJA 3LZ6A 2ZIAA 3NT5A 2YC4C 2B7BA 4RH0A 2L2QA 4XDZA 2YJ5A 3H8SA 1JEQA 3EEBA 4FYIA 4ZAGA 5FYQA 3ZKWB 3EODA 4N49A 5TX7A 1XQXA 4X0EA 4DR5B 5DB4A 1Q5PA 4IVPA 3THXA 3CWQA 2E87A 1XZMA 3VFDA 3C8DA 3VNBA 3DVAA 2A94A 5F35A 5BMVA 1DTWA 3P19A 4Y2GA 5C52B 1LB1B 1Z2EA 3K71B 3CIOA 1KOJA 4HFMA 1ZDMA 3MAJA 4YV2A 2F1OA 1U8YA 3DAGA 2P69A 3DMNA 4TS9A 5A5GA 2O23A 4GVXA 1M0WA 4IDGA 2XOKA 4BX3A 5ICEA 3IPLA 3PSHA 3RUIA 3HPQA 3L4BA 1U4OA 2QM8A 4MIOA 3EBOA 4DIUA 2XRYA 1TJ5A 4D9MA 5JANA 3HA2A 3AFOA 3UWDA 1YOVA 3THXB 1L5ZA 4JLPA 2VG8A 4N3BA 4EFKA 3CGGA 3KLPX 4PYIA 5JZOA 4O2AA 2PA3A 5AVWA 3AXSA 3NM4A 1PJAA 3LPAA 2RHDA 3I6BA 4CLXA 4EJFA 3D54D 3RYCA 1XCBA 2X0IA 3KQNA 3IIKA 3AHHA 1QONA 1CVIA 5DBHX 2SKCA 2OO5A 4R1OA 3ZYCA 2X9LA 5TB5A 4F21A 3EDRA 4GRDA 3CLSC 2PQ0A 3G5UA 3JVEA 4DSNA 5E8RA 3C1UA 1CQXA 1YOVB 2D8MA 2WA1A 1L8XA 1OY1A 5DOZA 2Q1WA 1EK0A 1RYMA 4QJBA 4BNLA 4O2AB 2ZIZA 4QDZA 3SQDA 2NZVG 1T4BA 1UC5B 2GZMA 3HEAA 1ZOSA 3I12A 3PICA 1B6RA 4O33A 4DS3A 2GFQA 3K4PA 3BZUA 4JEIA 4X9XA 3SDZA 4GLBA 4E6PA 1OOEA 3PXAA 4KJZA 3SJCA 4NCIA 4X7BA 4AI6A 1ITZA 3RS0A 5ICFA 4YCLA 1VXOA 3TX6A 2ZWMA 3BSYA 2WNHA 4HAYA 4ARUA 3FDFA 1V16A 2Z6QA 1OSNA 5KYNA 1DQNA 4TKVA 4MDFA 4TXHA 3C1TA 3JQ8A 2DCUA 3HCOA 4YRGA 2PMWB 3V4ZA 4J43A 2BHLA 3BE8A 3QK7A 4DQUA 1W0JA 3R0ZA 2CF5A 1J0DA 3PC6A 4PGHA 4UOQA 1IG3A 5IAAA 5DYIA 3LQ2A 5T57A 1J8DA 2Z30A 4JVOA 4L0DA 1RT9A 1K86A 2DQZA 2PVCA 4L75A 1NVVR 4JJ6A 1LW6E 3DFFA 1BE6A 1JIXA 2Z4RA 5LQUA 4ZVKA 2BN4A 2BI8A 3GD5A 3BAFA 1V16B 2QTLA 2Q27A 1UDRA 1KOFA 3JQ8B 2UDPA 2TYSB 2YYAA 1NUUA 3GNLA 4KVAA 5K3FA 4DIBA 2NPIA 5CBPA 2WHXA 1OPRA 3QGMA 5GP1A 1E1QA 3TIVA 4Z1OA 1QV6A 3ZHVA 3W1EA 5KWVA 2C2HA 