2GEFA

Crystal structure of a novel viral protease with a serine/lysine catalytic dyad mechanism
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
211
structure length
198
Chain Sequence
DLPISLLQTLAYKQPLGRNSRIVHFTDGALFPVVAFGDNHSTSELYIAVRGDHRDLMSPDVRDSYALTGDDHKVWGATHKFNVKTRTDLTILPVADVFWRADGSADVDVVWNDMPAVAGQSSSIALALASSLPFVPKAAYTGCLSGTNVQPVQFGNLKARAAHKIGLPLVGMTQDGGEDTRICTLDDAADHAFDSMES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protease VP4
publication title Crystal structure of a novel viral protease with a serine/lysine catalytic dyad mechanism
pubmed doi rcsb
source organism Blotched snakehead virus
molecule tags Hydrolase
total genus 53
structure length 198
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2006-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.30 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2gefA01
3.40.50.11300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gefA02
2GEFA
chains in the Genus database with same CATH superfamily
2GRJA 2YYYA 3BB3A 4HEQA 4RVCA 1T4DA 1F8FA 4IKOA 5G1NA 1Y42X 4E5SA 3I05A 1N7EA 3EZNA 3LCCA 2HQ1A 1DQRA 1JFRA 1Y89A 2BP7A 5CEEA 3HU2A 2WSMA 2PRKA 3K9HA 3NBZC 3ZD9A 1X7WA 2RK6A 2WSYB 1K8YB 3KCQA 1BHSA 2Z1MA 2ZBGA 3KTDA 1CZLA 1L5HB 1KI8A 2HCFA 5FADA 4CCWA 1CUJA 3DLHA 3G13A 3IT3A 2PAFA 1XDZA 2IPOA 3KRTA 5A1JA 4P4NA 1HDRA 3O3CA 4UTVA 4AKHA 4PWYA 4A6DA 4BPBA 4X1OA 3CFYA 5DP1A 821PA 2E1RA 1CFJA 3NONA 2UVPA 1WW2A 2ADOA 3IP5A 4KN8A 5CYOA 2A6PA 1ZFNA 2A86A 4GLLA 2P8JA 3L04A 5AIBA 2QXYA 4JI7B 1TW3A 3ADDA 4XYGA 4YAWA 4XI9A 3T9FA 5HGXA 3ZNOA 3JV7A 3IMFA 3ROGA 1O77A 1NXPA 3G9QA 3U1TA 3M1IA 4L08A 2V6FA 2AKEA 2OTCA 4IBOA 1E4OA 5ESXA 5KSWB 5J2UB 1DOZA 4RFSA 2LDBA 3UWKA 4F3KA 4TROA 2J67A 3OMWA 3ZCXA 4JNCA 2ZBUA 1I6LA 5CLFA 4LCEA 3V1YA 1ZRMA 5FTKA 2QRNA 1F6BA 2BUCA 3ZHRA 1GSAA 2NPIA 3MG9A 5AW9A 3Q0TA 3CKLA 1GQYA 3LGAA 2GOYA 2OAGA 4OQZA 3KT6A 3R8XA 4B1FA 3TGLA 5KTNA 1C8KA 1JHMA 1YAHA 3LV8A 5BVGB 3LUCA 4BTEA 2VA9A 5DTIA 3AOEA 4ZXFA 3V46A 1ATIA 4D4MA 3S68A 2XHEA 3VO8A 1PJZA 4CMKA 4JU8A 1HNNA 5A6VA 2VEOA 2QT1A 2NSLA 5KX5B 4AP6A 1TTHA 5I4CA 4UU7A 3P9PA 5ALWA 4MUGA 4UMFA 2PUCA 1FU8A 3NHYA 1S2LA 1ISSA 2RG7A 4ID9A 3MAGA 4JYBA 1PR3A 2B35A 3NHSA 4RFLA 4OI1A 1UJ2A 3RVRA 2D90A 1DFGA 1SVIA 3GPBA 3G1TA 1CQJB 1M6VA 4RYDA 5K6AA 2ZXEA 2P9EA 4YP7A 2VG8A 3B2QA 4RFVA 3WK4A 1U8TA 4KMMA 1HKHA 1V7ZA 2OESA 5SYNA 2XDAA 3ZZTA 2QF7A 5BSTA 4AY6A 3GBPA 1R6BX 4UBMA 1TE2A 1UT8A 2B25A 4NTZA 5HF5A 2ENWA 4EB6B 3HTXA 3GR6A 3A05A 1JVSA 4REQB 4XRGA 1R6VA 3MS7A 1EFVB 3AF2A 3AFOA 4TTJA 4UQOA 2XT6A 5CHYA 5JD4A 5HM6A 2Q27A 4HDRB 4Z53A 4UXHA 4YTEA 4BFUA 4QG3A 3AM5A 1U0JA 3LOUA 1QOQB 4RPIA 4ZVPA 3E03A 2HT1A 2IWNA 2B7LA 5HFAA 3W9SA 1TJ5A 1P4AA 2LTAA 4HI0E 4RMGA 5EE5B 2EEJA 5F5XA 3RHFA 4AS1A 1I2CA 4JCOA 3QTTA 5F3DA 5A02A 1ZUNA 1EWTA 2E55A 4J8PA 3TR5A 4I99A 2BC9A 3U7GA 3A25A 1CDDA 3C3JA 3KTFA 1ZOOA 2G17A 3IQIX 4DOMA 2OHXA 4F4CA 3BN3A 3QVUA 4A92A 4IG9A 3W4JA 2BGNA 2D06A 1CNFA 2YY5A 3I6BA 5KYXA 4A8HA 4BNUA 1CBUA 4HB0A 5BXQC 1E64A 1POXA 2CWDA 5JMTA 3IUBA 4ETIA 1MRNA 2R1VA 4B4VA 4E3ZA 2CXHA 5BR1A 5CXQA 3W3AH 3WGMA 4AF6A 1P31A 3TUZC 1PWXA 4HH4A 2MSWA 2Z9CA 4EG7A 4EEXA 4NNPA 2ZIFA 4UUOA 2VP9A 4AWAA 2CNDA 2GBLC 1K06A 3A3NA 4QNNA 3WMFA 3KNZA 5IUKC 3V5NA 1TEZA 1KEFA 2WE7A 4DLRA 4MHSA 3JR3A 1IU0A 1P1JA 1TB4A 3QLUC 2QENA 4V0LA 4OU5A 1ZD3A 1HT2E 2JXOA 1TX4B 4TTSA 2RGXA 3CF2A 3G88A 1WIFA 4QDKA 4FWTA 5G02A 2FZLA 5DBEX 2Y1DA 4JI0B 4KR6A 1VCMA 4MIOA 1DC8A 5K0FA 1W49A 1ZGAA 4OHBA 1AKMA 