2GEFA

Crystal structure of a novel viral protease with a serine/lysine catalytic dyad mechanism
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
211
structure length
198
Chain Sequence
DLPISLLQTLAYKQPLGRNSRIVHFTDGALFPVVAFGDNHSTSELYIAVRGDHRDLMSPDVRDSYALTGDDHKVWGATHKFNVKTRTDLTILPVADVFWRADGSADVDVVWNDMPAVAGQSSSIALALASSLPFVPKAAYTGCLSGTNVQPVQFGNLKARAAHKIGLPLVGMTQDGGEDTRICTLDDAADHAFDSMES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protease VP4
publication title Crystal structure of a novel viral protease with a serine/lysine catalytic dyad mechanism
pubmed doi rcsb
source organism Blotched snakehead virus
molecule tags Hydrolase
total genus 53
structure length 198
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2006-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.30 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2gefA01
3.40.50.11300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gefA02
2GEFA
chains in the Genus database with same CATH superfamily
4M87A 13PKA 3MWGA 3NIWA 5H5JA 3VYSB 4O06A 2XBUA 3QUAA 3JQ9C 3QFTA 1OUMA 5JVDA 1TECE 4R4JA 3MH4A 4QPPA 3CLRD 2B6HA 5TPZD 2PN1A 2JAUA 2WJ3A 1G5HA 3JQBA 2BFMA 2ZSDA 3H2SA 5F1PA 2GPNA 4CF4A 1J0BA 2QTAA 2LWIA 1XZMA 2WAYA 3K1TA 3L0YA 3LUAA 1XMIA 4H4EA 4HLCA 1PR5A 2A35A 1XJCA 3AKCA 3P9IA 2YJNA 1M1YE 4AFNA 1PR3A 4ZQHA 4BKMA 1UC9A 4S0ZA 4TLAA 5IUNC 1O6GA 1SCBA 4FT2A 3I01M 4KDEA 1DQZA 1M2NA 2XITA 1KEUA 1UEXC 2X14A 3BMQA 3EIFA 3LBAA 3P27A 3GPLA 3GPIA 4NRDA 4EHFA 1X3SA 2FPWA 2AIRA 4WEQA 1KQPA 1KDRA 3FSGA 4MV9A 1A4IA 4FBMA 3O31A 1GZHB 4HCJA 3ZNPA 1H42A 3KXKA 4V03A 4BWYA 4D6YA 4DADA 4DWWA 4EKNB 5I4BA 3LFTA 1XNQB 1BWSA 1N2BA 4M1EA 4UD6A 3R1IA 1CUUA 4CCYA 2RG1A 3KXPA 1MO5A 2G71A 2RHTA 2XQVA 3LBFA 3UG6A 2ZJBA 3FWPA 3RYTC 4UJ5A 3E3LA 1DO2A 5ICSA 2GWRA 4NENA 3I6BA 2BPOA 5B30A 3ER9A 3LCVB 4K3VA 3RB8A 4PG5A 3SICE 3VUFA 3BQMB 2W4FA 2BFPA 5UKDA 3JZMA 5MN5A 1N6KA 3G8AA 3H42B 5LMNB 2TMYA 4YAUA 5IXSA 2IXGA 3FPCA 3HZOA 1L7MA 5AXCA 3T3PB 4WDQA 4KAJA 2FVXA 4AMHA 1ULBA 4GS5A 5A6SB 4NI5A 4TMWA 3RS3A 3KUDA 4PQRA 1XZKA 4E07A 4CN8A 2YZGA 2AXNA 1XXHE 3A0RB 4ZVVA 2ZJ2A 3DEJA 2KJDA 3AX6A 3VUEA 5KC8A 1AV6A 3V8QA 1RFGE 1JR6A 1F06A 4MYDA 3GJSA 3NPAA 2GEFA 1F2TA 4Y6QA 2VNIA 4KOEC 1SVSA 2C1EA 5KPJA 3G2KA 2O8FB 3CN9A 1NVVR 3SVTA 2D7CA 4XJSA 3DJFA 2ZI6A 3ZDBA 3QOWA 3VSAA 3DMHA 1NF3C 2WBLC 1EGHA 4W6ZA 4G8CA 5DYTA 2GBLC 1HDIA 1ORHA 3C6BA 3N2YA 2XUZA 3BFXA 3I45A 5EQTA 4LYFA 5AVWA 1I1NA 2R6DA 3SEQA 1SCJA 1ODLA 1CV2A 3CLUC 4R3WA 1VJ0A 4PCUA 4OHMA 1GKKA 4HZIA 5B2ZA 3SDZA 2WILA 2XRYA 3UB2A 3JD4A 1R6BX 3JQDA 4KO4S 3CWCA 2YKGA 3U4GA 2F3UA 1ZMXA 1AUOA 4MKIA 4J43A 1W2HA 3MFYA 4MYTA 4XGQA 3ZQKA 3T5PA 3EB9A 1I24A 1NBMA 1T35A 1GTMA 2R1TA 1E79A 3AEQB 4U9IS 5AXAA 4ZDIA 2D8AA 1CUBA 3D81A 3DDNA 3JPWA 4RFSB 5F2EA 1JI3A 3T35A 1TC1A 3QU9A 1GT6A 1I1QB 1GOTA 3OCYA 3SAJA 3PHIA 4A2PA 2PO5A 2OQRA 2J4DA 3E35A 3TE6A 3CZ9A 2LA8A 5CJPA 3G0DA 2F8TA 1PW7A 4JJAA 4KV7A 3QVKA 3EW9A 1VB7A 3VU8A 3TPZA 3DTVA 2VTBB 2IIBA 1BS9A 1Q3TA 2WU1A 5JNRA 1HSZA 4CKZA 1T36A 2BHRA 3OUTA 4KEAA 3K53A 1BXRA 2ZB4A 3A05A 3W7BA 3C2QA 5EN4A 4Y3UA 4TL7A 3B3QA 4EKGA 5BSUA 1NI5A 1P3Y1 2B21A 4HQRA 4LRYA 4DLBA 1P4HA 4BCBA 3OJLA 3ZK8A 4E5PA 1JFSA 3C14C 3OZCA 4G5FA 4IOKA 1JFVA 1AKWA 2V0CA 4A91A 3U7FB 4D9FA 5KTSA 2EGKA 4PYNA 5ED0A 4BLTA 3L84A 4J8PA 3ZD6A 1P9WA 1YD7A 1NI3A 2W6ZA 4GKVA 4DIDA 2O7VA 3BXFA 1MG0A 2AW5A 2IOFA 4IDFA 3EC7A 4AULA 4E5UA 4MEJA 1VSQA 3F9IA 4IMRA 4EUHA 4F38A 4R2WA 5K0CA 1U8TA 2ETXA 3QA3E 4RPGA 3IQDB 2BKEA 1T6XA 3ORFA 4NMSA 2J6CA 1QGED 2HBQA 3EWNA 3PV5A 4IJMA 2XCOA 3HKDA 3TQRA 5BSEA 3PP8A 2VQSA 3RLIA 2SHKA 3L8MA 1I33A 1EUCA 2PZAA 3IAFA 2ZBVA 4N8SA 4YJGA 2DPXA 3BHMA 2AINA 1P0CA 4QYXA 3WL5A 5LWQA 2XKKA 1F48A 4NK5A 1XZAA 1FW8A 1E2GA 1VJ1A 3DFZA 4LWPA 3TNLA 2WTEA 4N76A 1C3LA 4KAXA 4F97A 2CLFB 1W1IA 3DO8A 4ZI3A 4LCJA 4LSZA 2P4UA 2YWRA 5LZ5A 3TW4A 2HBYA 2ARKA 5IWAB 4CDNA 2YWEA 4O1IA 5FOQA 3Q0EA 3F6CA 3I62A 1UQRA 3SC2A 3HP7A 3WLTA 1L5VA 4P32A 1QRUA 4CKYA 3IXLA 1IY2A 1KAMA 4US2R 1R27A 3EBLA 1M2GA 1LLCA 4LS3A 2X5KO 5EHZA 3QMVA 1HV8A 3EULA 3ZHOA 2CVHA 3B51X 2J0EA 3MXOA 4HPWA 2A5YB 2VSOA 2WPDA 3H5WA 3OIYA 4D98A 1O95A 3BSWA 5HCUA 3G3EA 3CBYA 1UKEA 2YJGA 5C5DA 1SCUA 3GP3A 3N9IA 3DGFC 3IUYA 4JJZA 2YHSA 3D6JA 3P9QA 4PYIA 1UM7A 3QWBA 4MI9A 4P80A 4RD6A 1MIOB 1H4TA 3TXXA 1EP9A 3R5KA 1XPOA 1Q92A 3GROA 4ND3A 4LF9B 4CF6A 1R0YA 1WSAA 5T7BA 1PS8A 9ABPA 1XJQA 3L1UA 5LJLA 1XVIA 1A2KC 1ZQ9A 3H5OA 4KLRA 3HYTA 4R2XA 4WDRA 4J7AA 3BXEA 3I28A 3NIBA 4LGVA 3WP0A 1U6IA 4EY7A 2ZT5A 3JW8A 1OFIA 4HDCA 1R0XA 4O02B 3SYLA 1XTJA 2C98A 2JCSA 3GFFA 5KPDA 1P1DA 4K9LA 4H1TA 2ZU6A 3D0OA 2FEAA 3UCXA 1VLMA 4MI3A 3V4OA 3Q5EA 2A8YA 4KXVA 3VH2A 3WIUA 2DLDA 2WUVA 4CR7A 2IWPA 3QE0A 1KJJA 5JZMA 1C4XA 4ZYYA 4QJ4A 4G5XA 1WUIS 4CVNA 3CBXA 3BWXA 1EFVA 3KETA 5CJJA 2QK4A 4PVCA 2YWDA 2ZBEA 4HYYA 3RC3A 2JLZA 4AY6A 5JXJA 2OCBA 3C39A 3VC1A 4CKCB 3JR7A 2X2PA 3V7UA 4MI1A 3RANA 2AC7A 1JV2B 3RJ9A 2FPXA 1UBKS 3GDSA 3OESA 2H2AA 2XNSA 2C2YA 4EATA 4I5FA 3PUXA 4ALKA 3UJBA 4TN1A 3BMNA 4MTLA 1AQYA 3CE6A 3ACDA 4OO3A 5E4JA 5HRUA 4UCFA 3R7DA 3L79A 5A3RA 3FPGA 4QDXA 5TEVA 1K32A 