1TNDA 3CLRD 3NBUA 3BWBA 2YRWA 2BFEA 4O0LA 4PR3A 3WNVA 4N03A 3T0IA 4DG9A 3RD5A 3JALA 2QVGA 1CEQA 2GN4A 4MQEB 2WIAA 3ADCA 3DOIA 1LWNA 2RSLA 1M34E 1ZXXA 4XWYA 1SC1A 1I2DA 1BSVA 1WE2A 4OY3A 3SQOA 4C7MA 5C3MA 4UVIA 2DCMA 2ZR9A 3KB8A 4A4DA 4V3CA 5K3FB 1ORVA 5CBPB 3QPWA 1A98A 4BDTA 3W90A 3WO0A 3I61A 1ZMXA 2V59A 1GLNA 1XA3A 4JUAA 4LHSA 4Q39A 3UXYA 3AL2A 4JT8A 5A5VA 2A9OA 2J0UA 2QZ4A 2AX4A 1QFMA 4J16C 4MULA 4RZHA 4Z9XA 1RKXA 2BFEB 3EQZA 1DWQA 2VUTA 4AY6A 4XVHA 4X63A 4BO2A 2XZTA 5TQVA 2I6XA 2B98A 3EZYA 4R84A 4PZLA 5TS3A 1L5SA 1SVMA 5DGHA 5HQ3A 4P86A 2CYCA 2G9NA 1EBBA 2E6UX 2TSYB 5KIAA 2Q4TA 2VQ6A 3HB0A 2PMDA 4G07A 1H0KA 2DLCX 1ZH0A 4YUYA 4ZC1A 3TIGA 2H65A 3EVFA 1VECA 2C4TA 5A9SB 3L7DA 4CKWA 3G0BA 3TKLA 3EZ6A 1MH1A 1XZGA 5L3SA 3A7DA 3UPTA 4RTRA 2PFKA 1XXHA 2YJNA 2E21A 3WKCA 5EIHA 5KKAA 1N6KA 3D4IA 3ONWA 5GMOA 3NHRA 2DVMA 2XDAA 3INGA 3FROA 4P82A 5KVCA 4H31A 3MHTA 2IGBA 3PEEA 2VHUA 3UBMA 4U4AA 3V9AA 3Q7TA 4W5NA 3ETGA 2CBGA 3ZDEA 4LY6A 2POQX 4D9KA 1Z0SA 5K01A 2B8NA 3MJRA 3NBZC 4FDUA 4K9NA 4XKJA 4DR1B 4DBLE 1DQSA 3AY6A 1K6XA 2E37A 4CKWB 1T5DX 1M5UA 3F9IA 1UMCA 5F3WB 1TJNA 1U1IA 3HCDA 4WKNA 5MGNA 2WG2A 2HK8A 4IYJA 3AIMA 2WPDA 5HUHA 1XXHB 5L3SB 4MS3A 3D2AA 3MA0A 1YTLA 4BPBA 5L9AA 3LK6A 1GPLA 2QMQA 1P9WA 5EMNA 5E1MA 2WHPA 1Y6GA 1N0IA 2ILTA 2C4UA 2J31A 3DUFA 4LBYA 3VNAA 3VPSA 1Q3TA 3WYNA 4BVJA 3L7JA 1QHFA 2DFDA 3UJPA 4OYYA 3SN6A 1UQUA 4RY2A 3C5HA 4XR4A 3UEOA 3PXCX 4M46A 5JLAA 3GNTA 2Q45A 3UAYA 4RADA 1W34A 4GGPA 2WSSD 3T6KA 2JDIA 5ALGA 4LDJA 4MS3B 1OI2A 1O6GA 3F6PA 3BSWA 3IXQA 1H05A 1X94A 3X0DA 3A1DA 3KWJA 1DO2A 3PI6A 3D6NB 4H1UA 2VSYA 2WHPB 1BVYF 3HCBA 4US2R 2GTIA 2WILA 2YXPX 3L0ZA 