3WR5A 1G4UR 1PZXA 4IS2A 1E9RA 1C3OA 3A9CA 3TD9A 5TARA 1ZM4A 3A3PA 5KOJA 3VNVA 2O0JA 1U5CA 4AYWA 3U4MA 4B8YA 4C7OB 3OJWA 4JMPA 5FB8C 2BD0A 3VPGA 3LT2A 4YJKA 5CP8A 4YX9A 2JVJA 1VYTA 2YXDA 1YQXA 3AI3A 3VH1A 4H17A 1NOJA 2NVUB 5CB4F 5A2QA 1VG1A 2DGDA 2W2OA 2F64A 2CS5A 4TSFA 5AJXA 4O8CA 4GI1A 1DT5A 3NKVA 1GLVA 4GKVA 3KDKA 2P0AA 5AM1A 4E1VA 3KQKA 1WUHS 1EESA 3BH6A 1IZ8A 4WOCA 1TEVA 3AKCA 4KODA 4DR6B 3DCJA 4GOKA 3QKWA 4TOIA 4D97A 2WPDD 4DWOA 3AJEA 1K5PA 4Q3KA 4E11A 2CDBA 4R2IA 4HNHA 2VT2A 4RJKA 2AZTA 4UUQA 5TF4A 1KSGA 4DIEA 1JIVA 3FSGD 1J25A 3Q1LA 2Y3IA 2R2GA 4F7WA 1PGQA 4DG8A 4UTZA 1O6FA 2WHEA 5AXCA 5IAJA 3SZ3A 3L4FD 1G21A 1O94A 3UHFA 2X4IA 4OIFA 2GA8A 3IUYA 5ISMA 2BI4A 3AFNA 4PWZA 3H5WA 1IOZA 3HHEA 4WJZA 3RSSA 1P33A 4DNQA 1JU4A 1QRUA 1VSTA 3HUFA 1KORA 2FP3A 3D6HA 2CLSA 4OK6A 5KS2A 1KP2A 4FCVA 3VAYA 2AC4A 3CKYA 1JE1A 3O95A 4XWKA 1PGJA 1W6UA 1Y1PA 2HU5A 4E09A 3CZ4A 1I51A 4CR7A 4Q4CA 3ID4A 2ZBQA 1QU3A 2CL7X 4Y6QA 4X60A 2Z8YA 1S5PA 1E0AA 4PG6A 1HT1E 2QTHA 4I4TF 1XRJA 1TQ2A 4N7MA 3HB4X 4D4IA 1D9ZA 4XM2A 4V1CI 1D03A 3ADCA 4KXUA 4TZ0A 5FEMA 4ODIA 2VWHA 4HWOA 3W06A 5HZGA 2HH9A 1W85A 5KJ6A 2WEKA 1L7AA 4BAGA 1G1AA 3O5AA 3P71T 2FUG1 3OLWA 4IDDA 3GJXC 4W1QA 1Z34A 5E4JA 2FSUA 5F7XA 3G68A 3C7KA 2OHFA 1OR8A 4DV4B 1NM5C 3JQAB 1PYDA 1LPBB 2EGHA 3IODA 3NDRA 4F3YA 3GFGA 1UAAA 4RMJA 5JLAA 3D5EA 3RRZA 3IEUA 3P2KA 1M2VA 1MRSA 2WA1A 3E5MA 5DPMA 3RC7A 3VU9B 4CWAA 3WWPA 4GBED 4K05A 3WB0A 3GXOA 3PNSA 2VHTA 1QIDA 5E6UB 4R2KA 1H9CA 1O1YA 1ZXLA 4M21A 4OSEA 2B4QA 2JSNA 4D9HA 4B3CA 3S55A 1FJHA 3VO2A 3FUVA 5DZSA 1TJNA 3LE8A 1HYHA 1NW5A 4UDOA 3LNYA 3DFFA 2CVQA 1L5ZA 2ET6A 2BRUA 4ONEA 1R0RE 1BEUB 1M1YB 4DMFA 1A2BA 2WKSA 4EA8A 5KSZA 4EA6A 5DT2A 1I7NA 4QTYA 3FPBA 5HFNA 1EX6A 2V7WA 4RIGA 4BEBA 2OV1A 1PT8A 4H7JA 4JGGA 1BZYA 1R6AA 4I19A 4KWEA 1ONOA 3F2VA 3HSSA 2P6MA 2GPTA 2J41A 3JWGA 1BVYF 1XRQA 3P19A 2P77A 3D4BA 3DMNA 3G7UA 4Z2AA 4N39A 3IHLA 2V7XA 4IJKA 2FFHA 3A0RB 3BD9A 1Z6ZA 3FDXA 4JBXA 1EP2B 1QTNA 2NYAA 1NYQA 3MH7A 2OV3A 3MF4A 4P3YA 4YI5A 5IBQA 2R62A 5CMLA 5LBTA 3RK0A 2DKFA 5JXJA 3K1AB 5EJMA 2Z2JA 1G6HA 2EF0A 4OXRA 3A10A 4E51A 4LJSA 1HKUA 2B4AA 4KXQA 2JLVA 4MHTA 1L5RA 2UXBB 3TG8A 4X6LA 4C6TB 1Q83A 3L4JA 4R1OA 4NMVA 2R87A 4IEEA 3DBHB 4OHUA 3S0JA 3ZX4A 5HXAA 4U2CA 5JW6A 2NADA 3EPKA 3V7UA 3FDFA 4R7ZA 4Q6BA 2ZSUA 4P2AB 3IUJA 3NT5A 3VGPA 4LGVA 4AJPA 2C54A 3ONDA 1E5QA 5KMGB 1X94A 5EMKA 5DSXA 1LWNA 4FZ5A 1JKXA 1EU1A 1YRQA 1NUTA 1X70A 3AK4A 4J4HA 4Y98A 2VQDA 3ZNQA 3JQ8B 3O75A 4BVAA 4KMOA 2JI9A 3LWDA 1KNXA 3T5PA 1V47A 1CS0A 4JOHA 1JT9A 2BFBA 2C2KA 1UBGA 2OM6A 3A1FA 3M6LA 1XWIA 4LDRA 4QQNA 4YMIA 1OCEA 3SF0A 4ZMRA 3R9XB 3FWZA 3ROTA 3HSYA 3Q7IA 5AUPB 3SBXA 2A5YB 3DOFA 2C4TA 3OAAA 2VPZA 4WUTA 2EWMA 4I7EA 4PC7A 5ED0A 4EMTA 1JJ7A 4F5YA 5KC8A 2Z8XA 1JALA 3VTAA 4MJ3A 3DJ1A 3ENZA 3TQSA 1QZUA 4HRXA 2OWDA 2IFTA 1FNBA 3EOBI 4JP8A 4YAFA 5T41A 1KDZA 5A03A 1SKYB 1E1QD 2RC5A 5DM60 5B6JA 3OJFA 1IB6A 1WP4A 1XZPA 3LUGA 3TLYA 4RTMA 3UAGA 1VKZA 4B2YA 2P0YA 2UUOA 3ZLVA 2A1TS 1UOQA 2PX4A 2YN0A 2VYVA 4JI1B 4KIJA 3IPAA 4ZAXA 4D96A 1F60A 4DYHA 2KX7A 3OU2A 4UJ3A 1I24A 2Z8ZA 3HFGA 1CY1A 3LTEA 1A2OA 2RCYA 3WNZA 4BMPB 3TLGB 2DKRA 2UUAB 4FC7A 3N8NA 1U63A 3EARA 5CLGA 4KH1A 4GM1A 3R0ZA 4LPSA 3E9RA 4NJMB 2OMKA 3OLXA 4TXLA 3RG2A 1XD2B 4MEBA 4J91A 3T7AA 5BVHA 2LP4Y 1CY8A 3Q4GA 3I09A 3L7IA 3VC3A 1UFQA 1FRNA 3ZBTA 3ED1A 4J1SA 1L5GB 4KPEC 5IYZB 4GSYA 1RT9A 4QOFA 5MHTA 2O8DA 4MKXA 2P65A 3UHJA 3IBTA 1SVMA 3WS7A 4CMCA 2KPLA 2QRHA 3AFIA 4YWHA 2H7XA 4ALJA 4M1YA 