3LE8A 5IU6A 3WQQA 4BWGA 2X4DA 5CPBA 1ZUD1 2IYEA 3O3CA 4RE6A 1WDLA 1GZSA 4XUEA 3V3KA 2ZRPA 2I3GA 3BL6A 3QU7A 5JPIA 2ZDGA 3K16A 3V4ZA 2WOJA 3X1YA 2B2XA 2ZIEA 1R6XA 4P3OA 5ILGA 4MIKA 4ZCIA 4HUQA 3HBNA 3HXKA 3LCRA 2QPLA 4RWZA 2Q2NA 2ZIVB 1P1JA 4JXKA 1U4NA 1EBFA 4HDNA 2JFUA 4R8KA 4DJAA 1C0LA 4MIOA 4RCZA 1N6EA 1U39A 4YUXA 2PTGA 1DBIA 2OE2A 1W5BA 2P4EA 2QN9A 1PZFA 4DA8A 4RS4A 2Z43A 4NABA 3USES 4QOHA 2OVFA 2FR1A 4EX7A 3HU5A 5DNVA 4XD7A 1N1MA 2O6HA 3VYWA 3OCCA 4JU8A 3QU5A 3THOA 1I2ZA 3DL4A 2OESA 3WQRA 5IYZA 5KNDA 4UAVA 4PAMA 4BO7A 1T3LA 1LSOA 3GMTA 4PR0A 4QULA 4RD1A 5HPYB 1DT3A 3WYGA 1UP4A 4RMGA 5G53C 3CVYA 3A6ZA 4RXUA 1RC1A 3H7AA 3HCOA 5HZGA 4KU4A 4IFEA 1YR9A 1NLMA 4Z4QA 1E3DA 1O97D 2ZSEA 2BEUB 2BEWB 1GXSB 1XROA 3CM0A 4LE1A 4HEQA 1K68A 4ZQGA 1NW4A 1E7RA 1J9ZA 4NIMA 5I48A 3E4CA 4RLQA 1TVKB 3G5LA 3NB0A 4GI2A 4P81A 4G0YA 1AF4A 2HJGA 1Y89A 2VQ3A 3FJYA 3DXYA 1TO2E 3HCDA 1VSBA 2QTGA 2ZJ1A 1ARZA 4M38A 3UOWA 5BV7A 4NYJR 5BV0A 3IX7A 2J9YB 1S1MA 4CDMA 2Q9BA 1YVEI 4XGRA 3LVFO 1V11B 4I9NA 1WKVA 1Y9AA 3AFGA 3W3AD 5ITSA 4YN3A 2YV4A 5FUVA 4FYHA 3VO9A 4D96A 5AD1A 1QP8A 3HDYA 3RUEA 5FOSA 4D8TA 2HADA 4NBNA 2EFHB 1Y4ZA 4RHXA 5LBUA 4DCMA 1CRPA 2NTVA 3PPIA 2R85A 1X9GA 5EKDA 4AY2A 1MXHA 1RBYA 1PDOA 1XCOA 4IIXA 3O4RA 3EJ6A 4ME6A 1I4WA 3S2SA 4OHZA 4B6PA 4A0FA 4DIBA 4ZI7F 3WGUA 5DM60 1XAIA 3IKMB 3JCZA 2IZOA 3PDZA 3BDAA 1EKXA 3E82A 1P29A 4LHSA 5TQ0B 1L5KA 3STXA 4N39A 1NUAA 2FR8C 1C9JA 1JHZA 2IYTA 2Z8ZA 4YAGA 1CR2A 2PVCA 2ZRIA 5GADl 1MDFA 2W42A 1N25A 3MLBA 1ZCFA 4GIBA 5B55A 1I94B 5FUMA 3CYYA 1VBMA 2GBPA 1XZLA 3CVJA 1LQUA 3QPDA 4KQ6A 5EMKA 3SQLA 1PQ4A 1Q1BA 3ZLTA 1K89A 1P2UA 1DU4A 2IXEA 2H00A 4CM7A 4PCAA 4Y0VA 3ST7A 5H0IA 4HB2A 4JL8A 4D4GA 1IY8A 3LSTA 1ML4A 1I4TD 2QV7A 1Q44A 1QH1A 1E2HA 2XE4A 2PSDA 2QLTA 1COWD 1SHLA 3IILA 4P7BA 4C4OA 4DLTA 1DKQA 3H6HA 4GMFA 4OHOA 1BJRE 1VE7A 2VL7A 3E58A 1FFWA 3MJRA 4CL3A 2O3JA 1GYQA 1YIOA 2BUBA 4I4IA 4BCDA 5KYKA 5I9TA 1DS6A 2QX9A 1X7ZB 4BJ5A 1UBSB 2YS6A 1G5PA 1SAYA 2BT4A 4PQFA 3VR1A 5EJMA 2L42A 3FYHA 2G06A 1VIVA 4HQLA 3E0XA 5I9IA 3AHDA 3RBVA 2ZUWA 3Q7EA 1ZVVA 1IZ0A 1R12A 2EGUA 3ZXSA 1CNMA 5D13A 5JD4A 1EDEA 3DLCA 3I2IA 5A5DA 3AJRA 5F7ZA 5AVQA 1NIJA 1I2MA 3IRUA 2DP4E 5IKXA 2OO5A 2XOKA 3PENA 2FZLA 3QUQA 3WNDA 1VYHA 3DBVO 3BZUA 3VU1A 4B6OA 3K0CA 1ZS9A 4F3TA 3KTAA 4FIDA 1P0MA 1XA3A 1E58A 1T25A 1BJKA 1YUBA 4IFTA 4JITA 1LV7A 3SBDA 1O6CA 1V6CA 4BTLA 5JALA 1UBGA 2I22A 2JI4A 1I3OA 3EFOB 3OVMA 5EUQB 2SCUB 4KYTA 3IHTA 1ZNQO 5FTJA 1B8VA 3G68A 4RTOA 4C2AA 1R00A 4PINA 4NPCA 3NYRA 4NCHA 1H4VB 2QS9A 5FADA 1LF5A 3FDZA 1BVUA 1Z07A 1GNPA 1VCOA 4IWYA 2EFDB 1RRVA 3ESBA 5I7EA 2WJYA 1HZZC 5K09A 1OB2A 2VPZA 3I9OA 1MR3F 1N9GB 1SQFA 1Q15A 1YS7A 1TE2A 1TYDE 3DH0A 4RPIA 4UZSA 2AZTA 3B3AA 3UK6A 4TKZA 3NTUA 4CKEA 5CA0F 2V7TA 4HDOB 4DAOA 3D8BA 3JQAB 4JUIA 4P5DA 1QO0A 3R2JA 4FOLA 4F4DA 4KW7A 3WXMA 4HS9A 1C30A 1Z0SA 1P19A 5AW1A 1LF0A 1K6MA 2H9YA 2Y1XA 3SQXA 3FNBA 1N4DA 1VJDA 3A9RA 2BHLA 1W52X 2WIDA 2YIVX 3FPFA 3LWZA 3S27A 1T26A 4JOPA 3UAYA 4G0VA 4ND4A 3VNVA 2Z95A 1N2CE 2XKJE 1T34A 1UF9A 2EFGA 1K92A 2QLNA 3COSA 3FW1A 3N8KA 5B3LA 3HUUA 3OTIA 4K6GA 1EUZA 3M6VA 3FI0A 3SLRA 4BBAA 2Q3JA 1MJFA 3MRSA 3GJZA 1NL3A 4IZIA 3RS5A 1OBYA 4Y6LA 5EINA 4DNFA 4ZK6A 4WCVA 1BMDA 4GM4A 3W2IA 1L7RA 1ZQ1A 2ZTVA 4O4HA 1CT9A 3MT7A 3T7IA 4ATNA 3M4XA 2B8NA 4HNVA 3F49S 2OSVA 3OM1A 4ZVKA 2QM8A 1QYRA 2VOEA 1C0PA 1ZK4A 4L76A 7AT1A 3PGJA 5I7ZA 2B92A 2NYUA 3ILVA 1MAUA 3CZCA 3HC7A 3ZU3A 1IULA 4ZEWA 4M1WA 4REMA 3MF4A 3JX9A 1YTUA 4W82A 4N5MA 2DWUA 3FTDA 2BUAA 4XPZA 4C7BA 5IK2D 4HGRA 4HZGA 4ZHQB 1SD2A 1TJNA 2YWCA 3MJTA 3K94A 3VPSA 2I4NA 3ZDFA 4EY3A 2WTUA 4WVLA 4OM8A 4DMCA 1ZN8A 1X70A 4WKBA 1WVGA 3IE1A 2C7RA 2ZCVA 3KTDA 2II6A 4HAZA 1J90A 4NMQA 2HK7A 2Q5JA 2GD0A 3THXB 4F1KA 1U2TA 4RA9B 1SCNE 1U0EA 4I9UA 1NYRA 1WR8A 2X8BA 1OHHD 1CY8A 2GFHA 1CUDA 4MS1A 4QA9A 5JYCA 4URFA 1O4WA 3G79A 5JXWA 2EGHA 2GSWA 5CDSA 1CY0A 2CK3A 4B7ZA 2I9PA 2B61A 3AJDA 4ZZIA 3WI7A 1JS1X 1E5TA 2L4TA 1FVFA 2NV6A 1U80A 1HQYE 1VMKA 2QR5A 4FWTA 2ZPAA 3B85A 1BYUA 4ROSA 4Y9TA 4Z7NB 3R6TA 3RTDA 1YI8A 1XDWA 2CD7A 3EZXA 3I5YA 3ID2A 5DIFA 3ZS9A 1N6PA 2FNAA 4II3A 4CMKA 1ID1A 3W5DA 2CJWB 1N1EA 3LF2A 4LOLA 1IHDA 4YV7A 4E30A 5E9AA 2NXEA 5HJEA 1N78A 4PPGA 1YA6A 3A58B 4BKOA 4TRJA 4FR0A 1QIJA 3QFFA 4JOCA 2J6BA 2ZWVA 1DAPA 4HWOA 5TF4A 3JU3A 1NI4B 2JIDA 2Y6VA 1PEYA 1GTL1 3WRXC 5L4NA 1JQ3A 1Y82A 1YL6A 2Z2ZA 1LB1B 4WKPA 4ZRMA 1PL0A 2IHVA 4YP1A 1XZQA 2WZDA 4BNKA 3H04A 1QQTA 3Q6NA 1VE3A 4RKYA 3ZE8A 3MJFA 4DEXA 2XEXA 2PA1A 3AWDA 2P30A 4PCLA 3LQKA 4N12A 4EA7A 1N7FA 1XEWY 1TTPB 1JKJA 4OTZA 5KCMA 2Z2JA 3RAGA 2XVZA 1QG2A 5FA6A 5DWVA 3DL2A 5GJBA 2IPAB 4TL8A 3DBHB 4MDFA 3OZUA 3WLPA 4QPNA 4IYRA 4QWMA 4PNEA 5KTRA 1JW9B 3VYVA 1WMEA 2G8NA 2OC9A 3OUZA 4YQZA 5D6NA 5ALEA 1U2GC 2NXNA 5ELMA 4X84A 5BQPA 4EHKA 3GBVA 4KVGA 3MGBA 4OYYA 1AN0A 1Y0BA 2I7DA 4XAQA 1P9NA 2QTFA 5JC8A 3VPCA 2H59A 1P18A 2GZ3A 1KA9H 5DCWA 4N6OA 4BNYA 1T1JA 4XDGA 1R5BA 4D4IA 3WDKA 3VR3D 3NAGA 4UPVA 1N0IA 4CKWA 3BD9A 5EHNA 3WGIA 4JT9A 2KJQA 3IODA 3T7EA 2ZR9A 1E1CB 3EEFA 4JVOA 4QM7A 2BGWA 1QGUB 2PCJA 1M75A 4C30A 1KKUA 2F17A 4V0NA 5CLHA 2BFDB 2NUAA 2IYQA 3GARA 1VP3A 