1TK2A 4IQFA 5AKYA 4LC0A 4MVJP 3K2IA 2FPMA 4ZJUA 1GQRA 1B0PA 1JUDA 2JFBA 3QOFA 2BE9A 3VDXA 5E9QA 2JAXA 5K3SA 4ZWNA 3ERCA 1Q74A 5GAJA 1KPGA 1NMXA 4J75A 4NG4A 3GLGA 1CRZA 1V7CA 2HV8A 4N5NA 4YEDA 5LZ7A 2UYOA 3TQQA 1W76A 4UARA 5ALDA 4AJOA 1MAHA 4PS0A 4HUJA 2NP6A 4FXPA 1JX6A 1PV1A 2VIIA 4NBKA 1D2RA 1ZM7A 3GRFA 3ZWNA 3O9MA 5SYMA 4U9IS 1HRKA 1PFWA 4J2HA 2J4CA 3OI7A 1QFJA 4QNMA 4R69A 3O9VA 2OSBA 1CZUA 1O77A 1TT7A 1THZA 3COPA 4G26A 4HAWA 5LZ9A 4ZOQI 1MDFA 2CVFA 4YCSA 1DAMA 5K99A 3A4YA 1DSSG 4FYWA 2FZ5A 1S8OA 1PZGA 3KM0A 3GLGB 5H8WA 3TNFA 5ES3A 3TLEA 4IDFA 4KQKA 5KQPA 1M2KA 4ZI7A 2BC9A 4PG4A 4RDXA 2BGTA 2VQFB 1CUVA 4O29A 5B5SA 1DWUA 3NM5A 2F9FA 4Y6SA 4DQLA 1QV7A 1YS2X 1CVRA 1P8JA 4OJYA 5K0CA 4GOND 1Q84A 4F5ZA 2H2FA 5ESXA 4G0OA 2WLSA 4HPJB 1N2GA 2PSHA 1UFOA 3G2JA 3ZWWA 4EMBA 3O7WA 6LDHA 3I2YX 1XD9A 3IPAA 5EJGA 3UWMA 1J9GA 4HMOA 2WM9B 3AEXA 3MZ0A 4XVUA 3B6MA 1RHJA 3OZDA 3DP7A 3TXXA 1B76A 3ZXIA 2Z3ZA 3W5UA 1NP7A 2EP5A 4A6DA 3LUDA 1BDMA 4HEHA 2GVNA 2H1WA 3EGVA 2WUEA 4G09A 3QEKA 3VISA 3OQ1A 2HIGA 3RBAA 3QMWA 4LZWA 3LGSA 3KDSE 3WL6A 3UFXA 1SKYE 4KQ9A 2Y0CA 2JBAA 1KDYA 4NMHA 1HT3A 1I4EB 1ECFA 2ET6A 3OPYI 1LA2A 3O4GA 3R7FA 3GLTA 1HNNA 2XTJA 4YI5A 1L9KA 1T8WA 4FFBB 5EIAA 3BOSA 4BRSA 1IWOA 1Z8FA 1OBVA 2B5VA 4OQNA 3WY9A 4BGIA 2NACA 3G68A 1D2NA 4JT4A 4E08A 2BEUA 5JEDA 1ZAKA 2HC9A 2PR2A 3L8HA 4UM5A 3TQIA 4BQSA 2OL4A 2QMOA 4P4TA 4AS1A 1Z38A 2JBAB 2R65A 4A8TA 3IQIX 3OM0A 4G8CA 4KV9A 4MQ5A 4WJLA 3HJGA 4S05A 3CEMA 1ZKDA 1Y8ZA 3N74A 3HJRA 2VPXA 4GG1A 1K5HA 3WWOA 1CD5A 4NZPA 2C96A 4NYJR 1E1RA 1KNXA 1Q57A 1P0PA 1U7DA 4RMHA 1IC6A 5G40A 4DR2B 4A2PA 2ZSKA 1SRRA 1QMGA 2GLXA 1IQRA 2QLFA 1P4RA 2IPOA 