3CBGA 3BXEA 2WIDA 5J4VA 3L0PA 1U3CA 3DNPA 3PQFA 3ZU5A 6Q21A 1JN0A 4LVNA 3AI1A 3D3QA 3FJ1A 5CW1A 3TWOA 3B2NA 3GN2A 3LQ4A 4BWGA 4B47A 2FPKA 2VN8A 4QJIA 4HG2A 4BB9A 3OUZA 2WJVA 1QH0A 1V3TA 3U3MA 4BNYA 1EK2A 3P9ZA 1JL3A 4UVIA 3EGVA 5FUXA 2W48A 1VDMA 2W4IA 5T3YA 2DY1A 1YZNA 1RKUA 1BS2A 1E4EA 1QX4A 1U0SY 2VS1A 2ZJAA 5D13A 3HUTA 4B33A 2M6KA 1PX0A 2HPAA 3ESZA 4H4DA 4TMKA 5LD2C 1LPMA 3ZDXB 3D0RA 3I4FA 4L27A 3HN7A 4L8FA 3DXFA 3AEKA 2NQ8A 3GAZA 3N7UA 5CA0B 1EFKA 1N3LA 4C01A 5HRAA 4U7DA 1RYDA 4IDPA 4NZOA 4JBGA 3AF4A 1H4QA 2CVOA 1BN7A 2COEA 1T26A 1C9EA 4K28A 4EAQA 1E1NA 1L5VA 4DSNA 5DOVA 4F92B 2Y1LA 4HVTA 2P5SA 4OMCA 2J3LA 1L5KA 2AN3A 1QONA 2X0JA 1YV9A 2JIZA 1I5OA 1YRLA 2I99A 2D5LA 1YE5A 4RKEA 3RLEA 2W8ZA 2OFFA 1KVSA 3FB1A 2BFOA 4CMAA 3JQ9A 4HAWA 4M0MA 5E7JA 4J16C 1P39A 1Q3HA 2WLSA 3QOFA 4YCJA 2FW0A 1BA3A 4AWXA 2HGSA 1EDEA 3ZE1B 1UJ5A 4JLDA 5KHAA 1FU7A 5IVDA 4A23A 1JHXA 4PRLA 2NXCA 3DEIA 4ALMA 2RHJA 3AUTA 2ZANA 1WU7A 1BE0A 1KERA 1L7MA 1X1TA 1P0CA 1UJBA 4L6AA 4B3XA 1UBSB 4Q2QA 1H22A 5TR9A 4KYUA 3WKCA 4BMSA 2PJRA 2WJ3A 3A4NA 3BD7A 1NJGA 1EGMB 3AESA 3OFKA 4Q3EA 1IC6A 4Y9UA 1Y9JA 2BKAA 2IHVA 2IYEA 5JUWA 2EIHA 4MI9A 5JY1A 2RARA 1KC1A 1JKJB 1KMHB 2YUBA 2B2CA 3FPKA 2DHQA 2QRMA 1T2AA 2YR0A 3SXPA 4ZU3A 5L51A 3GC6A 1UDWA 3NYWA 2OQ2A 1DIBA 2YV3A 5F9MA 1SR8A 4AAYA 2VSVA 3BQMB 1B43A 2R25B 4LHYA 3BDVA 4WXEA 1XHEA 3EYAA 3OIWA 2AGVA 1QBKC 3I76A 2RGRA 2RH9B 3KYIB 3OI7A 3FPEA 1N92A 4PYOA 3H8VA 3QIKA 2BMFA 4HYEA 4RZHA 5EIBC 2I4NA 2L18A 3MTGA 2H9YA 4LBWA 5MFZA 3EZLA 1TJYA 3Q8WA 5DLDA 5EZYA 1W19A 1FTGA 4G5HA 4ND3A 1B8NA 1E9BA 2QTLA 1DADA 5DI3B 2WJ4A 1U3DA 4KNVA 1ODLA 4PO8A 2WG1A 3IVGA 2QLMA 1KEZA 3VZCA 4IIJB 1D5WA 1KWAA 3YASA 1SVLA 4WFQA 3GFPA 3T5GA 3D8SA 3HM9A 2NTEA 1R4MB 2JH9A 4FEEA 3VZPA 3B1XA 3NAGA 4KAAA 3ZW7A 1NR5A 4ESVA 4WZBA 3EW9A 5F1YA 4RY2A 3AV0B 2XOKA 1P0MA 2BMWA 3VKFA 5DRYA 1USIA 5H9WA 5L6MB 1B7GO 4JX8A 3VC2A 3RFVA 3G82C 4JJ7A 2DBZA 2OORC 1F3OA 1W36D 4FX5A 2KBFA 4ZCSA 4IW3B 1OYVA 3L1VA 2AXNA 1P5ZB 1T3LA 3DYVA 2QUJA 3F9CA 4I1OA 2I67A 5T6MA 3NBXX 1PJ4A 2I4TA 4IIBA 3H8SA 4JJKA 5B1DA 5FX2A 4A27A 5HEDA 2O6LA 3KQUA 2O8BA 1L4LA 1GCGA 3IUMA 1PQUA 2AR7A 4YA6A 4ZV9A 4A2QA 4F6CA 1HR0B 2BV3A 2FPRA 1SOZA 2R65A 4KC0A 1J39A 1QE3A 4QTUB 4CKBA 5EMJA 1E96A 4IWNA 4QBGB 4R3UC 4DUGD 3DQPA 4NSNA 2QNBA 1IN4A 2BT4A 2RGEA 3VMMA 2M10A 2JZCA 2Q3FA 2VSQA 3CRZA 2OC4A 2QP3A 3P8ZA 3SEQA 3DM9B 4CQLA 3DL4A 1K8RA 2XZLA 1QLCA 4R7GA 4DF3A 3PUKA 4IIGA 1P9LA 5HF9A 3DZHA 2RRMA 3FPAA 1T91A 2QRVA 4CM3A 1F2UA 1X7YB 5IM5A 3W0LB 1SA0A 1GTG1 5FHTA 1ECJA 1X86B 3FY4A 4U6SA 2RIRA 3K7EA 3WMGA 4PHGA 4D92A 5J4HA 2RG1A 3DJAA 1RQXA 4DYDA 4EG4A 1BDIA 3X1MA 4P35A 1R6DA 5EUQB 5I6DA 1RQNA 1OKKD 2VXOA 4J7CA 4K6FA 1R50A 2DLDA 5K8VA 2AFHA 5FBZA 1LLCA 3HPRA 4K2AA 2CT8A 2QU7A 4BFYA 2QZSA 4AJLA 4IIVA 3LT4A 1IOVA 4XHVA 2KW5A 3N7TA 2FWBA 4OBXA 3O2QB 1DWUA 621PA 3U56A 5E6SB 4FFSA 4KOEC 4G3XA 1GAEO 1H8EA 1Q0LA 3KX2A 1FFYA 2BKXA 1JEQB 4ZAGA 5BSEA 1TI7A 4BAUA 4Q1CA 3GLGB 4HRVA 3SVTA 3W9YA 1NVDA 1X3LA 3JZDA 3JARB 2VPIA 4TPKA 3T0FA 2FW1A 1I5EA 2AVNA 4WRRA 5FWDA 2WUGA 5TQ0A 5KTRA 5IVKA 1C14A 3R7WB 4GPZA 4C4ZA 2IODA 1Z82A 2HMWA 1E3LA 1XFAA 3FMVA 3KJHA 4YJFA 4BCCA 5DNCA 1BNCA 4WESB 5DEOA 3V7FA 1KK1A 3RREA 3T0IA 3FYDA 4G9GA 5A9SA 1VPDA 1GZSA 4OHCA 3E7WA 1U7WA 4RVUA 1C81A 2HSWA 2J45A 3GDVA 2V5VA 4BBAA 4BWVA 3HM2A 2CNNA 2Q6IA 2O2GA 1SQFA 5IJ9A 2JC3A 1A9XB 1RRCA 2QD4A 3WE7A 2HUPA 1B8UA 5EMLA 3OZTA 5DT9A 1Z0FA 3ASYA 4XB2A 4YXFA 3FLEA 3KD3A 4IQ8A 3B6KA 2CV2A 2ATIA 2YHBA 1JHPA 