1GFSA 2LCIA 3RUPA 3TVYA 5ICGA 5KTNA 4UAJA 1Z6TA 2QB5A 2WZCA 4KK3A 1AB6A 2CFRA 3OQOA 4G2TA 4GG1A 1JAXA 1ZXBA 4OHYA 1IE3A 3TQIA 3WO1A 3DS8A 5B3KA 3WB1A 4R7TA 2V1XA 2YFKA 1E7WA 2BW0A 4L51A 2FFAA 1FVXA 1YS6A 2ZWOA 2HJSA 1E7MA 1N3BA 3KDKA 3GUCA 1KEFA 2CL6X 3KJXA 4D8XA 2QRVA 1GZ6A 5AJHA 3FUTA 4P0TA 3NM6B 3QVUA 3WQHA 2ZCJA 2KL1A 2HF9A 2EC5A 5H02A 2IX9A 5EPEA 2O1EA 2WJGA 3C15C 2E4ZA 4CMIB 2AKEA 2HM7A 2V3WA 3AQ4A 2OT3B 1UEQA 1YQXA 3HDGA 5JH7B 5I8ZA 4I3FA 3T54A 4E4YA 1ZG3A 4K86A 4QUBA 1Z18A 3H16A 5IMSA 1C1DB 3CUWA 3T4PA 2RGRA 4J0GA 4WFJA 1G2IA 1NW8A 4M22A 3TW6A 4LTDA 4L8WB 1RYZA 2GTIA 4UEKA 3RI3A 4WE3A 4OI2A 5ALWA 3L0IB 1N33B 4BFSA 2CZGA 4GDMA 4RJLA 1U2RA 1V3TA 3AEKA 5E4TA 3VU9B 5DW3A 1S0UA 4WCFB 3MUEA 4QTYA 1TJ4A 2HMSA 3FCEA 2TSYB 4TSFD 3RSFA 4MKFA 4AQ7A 1U8XX 3BCSA 4V2UA 2TMGA 2DBYA 2PUFA 3HO1A 1C9EA 3DZ8A 3NBUA 4AK9A 1ZWKA 2Q1WA 1E5LA 1EQUA 3TNYA 1XRQA 2OWDA 2QMYA 3FROA 2BKLA 3QVVA 2HMWA 4UBIA 5E0OA 1Z36A 2R6FA 3FVTA 5EIWA 3L1JA 3TLCA 4E12A 2EERA 5KSPA 3WK7A 1L5FA 2ZOSA 1V2HE 3ABZA 3G7NA 4GXRA 2QRQA 1NF9A 5CH3A 2Q3EA 3RJZA 3AU8A 3VR2D 2BTQB 1KEPA 2O2HA 4DN6A 2FKAA 1QS0A 3CNQS 4B3TB 2WVHA 1V9CA 3HGTA 4BLWA 5L3QB 4WUVA 5LWHA 4N9WA 3DKRA 2GM9A 2JEYA 3I9V1 1HDOA 3R7FA 1OPRA 2BFBA 3GLTA 1KI2A 5CX1B 3MINA 3OCXA 2BGUA 2H7VA 2YYYA 2R65A 4EY8A 5A5GA 1JLLB 3THWB 4UTZA 4A5SA 4YRKA 1XQ1A 1QAQA 4ZO8A 4WKCA 2GZVA 2PAAA 1QIHA 2CNLA 4QBTA 4EM6A 1TA0A 3WQBA 4D6PA 1ZIDA 1KIMA 3L7CA 1KRHA 2FK8A 4PZZA 3N70A 2RAFA 5EMHA 4YXWA 1P80A 4RPCA 3UCFA 3ZOKA 2DRIA 3IVAA 1FDSA 4DXAA 4KQEA 2VDJA 1US8A 4FN4A 3ZWBA 3OTPA 2WU8A 1FZQA 1CUGA 4Z8YA 2ZQYA 5EXEA 1GCOA 2AXQA 4LJ9A 1FFXB 4WLUA 2A1UB 1C14A 4W9RA 4EG4A 5K9ZA 4LNUA 1RYYA 3SXUB 3L46A 4OEOA 2EHJA 5D3MB 2FW1A 5EP2A 2DPGA 2Z8XA 4B31A 3RRBA 2PPLA 5FYDA 3KQTA 4C9BA 4WK2B 4DG8A 4EMTA 4D81A 3ZGZA 1GKIA 3DE6X 2Y1KA 3RC8A 3LP6A 1VBKA 4A2CA 2O2JA 3BE4A 1ULAA 3KK0A 2ZYAA 4UHEA 4AJ4A 2HGSA 1G8MA 2XBLA 4PX5A 2HDOA 2QRUA 3FSRA 3OJFA 4R2IA 2FX3A 3VDXA 3ZWPA 1PV2A 4GNRA 3DORA 1JA9A 3OZTA 2OBLA 1ZIPA 2YTWA 1EVYA 1D1PA 1K6JA 2FN3A 2WJHA 3OETA 4WASA 3AP2A 4Z2YA 1CK4A 2VHXA 1THGA 2X9LA 3AL3A 3F3MA 2R4QA 1HORA 4N3BA 4K8RB 3RUIA 4RZHA 3IA2A 2DBZA 1TRHA 3OTGA 4Z8XA 2DKNA 5CHEA 3V4FA 2H7XA 4C4YA 4BUCA 2J8ZA 4FFMA 3ES9A 1FRNA 1R88A 4UHFA 5I7HA 3DYBA 1J56A 1SXQA 5JAPA 1HE8B 1K06A 3BHIA 2M10A 2BDTA 2AFHE 3UMRA 2I8CA 3ZV6A 1S1CA 2PUEA 3GFVA 4HMQA 2YWFA 2AVDA 4UQLA 2PGLA 1YB6A 4QUIA 1ZUWA 4C6SA 4JR1A 3UKOA 2VCHA 1YS9A 3JASA 1QYWA 3DFFA 4O4LF 4QO8A 1V4VA 2JBHA 1ZK0A 3OEHD 1FFGA 3KWJA 3ONVA 4YP7A 1CUJA 1II9A 4BVGA 2R47A 3KQUA 3FAZA 3WK4A 4D79A 1C8KA 2H29A 3Q1KA 3EGIA 1GTVA 5FWAA 2V90A 3OTWA 5IS2A 3H2HA 1GP2A 3EY9A 4L3OA 2HKIA 3DW1X 1SUBA 4WW0A 1NN1A 2NVUA 3GJRA 5BSMA 1CVIA 2VPPA 3EHEA 4DA0A 3DZFA 5I45A 2OL4A 2YIJA 4GC5A 2LRHA 1HNNA 1O9BA 5CT6A 4IF6A 2XF8A 1GRCA 4EPYA 3YASA 6CHYA 4O2RA 1VL5A 4UHJA 4PO8A 1JNYA 3EGDB 1QAOA 1TL7C 3GOHA 4WINA 2G4LA 1NRXA 2NYRA 2QUAA 1GZVA 2A33A 4Z4HA 3IB3A 4N3AA 1THZA 1MRSA 4REQA 3GMIA 1JBEA 1PWHA 4YMLA 4FSHA 3CC0A 2HK6A 2CUNA 3IESA 4IXTA 1G4HA 2QD1A 4U3JA 1OILA 1VHDA 1WXEA 4OQ4A 3TGLA 1HT3A 3HJTA 1TCAA 1LNZA 1G42A 2W6NA 1FMCA 1UXOA 2JCYA 4EB8A 5JY1A 2KYRA 4GKKB 1E8DA 4OD0A 3ASVA 1TW3A 4O2AA 1TFUA 2YBDA 2O8DB 1WD7A 1SY7A 1ZN2A 1SURA 3B3FA 1AGPA 2PMEA 5C7YA 1USKA 4QFBA 5I01A 2B4QA 5BVHB 5A4AA 4JBXA 4NEHB 4JLKA 4I6GA 3JSAA 2E82A 1U7DA 4TT3D 1T0IA 3G5AA 3A6LA 3GB9A 5K8LA 1T6BY 5KYTA 1M1ZA 3T38A 5HK8A 2V7QA 3L7AA 1PRYA 3KKNA 1OF1A 3INRA 1LBHA 1DRWA 2CLCX 2UYQA 1ORIA 4Q1CA 5AKJA 4H18A 1VPVA 1OLUB 3K1JA 4JI1B 2QRMA 1BWQA 3OFNA 4XDZA 5KKAA 2Q3LA 4PZEA 4CDRA 2L82A 4MR7B 1YE5A 1G18A 4MRPA 4C21A 1I2AA 1LZKA 1SUAA 3NIGB 1G4UR 4PHCA 3WRVA 3CUYA 5C4IA 1RKUA 4L8YA 1P6QA 3BAFA 4C4AA 3K8ZA 5GVRA 5T3UA 3T6KA 3CV3A 3QQ5A 4X7RA 3VR5H 5JATA 1F4VA 1PWYE 2C4HA 4NARA 5EE1A 1NVTA 4CGYA 2ZUTA 1W2WB 4CIDA 3I53A 1D2AA 4QEDA 4U7HA 3ND6A 1LTKA 2JRCA 2B69A 3E70C 3I4LA 2W6IA 4R9UC 2OQ2A 3OKAA 3B7GA 5KNCH 3VPXA 1FEZA 4IKEA 4ZU6X 1PFYA 2OBYA 2R0QC 4CLXA 2Q49A 4IWXA 5JUWA 2ENOA 5HFCA 2J6IA 4KQIA 1A04A 2FEPA 5F67A 2RHDA 2XYVA 5ENVA 5B7QA 4C6RA 4M86A 4RUKA 5A1JA 3AHFA 3UZUA 3OPYB 1KY3A 2HLDD 4ZOEA 1AQ6A 4U7FA 4MRVA 1ESZA 1ZEMA 3PFNA 4ZOLA 4ENVA 4WBNB 1KTVA 2XTNA 4N5IX 3LX6A 4DA9A 1LWOA 1YCHA 1JQAA 1ISMA 1USVA 3R7LA 1YWGO 2AJCA 2P78A 4ARZB 1Z25A 3M1AA 4O59O 4HI0E 3HKCA 5L6MB 1XZFA 2AUMA 1BEEA 1X13A 5HFEA 2DFNA 2VHZA 4HXEB 1JF8A 3GZNB 2YZNA 4UUBA 4OL0A 3UMGA 2XB8A 3NGLA 3S70A 1RWNA 2RBGA 3SE0A 1DJQA 3ICWA 5DKFA 1BDJA 4IDBA 4J0HA 3F4KA 1U2QA 3OIWA 2CXQA 5LD2B 2QMEA 1SEVA 4GNKA 4TUYB 1PAUA 2V7BA 1CZUA 4IQ0A 1UF1A 2NVWA 3CO5A 1JEYA 2GEKA 1AHNA 3H11A 4RLHA 1XMJA 3GD7A 1PLLA 3QYJA 3QVGA 2G9NA 1AHPA 2JKVA 2QKTA 4CU2A 1W9MA 3WK9A 1O9HA 3DMYA 6NULA 5JIBA 2GKOA 4N7MA 1Q50A 1KH1A 5DLDA 1QF9A 4JQCA 1D4ZA 1FSGA 2APJA 2VDLB 5TMEA 2NQTA 1Z2EA 1N6DA 3KS9A 5TX7A 3VR6D 1H05A 1TF5A 1VJTA 4I1SA 4DBVO 5F52A 3ONEA 3ILSA 5CLGA 3S2EA 1ZJ5A 3PJGA 4DILA 2BELA 2K2QB 5LXTA 4MQFB 2JVIA 2Q99A 1GFIA 2JFHA 4MUYA 3V8VA 3OAAD 4B6SA 3KLBA 3HEBA 4Z5XA 2X1HA 1Z87A 3AESB 3WYNA 3NNSA 4BAUA 4AO7A 3PC8C 2H2WA 4UXJA 2ZJ3A 3SXPA 3URMA 4BLVA 1MJNA 1MQSA 