1GG2A 2JLQA 3CIFA 3G8BA 4KEAA 4BQRA 4UXJA 5AK4A 4DA7A 3KXKA 4OMCA 4Z4HA 1KQOA 2BEUB 3E3MA 5J2TA 1J0AA 1R3DA 1K06A 5HFNA 3ETJA 4DCPA 3T5CA 2FSSA 1SHKA 3TRDA 4BEBA 4DF3A 4PU0A 4F4DA 5KYKA 1CZHA 2I4NA 4XCXA 2O8BB 4OK3A 2X2EA 4FX2A 2P9BA 4U7DA 5K0LA 1SHLA 2GKGA 2VHEA 5FA8A 1IBLB 1AQLA 5P21A 1H3EA 3GFOA 1ATIA 2FUNB 5FA6A 2X1VA 1GGVA 1U8AA 2ID9A 4IRXA 1W1IA 1AB5A 2E4UA 3GF4A 1PIWA 2QAGA 3N07A 4LZOA 4YJKA 3CRMA 2Z43A 3N1UA 3QEOA 1R8XA 5DHQA 2GAJA 4PG5A 3ZQJA 1TZ2A 4O5OA 1ZGZA 4G5SA 3H5WA 2OAGA 2PPVA 2QK4A 1ZWLA 2RGBA 3A4LA 2VK2A 4WN3A 4ZCLA 4W9NA 5H0IA 5GPBA 5B2FA 1D0IA 3PT9A 4XWGA 5A9TA 5GONF 3UAOA 5IDYA 5HJEA 4E7PA 3GT3A 3E48A 1MC5A 4L95C 1YQTA 4NYMR 3UIEA 2V0GA 1AHHA 4RLFA 4F45A 2I3ZA 4JD5A 3ZU3A 1YI1A 2FAXA 4PX3A 3VGPA 1M7BA 4FCCA 2AKAB 2FFQA 4KE9A 4MGEA 5C8VA 3ZVMA 3NRCA 2W6OA 1G64A 4BJ3A 3QOXA 4RABA 3VHRA 4R3UC 4E07A 4E30A 3K2EA 4HLUA 1DJOA 3LZDA 2CL6X 4AZTA 3T61A 3CNQS 1JH8A 4MUXA 5BV7A 5EE3A 4C5AA 3G8DA 3I01A 4MEAA 1SZDA 4QXOA 4ESEA 3W5DA 2WIJA 3NNSA 3QLEA 1ZNXA 4CQNA 1S6YA 4QDKA 1PVOA 1SWWA 4P0TA 3TVYA 5A4FS 1K0UA 3IEXA 3IH5A 2DM6A 1EEHA 1C7FA 3GA0A 4FNAA 5CEJA 2QUAA 1II8A 3IOEA 3EC2A 4GFDA 3DBHA 3QA9A 4GDFA 1W1WA 3IQHX 1Y3FE 2ECOA 3B1FA 3OTGA 4QU5A 5J63A 2QGNA 1GNRA 1T4MA 4MW4A 4DUPA 3BE6A 3K30A 1H8HA 1KS2A 3NAQA 2JJ1D 1E96A 2P6UA 4KH1A 3RYFB 1RLOA 3H11A 5AFSA 3PC4A 1VI2A 1G8JA 1DTEA 3P45A 2WJYA 2IX3A 4X7MA 3EHEA 2XA9A 4NG5A 1KAMA 1R27A 2XYVA 3PE6A 3TM4A 1Z6QA 1II8B 3DBHB 4GVPA 4BTLA 3HXLA 4IJKA 2GWHA 4JLJA 5J1TB 2QW8A 1NXWA 3IUPA 3ZXXA 3H86A 4GSLA 2Q2NA 4X6LA 4DIEA 4F91B 1YR9A 2IY8A 4BLRA 1TIPA 5IRCD 2I3DA 1N0VC 4JYCA 3R0XA 5KWJA 3SLRA 1XK6A 2RHBA 3NM6B 5JAHA 