2OQSA 3E3AA 3KFLA 1ISMA 4CIVA 4F38A 2JH3A 3WBKA 5DH9A 1RPTA 1Q1EA 1PFYA 2QKYA 3E8MA 5KYUA 1OMOA 2PPLA 3CW8X 3GWZA 3IJPA 3K6JA 2ATEA 1YZLA 3CSDA 2CLCX 1YZFA 2JKYA 3O1JC 5AI0A 4V0NA 5K99A 4R2JA 4EW6A 3T38A 2C3YA 3CGGA 3PXEA 5CX1A 4IDGA 1QHHA 1XZDA 3SZUA 3WGOA 4DLLA 5JZOA 2WKQA 1DB3A 1F0KA 2Q0XA 3ZWOA 4DC1A 2BFDB 4C0SA 1D1QA 2BYTA 1KP9A 3O2SB 4O4JA 3ZK7A 2NQ2C 4AUNA 2ISCA 4DKJA 3GN1A 3OQPA 3WK8A 5JCJA 3KHSA 1EWVA 5AW2A 1FSSA 4RKWA 3SK0A 1EG7A 1HE5A 1GGVA 4RK4A 4R8SA 4UNPA 4YRTA 3U3DA 4BV8A 4FB5A 1WUTA 2QE7D 5IANA 3N59A 5BR8B 5DHPA 3PGJA 2PKUA 2NUTB 2VDWA 1QRDA 1DUVG 3PQ4A 3QXGA 3QWIA 2P35A 1E61A 3RHZA 2E1PA 1CP2A 1FTSA 1VI5A 2LZ0A 3OKAA 3QUBA 1YXMA 2F2TA 1FUKA 5ALRA 2I4IA 1PX2A 5FNVF 3LUPA 4QJ5A 3UBMA 1PT5A 3R5TA 4U00A 3GGJA 3V33A 5KWEA 1AA6A 4JOGA 4FGJA 2Y0BA 1Q6ZA 3GGGA 1V3VA 4QPPA 5C1IA 2R6JA 4R5HA 2P9TA 1XTQA 3CJQA 2ACWA 1KAHA 2JGDA 1BHJA 1ZOSA 2I34A 2NV0A 5J40A 5JTTA 1CJKC 4MLPA 1U9IC 4IIHA 4O0MA 1N6DA 2BE7A 1JPUA 2P1RA 3ADPA 3NC0C 1ZEJA 4MRSA 2JASA 3URMA 4C3UA 4D3DA 3FRJA 3QE4A 1DQYA 2XUPA 1FFAA 1B42A 2QOEA 5C8YA 1VJDA 2K4MA 1CV2A 4MAAA 4YRAA 5LMNB 1NT2A 4M1QA 2AN5A 3RUAA 1UEZA 1II9A 1OPXA 1RLIA 4Q7EA 3NBUA 3GJZA 1K7SN 3BXZA 3PQCA 4YJ3A 3Q7SA 4A82A 3BK1A 1FYXA 1OFGA 1S8NA 3GXBA 1VE5A 2HLHA 5H1YA 1HG0A 2J32A 1WG8A 3OOWA 2WIGA 3DV0B 5HX7A 1AMUA 4YMVA 2D0IA 2YJTD 1TEXA 3FIJA 3IXLA 3KE9A 4JLAA 3OWHA 4S24A 4BNTA 3EXHB 2Y92A 2YH2A 3BWMA 3E7DA 2C5EA 3EZFA 2H51A 1KAMA 2VUHB 1QIGA 4JROA 3IDFA 1GAWA 2QJRA 5G3ZA 2AZDA 4F2PA 4PPQA 5BN3B 4E21A 4Q1DA 2OP1A 3I04A 8ATCA 2D0OB 4G0YA 1XQVA 4JBHA 3TPCA 1ZRHA 2YUTA 1N2ZA 2W93A 3K9WA 1ECGA 3EGWA 4ZRNA 5C32A 3JVUA 1MEEA 1RHUA 1T9ZA 4IF4A 4GSKA 1SUPA 1PR0A 2G28A 3QIVA 4IVRA 3C3DA 3EYWA 4XFJA 2BGMA 1W9MA 1NTOA 5EIWA 2AT1A 3UC5A 3VV3A 1T3ZA 2XMGA 4RF5A 3TQRA 1QRTA 1CB7A 2DU8A 2O8CB 3HB9A 2PRJA 3I8SA 4UZFA 1QNLA 2P2YA 3NATA 4XFKA 3AP3A 5H3HA 5FT9A 1QYWA 4XPIA 1Z33A 1NP6A 1DQZA 1R18A 1IFXA 5IVHA 5KAPA 2HY7A 4Y9DA 4QVIA 3LCUA 4MPDA 3IBCA 3NEAA 1F14A 1Y3CE 2QG9A 4IYJA 3PICA 5FRDA 3ETNA 2VDOB 3QV2A 3RWMB 4ARBA 4ZFNA 3W5DA 1O95D 3OBBA 5KDLA 2YOFA 5KCZA 2FDCA 3LDAA 3NHPA 2HF2A 2WILA 5CDTA 1RZ3A 2CXRA 5HF1A 2RH4A 1EVLA 4C0BA 3BB4A 1GARA 1ML4A 1E2GA 4HSEA 4OI0A 4AN4A 1L3IA 1NW8A 3AHJA 3ESCA 2Q4EA 2D59A 3U7RA 1G16A 5ICMA 4NWIA 5FV4A 1M5ZA 5KNCD 2PSSA 1KH2A 1V4BA 3A2NA 1Z4LA 1K6MA 2HEGA 4YAEA 4KQXA 4ZCIA 4P3PA 4GL2A 1P4HA 3NYRA 2XI4A 5EOVA 3WYGA 1ZWKA 5EJ6A 4IFBA 3RANA 2DFLA 4MW7A 4FYPA 4J3NA 1N2OA 4BX0A 1RHQA 4WA7A 5DTQA 1CRQA 4ZZ2A 3DTVD 3HKDB 1PRYA 3LLVA 4QJ4A 1XZ9A 1CR1A 1ECFA 5TNXA 5IXJA 5DULA 5J2TF 4J75A 3A1UA 3A4YA 3HJBA 4E3BA 3CG4A 4QDUA 3DBVO 4S1OA 4AF8A 2DJTA 3ZS8A 3LNXA 2I55A 4CIDA 4YYEA 3WRVA 4EPVA 3S1SA 4V38A 2ZIXB 4G24A 3SF8A 2D8AA 3VJMA 5JPCA 2O7RA 4FYWA 3JZIA 3M3HA 4OK5A 1VCNA 1CUBA 1N6EA 4NQRA 4XYMA 5LA6F 3RVJA 3EMVA 4FNAA 1USUA 4YQFA 2B5VA 4DLPA 1PS9A 1Y3AA 3AKYA 3F1LA 3B76A 3M6FA 4LI0A 4US0R 2O2XA 4K5QA 3FNRA 2X8LA 2PZJA 4R69A 5TGDA 4BXOB 4NCIA 4BVHA 4UDYX 3VOTA 3VRHA 1DAMA 3RBAA 1CE8B 3BKXA 1ITZA 3ZJ4A 5ALKA 1G0OA 2GNPA 2FLKA 4YT8A 2X9VA 1V0JA 2PX6A 2A1TR 3MGAA 3TLEA 2R84A 1I1QB 5AUNB 4QXRA 1CVIA 3HDVA 1LLDA 1XP8A 3KQVA 2QPAA 3RSHA 2X2PA 1LRJA 2SBTA 4ENPA 3QUQA 4E4RA 3SSOA 1QV7A 4NENB 2NAPA 3B2EA 2GSDA 3JQQA 2F00A 2Q2WA 2GM4A 1LI4A 2DQKA 3SM3A 1EIWA 2WWTA 3BMCB 4OQEA 1JJAA 4RSRA 1BFEA 1V1MA 1CNMA 4YCBA 3WJ7A 4DE5A 1SZJG 4O29A 1HZZC 2XUFA 3W8RA 1IUPA 3LLSA 3QQPA 3J81A 1SY7A 1F48A 2WHXA 5CU7A 2FQQA 4BJ3A 4Q0MA 2C58A 1XZKA 3KXDA 3PD1A 4M8NE 