3DMDA 4HH1A 2OGTA 4QO7A 4Y9UA 2IF2A 1XZPA 2IHKA 1LW7A 3NFKA 5CDHA 2ZUBA 2O8CA 3P2OA 3ZW9A 2VSQA 3KB2A 3NAQA 1W49A 4HLUC 1E2EA 3L1IA 4OMFG 4JC0A 4AIRA 3JQ8B 2AYZA 3HVKA 4LNAA 4ZJYA 4KPEC 3CLTD 2MSCB 1YCGA 5EWJA 4BKUA 2AOUA 4EGCB 2VBIA 3SHTA 2YHUA 4R8VA 4ZXPA 4Z3KA 1XTZA 4FP9A 4KXLA 2GZDA 1YQQA 1J1IA 2DHQA 4TYMA 4X91A 2IHUA 2XKBA 2D1RA 1XZBA 2ONKA 2ZYTX 4GE3A 4ARUA 2GTHA 4JB8A 1ZIXA 2ZJFA 2WQ7A 2FUNB 3AONB 3MK31 5DX0A 5FWDA 3ZEAA 4MNTA 4ALJA 2HHHB 4BP9A 4B1FA 1OASA 1U5BB 3H5AA 4H1UA 4G5HA 4MHOA 1I7PA 3PHLA 3RIEA 4P0CA 3GH3A 5CP8A 1U3FA 1P7VA 3K2BA 3H9GA 3MAGA 4LBYA 5L51A 3EXG1 4K3UA 1HT1E 2BZGA 3EY4A 1GZUA 4AJLA 5LMUB 4E03A 4DTCA 4NV1A 2OUIA 2YN4A 3OFKA 1YRHA 4J6FA 2MYUA 1ZWLA 4C2TA 3FHOA 1T9HA 1NUPA 3A8TA 4KZPA 1UPAA 4E3ZA 4AP6A 1FPMA 1YFKA 1RABA 3K0BA 3BKXA 4E6EA 3O8LA 2O1WA 3VNBA 2HA5A 3DJ3A 3QEAZ 4U5QA 1EM8B 1FXWA 2Z83A 2IV2X 3FHLA 3I72A 5JAQA 5COQA 3ROPA 2VPWA 5B4UA 4U7TB 2QT1A 1NXPA 1QB7A 1EFDN 1NFFA 1QDUA 2ES4A 2O05A 2CNBA 2P4HX 4PNZA 4UM9D 3HJNA 3UJ3X 4CE6A 8ATCA 4LJ8A 4X85A 1DKLA 2XZPA 3FFWA 4URHA 2CB0A 2PUVA 2EP8A 5C2JB 2PYIA 3O46A 2BBTA 1O94D 2WE8A 4F4CA 3R3JA 3KAQA 4E13A 2BRUA 2NXWA 1I0ZA 4KXUA 3GLKA 4B0OA 1IEXA 1PJBA 1IATA 1WS6A 1QIMA 3N0XA 1YTLA 2NTEA 1QHGA 1Z2OX 1F0YA 1GRRA 4KIUA 1KOGA 2HY7A 5H3HA 3V4RA 1E69A 2HSEA 4E7OA 1QQAA 3K96A 2E85A 5CFZA 3H19A 1YNOA 4OREX 3SQDA 4B3DA 4RANA 1P72A 4JOBA 2IXTA 4PV7A 2VWRA 4KUHA 5FOXA 4N7RA 4BLPA 2O23A 3N2EA 3ABIA 2H54A 4FJ1A 1CQJA 5J2TF 3ZHTA 4FB4A 1VC2A 4H7IA 1LPOA 1CNEA 1RQ2A 1V3UA 3W8FA 5L3SA 2FUCA 3D4OA 3IKTA 4JMPA 4RFLA 2GYWA 4L8VA 2Y76A 3AYZB 3ROFA 5GQSA 1WULS 1G3UA 2OHHA 2GM5A 4V39A 1JDSA 1UQTA 1HOXA 2QRNA 4KACA 2AEJA 3LLCA 3MBKA 4L07A 4KB5A 1QP7A 4KITB 4WIAA 4GR4A 2AHOA 2GOYA 4D8VA 2H2FA 2F1HA 5JXIA 3G2LA 4MVJD 5JHGB 2BGMA 3K1AA 2VOJA 3VQGA 3OU0A 3I9V6 5KYVA 4EWLA 5JMOA 1IRIA 3GO4A 3TG2A 3OLWA 1OYVA 3Q15C 3OF5A 2ZANA 3BIXA 1GZ7A 3KLMX 2PQMA 1DINA 5CLIA 4B3IA 1QAUA 5BYBA 4Q4DA 1MC5A 5EJ9A 1ZRHA 3F6YA 2HWYA 2W7RA 4MJ7A 2IPNA 1R0CA 2PGOA 4RE5A 4F2HA 2FV8A 4UVIA 2AF4C 5FWXA 2JVKA 3GFRA 2HCBA 3TZBA 3V8EA 3OH8A 3SX4A 2ZI3A 2N75A 1I3CA 2YRFA 2B2CA 2C7OA 3KZEA 3R5SA 1GV1A 1VE9A 4JOEA 5CJ2A 4BE4A 1T9CA 2JBAB 5K6TA 3J7AC 2I4RA 1ZOPA 3EZ9A 3GWZA 1GZ5A 2ZPUA 5JC1A 4YQEA 1YAJA 3BYZA 1YZVA 3FF4A 3H3FA 3KEMA 2ZJYA 4MVJP 3SKVA 5BY2A 2D4HA 3REFA 4E0BA 1PP4A 3ZCUA 3ZZTA 5KOIA 4OQQA 3ETLA 4U0KA 5EIHA 2H1WA 2MINA 2WU0A 1XO1A 2EARA 5EUBA 2JIZD 4D5GA 4EYGA 5BPHA 3GG2A 1ONOA 1WJGA 2IE8A 2XH8A 4K05A 4ZOBA 1VBNA 2PKRA 1TRKA 3GLIE 3TM5A 3W5AA 3K0EA 5SZIA 4PXAA 3TRJA 2VYVA 5IJ0A 2IITA 5CHYA 4HDRB 1MN6A 2OHGA 3GABA 2W48A 4C0WA 4TZ6A 4Y6GB 4BMNA 4HFRA 2G4CA 1ZPDA 3D7RA 2DFDA 1CY7A 3JVIA 1TAHA 3HFGA 3BDIA 1XCBA 1ZDMA 3LPCA 4TTPA 2O48X 5HKAA 4O25A 4M6WA 2INGX 5T4BA 1RWXA 4FEYA 3WGQA 2GARA 1EEHA 1F1BA 1PT5A 3FB4A 3LUBA 4KPFC 3RF7A 3VTKA 3CIOA 4DSAA 3RHFA 3NHBA 4BZPA 5A3QA 2G1AA 4WWHA 4I19A 2R7MA 3LI2A 1RU3A 4JHXA 3R24A 2YV3A 3EGXA 4P3NA 2O14A 4ENWA 4POOA 4JUCA 4QFDA 1YE3A 2ZIGA 1XCGB 2GDJA 3ONWA 1DPFA 4OFWA 4Q7LA 4DUGA 1ECCA 1F6DA 2JGJA 5TIIA 1WABA 2BEVA 2V03A 1N6HA 3M6AA 3I2HA 4IRMA 1J5EB 5LDDC 4GP7A 4ZT7A 1BW9B 3A3PA 1U5CA 1B73A 1GYRA 1D1SA 5BWOA 4IQGA 2OCAA 1WXIA 1PFKA 2HMUA 1JGTA 1SG9A 2VATA 2VUTA 3NHKA 2OFXA 2Q4EA 4LWOA 4WCFC 1GHTA 1IAVA 5AW5A 4E5SA 1EVLA 1PFWA 1MA0A 1IJEA 3GG9A 3UGKA 4JGIA 1LQTA 4F71A 3IP1A 1T4MA 3PIRA 1Y8CA 4YPVA 2KHZA 4GKAA 5HKLA 1FA9A 4LMAA 4X1OA 4BMYA 3WHLA 4BX9A 4XDYA 5LLTA 1BFUA 1FX0B 4LJ7A 4FE3A 3CG4A 4Z9XA 1JZTA 4UBKA 1JLSA 1YRWA 1P74A 3UQYS 4AZTA 1TFRA 3AZQA 3H8VA 2R1ZA 3ADCA 1G1MA 4D9IA 1IUNA 1RFLA 1IG3A 1B1AA 2FWIA 2XNHA 4B76A 1CCWA 3BRSA 4BP3A 4PWYA 4F6RB 3RWOA 2MYTA 4HH3C 3N1UA 2XQKA 1CSEE 2WWFA 1FMTA 4JQSA 4ARSA 1MOZA 1U0BB 3ABOB 3NCVA 5KHOC 1CJBA 4NJMA 3WIVA 5JCPA 4GQIA 2EKDA 4GVDA 2GPJA 3L2OB 3VSDA 4CM9A 3NHMA 3WWEA 3TTWA 2RD2A 3V3TA 3GUUA 5E9JA 4OAOA 2WWVD 2Z2YA 3EXHB 3LTEA 3PPXA 5FP0A 4Y6OA 1VGRA 1SC4A 3RRNA 5KU1A 1ZCJA 3UKJA 3PFHA 2CV2A 3CLRC 1V5EA 2C94A 2VXCA 3NWOA 5EMJA 3REQB 3WQSB 5IZCC 2WTNA 4V2IA 2QRKA 2I1WA 2O4UX 2P75A 3H97A 3LG2A 4XCXA 2X2EA 4EGJA 3VC2A 1DCKA 2RI6A 3E9NA 4MR9A 1SU8A 1A72A 5FOWA 1Z0DA 3K9QO 2IXBA 3DPSA 4KTTE 2ZVDA 4Z1MA 3DOHA 1WF8A 4KQWA 4BOYA 4PFQA 1OWNA 2XUFA 3F8TA 4XLZA 1G6Q1 1NR7A 1BRMA 4L57A 4DDMA 2ECKA 3CH8A 1ACJA 3K9WA 1W88A 1QONA 3O2SB 2BAGA 3CVUA 1IZ7A 3HACA 2XVAA 2O7NA 5AOAA 2CLOB 3OWXA 1XCPA 2QG9A 1A50B 3W1WA 1W4LA 4HB0A 5GAJA 3QM1A 4AJIA 3SP1A 4FZJA 2NO5A 3SHOA 1BE0A 1HEUA 3RYIB 4C1NA 5A4IS 4FILA 4R01A 2I6FA 5IUKC 3GOQA 4R1NA 4CIVA 4YDSA 5E9WA 2A5DA 3N0WA 5G02A 2PM8A 4DG5A 1AH2A 4EUEA 5DM2A 3Q9SA 3TZQA 1N7TA 1FVHA 3KNZA 2W2QA 1YVDA 4EUFA 2R1VA 3CXUA 2PIAA 4JBIA 3TLMA 1NG9A 4ZI7B 3JVVA 4B6RA 1GQRA 1ULHA 5FBHA 3F97A 3DPIA 5J5CA 3PX2A 2YWJA 4KQGA 3SYMA 4YUYA 2YBEA 4KKXB 1PQYA 4TKUB 4HADA 1DX6A 1WXQA 4GVLA 4Q3CA 1BHO1 1H2FA 2OD2A 3O21A 4WLNA 1QMPA 2M32A 3DFMA 1FSPA 3BTUA 3N6XA 1N2XA 2FP4B 1QTNA 4JROA 4XIYA 4KGXA 4I1PA 1HX7A 2O2XA 1JFTA 4C7OA 3GXOA 3IO5A 3QF7A 3LYLA 4ZAZA 2QJFA 2I5PO 1LLFA 4DKJA 1KU6A 2CHVA 1AU9A 1OXUA 1ZINA 3HKEA 1K97A 1KAHA 3I0ZA 3DP9A 3IVXA 1KYVA 4YALA 4YP0A 3G59A 