2I03A 2AFIE 3WYEA 3OO1A 3TXAA 3JAMA 1FJXA 1SXIA 2IJGX 4NLLA 5HMLA 3DPUA 2GJAA 3H11B 4C6TA 1ORDA 3BD8A 4FUQA 1O7JA 3A1CA 3U4QA 3JASA 3DAFA 3GZJA 2JFNA 1RFLA 3OUZA 2RHHA 3KVOA 4K88A 2X23A 4ZTUB 4CMCA 4ID3A 3T3GA 3VZRA 1CFJA 3A3OA 3RJMA 1R10A 3RREA 1NRJB 4GX2A 4YAWA 3CEPB 3I9FA 1J07A 2GAOA 1RLUA 1H85A 3HJBA 4CQLA 4GPBA 2WI8A 3N0VA 2AYYA 4IHKA 4TT3A 1GN9A 3ASZA 3GRCA 4DBZA 4MYHA 5TF4A 3L0PA 3CZMA 5CNJA 2LIPA 5CURA 4C6TB 4EUSA 1RXYA 3U4QB 2Q6OA 3JASB 3R23A 1T1EA 2IXBA 3W4JA 1Z6ZA 3HFJA 1CQJA 5AO9A 2NOAA 4DEVA 3K70B 1GG5A 3X1MA 1A88A 4RY8A 1YU6A 2C5GA 1OWMA 1FP4A 2KLHA 2OP0A 4O1MA 1L5RA 4E5UA 5B4UA 1HEUA 4JR0A 4JI1B 4CQLB 1NWHA 2PAFA 4YQFA 3OECA 2FW8A 4RCZA 2EFHB 4LZJA 3QMPA 3OIDA 2OHGA 1JXMA 4MVCA 2RGDA 4UCQA 2LR0A 3E3OA 3CLUD 4D4HA 2B4TO 3CVXA 3VYVA 4TZ6A 2AZDA 3H75A 2B1QA 1QQBA 1T8SA 1TJ4A 2ZRPA 1CQJB 3FKJA 1EFDN 1QZUA 5HYVA 3W9YA 3O91A 3MQ2A 2O06A 1VKOA 4LWQA 5C4MA 1RM0A 1GQOA 1OZGA 1FP4B 3DEKA 5JTTA 5AIBA 2ZIXA 2IKSA 3N05A 4J1QA 2JI9A 1ZGHA 2GRAA 3NXSA 2GPTA 3U31A 4QHYA 1UEXC 4CHTA 3QKWA 4Y2RA 3VPCA 3DA8A 1RVDA 2P9EA 3GVPA 3ZPXA 3RSFA 4PLTA 1B6TA 1DJMA 2IZOA 3MBOA 2F64A 2GNAA 2VHWA 3KK0A 3RO7A 3B7WA 1G7SA 5FL7A 4L8LA 5F64A 3SC3A 3V8VA 2C07A 1YFZA 4A10A 3W9BA 1UAYA 4IEEA 3TGLA 4WZBE 3HCCA 4MUAA 4A0HA 2H7VA 2V97A 4TYWA 2ZIXB 2GBCA 3BRWD 4M22A 4MW7A 1LNZA 2O4UX 1TZMA 4HVTA 2AMYA 4IILA 1XKQA 1GU7A 4HH4A 4Z9YA 2EKQA 5E7MA 1JW9B 4IIGA 4B7UA 4QM6A 3L92A 1VBKA 1LDNA 3ESRA 2VXOA 5AOAA 4TKMA 2AJBA 1CZNA 3HL0A 1SXJA 3PHCA 5E4JA 1ISPA 4A15A 3K0AA 3TLCA 1DIRA 1FVXA 1I4TD 1OLXA 4BLTA 1KJ9A 1L5HA 3NDRA 2AG6A 4G8BA 4S35A 1Q7GA 1XLWA 3PZBA 4G5FA 2ZXUA 1GYQA 4UAUA 2A0YA 4Y3UA 