4Q00A 3DZGA 3RL8A 4ZQBA 3RO7A 3AZQA 5LC1A 4UHEA 3A9RA 5AKIA 3H5VA 2KJKA 2CSSA 3GZTB 1W4AA 3IDQA 3EFHA 4TMWA 2IHTA 3NVAA 1YOVA 5M04A 5CAEB 5ALJA 2C57A 2UZIR 4ZU6X 3MGBA 1TA9A 1BRTA 1RVDA 1W34A 1Z3IX 3D6UA 1M2KA 2V7EA 1C30A 3MUEA 2REYA 1O4WA 3R3YA 4XSHA 4DDTA 2G1PA 3X0DA 1ARZA 1B2RA 2JGNA 4HDNA 4CV0A 2QQGA 3ZTTA 2QY6A 2HNBA 3I9OA 1SHLA 3MWDB 3JPWA 1U9JA 4IHJA 4X1IA 4NABA 2FUG6 1UADA 4Y1EA 3EGDA 4BP3A 1MDFA 4MYRA 1PHRA 3UXMA 3CRQA 4RY8A 4LK3A 2HJRA 3CR7A 3GJ5A 2SICE 3GQBA 1F0YA 2EP5A 4MVJA 4YECA 1K86A 3KEGA 3NGLA 1GILA 1XAGA 3DOOA 4B4KA 1YDMA 3KFVA 4MQMA 4WCFB 3WLJA 1UBJS 1XKTA 1T0PA 4C2BA 5AKXA 3AR3A 2HSDA 3FPSA 4D79A 4LF6B 1QIHA 1D1PA 3CBXA 1JRLA 1J1IA 3N39C 1CDOA 2F8MA 3ZDQA 5K3CA 3K82A 2ZQZA 1O0BA 4Z4IA 1QQTA 1P1EA 2IP2A 3BRWA 4R1MA 5AMXA 3L41A 2JJ8A 2IPAB 3A2KA 4N7RA 4UAVA 1XEFA 2H92A 3VX4A 1SQGA 4BGVA 3QLVC 3W8EA 2PRZA 5JCXA 5AVXA 4WXPA 3DVLA 4O8ZA 1T9GR 2BZGA 4M7WA 1V9CA 3LWZA 4MKHA 5LDDC 4RVDA 3W6OA 5MDHA 1ZI8A 3AERA 1UXKA 1VSBA 6REQB 4YDQA 2I0LA 1GYQA 3BGSA 1CIVA 2I78A 3RADC 5GP1A 1II8B 1Y8QB 1JZTA 4ZWNA 3RSOA 4EW3A 2OY0A 5LR6A 1TUIA 1N6IA 1R5JA 3KPVA 1JFLA 1P9RA 3U40A 4WFJA 1JU3A 3IQZA 2OZLA 3I37X 3R7AA 1GEEA 1S1MA 2BTOA 4UKDA 4BJHB 2ZSIA 1PZFA 4KNWA 3S29A 1RRMA 3B48A 1WG6A 3GLKA 3PU6A 1LDNA 1PTKA 3OWOA 1KSHA 4Q48A 2QN1A 3DE5X 4UFNA 4U7GA 1V6AA 2X7XA 3A9TA 3RUIA 4GPIB 5KJCA 1QVZA 2QVBA 3CXUA 1X7DA 2AEJA 3GELA 4WE3A 2R60A 3SR0A 4RJIA 3WXMA 3DDCA 5BWMA 2PQ2A 1OBCA 1YU9A 4Q9AA 4TUYA 3TOCA 5BV0A 1U7DA 3NP9A 1YTUA 1U1GA 4J2TA 4LX0A 4NLLA 1TAQA 1D4OA 4JKIA 1ZC3A 3LKBA 2DH6A 4IPTA 5NLLA 1DLJA 2ZSBA 3A36A 4ARUA 5JXIA 5FH9A 1JIQA 1CULC 1L0BA 1Z0ZA 2W2KB 2PYZA 2WPNA 3L8HA 1R6TA 5ALGA 4Q9JA 5KQPA 4TXHA 2GK7A 5KPDA 2VWGA 2JGEA 4H1WA 4GQBA 1QHYA 2YT7A 1UF1A 1E3IA 1PEDA 2QSZA 1FYVA 1IBKB 2GPJA 3KDSE 3LC7O 3CC0A 3W5BA 3IVXA 4UZSA 2C7RA 4UHKA 4FOTA 3DAFA 1EUDB 3DONA 3LT5A 4FKMA 3QFTA 2DFPA 1CUIA 3VDXA 2YRWA 4N6GA 3NTOA 3DKKA 4RIEA 3C24A 3ME5A 4GE0A 5FTLA 1OZAA 2AWNA 3I0NA 3LDHA 2BR3A 3QNUA 4EEKA 5I8WA 3GDOA 4FUTA 2GASA 4HEHA 1W5SA 3DM5A 1BD3A 3QXSA 4XWGA 4MI1A 5E21A 1UMBB 4L6IA 4P0PB 2VSOA 2GFQA 2IVFA 2IUYA 2QT5A 1W4ZA 3AHEA 1BIFA 3EIQA 2CLMB 2XTAA 4L51A 4A8JB 5JJ5A 4Q7QA 1VYVA 4PU0A 1TYAE 3T12A 4LSMA 4OXQA 1ZN7A 1BCRB 1WPQA 5FI5A 4AC9A 4C0WA 3PVZA 3G9UA 1G8AA 2HBZA 2GESA 4BMZA 5U9CA 5EL0A 1CXZA 2Z30A 1G5QA 2BR4A 1AY0A 2GLTA 1Z2NX 1YFKA 2QAGA 3B5JA 3L7MA 4JI6B 1RJFA 3LS2A 1NFRA 3K9CA 4PLTA 2AQIA 1G3RA 2HK9A 1NI4B 5IKOA 4CDRA 2WF5A 3GNTA 2M6RA 3HCDA 4Z51A 1OAOA 1XNHA 1FSFA 2HF8A 2OKCA 1NQ5A 3KZNA 3UUFA 2QQ5A 3LF1A 1L1EA 4NEQA 1IOLA 2XDQA 3R3XA 3ZDDA 4H16A 4RTJA 1PR2A 1W46A 5D1NA 2LXNA 1UCFA 3RRNA 4K72A 5IMBA 5IC5A 2J6CA 1XCOA 4KRYA 2ODBA 1TD9A 4IRXA 4OQ4A 4GICA 5T5QA 1XMSA 1N2XA 1U3TA 3G85A 3N9IA 2B8EA 3OD1A 1Z17A 1YA4A 4WBNF 3NHZA 3IV7A 1QXSA 2PWPA 2FRDC 3D7LA 1PZHA 2PLNA 1NI3A 3KOOA 1NJ8A 2UAGA 3K5PA 4LJLA 2GO7A 3VR6A 2WD7A 3TOSA 2EFDB 4HNAA 1MP0A 4NYIQ 5LP1A 1FDRA 4XQGA 3F6EX 3QYPA 4KPUB 1GEGA 2FQXA 3KOMA 4WEOA 3WAJA 2O5EA 2ZE5A 4B5KA 1QWOA 4N8SA 1U0GA 1GPLA 2RHLA 1ZJ6A 3RRJA 1VL8A 1JB9A 1I2AA 2WRZA 3NJ8A 3S1AB 3JYOA 3LQQA 4HEA6 3U39A 1W36B 1RMQA 1ZEMA 3GUZA 2R5NA 3EBOA 4YFYA 2YBDA 2RGUA 1DKQA 3KDAA 3L7YA 4AJJA 4O2AB 4ZO9A 4CI9A 2IY8A 3KUDA 5AI5A 3DDHA 5KYNA 4GBJA 1D1TA 1LH0A 2FW9A 1YQEA 1J20A 4D9NA 1K2WA 2J4CA 4ER3A 3IERA 3FHTA 1WH1A 5HEYA 1O9HA 3TL6A 4PX2A 3GUUA 3SS7X 4O59O 4OAQA 1W93A 4BNGA 3VQGA 2C88A 4WKGA 3CIOA 2FZWA 2WUVA 5AD1A 1SBYA 1TK9A 4GYKA 5F4BA 3T7KA 3TR0A 3ZU2A 