4F3CA 1DV2A 2GHQA 4KQXA 1NUUA 2JB9A 3ZU5A 1RLMA 5FOVA 1J70A 1OX4B 1MNQA 5E6RB 4RGYA 1K6EA 1BWRA 1DC8A 1L5YA 1NSTA 3DMPA 4MB0A 4RVNA 3UYLA 3KUCA 1NUQA 4A26A 3CIFA 3N07A 1X1DA 4NE7A 3N2GB 3TDKA 1M1YB 1NZFA 1FNDA 3J80A 5F3DA 1UEJA 2NZWA 1WEKA 2QQGA 3DTTA 5CD9A 1GVNB 5E6PB 4KYIB 4HOPB 3ITKA 4JJGA 3E8MA 2P7IA 2JGKA 5E4YA 4H11A 4FNMA 1HG1A 2QL9A 3LHKA 3GELA 4ZMRA 5AKHA 3KOMA 3DOEA 3L5KA 4BNMA 4HVLA 3CHYA 4I8IA 2Z04A 3N0TA 10MHA 1X1AA 3MS2A 3OQPA 4ZTZB 5AK5A 3E5NA 3BK2A 1FIUA 5CGZA 1CF4A 3G5UA 4Q47A 1T2VA 2DULA 2NU6A 2G40A 1Q16A 3A3NA 3WGNA 3BULA 2FLKA 2X0NA 2FPRA 2AK2A 3CT4A 2BFCA 1D5WA 3UHPA 3PFGA 2AI3A 2PANA 3B3JA 5KYUB 4IIJA 3INTA 4M1MA 4GLLA 3G2NA 4B3JA 1BGWA 2WYVA 1OB5A 1Z12A 1GAXA 1YJXA 2H65A 3KU1A 5KKNB 2GSDA 5AXDA 1YZ3A 4DCVA 4AY3A 5JT1A 4C0BA 3DKIA 3I34X 4FOSA 4G0XA 1XTVA 3VKHA 2VJQA 4GGPA 2CV1A 4D8WA 5AW0A 4IDCA 4RVSA 5TS3A 1XYGA 3G5MA 1ZEJA 1G19A 3LBHA 2ZWMA 2Z57A 4I4NA 2V4UA 4LKRA 2KWIA 2QVZX 1RXUA 3FY4A 3IBGA 3FRIA 4KFSA 1R6JA 4HWGA 4ZICA 1SHJA 1MENA 2UVPA 2J41A 2XWQA 3O9VA 1XXHB 2BGKA 1C9NA 3MBOA 4CV2A 4BFXA 4MMZB 4X94A 1IU0A 3TECE 2CXHA 3FVRA 3VPBA 4V0KA 5L45A 4CEIA 1DO8A 1Q1ZA 3WTCA 1QYDA 5E38A 2FH5B 2J85A 4AS1A 3BJEA 3E9MA 4TPKA 1YZYA 2PLWA 1DAKA 2PRYA 2R5WA 5G3ZA 1B8NA 5IT4A 1JJBA 2YIMA 3JXEA 1PL6A 4XJVA 4Q9AA 1PE0A 1CQIB 3QYAA 4TYQA 4P2BA 4GGMX 1CVLA 2BHSA 2KMLA 2EWVA 1QTIA 2I3AA 3MWDA 4IXDA 2W6CX 3LS2A 5FKJA 2FSGA 4AXXA 3GUVA 1IHJA 2ECFA 2FG5A 2RC5A 2XWSA 3U31A 5AM2A 4NDZA 4XLLA 5DDIP 1VA8A 1X5QA 2OILA 3ZGVA 3F7TA 4C4ZA 1DB3A 3OQHA 1MO4A 1EK2A 2B8TA 3LHFA 2CYCA 3R7WA 1ETUA 2FWRA 2B1IA 3TTTA 4YUAA 4TXNA 3UB4A 2QKUA 2B7BA 5EMMA 5EY5B 3F90A 5HMMA 1NMEA 4NMLA 3P32A 4RH1A 3T5CA 3TSOA 3N6RA 3WLJA 3NWJA 5JS1A 4X5OA 1Z4QA 1H94A 2WYWA 7ABPA 1K7YA 2B8JA 3M34A 4M9CA 2JDID 5HKKD 4D80A 1B41A 1P2FA 2XTJA 4U63A 1RP1A 2QLLA 4OLJA 4M8LA 4WNAB 2I65A 4DV2B 1UPUA 3WJ1A 4M4SA 2LKDA 4QOGA 4BZWA 4DYHA 4EP1A 2GA9A 3BXZA 5JNTA 1N6LA 5IAAA 2YNMA 3RKRA 5JISA 1UKZA 4KAAA 2N1BA 1ZVQA 3LKZA 3M0EA 3GW8A 3MYRA 2ZLBA 4F92B 1TE0A 2O0JA 5LD2C 3BL5A 5JCOC 2B3TA 2V7VA 4Q01A 1RPNA 3SVLA 2W2LD 3GC6A 1TKRA 2ZSJA 2QKVA 3AOEC 3KYIB 3L7YA 5FLEX 2EL7A 1YBAA 4IMJB 3K0FA 3GEHA 4F3NA 5CB4A 3HBAA 1SOUA 1GLVA 2FWAA 1KFEB 1Q22A 3RSCA 3SJZA 5CYGA 1EQ2A 2H31A 3NJRA 4KO2S 5B3AA 5CFLA 3DHEA 3CRRA 1BO6A 2AMLA 3F4BA 1D9ZA 1TM1E 1S89A 3HN2A 2RHCA 2B83A 3U7QB 4HYTA 1TJ3A 4X6YA 2X2FA 4D46A 3G6WA 3GUZA 1W9HA 2WLSA 2BZSA 2ODWA 3CY6A 2WA1A 3BUSA 1O57A 221PA 3TMKA 4EX6A 2Q5QA 1KNQA 3ZW8A 2P68A 5T5QA 4XA8A 1HKUA 1OIWA 4HH4A 5T67A 4LFBB 1E2BA 1QXSA 4BJ6A 4MS3B 2M2IA 4GQAA 5AOBA 1UZAA 3SJCA 4DQVA 4DXHA 3M70A 4BNUA 1J06A 4EG7A 3ZU2A 5JRJA 3EXG2 2OKGA 4LMPA 2P8SA 2Q1SA 3FTPA 1V62A 2R1UA 3R8CA 1K4MA 4B2LA 1UBUS 2VHVA 2TRSB 2VTKA 3KHKA 3GJ9A 1IZYA 1TC2A 2ZYRA 4OQZA 4BLQA 3E9YA 5EI5A 4QOEA 2XE7A 4N40A 3DCIA 4ERXA 3DV9A 1G20E 2Z3ZA 2O7RA 4LY3A 4JAVC 1I51A 4OHKA 4Z4IA 9ATCA 3FOZA 4WKNA 3COZA 1TMGE 1V7QA 3SMVA 5BXYA 3GLFA 1H4QA 3AUUA 4RDCA 1QVVA 3OE4A 1J0AA 1T5BA 2I99A 3W2GA 2C9CA 5DXFA 3H2IA 4BMCA 5AOVA 3RFVA 1T15A 4F06A 5JVDF 1RRCA 1EUYA 2CNNA 4YBZA 4KR3A 3MAJA 4EF5A 2RI0A 2H92A 3V4PB 4M0DA 4JOJA 4H7JA 4BRUA 4D42A 3BPUA 4RZIA 5EJ8A 1QK4A 3QUBA 1V8ZA 4DDTA 5LKAA 3H2JA 1JPJA 4J29A 2PUHA 1DLIA 4TTVA 2YQ5A 1LBIA 4PZDA 4UW9A 1L5RA 2FPGB 2VEOA 3KT0A 2QBYB 4P5PA 4LHVA 2W8BA 2Y0DA 1JHUA 1J8MF 4FFOA 4GVXA 2QSZA 4BMZA 3WBBA 4ENPA 2G2LA 5I9SA 1DJPA 5SY4A 2PYZA 4MZXA 1OAAA 2GJKA 4FWBA 3CNNA 1CUEA 1ZZGA 4BIMA 4QUKA 2NIPA 5AW2A 1F7VA 2Z6AA 3KWLA 5ALJA 3Q9LA 1YRBA 1MFPA 3IO3A 1OBCA 4MVJG 4YC7A 5I8PA 3D6TB 3B12A 3C0KA 4R1UA 4HDMB 1WXXA 4HVAA 5JYEA 1GQSA 3JD0A 3TNJA 3P8ZA 2PS1A 2X41A 3RSSA 1QMGA 1EJ2A 2W93A 2J33A 2OB2A 3HB1A 3CZRA 3QEMA 5TS2A 3RIYA 4HV4A 5C8DA 3TFQA 5JQGB 2EQ5A 4WY8A 1EYZA 1SG6A 2HRRA 2HU8A 2X23A 1X2EA 2O0LA 3E7FA 4JASB 1C7IA 4ZQEA 3ZJYA 4YDQA 2C2OA 3STHA 1CZHA 1PT8A 1RLJA 2WHXA 3O4IA 4LNHA 4MLPA 4DCCA 5CPFA 3D54D 3H2GA 2A59A 3KJIA 1CG6A 2GZRA 3ASYA 4HF7A 1I30A 3RABA 1U99A 4JEIA 4L85A 3WRYC 4WTOA 4G36A 1MA3A 3G9QA 1X8XA 4L0QA 1FTSA 4MWOA 2GCOB 1GCUA 3O1HB 4K46A 1RCUA 3S55A 1HLDA 4F8YA 3TWOA 1H8EA 3CSDA 4I1YA 2CNOA 2BKVA 4IH4A 2XOXA 5GP1A 4Z0TA 1KYYA 1UZUA 3C43A 1EHYA 1VPTA 4I6JA 3EPPA 3TN7A 3WKBA 1O54A 5JTTA 4CTKA 2OORA 3PXBA 4MWEA 3D7NA 1QYXA 1EXNA 2IDKA 1CZRA 3SBXA 3OG9A 4YCLA 4YQYA 1PX2A 2XGGA 2R8XA 4KBYA 4DJJA 2HWXA 4BB5A 1IONA 4ZO7A 1SOWA 4Y9DA 1SKBA 2QVBA 3H1PA 4XQEA 4LWQA 2X9GA 1PJSA 4UNNA 2B1JA 2I78A 2JHFA 4IH1A 2XIQA 2OXRA 3G0CA 3ZHRA 4ZCTA 2JGEA 2IODA 2PSHA 2EW2A 4II2A 4AQDA 1OW3B 2RKWA 2GAFA 2CUTA 1AZWA 3I9MA 2WF6A 3CURA 4UQOA 4LX8A 5JZVA 4D97A 1TUGA 3J7TA 3V6MA 4BO2A 1FFCA 3WNZA 4J91A 4YAJA 4FZ5A 3EBOA 2JLYA 4GYYA 4NONA 1ISGA 5K8UA 2C3UA 4FDVA 4RD4A 5D86A 4MDEA 3FZGA 1QB8A 1W85B 1SXHA 4J49A 4XARA 4J7XA 3Q6IA 5TXGA 1TGVA 1UT5A 2VG8A 5EJFA 3UPDA 3DBLA 3HJRA 1UDAA 2EFYA 2RGXA 1ACMA 1U7UA 4WJKB 1V47A 4TWRA 1QIIA 3L93A 3CZAA 3MCUA 3PR1A 1TAUA 2QE7D 1ODCA 1NLYA 2P9FA 2FMUA 2NU9A 1A5BB 2ORVA 2Y8EA 4RA6B 1Z6YA 1NPTO 3NDJA 4LC0A 4PSCA 2VDUE 3H86A 4RV4A 5JY6A 1XEFA 3EGCA 5HFDA 4J1TA 4P7JA 1QVAA 2I7TA 3GEDA 4XKJA 4IIDA 3DVSX 3RSQA 5JOQA 2QTCA 