2PZAA 2AOTB 1P2UA 1A9XA 4YJ3A 2J3EA 3AZQA 4CL3A 4BFXA 5BW6B 1KP2A 1IOLA 3VR5H 1IY8A 1Z07A 2DH6A 2HIMA 1BX3A 1U0SY 5CEFA 1VIDA 1Q44A 2CJWA 2QRHA 2M32A 3Q0EA 1G5RA 5FKJA 4FS3A 1P9LA 4L9AA 4P7FA 1SXJB 4ZREA 3IRVA 4N0EA 5FR2A 3K0AB 1Z0FA 3A4NA 2X14A 4KO3S 4TSKA 3REFA 1OLXB 3A32A 5IJAA 1Z12A 2RHMA 2P2YA 5IVDA 3UJCA 4LFAB 1L5HB 3KR2A 3D7MA 4HR7A 3SS8A 1PZHA 1JG6A 3GLVA 5AHKA 1I7SB 3CCFA 3C1AA 5CEEA 1QFZA 2VPQA 1YFKA 4JXJA 4XLLA 1A9XB 1UT8A 4YJ3B 5FBHA 1WUHS 1ZI6A 4AUNA 4ETIA 4F38A 1WMDA 3HNPA 2PRKA 2O54A 2Q5OA 3R5JA 2BFPA 1W0KD 2NTJA 1POWA 4URWR 4RE6A 5LYJF 2CJWB 1RYEA 1YCHA 2YX1A 3PHIA 4RZXA 3OEHA 1G3QA 1PR9A 4ZO4A 2O2IA 621PA 4L4YA 2HSZA 3CTMA 4CIYA 2C0PA 2JCSA 4DLAA 3UV7A 1E89A 3A6KA 2XCSB 2FWPA 2FMIA 4DM4A 2O8CA 5L3RA 1KQGA 1ULSA 1L6IA 3EXHA 3H2BA 3QQPA 2IC5A 3BE5A 1IHUA 3FE2A 3K7EA 4DLSA 1T4GA 4FGSA 1VYHA 1LBIA 1VRWA 3K53A 1OC4A 3BGWA 1Y48E 1PL8A 2HU7A 3DXZA 3PPXA 4I8XA 3GXOA 2UYQA 4NE7A 3SQNA 3VI4B 1UPXA 5ALHA 4TOIA 3R2JA 4F46A 4BNNA 3P1JA 1VSQA 2ZB7A 3MSCA 4OHMA 5EYPB 3CISA 2H2AA 5GM2A 5FPTA 4LW8A 1U0HC 5ELLA 1FFBA 3ENZA 2FRDA 3OETA 4IMJB 4L9SA 2P2CA 5JAMA 4ZVQA 2O8CB 2COKA 3EXHB 2HWUA 3KPYA 2G9VA 3NVMB 1YR3A 2FZKA 3KLBA 2GWRA 1FFAA 4EJSA 3H18A 1WQ4A 1BYIA 1U3VA 4CLHA 1Z6PA 2GM5A 4NOKA 4CFSA 4W5RA 1W2GA 1I4LD 2I6SA 2D2FA 5HR5A 3LSYA 1MX3A 3R0JA 2EATA 3KQUA 4M55A 4YMIA 2PPLA 5DW0A 4HB4A 3RUDA 1MKYA 4BAUA 4IMPA 3SIRA 4MYRA 4EVRA 3PQ2A 3STTA 4YJDA 4OF4A 2AI2A 2GETA 2FMXA 1ZQ1A 2ZJ3A 4YR9A 3CVWA 2JAOA 3PEUA 3UT6A 4M9SA 1JDNA 4MDHA 4Z99A 3UW1A 2HF7A 1IQPA 1DKQA 3VZDA 2WSMA 2PD4A 3UJNA 4PPGA 1OWPA 3D4BA 5AJUA 4IV5A 5B64A 2ZK7A 3B3FA 3FHLA 4ZV7A 2GUGA 2C4VA 3Q41A 5JZSA 