3GX1A 4E7PA 3USES 2ZRIA 2ZWPA 3ESBA 3DHVA 3BS4A 3V1LA 5K0CA 1U0HC 2XE8A 4XDYA 3ND5A 4TS4A 3O4IA 3SR4A 2YWEA 2BOVA 4TT8A 4EQ6B 2FFQA 2PZBA 5EG5A 1BC5A 1O97D 4TRMA 5CEFA 4YRKA 3BGDA 1R1DA 4JY7A 1Z37A 1L5HA 5HF8A 4U7WA 2XCUA 4HFMA 4QUDA 1V25A 4Q2NA 4Y0VA 2VXYA 2Q5JA 3RBVA 1N2HA 3Q41A 4B87A 4BNFA 1YK0A 2PKRA 3QBTA 4BMYA 1NMQA 1IZ0A 3ICEA 3WO0A 3ZXIA 3D8BA 4HAZA 1I10A 1ICIA 4UD6A 4URYR 5DGIA 2QKTA 4FN4A 2AJLI 4IX9A 5FQNA 3OPYA 4PCVA 1ACJA 3HRHA 4J6EA 4PR3A 3DE0X 3GUCA 5C8ZA 4M7PA 2R44A 1YRWA 2HHAA 2V4ZA 3K0KA 4NCNA 1Z7BA 5J2UA 1YMQA 2GJAA 1LPOA 4RE5A 5E9WA 4R3WA 2H5JA 1WFVA 1QDUA 4CEJB 1SIUA 3CZRA 4W1RA 2IYWA 2PU5A 2ZQ5A 4OATA 3K2QA 3TQTA 3F71A 2HMSA 3RVMA 5JYEA 5FBLB 4RK7A 3CURA 1B8QA 1OLSA 2BKLA 1M5TA 2B98A 2WYOA 3RFUA 2CJFA 4JNKA 1BO6A 2JFPA 3KZCA 1IZ9A 4RKYA 3HEBA 4ZZIA 3MFYA 1Z08A 1K5DA 4TLDA 4TXNA 2DUNA 2J5KA 1IWPB 2Q1WA 5CCBA 5D86A 5ALVA 2CZGA 1B76A 1M1ZA 3OTHA 5CJPA 2X3YA 3CRVA 4DXAA 2GQ0A 2QORA 4KQ9A 5KX5A 1JVNA 1DRKA 2JBHA 3DZCA 2WC1A 2WKRA 1XQ1A 4NARA 3OH8A 4M1WA 2JGAA 4LWQA 1S7CA 4ZGBA 2Z09A 2XWPA 4D99A 4Q1EA 4YJGB 4N9WA 1X80B 1KH1A 3MJCA 5DBHX 5ILBA 1PS0A 2O2IA 1CQJA 1GUDA 4PC6A 2ZULA 1HTWA 4QASA 3HWRA 2PZEA 4B2IA 1QF6A 5F2KA 3CZCA 4FHFA 1TM4E 3HYTA 4UU6A 1SCUA 4EB6A 5LQJA 2J33A 1BW9A 2VHYA 3JVEA 1PWYE 1OGIA 4OO3A 4KO4S 3ER9A 2H1IA 2ICAA 3DO8A 1TAHA 4REQA 3PNOA 5F1KA 4JT4A 1IWOA 3ZH2A 4NZZA 2HDHA 3HBAA 2UZ1A 2WUDA 3B1JA 3OU0A 2V98A 1EFUA 3PTZA 4Q7LA 1J2TA 1M0TA 1U7XA 1AHIA 2J0UB 4FC6A 4HDRA 1RXWA 2C95A 3UCEA 3FWNA 1ZNQO 1W94A 4JK3A 4J07A 4Q05A 3WY9A 4WOBA 3WA6A 5U4XA 2IV3A 1IXSB 3GLTA 5IXYA 2VXBA 2DY0A 2GETA 1ST3A 3L9WA 2QQ0A 4YJ2F 3VOSA 2ZVJA 4YH1A 1KTIA 1RC8A 3OE7D 2AXEA 4F4IA 1LPAB 4E88A 1YZVA 3SHVA 1H1LB 5IT0A 1N75A 3GGOA 5L8VA 3HUDA 3IALA 5H3CA 1ZPDA 1SOWA 2CBZA 3NTLA 2HE4A 1QGOA 2FDRA 3L6BA 4M1EA 2LKDA 2XGGA 2FUNB 1TRKA 5K3OA 4DLZA 3KLBA 2E4ZA 2PJZA 2FETA 2NM0A 3KL4A 1JQ5A 1MFGA 1RM0A 3NW9A 3OJ0A 4J43A 2OGWA 1I3LA 4AP5A 2AOVA 5JAOA 2DE0X 2XODA 2PKWA 5DNAA 1X15A 2VJOA 3CN9A 1O89A 3CC8A 4JDUA 1NBMD 3UJCA 5A05A 2BELA 1JECA 5D3KA 5ECDA 2XB6A 2EAUA 3DFZA 1J8YF 3PPYA 5L3QA 1GRRA 2E4UA 5JE8A 1MAHA 1NBME 3VDRA 4ZK2A 2I4LA 2ORED 5C31A 1W9HA 4AO6A 1P74A 1R10A 2V0GA 2HLNA 1UDAA 2IBSA 3OFND 1JH8A 4Z8JA 1WXXA 1SC6A 3N86A 2MTBA 4ZEWA 2BEKA 2HA2A 2OO5C 4Q21A 4QWMA 4PS1A 1GO2A 4PZ9A 4QJ3A 2EP8A 4C9BA 5TLSA 3P52A 1MOSA 4H7FA 1ISGA 4B32A 4ZYLA 5IEJA 2I2BA 3C3YA 4YLGA 2GT1A 1VZ3A 2NTJA 3W1VA 2VAXA 2VCEA 2W0SA 4BNDA 4D1YA 3F3YA 3K1TA 3MA0A 2YJ3A 3ABQB 4B6OA 1AS3A 2DQYA 2C77A 1PWHA 3AZPA 3R9WA 4HZGA 3D2CA 1U3GA 2I65A 4NFYA 2FQWA 2BZSA 4JKYA 1NV9A 3BILA 5DRTA 2DJIA 4LRTB 1KJ9A 4GOMD 2OA0A 4C7MA 4PSCA 3P9RA 3E9QA 4PZPA 1W29A 1G2PA 4PIVA 1E3SA 2O7SA 3ML1A 1I2ZA 1TJPB 4ML3A 3QX3A 2R47A 1BQEA 1QHNA 2FG5A 2UYOA 2HKIA 4WZZA 4FEGA 5HKAA 3ONNA 1E2KA 2C4KA 4NU5A 3DE6X 4GOXA 4U2EA 4UW9A 4RMHA 1AQLA 2G3YA 2JATA 2WYHA 2H1WA 4L0MA 1OX6A 1XQYA 2V6JA 1XZ8A 4WKCA 4B71A 2ECKA 1K3FA 2FEKA 1QZZA 1VIVA 5HTOA 1DX9A 1HG1A 1T24A 1N8SA 5F78A 3UIEA 4D9CA 4JYMA 2ZYVX 1XCLA 4L4SA 3ANYB 3TQFA 1A9YA 1BMFD 4LE0A 5D87A 2BGWA 3W78A 2F48A 4BZWA 2IH4A 3GNSA 3HXPA 3I64A 4N4AA 4MW0A 5CFLA 4JBWA 1F7VA 1YMUA 3H5NA 5IASA 2WT4A 1ZJWA 3H1PA 4ZRMA 4IMJB 3IB6A 4C87A 1FOEB 3PFWO 1V8PA 5CH3A 2P9YA 4ZEMA 4YJDA 1MFPA 3DTVB 4XX1A 5JAUA 2JDIA 1M8JA 1UF9A 4O4IB 3UH1A 5L95A 4I50B 5ELMA 2DMZA 2VAWA 1KEWA 1RIIA 3RJ9A 3UG6A 3V7NA 2X76A 5JC8A 1H1TA 2FOXA 1YIAA 3TFQA 1JBEA 2E89A 5MFPA 5EKDA 4COKA 5GV8A 3CNQS 4G6ZA 5FPSA 3TTTA 2WFMA 2EQBA 