1Y1LA 4FFBB 1QH8B 1WHDA 2WICA 3CUUA 1KH3A 3MTAA 1MB9A 1TUEA 2Z58A 2XCTB 2R4HA 3BILA 1Y4UA 3KKQA 3P0JA 5A5VA 3IKVA 3WMEA 5FPKA 4GL2A 3CH5A 5ESRA 2ZPTX 5K6AA 5DYWA 4EKYA 5KJFA 2BLLA 3C8ZA 4IINA 3C6YA 4KQ1A 5A4FS 2XDQB 1P75A 2D5BA 4LX0A 1MH9A 4RHUA 4RF5A 2YASA 3SM3A 1BA2A 4KE7A 1R3DA 1PUIA 1J9GA 2JAXA 1M5ZA 4MKHA 3RREA 3HXOA 2WW8A 2WKWA 3AILA 3RK4A 5BNIA 2XF2A 2VHCA 1ZVKA 4U9UA 5AKEA 7ADHA 3N8NA 2XQGA 2JIOA 2W37A 3GRRA 3I5MA 4X1KB 5HFFA 1DBWA 3ANXA 4B8ZA 4QU9A 4BQQA 2BJVA 1FU8A 1RRMA 1ULUA 3CH4B 4YAIA 1PEKE 1U8CB 1ESMA 2GJ8A 3NTOA 5IAJA 2AJTA 3V32A 4FFPA 4ZQIA 4OSPA 3PGXA 4KQ2A 2EJWA 4KH0A 3D0RA 2X5NA 2TECE 2BZ0A 4D5EA 1QZXA 1NIPA 1XA0A 4GBGA 3QELA 1HETA 1X8JA 1U2PA 2Z09A 2YMQA 5L53A 4RTNA 2OLKA 3G88A 4H27A 4TQGA 3UXHA 4CQMA 1KJIA 1S2IA 2Z1MA 1Q84A 4J76A 3ZTYA 4OQXA 1QTQA 1SHTX 2E2WA 5AI6A 4TX1A 4BC0A 4RK0A 4JVSB 3Q3JB 2Z5GA 4LC9A 4PWZA 1T9BA 2AFRA 2MDTA 4FR5A 4JOSA 2EW1A 4LPSA 2YMMA 4JI2B 4FVTA 2HREA 2DAPA 3QKSA 1Z0UA 4F7WA 4NBVA 2PKXA 4W5OA 3OT1A 2ERCA 2W90A 1S8NA 4O4LB 1JG7A 1SCQA 4E11A 1Z8NA 4EG5A 3UJAA 3WZLA 3AUKA 3PUZA 1GNSA 2HDWA 4OQDA 4JT2A 1CRLA 1FDRA 2CLHB 4M0CA 4UEOA 5DMXA 4YLYA 4YAEA 3M5CA 1P33A 3OY7A 3WB9A 5FBQB 4V1CA 3IEPA 5KYXB 2QGZA 2XMCA 2EEZA 1PV1A 1Y6RA 1GCGA 3DBRB 1I7QB 1RE1A 2Q9AA 3K2QA 2IYXA 3LGXA 2V5UA 3T7TA 4JCCA 2NO0A 3ZVRA 1A9OA 3BH7A 3WLEA 2GPWA 3N28A 1FRVA 2XMDA 2I7XA 4KMRA 3RAPR 3TEMA 1BRTA 3BRCA 1XMQB 3JQGA 3T5AA 1KGSA 3HRHA 4WNCA 1WSDA 3AB7A 3KDSE 3II6X 4QPJC 5G4LA 5TR9A 1XTKA 2QUJA 3GZ4A 4BTVA 2OZLB 3I6ZA 3FH0A 5B1DA 4PW0A 3ADKA 1JBQA 4FHFA 3GJYA 3BGSA 3NOXA 4O5OA 4X7MA 1SXJA 2VP4A 3F8SA 1A8PA 3FSGD 3WWDA 4WY5A 3SLGA 1YJBA 2AEFA 3EXHC 4M76B 2I8AA 1W8IA 2JXOA 4LSWA 4X61A 2XLCA 3K4QA 2ONZA 2UV8A 2E4YA 3VMMA 1ZRNA 2QIPA 2DXIA 4KFTA 2FCFA 3KG2A 1RPTA 4Z0PA 1R8JA 3QOXA 4Q9LA 2ZXUA 1JHOA 1KERA 1TM2A 3WISA 1G59A 1ZJJA 1ZCZA 3GLSA 4O4JA 3CB4A 4L72A 4RENA 1KK0A 1M3SA 1SO8A 2ZKIA 1WKBA 5CW2A 5JRDS 3C3CA 1K4YA 1R50A 4J0KA 2VJBA 3SFTA 1L2TA 5JYDA 3P0FA 3SYRA 1IHXA 5GOZA 1QIEA 5FLXA 1UZMA 1GM5A 2PIDA 2OAQ1 3AO0B 2PGDA 2PH7A 4XRGA 2I4SA 3TSVA 2BDUA 4EDJA 3VSBA 1A2OA 1N2CB 3U3OA 1SWWA 3TE7A 3DV0B 3WJ2A 1X8SA 3BK7A 1TAQA 1E96A 2E89A 2O20A 2PXAA 4RAOA 4TTTS 2FRXA 3H6KA 3KOWA 1BWPA 3BE5A 2W58A 2H4JA 2WP8J 4Q03A 3KZNA 2HBRA 1K3FA 3FGOA 4H6XA 4XWGA 3TVDA 3WAKA 4DCPA 2J48A 4LYAA 3PS4A 1BX0A 4PFJA 4V0QA 1L5HA 4YV2A 4RDXA 3WWOA 4V1CI 3AB8A 2Q3FA 3E18A 4ABYA 1VMAA 2RIPA 3KXLA 3IERA 4BECA 2XGOA 2NAPA 5BN1A 1ZJ6A 3DO5A 5H3CA 1LV8A 3MJEA 2UAGA 2XGJA 1GG5A 3IBSA 4ZYVA 3BEDA 1CPYA 2YFHA 3DT9A 4KWCA 4YLGA 1UP7A 3WYDA 2HWUA 3T4EA 3KQWA 2EJUA 3QPBA 4EL0A 1E94E 4REYA 4OP2A 5IYZF 3P5SA 4PCVA 4DV0B 4J16A 1Q91A 3LRXA 5EP4A 5BMVB 2O3SA 4FCCA 3R4CA 4XB2A 1Q7EA 1HI9A 4DR7B 1CLUA 3P0EA 4LXQA 3D8SA 4JXXA 1NJ1A 1V5GA 1NBMD 5L3ZA 5HFJA 3CLKA 1WMFA 3IE0A 3NETA 1CZKA 5E3IA 4MKRA 3ICEA 4CLEA 2JWEA 3OCUA 1E0DA 2ZIUB 3D6HA 3Q3HA 4P31A 3EX7C 4KR0A 3GL9A 3ZCRA 4DJTA 4TMTA 4MUGA 2HRDA 1TKBA 4JQZA 3FPEA 3KXIA 5HM6A 4LRXA 2A3RA 1NWHA 1ZSNA 4F5YA 3W8DA 1LDYA 1D07A 5CVDA 5G1OA 3LF1A 1IY0A 3SYTA 3VQTA 1D7AA 1N77A 4IIGA 4H2DA 5HF9A 2FLWA 3PDIB 1C3XA 2JAOA 2WM8A 1HNZB 2VYNA 4OY3A 1B23P 1CIJA 1SHUX 1IBCA 4D6XA 4C14A 1DUIA 3UWPA 4CQLB 4ML3A 1U0NA 1VIDA 5G41A 2NZ8A 1XV5A 1QV6A 1WA5A 4KJZA 5BSGA 2X7ZA 2M0VA 3K9FC 4C0HA 1KQNA 2GNOA 3ABQB 4YJFB 1D0IA 1X7WB 4WI1A 4BUZA 5JADA 4R1PA 5IF9A 2O7SA 3GYBA 3NHUA 5HHTA 2ZYVX 3H83A 1T3TA 4I4CA 2WEKA 1H2BA 4JNCA 2FF5A 3RC2A 3IH5A 2XVXA 1QOZA 4Q3NA 5FNZA 3T4UA 3WWCA 4B5KA 2Y66A 3PE4A 4KPYA 5E2AA 1TCCA 2LDXA 3I4FA 3PCTA 4R2ZA 2X0JA 3CCCA 4UE6A 1U4SA 4HNHA 2BFEA 2CJPA 4EO9A 3A1CA 4BGUA 4K9NA 1HC7A 1PU2A 8GPBA 4YJDA 3QPUA 4F72A 4QDUA 1BDHA 1H9BA 2ZR7A 2C0QA 3ANYB 3W04A 4G0WA 2RBEA 3B8HA 3DV2A 3PVZA 5B3JA 4P86A 2JFYA 5IAEA 2CCKA 4KBFA 3D8NA 1I92A 2Q3BA 1Z0FA 1ICEA 3TIFA 3BRWD 2PYDA 1MOQA 1PYGA 2GF0A 3KYJB 2QPTA 4IW3B 4EB6B 4IKOA 3MWEB 4D3ZA 2ZT8A 2BISA 5CM8B 1U31A 2NZXA 3GNTA 5CX4A 5DHTA 5J2UA 4CLRA 4FN5A 3NBKA 4K28A 3WOHA 5D1NA 5TT1A 4AC9A 4DA6A 1PTJC 1U2DA 2VH5R 4XSHA 3WGVA 5HRAA 3PFFA 4URZR 3C45A 1LQ2A 1Q1GA 1T6ZA 2QQFA 2CD9A 3ICVA 2IOYA 3KR2A 3IPCA 1CXZA 4OJNA 4ZVRA 5LA6F 1KR2A 1Y5LA 4HSEA 4HWRA 4E1BA 4M8SA 3W9YA 5JJIA 5DHSA 2PY6A 1BZYA 2RHBA 4JZYA 1RAAA 1IWOA 4K9QA 5A2QA 1RJ9A 2FOIA 3O1LA 1O95D 4BV3A 1A3CA 2G82A 2HFKA 2P2CA 3T5BA 1P0IA 3C70A 3BH0A 1YB5A 4LOAA 2FWNA 2QVXX 2DJTA 4NAHA 4EJMA 5HFBA 3DIWA 2O52A 2J3KA 4UEJA 3BB3A 4BATA 5BP7A 3WFIA 1D04A 1U37A 1DTWA 1FRQA 2ZIAA 3USZA 1X7HA 2AN9A 3LOPA 4DSUA 5KMGA 1X7XA 1IBLB 5LZ8A 1RWWA 1BH6A 4TVSA 2YT8A 1W4AA 4TS3A 4YDPA 1B3BA 1SZJG 4LJ5A 1D7OA 1Q0PA 4F9TA 3AF5A 5LQNA 3EW7A 4AKHA 4IV0A 1I14A 2FN8A 4OOEA 1RKXA 2JGAA 1PG2A 1DARA 1DAMA 1HT2E 3IEUA 4ALLA 3WNVA 2FAXA 1FY2A 2REXB 3AZOA 3E0QA 4TVBA 3S5UA 1VL2A 3O8RA 1KY4A 4K1XA 1Z28A 3EMDA 1JE0A 1ZYUA 2KM1A 2PR7A 2H18A 3OD5A 4I08A 4MS4B 3BE6A 3OSUA 4MV7A 2VJOA 5EE3A 5KINB 3TRIA 1Y7LA 2AMFA 2WT4A 3W4KA 4I2NA 4FB5A 4XI9A 5AI5A 4YLEA 4B45A 2PEYA 4RMIA 1A77A 4IC6A 1CTQA 1ESEA 3JYHA 4CR8A 3ZDZB 3AW9A 3LBYA 3NJ4A 3HEMA 1B6GA 9GPBA 3EH2A 4XUCA 3LOUA 1SXIA 3PK0A 1CQZA 5KEIA 2W8ZA 2HHAA 2WWXA 1R18A 4HNRA 