1QYDA 4PQEA 1QTNA 3A1TA 2C4MA 2XNJA 4YWJA 4Q24A 5E9AA 1QFXA 3V8EA 4KFTA 1D4ZA 1IEQA 4AP6A 3D0QA 1ORTA 3OD5A 4HO1X 4M1MA 1NQXA 1XLUA 3I8SA 4LBVA 3V4LA 2PZBA 3F1KA 3I64A 1JE0A 4ENQA 4BFZA 5BWNA 3ZVNA 1L4UA 1FNDA 1EU1A 1NDQA 1QVZA 3KYIB 1LBSA 4S24A 4YJHB 4B4DA 2O2CA 4KL8S 3NHLA 3A1EA 4ARAA 2ST1A 2QZSA 1SVOA 3N8KA 5I7UA 3LOQA 4TYMA 5DGCA 2GK7A 4H7FA 3AI3A 1W93A 2QSYA 3QVGA 1CE8B 1X87A 4K5QA 4Y6QA 2VAWA 3TEJA 3C6YA 4X6YA 1UWLA 2ZSUA 5EP1A 2GZ3A 3O3OB 1JAYA 2Q1UA 2Z2IA 4LDQA 4R9NA 1DKOA 2DB3A 3RODA 3U1VA 2KS6A 5JRJA 4DQVA 3A6PC 1F48A 2YCBA 3D7KA 3H2GA 5EHNA 3RIEA 4ZHSA 3O83A 3FNQA 3B60A 2Z1MA 1O6BA 1K6IA 3FSJX 1TLLA 3GWZA 4R6WA 2GA8A 2DECA 1R5JA 2ODBA 1CQIA 5ALKA 3K70C 5JSKA 5DRTA 2JLSA 2XYQA 4MUMA 5K45A 5BN1A 2RI1A 4CM3A 1CU1A 1JDBB 3FF4A 2OD9A 3IMCA 3L7NA 4NHEA 2Z2JA 2FFRA 3W5HA 1OD6A 2DBRA 3CXUA 1J23A 3OTHA 5KPDA 1KVSA 3GAMA 2EYQA 1JHPA 1LF5A 4FDLA 4WPGA 1YRYE 2P75A 2WYVA 4HATA 3GEHA 4I1UA 2QP3A 1G60A 3NBQA 4Y2HA 2IV7A 3OLZA 3KKQA 3CT4A 3BCSA 1IOZA 3HVUA 3OE1A 4MKIA 2XWJI 1E4OA 1YS1X 3R76A 1O6FA 1CQIB 2HBYA 1CDDA 1QM5A 1PVVA 3G17A 3R3HA 2ZXFA 5BYBA 1XNHA 1ZJ4A 2DTDA 2X4DA 3K6RA 3MUOA 4B71A 1BQ3A 2CT8A 1UIMA 5EINA 5TF0A 2FG5A 1EK6A 3R6WA 3LC1O 4CM7A 3DL4A 2IYEA 3JU3A 3QVSA 4C88A 3EQ9A 5HM6A 1FFGA 4XZ3A 4GVLA 4XJSA 4B2IA 4G67A 3F8WA 5FBVB 3QBVA 4AULA 1HKHA 5E2IA 1BMQA 3HVKA 3C3CA 4HLQB 4M9RA 4PF1A 4WKOA 3STWA 1RXIA 1P4HA 1LK7A 1PL0A 3C3PA 4KN5A 1A71A 2WWHA 3FJYA 1BDBA 4PAQA 4PX5A 1U2DA 2EP7A 1U8UA 1RAIA 2J46A 2W2QA 3PFBA 1RQNA 4MITA 1IWPB 2WVJA 5EPEA 3UJ3X 1AXGA 3GGDA 4K6HA 4ARBA 5GJWC 2LBPA 4KLRA 1U63A 2YV3A 4IZOA 3FWPA 5KEIA 2V7TA 1QGAA 5BN3B 3QLVC 1XAIA 2ABWA 4PC6A 