1NVEA 3KU1A 1DHTA 1DRJA 4B75A 2G25A 4U7HA 1NDHA 2XYGA 2I8CA 5JSUA 5HP4A 4CF7A 1NRWA 5KTKA 3QXJA 2NSDA 2H06A 5EERA 1QP8A 1NBEA 2HBRA 1A97A 3BIXA 5AOBA 1XJQA 2HA6A 2PXHA 3AW9A 2VJYA 3JQAA 4KQWA 2CV1A 3HWX1 1B4DA 3ZDRA 2W42A 3ICPA 3VHQA 1E2JA 3DTYA 5KZMB 3PLAE 1THMA 3PYXA 5BUCA 1ZX1A 4ZI7A 5HW0A 2AV6A 1NW6A 3VU9A 4G8DA 4MV7A 1XVLA 2W6CX 3AR7A 1L5WA 4M7OA 3D8UA 4Q9KA 2NUPB 5CJ2A 5E11A 1MENA 2D8MA 1RSZA 4P3KA 3BXXA 5E6UA 3VKWA 4UZEA 3U4DA 1ADYA 1ISFA 2BDTA 1ONNA 2BEWA 1JBQA 3IYLW 2PJDA 1U39A 1IPHA 4CFZA 4URXR 1U2GA 1XP5A 4FDVA 4EYOA 4B3FX 2J08A 3OQVA 3ID1A 2DZDA 4J03A 5EKSA 1PNVA 2A88A 3OUUA 3P7MA 5GJWC 4MB0A 1N4AA 1Q20A 1M0SA 2OGTA 3AY0A 4DFDA 2KJDA 3LY5A 3B1VA 1EX9A 2G6TA 1NN0A 3P0JA 4I6JA 2M0VA 4Z0TA 5KSYA 1M72A 2Z1DA 3DZBA 4FI3F 4P4GA 4Y7CA 5J5CA 2VRNA 4GPTA 4O2LA 8OHMA 1IAQA 4XW2A 1JQLB 2FW8A 4MTLA 1ODCA 3H5AA 3E61A 4KQ2A 4ZHQF 1B74A 4R40A 3V8EA 4D5GA 3D81A 4I2VA 3AUAA 3D1LA 3R6WA 1FMFA 5IAKA 2QTCA 4ND2A 3ZLTA 4OXNA 3QYAA 1D07A 1RC0A 3ZWNA 3VUFA 4YRGA 1Q1NA 1VB3A 4PBRA 5A3VA 2DQ4A 3COPA 3LD9A 2GXSA 4YP1A 2BMJA 3QOYA 1SU4A 2AX3A 2BWJA 3VU0A 4OL0A 1M8GA 2PUWA 2IBMA 1WKVA 4N41A 2AYXA 3B6ZA 2BISA 2HFJA 4BQPA 1X3SA 2N42A 3GPDG 3IT0A 2RFLA 4JYPA 2HQOA 1QHXA 3E27A 1AUPA 4EMUA 5AJWA 2F67A 2FF7A 3FBTA 3A70A 1TYZA 3EEYA 2ZYRA 1E2LA 2SHKA 4IGFA 4R54A 4OGGA 4WCVA 4POOA 1Z7YA 5KMGA 4X44A 1EXMA 1CJTC 1C50A 3VO1A 2ZVDA 3RU3A 3VDNB 3JQ8A 3K2IA 1P2VA 3K0FA 3BJEA 4OJQA 2ZYUX 1BFDA 5L3RA 4J2OA 3R9XA 1ECLA 1TMGE 1AQYA 4LQDA 4BWYA 2NU8B 1RMTA 3C15C 1KDRA 2QLLA 2WTMA 3IPYA 3L0DA 1HL7A 4DDKA 2RGGA 2A3RA 3C3PA 4UEQA 3PV4A 1PFQA 1JEEA 3HZZA 1MZPA 3WLQA 3T4PA 5DBFA 4WVLA 1CHNA 5HHTA 2ZYGA 4KFRA 4HVCA 2VAPA 4DV1B 1VXOA 4WLFA 2XKKA 2C5HA 3U2QA 1P2BA 4K75A 3JD1A 1QLWA 4Q9NA 1UITA 1OE0A 1Z5VA 2RB4A 3FNEA 2PL5A 1ATZA 1SKUA 4TKVB 3S8EA 4TQUS 3LC2O 2NU6B 2PA0A 3QKSB 1RWQA 2ZUTA 5ILOA 2WTNA 4UUAA 2BONA 5M29A 1A1SA 2VJKA 3B3AA 3TLGA 5LLDA 2A7QA 2WUFA 3H4IA 2VSXA 3GCZA 4G8CA 3ANXA 1YFZA 1IXKA 3OUTA 3T5DA 1XD2A 4KO3S 4Y6PA 3EMKA 2Q41A 4R1SA 2B9EA 4JJ3A 1MJNA 2VTDA 3WMRA 4LV5B 4TX1A 2HK8A 4WMLA 4CR6A 4UPEA 5IYZA 5FTMA 1P8AA 1QQAA 4QM7A 2DPMA 3KDGA 3TEFA 3RSGA 4PBTA 1ZSYA 2HL6A 3WKDA 3PKJA 4HGZA 4U6QA 5CT9A 3WHPA 5DLPA 2PYIA 4ZD6A 1N0HA 3RS3A 5KQRA 4ZICA 1ZZEA 1UH5A 4GOOD 3M6WA 3OEHD 3ZJ5A 1GZVA 2P4HX 1EAYA 1XIVA 4HCJA 3MM4A 5AVOA 1I7SB 4W5NA 4YWJA 5ECWA 1CC1S 5CLIA 3HA7A 1KPHA 2D1QA 3UK6A 4CM8A 3GB9A 3ZX5A 4XWWA 4QBIA 1BGWA 3TFWA 3E18A 1LC0A 1B00A 2HHCA 4MYSA 1RLTA 1Y81A 4J49A 5KQGA 5F1OA 3H75A 1G60A 3F73A 1MF7A 4WDRA 5CA0A 2A9KA 2Q8NA 5CPBA 4LKOA 1RNLA 2J48A 2QZPA 3PGA1 3DEKA 4YVFA 4YP0A 2UUBB 4CUJA 2PSFA 2DEUA 4RZ2A 4E34A 3EIEA 4GP6A 3EEBA 3F97A 2PSEA 4ZOLF 1NPDA 2PKYX 2ZM5A 1Z0AA 3R3UA 3QUTA 3QSYA 1ZRNA 2ALJA 2R5FA 3I9LA 4NG4A 1X7ZB 5BWCA 4GGMX 3ZD7A 4LBYA 3BTVA 4JYAB 4DM3A 4D2IA 2GI4A 3DOHA 3RTEA 4HXFB 3EXIB 2QPTA 1R4AA 4BO5A 3WL5A 2QTGA 4PFSA 4AZ0A 5LJLA 2ZWVA 4YQYA 3V34A 1RKQA 2GCOB 3WK9A 4ZZ3A 1X1DA 1I5RA 1KA9H 5DHTA 3E82A 1WJGA 2VVTA 2ZDGA 3FTFA 4HUTA 3TVYA 1X7GA 1MAAA 2GCIA 3CO0S 3KFXA 4W8HA 4EI2A 3I58A 4OJKA 5D85A 5GOTA 5IABA 2WJPA 2CY0A 4CG2A 4YCMA 5FFMA 1K6JA 3FKJA 3L84A 1WUJS 3MBIA 5F76A 3STVA 5CFQA 4R2MA 1DCMA 4TV8F 3C1UA 4TQ9A 1QO9A 3WFIA 3IDSA 3QEJA 1M6HA 5FUVA 2QHXA 5LUBA 1SD2A 1JAYA 4QGBA 3W5SA 4HNTA 1Z39A 3BCUA 1GPYA 2DCUA 5L4SA 1JR6A 2PGJA 1M67A 1JKJA 1KMHA 4XD7D 3E2IA 1CZNA 3NKFA 5EXDA 3VPDA 1WRBA 4CHTA 4NBKA 1K66A 3AFGA 5K0EA 1VE1A 3CM0A 1SO8A 4RABA 4ZT5A 3K0CA 5GVSA 1OTHA 3U48A 5JSQA 4BLRA 