4D74A 4DJFC 1RY4A 4G5QA 5K3FA 4FBGA 3WB2A 1JALA 1W9OA 2VT7A 2XVMA 3B6JA 4AX8A 3A7DA 4RK1A 1LJLA 1SCKA 2D1SA 2VNSA 1TP5A 3GFQA 4OH1A 3TQSA 4A23A 4G86A 4EI2A 3DMTA 1TEVA 2PL5A 2G1KA 3I04A 3T7KA 4MEAA 2H17A 3PEFA 2IT1A 4G25A 4QX6A 2GJ4A 2GBLA 4UM5A 1L7XA 2PZFA 2GR9A 3AP1A 4UUAA 5HOEA 2DR2A 2H0QA 2W6OA 3ZWCA 3KKKA 3ZG6A 3SIXA 2G5TA 4O4HF 5HBRA 1N4AA 3WBJA 2GCIA 3RAJA 4F3RA 3AF3A 5LLDA 2YJ3A 1DBQA 2PX6A 4EUKA 3NM4A 2X0KA 4I36A 1C8LA 5J2TB 3M3DA 3ENNA 3RUHA 1M54A 2OVBA 4PANA 3EEBA 3IPXA 3QG1A 3D6NB 2BGIA 1MU0A 3VX3A 5T4HA 3FR8A 9LDBA 1I5OA 4JJ6A 4N8DA 1VA5A 4HGPA 3VMFA 3L7BA 4BEWA 3A6EA 5MHTA 5CIYA 1GR1A 1ESNA 3E8XA 1GUDA 4RQAA 2GNPA 5GJWC 3VZDA 5KNDD 3T3IA 4ZZ1A 4D8UA 2DFKB 3OURA 2XMZA 3SOPA 1JHVA 1JP7A 3JVEA 2IJGX 3T5TA 1QOPB 3F0TA 1QTRA 3P2YA 1ZVMA 2V4MA 1AKEA 1QVZA 1IH8A 4ZO9A 5BW4A 4F93B 2P40A 3OQIA 3ZY4A 3AL0C 3LHDA 1AK1A 4EGAA 3GT3A 2H1CA 3CT6A 4XM0A 5HMLA 5B4TA 4BX8A 4OH7A 1OI2A 1VRWA 1EFAA 1K9VF 1YFZA 1AO0A 4URYR 1Q7BA 3W6NA 2YJ4A 3U9TA 1X38A 1ZD5A 2GNAA 3KD3A 4UFPA 3EZYA 4CMJA 3OLYA 2UZ1B 4ETIA 2IE0A 1RD4A 2Z2IA 3D6VA 3TJMA 5CAEA 1W5EA 3GLRA 3BF8A 5CB8A 1ZD4A 1OX5A 2D92A 1ENOA 1Q21A 3L06A 4AJKA 2CSJA 3TVTA 3LM8A 4BV2A 4YO7A 5EQDA 4FJ2A 4B9EA 1LXCA 2VFAA 4GBJA 2HPZA 4NFHA 2IUYA 1L4HA 1PZHA 4DVGA 5A9RA 1EVIA 2Q0HA 4AJEA 5ADUS 1BD3A 1U0GA 4OFZA 1B0ZA 1GDTA 2HO5A 1NPYA 4KPUB 4P22A 4YRFA 3F96A 4DVJA 3OQVA 4Y2YA 4CI0B 1UPBA 1SNYA 2AFHB 2QX6A 4MPRA 2KYLA 1V8DA 2CSXA 4X97A 5BWCA 1D5GA 4A1OA 3C5WP 1R4NA 3RRFA 1XEXB 2BYGA 1H1DA 2I4OA 2JJQA 4L4RA 1E0KA 1MG5A 1WQ4A 1YKFA 4MUAA 2PKQO 1ZLXA 4Y30A 1R0KA 5AQ1A 2D5IA 1VXRA 2WFZA 5JBNA 1Q6YA 1JLRA 2D7JA 4FLNA 1HL7A 4J90A 4MV4A 2B35A 2DQ4A 2FJPA 2FGJA 2ZBQA 2YJZA 4KWEA 1R4MB 1U9YA 5ANRB 3U4MA 3B1FA 4E5DA 2AWNA 1ADBA 2WL7A 1N3IA 4G4SO 1W0KA 4P34A 4TSKA 1ZM9A 1RKBA 3MGAA 1CDOA 4KXYA 3TW8A 4YJ3A 2UZCA 1JECA 2C95A 3LUKA 5TLSA 5JS6A 1EXVA 3NANA 1WHAA 2EWWA 3IDQA 4DCUA 4WZ6A 2FHPA 1TD9A 3CISA 5LQRA 5AIAA 1T5TA 4MUJA 5HP4A 3M9XA 3N74A 3L7NA 4EGQA 3P45A 1QH9A 2CNWD 1ENPA 1PR1A 2WG2A 3FGNA 2VJMA 3MJDA 3R5FA 1CS4C 1NJGA 1Z2PX 1GGJA 5E11A 2FSUA 1P9OA 2YZ7A 4Y6PA 5ALTA 1SCAA 3KWMA 4XQ9A 3RRXA 3PL5A 4QVKA 2C7BA 3IT1A 2H1IA 4OA5A 1U7TA 1JDTA 3AV0B 2PZKA 1E9BA 4J4BA 4MYUA 5K1ZA 2WJ6A 2YXDA 3CH7A 2X3YA 4UOZA 3AL2A 1CETA 2WUGA 3RV3A 4BO6A 3Q7RA 1BAPA 5HDBB 1FNBA 3W06A 4UVDA 5JDCA 1J0EA 4A15A 4QOFA 2O2TA 1CUIA 2ZE8A 2XOKD 3EVEA 3SYNA 3GLUA 3PWZA 1DNPA 4E35A 2DH6A 2I62A 3ZDCA 3T5GA 1UBEA 1W36B 1GN8A 2C4KA 3AQIA 4HX2A 2NZYA 4WK4B 2EAUA 4JR0A 4MLZA 3CPJB 3EUWA 5U1PA 4JI3B 2ZB8A 2AVNA 2DE0X 2PMKA 3FPKA 5D7NA 2IPOA 1LJUA 4DC0A 4FBLA 2XWBF 4PZ9A 1PD1A 3PQFA 4CL8A 4LJ6A 3I30X 1DBRA 1KY5A 1COWA 3COYA 1YR2A 1Y42X 1UBLS 1X80B 1ZJYA 5DGHA 3GGSA 4PRKA 3DEZA 2VHJA 2C42A 1YS1X 4BO0A 3DB1A 1GGFA 1RP7A 5DI3A 3MHTA 3W3ZB 4O6VA 2H1SA 4L0MA 4CXMA 2DUWA 2C5BA 1TNDA 2PRSA 2Y0CA 3FPAA 3I23A 3C3BA 4XR9A 3S44A 3O8NA 5TT0A 1LGYA 3D9QX 4HK4A 2DJ5A 5NULA 4PC2A 3TK1A 4YHBA 2Q50A 1MQ8B 4R1TA 4I50A 1MVLA 3OMWA 2ABWA 2YH2A 2I7VA 4IM7A 4B34A 3TQQA 2YV2A 2ZWIA 3SKXA 3GT4A 4L75A 3TAUA 2RB4A 2XX3A 5GLJA 4HD8A 2A14A 3PLAE 3UAWA 3OPXA 4BIIA 3DZCA 2D8IA 1WDTA 2OV6A 4C4XA 3L4FD 1L7PA 3KVOA 3DM9B 1JIQA 3K0AA 5I47A 1PYOA 2FI1A 4JODA 3DQQA 5DOZA 5C7IO 2GO1A 3UA4A 3MMNA 4FHZA 1XMVA 2F8LA 1U1FA 1U0FA 1ZKMA 3QJGA 4W9NC 4DUZB 4OUKX 1UINA 2O3QA 2C88A 2C97A 3N2ZB 4MO9A 7MDHA 3DDHA 4HB3A 5KAPA 1QHNA 1Z9BA 1NDHA 4Y2JA 3NU1A 1KEVA 4LVOA 3RS4A 1II8B 1X8KA 3EZFA 4HB4A 5EIBC 2PMFA 3RYHB 2IX3A 3RF6A 4ARBA 4RXTA 2P6UA 4HTFB 2Q5IA 2WHRA 3G13A 3HWSA 3OX1A 2RB5A 2FWBA 3D2LA 5AM0A 4AP5A 5KJCA 3OZFA 5PGMA 4E88A 1T24A 4XE5A 2B7CA 1QFJA 1YCFA 3ZVMA 3PX7A 2PBZA 4ND8A 4DGQA 4DSOA 3IJPA 5AJZA 4PICA 3JTEA 4ESEA 3DEFA 3BJMA 2EJTA 3GEGA 1S8FA 4JLVA 1LPAB 2J9RA 2AQHA 1R6DA 2KSQA 2FQXA 3RSGA 2RAVA 2QD2A 3CTMA 5JV5A 3NKVA 1HXHA 2UZIR 2KV8A 4QJBA 4CZ2A 2Y0PA 2DFVA 5JZBA 2ID4A 2HEGA 2P5SA 3GH1A 1TJ5A 1KOJA 2XV1A 3AVTA 1I01A 1SXGA 4C87A 3AUYA 5DE3A 1MOSA 3FYUB 1S4QA 4IGFA 4QXAA 1ZBQA 4N5HX 2QIOA 3DSRA 2WM2A 3G7UA 1YXMA 4BFTA 1UCFA 3QWIA 5EZ0A 3IAHA 4M1SA 1N75A 1ZD3A 2D5AA 5A2GA 1Y1RA 3P2EA 2R8YA 5C34B 1M76A 4PRYA 4K03A 4FGUA 2KJPA 1CS0A 1Z39A 1VQ1A 1M8KA 1QR6A 4YRJA 1JDJA 3U3MA 3NHZA 3OHSX 3OZVA 2IS4A 5BQ3A 4GYJA 2VDMB 3GCGA 2AOXA 1N5DA 2ZTHA 4HNUA 3NPMA 3CNEA 3LLUA 4RLFA 1G2OA 4LDZA 1Q0UA 2WJVA 1HFWA 4F1WA 2E18A 3OKPA 4Y2SA 1YBOA 5C1OA 3DR5A 3ESCA 5AW7A 1FNSA 4TTJA 1V6AA 4CEJB 2CJXA 3QVXA 5IK2A 2YTZA 3ECSA 3JAKA 3VC3A 4A0RA 2YYZA 4LPKA 4Q4AA 1J5PA 1JYFA 1QE0A 5EYPB 3A1SA 3E9QA 1NU8A 3A26A 3JS5A 4RMNA 4YMTA 1F2VA 3LVBA 5EIFA 5AXBA 1XK6A 2VRWA 2BMWA 3ZVKA 3HXTA 1I2CA 2VHQA 1IK4A 4EH1A 3ET5A 5G1NA 4HXGA 4DRXA 1GEEA 1ZGGA 1QFXA 1OHHA 1S4MA 2QD4A 1Z4JA 3PUVA 4NC9A 3VVMA 3HADA 2GTPA 3O3OB 5BWLA 2OAEA 4N7BA 1BC5A 2QAGB 2CZCA 5CNMA 2WAMA 3ESYA 2H4YA 1U28C 4B83A 4GZ5A 2JNWA 4L2IA 3UG7A 2QU7A 4NPHA 1OAOC 4BRZA 3IAEA 4FSXA 2FFHA 2R751 5JO0A 2E4AA 3JARB 1G8GA 5AR1A 4UXHA 1R74A 3T52A 1P9RA 1X7YA 1E1LA 4IJQA 3X2FA 1S2OA 3H9EO 4TXLA 2OYSA 3JRNA 1TQ2A 2V5AA 1UAYA 4GLFA 4BX2A 4L28A 1P73A 3OFVA 4RK4A 2NU7A 1ILWA 1DWUA 3EGHC 1GZ4A 2ZBUA 4MVCA 1BGVA 4F2GA 