3GLIA 2PXAA 4Y2SA 1EI9A 2NYAA 2XCIA 3NKVA 1KAHA 1MR3F 2E1RA 1LBHA 3LD9A 4FCVA 4F11A 2IYWA 2I3GA 1SXHA 2V5AA 3PD1A 4H08A 1GSAA 2DF8A 2P9CA 4MQUA 4YQZA 4B9EA 4DY4A 1UCFA 5K8JB 3BXFA 1QBGA 4Q1DA 5KYVA 3ETDA 4FC6A 3QWFA 4W8OA 1VCNA 1H5QA 2UZIR 4CN8A 3IODA 3R7AA 4F12A 1TB4A 2XUZA 1PQUA 1QANA 1ESNA 2II6A 1C8BA 2MIIA 2QE7A 4CKXA 3AOGA 4D81A 1XZIA 4DDMA 1ZD4A 4JVNA 4O4JF 3GLIB 4F9EA 3ZCTA 1SXJC 4RGBA 3VPBA 3MRXA 3L41A 3BJZA 3SR4A 4F72A 1JHRA 3A28A 2FSIA 3GY0A 4RVNA 1MDBA 5J40A 4EYKA 5JXIA 4IVNA 2H11A 3QVTA 5KX5F 4RTMA 2XB4A 3A2MA 1AGPA 3D8RA 4OHBA 5MN4A 3T3OA 1TQ4A 4PRYA 4G4SO 1JNYA 3MAAC 4MS1A 4C30A 2Z1DA 4XE5A 3TLYA 3ZY2A 1DXQA 2ZIFA 5KSZA 3OY7A 5ER6A 2V5VA 2CNNA 1C29B 3MT8A 1K68A 4JJKA 2XWBF 3EEQA 4MI3A 4Q4JA 4UU7A 4V3BA 3LT1A 2XB2A 2VUHB 5BRJA 1BD4A 3U4IA 1JFFB 3J81A 2GPSA 1YL6A 3S8EA 4RZ2A 4W99A 4WZ6A 3ZIAD 2BL4A 1NMSA 3K16A 2EQAA 3P2MA 2D8AA 3PFIA 4YFYA 4B1FA 4R1MA 4L51A 1K3FA 2FGJA 4MS1B 4BJ6A 5BSKA 2FPIA 2GM4A 1E2BA 3KJGA 5GM1A 5H82A 4AMGA 4IAOA 1W46A 2C8VA 1P5HA 3D3WA 3O0DA 4D7AA 2AG5A 2ZRHA 4DYHA 4Q4JB 4DA4A 2G67A 5CDTA 4D0GA 2BLLA 1E98A 2J7PA 2PWYA 4BX9A 2YOGA 1SOMA 4KR9A 1YNOA 3MGGA 2JFHA 5CGQB 3U7JA 4EGCB 1YVDA 2GCNA 4J0JA 2O50A 3AEUA 4DUYB 5A3QA 1E4VA 1HTTA 3A6DA 2IH2A 2VF4X 3EXHC 4DDKA 2QYSA 1A5TA 4C87A 4S3MA 5HP4A 5BXQC 1U3FA 2BF4A 5A4IS 1ZM4A 4L57A 2FPIB 4D46A 1YJAA 2YMPA 4DQ0A 4NTZA 4RESA 3EULA 1EVIA 3D3WB 3PQ4A 1N6PA 1ODLA 5H5JA 3EEOA 1YR7A 1PFQA 3KL2A 2RKOA 1DAIA 2G1UA 1RKBA 3TSYA 1NLZA 1VJ5A 3F49S 2GPNA 4EWLA 5AESA 3ANYB 3LXXA 1OPXA 2WYHA 3OOWA 4MVJG 3S2FA 1ZZEA 3MFQA 5KYYB 1AGXA 3AEUB 4O5AA 4PPYA 1ZW1A 1SWVA 1M34A 1GN8A 2FRDC 3I9KA 1JAHA 1Y1PA 4RFLA