8MHTA 2ZAGA 2DCUA 2XUPA 4QDKA 1I7NA 3DE2X 4C1BA 1RWMA 1WU7A 3PSHA 2VWHA 4PZLA 1E0AA 4O3MA 2O2CA 4HAVA 2WF7A 4LYJA 4ROTA 3WKDA 5FNVA 1MJGM 1QHHB 1XZHA 2HIHA 4MRRA 3EIQA 4O2AF 2JANA 4LVCA 4OUDA 4G1CA 4P53A 4K2HA 4C03A 2DT5A 2ZWAA 2ZE6A 2IXAA 4MQ5A 3S7ZA 4LSGA 5LIPA 3HQ4O 1PQUA 4QGHA 2ZZKA 2I6TA 4IV8A 2NMVA 3JQFA 4DLNA 3IV7A 2MMCA 2Z2KA 4Y7DA 3T95A 2R3SA 4MZDA 5HCNA 4Z4CA 5ISMA 3VGPA 3K6SB 2P0EA 2VF2A 4MH0R 1J1ZA 1XZIA 1PJQA 1UMBB 3E2PA 4KSBA 3DT6A 3A3OA 1EINA 1HZZA 1WMBA 2N42A 3GY0A 4PAQA 4A73A 4S05A 4E15A 4MPAA 4RI0A 1UMDB 3BKWA 2ZJZA 4RTRA 4QKQA 3Q41A 5HXAA 4NS1A 2RGAA 3IAS1 2NV2B 6PFKA 4YJ2A 4W4TA 4C0SA 3CVXA 1JJ7A 4BP1A 4RQBA 1LS1A 3RK1A 2A6PA 2ZWPA 3D8RA 4INAA 4X7BA 1BDMA 3GIDA 3CNLA 4K2AA 2G1JA 1OI7A 1WHTA 3R0HA 1HRKA 4WAUA 3VR3A 2JH9A 3L6CA 4O2LA 1HKHA 3ZHBA 4ALMA 2I8LA 1V7PC 3PGVA 2SKEA 2REQA 3ZBQA 1T4CB 4E51A 1Z4PX 4FK8A 4IOMA 5K7SA 1P2TA 4CQNA 3CQ9A 3GEBA 1BCSA 1XJ0A 2GJSA 1D8AA 2PRJA 1EE2A 3CKLA 5E7QA 4DR2B 1FOEB 1ZBDA 4OJMX 1T10A 3SJ7A 1SGWA 4QQ8A 5C4MA 2ZZNA 4UD2A 3G2PA 1YONA 1JQJC 1VHWA 4WESB 2OB1A 4BQPA 5ICCA 3I32A 3IIJA 4G1FA 5C8VA 5K99A 1F4PA 4DSTA 3DXZA 3H5NA 3RWMB 1ZH4A 2EYQA 4EVSA 2B0CA 4ZYZA 3LCMA 1DX4A 1V96A 1BEZA 1DXHA 2G5GX 2QQEA 3BWCA 3EXFA 3GVCA 4MCAA 2H08A 3JZFA 1V45E 1MOPA 5EPOA 1R4AA 4UKDA 2YOFA 4JQYA 3A4MA 2R62A 4BQNA 4R1MA 1P1RA 2X3FA 3FOAA 2HN9A 3PI6A 4FTWA 5ILOA 3PNPA 1Y6FA 5JS2A 1DXYA 5KIAA 5KQGA 4IDAA 1XFAA 3KRTA 1WB6A 3GGPA 5D3QA 4B6FA 4CCAA 1M2EA 2WF8A 3CCFA 8ADHA 4F91B 4UXIA 1XKTA 3VPAA 2B6NA 4M1KA 2BJWA 2YN0A 2FWPA 2FP3A 4IDNA 1NM5C 3P20A 2WHPB 2J3DA 4F4IA 1XLTA 2QJRA 2ZI9A 2JZNA 3B2NA 4AU1A 4QIHA 5AQEA 4A8JA 1AXEA 3VHXB 3HCCA 2JI6A 1KORA 3CVWA 1WIFA 5F1KA 1J25A 1G41A 1U1DA 3X2EA 1XKXA 5JVDB 1NVUQ 3TBFA 1EI9A 1I4EB 3ZGYA 2JLBA 1HMPA 2WD8A 2AZMA 3BBPA 4NFYA 1L8LA 1SEPA 4UBMA 4YXWD 1JE1A 3FZQA 5KDOA 2P6NA 1UJVA 3F6EX 4NMWA 4TSFA 2FPOA 2HCTA 3QENA 4P4LA 3FMPB 3PC7A 4Y6SA 1ZW6A 2ACVA 5FTNA 1UMKA 4S1NA 5EKTA 2I33A 4IRUB 3GLIB 4MHSA 1UFQA 4QPCA 1DJLA 1FNCA 3QXJA 2AWOA 3OOWA 5LXTF 1PVOA 3BMQB 4NE2A 3FTNA 1S01A 2YV5A 4PXSA 5EXXA 4MINA 4ER6A 1B8UA 1UM1A 1XQXA 3BB1A 1NRIA 4BNDB 1L6OA 5HS4A 3PPYA 1UITA 2FXIA 2I0IA 2WKQA 2YCLA 3GCNA 1QHXA 2QMOA 3DO6A 5A62A 4ZVPA 2G0TA 1TB4A 4CCYB 1L4MA 1IU9A 3I37X 2FPUA 2AI1A 4K72A 1Z5GA 2JA2A 5FUBA 1IRXA 3HDHA 3BG5A 3QV2A 3PA6A 3PD7A 4NENB 4Z7QB 2NP7A 4DZZA 2HXGA 4OG2A 5GZ1A 1GGMA 2ZS8A 1E60A 3VC7A 5A6SA 2QTHA 2BSXA 3ISTA 4S04A 4XDHA 4X62B 3LJKA 2EATA 2I03A 1SB9A 5B7PA 1H9AA 1HFEL 3GGOA 4W7IA 2DSNA 4Q24A 4H16A 2L18A 3U4DA 4Q4HA 1Y5MA 3RK0A 2CEKA 4PLYA 2EAQA 1NQ5A 1JXAA 1XTIA 3QMPA 3SF8B 3J81k 3K7EA 1SELA 1Z82A 1KOFA 1NONA 4UNSA 3FIUA 3UT5B 3ZLUA 5HRCA 2O8FA 1I3NA 1C7FA 4YASA 3D0KA 4F8EA 5ICEA 4DIUA 4ZVQA 4NXRA 4L22A 4LY6A 3B6IA 4ZVOA 3MPUA 2WG0A 3DZGA 4LAFA 4R5MA 2O2IA 4FYYA 1GG8A 4ENUA 1NT4A 2CDAA 1NSFA 1BQ3A 4FOPA 5FH9A 1K9SA 3RLFA 4MQEB 2VZ5A 3ND5A 4ICIA 2P9GA 2QP4A 4QE3A 1PJ3A 2C57A 5EJGA 3KUKA 2XCQA 3RU7A 4RIGA 2CDBA 2PUBA 3JWEA 2X77A 3HJCA 2Y92A 4PYMA 3IR5A 1TW2A 4JJFA 4EHNA 3ZU6A 4I14A 1C8BA 3ERCA 2KOMA 1W19A 4RJIA 3GEEA 3AEQA 4ILKA 1JR3E 3UV3A 5C8XA 5LU8A 3QX3A 3FM9A 1L7EA 2XNKA 1JT2A 3RFCA 5A0VA 2A30A 4RFSA 2DC2A 1WQ1R 2WJWA 4ZEMA 1BQEA 2DVMA 3I3OA 4TMZA 5TF0A 1H4SA 3ESXA 2QUHA 1YNSA 3B7PA 2R1TB 1HSOA 2EL9A 1N7HA 3N2KA 2P41A 2Q6VA 4MKXA 4X3PA 3I61A 1FXWF 1T5SA 3ZNNA 2NUPA 3AH8A 4YRSA 3OD1A 1EBBA 5KJ6A 2NADA 2R6CA 3NASA 4DCNA 3HTXA 1QCZA 3OEHA 2C5SA 3NAZA 1REQA 3E22B 3U0BA 2PTHA 2H3MA 4EGSA 2X5OA 1FFDA 2BI4A 1QKKA 2DPHA 1Z6XA 2HQBA 2N47A 2RSLA 3D1JA 4XQCA 4DABA 3F73A 3B2EA 1JHDA 2I3DA 2VH2A 1TPZA 3DTVB 4G81A 3VYTB 3BGOS 2V7QD 1PBTA 1UL1X 1T36B 3LT4A 3QKUA 1BXRB 3I6YA 5CBKA 3UAXA 1G5FA 1P1KA 4DWVA 3HB5X 1CUFA 1UJMA 3OF2A 4PTZA 4RHCA 3AVVA 1Y5RA 3I09A 4JS0A 3OFND 3ZWOA 1RYBA 4B5LA 1U1CA 3A3YA 4W6QA 4YT8A 4QUDA 1RHQA 3IURA 2Y67A 1ZM3A 4P3YA 2OHXA 3FUXA 1WE2A 3UWMA 3ZK9A 4ZCQA 4PQEA 4AWAA 1K0FA 3LK6A 1EB9A 1DGQA 3LO8A 3ZIUA 4CT0A 3AM3A 2C20A 4J2HA 1WQ3A 1MUUA 3SPXA 5LVAA 3QO6A 4L5IA 3RRZA 2BGLA 7GPBA 2QX7A 5HF8A 2CUZA 3R0XA 5CM9C 1YHYA 1ZXLA 5FOUA 3UMMA 3RIMA 4B47A 5EVCA 4PYQA 2CKMA 3BN3A 4WV3A 4UTRA 2OXEA 2QROA 1A9XA 1EM6A 3E3MA 1TT7A 2IEZA 2P5YA 2VYCA 3LU1A 3QQPA 4KK4A 3R69A 2PKQP 3WNQA 1EUCB 4RVGA 5CVEA 3ZX4A 1ZGZA 1H0SA 1V4BA 4W5WA 4YRAA 1G2PA 1DHTA 2L4SA 2C5EA 1TA4A 3BEOA 3FVWA 4ZYWA 2XRZA 4MGEA 3PVCA 1IM2A 1YVUA 2FSIA 1J00A 1FDIA 1U9CA 1UQUA 2QNIA 1KJQA 2WDZA 2XWPA 3EIOA 3EARA 1R4ZA 1FYVA 3BXPA 3GVIA 4WN3A 3WNCA 4H0FA 3H5IA 1PTKA 4TT3A 1NVEA 4CG2A 5F3XA 1FRFS 1WUHS 3D7MA 4ZV4A 1GNTA 4L15A 2VI5A 3K6JA 4N49A 4ZAFA 5IEBA 2ZAOA 4E22A 3C24A 1COZA 2FPKA 2AF3C 3VJKA 3SR3A 5SZJA 3VKWA 3GLFE 4R16A 1XE3A 1GV0A 2JKZA 4GSLA 1PGPA 3MUOA 3RJTA 2VPXA 3DXFA 3A31A 1F4LA 4JKOA 1NNUA 4RPKA 4ZODA 3RFUA 1CU1A 5TMBA 3HPRA 5EIEA 5F7OA 3DLPX 3RS8A 1RI2A 3T3OA 2QN6A 1R0RE 1DQSA 2FWMX 3TCKA 1UFXA 4ZYTA 4IHQA 4B84A 1G6OA 1L5QA 3QY0A 1MIOA 2EZTA 4CKBA 2Q4TA 3PC2A 3JALA 4Z6KA 3KV1A 4X65B 2I1VB 1DAOA 2I2DA 5JSYA 3GN1A 3SG0A 5I7FA 3CS3A 2JOAA 4EBFA 1JZSA 1N1DA 2HYDA 3HI6A 2FFBA 4PC3A 3RTEA 1DVRA 3SOEA 2WE7A 4MA5A 3PRHA 4LZNA 1I10A 3A4NA 2VLBA 3GZTB