4FFMA 4MAFA 2I91A 1T1GA 1XVAA 2ZKIA 3GY0A 3I23A 3CKMA 3OJXA 3QVVA 3TLZA 5FR1A 1QHIA 4CIXA 3HYSA 2FZVA 3N3AC 421PA 5M5BA 3VH2A 3FM9A 1MAUA 3O82A 2YFHA 2J31A 4RW0A 4EUNA 2QTZA 4LFAB 2X8JB 2QX7A 5B1YA 2XLCA 1DBQA 3WI7A 3OZGA 3OIFA 4W1PA 1W0JD 5DGDA 4IVQA 1AKVA 2WIKA 4Q7MB 2E82A 2VXCA 2XWQA 4M9QA 4W82A 3NM4A 5DI3A 1XE3A 3NHLA 4JEIA 1CEEA 2V4MA 5C7YA 3AFHA 3EB9A 2O6HA 1IONA 1Z07A 1GT91 1QQ7A 2B4TO 3AR5A 3Q0IA 4JB0A 5A4FS 1R4MA 5LMZA 2HNKA 1AZWA 2CVPA 1E2IA 5E4FA 1Y7IA 4F5DA 1DBSA 2ZG6A 2PBRA 1G9XA 1LF0A 3THOA 5FKJA 3G7SA 3R20A 5K1ZA 3IIJA 4NY1A 3RS4A 1P2UA 5JR3A 3JVIA 4MW9A 4AI6A 4IXDA 2PT5A 4A7PA 4X0EA 1Y6ZA 3GJ9A 2CXUA 2OS6A 2VUSA 2H2IA 1RW4A 4DW8A 3X3HA 2M6LA 2VZ5A 1P60A 4R2WA 1XOIA 2VNAA 3D3WB 3EJWA 2Y6VA 4M22A 4UTNA 4D82A 2EZTA 2MR5A 2Q2OA 1T4CB 1EHYA 1LBTA 3U7QA 1K75A 1MDBA 2O8NA 4OBWA 1DUIA 1TUEA 2P1ZA 4H7DA 4JOQA 1BU8A 1F2VA 4HDSB 2OYCA 1W96A 1CNEA 3PKIA 5KNLA 4QOEA 3I62A 5MN6A 5BORA 4ESEA 2HCBA 2I62A 3CPHA 4QO7A 5IT9A 1A72A 2GSWA 4G0OA 1I01A 3TNLA 1MABB 3A1WA 1QYDA 4HWRA 4Q9HA 3LSTA 3ST7A 4A03A 5FHRA 3OESA 1F4VA 3DCIA 2B94A 4LV6A 4QIHA 4EDJA 4N12A 1T2CA 5H4GA 3EXFB 1X7YA 1OLOA 2BDUA 1J0CA 1WBJB 3L01A 3FWHA 4PZUA 5DWVA 3QFFA 3TKYA 3UJNA 3BA6A 2JHAA 3DE1X 4KCGA 3IOCA 4ARSA 3L1UA 1Y5LA 4QUEA 4QRDA 4A3SA 4V02A 3KR0A 2Z3WA 3U9TA 2WE8A 4LZAA 1QE5A 1XTBA 2PWBA 1ZH2A 1N36B 1OI2A 5JNVA 3QO6A 4B3RB 1RBQA 1S3GA 5L7TA 1VXRA 2G06A 1YRYE 1EINA 2W2XA 4GX5A 1RZVA 4NE2A 5AXBA 3WHLA 2AOUB 1ZC4A 3E9ZA 1CUFA 1JYSA 1MQAA 2XWBF 3ET4A 5E6SA 1ORDA 3TGPA 3TNDA 4DM4A 1T6BY 3F7MA 4D8YA 1JEQA 4YCAA 4MV6A 3FIUA 1N9KA 1BWPA 4BMCA 1JDUA 1FFXB 2ZYWX 2V1XA 3JARA 4FD2A 1Y0BA 2QMZA 1BAPA 4HX2A 2CFCA 5FWYB 2V97A 1OHHD 4MR9A 2D2IA 4RHTA 2IS2A 3AB8A 2CNOA 1KI4A 1P7PA 4H0CA 3MPUA 3BCRA 3AI7A 3GH1A 2YXEA 3DE3X 3TJRA 4B09A 5A4JA 5ITZB 1W7AA 3NTUA 5BQ3A 3NG1A 3SC2B 4WESA 2CL6X 4ZT2A 4PLVA 2F3PA 3UQYS 1MH9A 3INRA 4TLLB 4RANA 3RUHA 1RHRA 2G5TA 2Y05A 2C4UA 1GXSB 2QT0A 4KBFA 4BLSA 1KR5A 2DOKA 3CUTA 3B78A 3M1YA 5AW8A 5GIOE 3TB4A 2FQ1A 1NULA 4FOPA 2YV5A 2C98A 2EHRA 4JJFA 1Q1QA 3W9UA 4RTLA 3O8DA 2VZ0A 3ABIA 2CDCA 3SX2A 3WK5A 1E3EA 2QSJA 1KY3A 3CSUA 4JUFA 2UKDA 4UMVA 1L5NA 3SIXA 4W5TA 1VB5A 2ECQA 4P7FA 1JTEA 3RRYA 1GRQA 4EHBA 3FE2A 2Z9DA 2G08A 721PA 2YTZA 3BGVA 3K09C 1GGFA 2WT9A 3II6X 4MO9A 1V2HE 3ZXYA 2RBGA 3CX3A 1JWAB 2H2GA 5LQSA 3S4YA 4KZKA 4R8VA 4AICA 3KQNA 3L4BC 3IOEA 4E7OA 3NMUF 1LVGA 4MQEB 3LXXA 1SKAA 3IT1A 3MSXA 4BQNA 2BFMA 4AZ3B 3SKVA 3DHWC 5KTSA 1I4WA 2N47A 1XEWX 4EHKA 1HZJA 2VYNA 4BB0A 2DSNA 5FWXB 4K1XA 1KI6B 1WOMA 3PDWA 1DDOA 2FGJA 2PZ8A 2W2QA 2NUTA 5JZ9A 4J6FA 4PLWA 1QIKA 4RIFA 2FEOA 3I0ZA 3RQIA 3GCXA 1X2EA 4H2DA 5AHRA 4PNZA 1W4LA 4OA8A 2CD7A 3D8RA 4G5XA 2J46A 3IE0A 4DJFC 3R68A 4Q3NA 4JSYA 2PX8A 1QGDA 3REQB 4YCLA 4BNNA 4GPD1 4BMXA 1Y8CA 5HUHA 2FZ4A 2MCFA 4LKRA 1CF4A 2I3BA 5AICA 2V55B 2CXQA 2WMYA 3CZQA 3EQZA 4HNGA 2EC5A 3FYUB 4X8LA 3WK7A 3HU5A 4AMYA 2F1RA 1SUFA 3CH7A 3NASA 4X45A 4EIWA 1XA0A 3VTZA 1XRNA 4FWBA 2BW0A 3QOWA 4X93A 2PV0A 1SQ5A 2YBEA 3D0QA 1H23A 5F5LA 2QN7A 1A8IA 1SHJA 1XLVA 1AH2A 3H6GA 3Q3CA 2WU4A 1D1SA 2CW5A 4OBEA 1YU6A 2C9MA 4RV4A 3HXMA 1ZGGA 2C42A 2I9PA 1J21A 2Y27A 2BFFB 5AO9A 2JLCA 6PFKA 3HWWA 1Z74A 2N75A 4M60A 4MGKR 3DV0A 4MS4B 2Q7DA 3B60A 3FETA 3MIIA 4K9MA 3RF6A 1QFYA 1NJ6A 4ND7A 5JCOC 3WYNA 1FFHA 4YCDA 4RJJA 4B43A 3CLRD 4IKEA 2Q5IA 4JL6A 1F06A 4UCFA 1MXHA 1MC1A 4JP5A 3T3GA 5BWNA 2R6GA 3OIVA 1F6WA 2CSXA 2E4AA 1QCYA 2VH2A 3LQRA 3N28A 3OOSA 5B58T 4JDPA 4W9RA 4AZSA 2GD1O 3U81A 4QPCA 1TL7C 3FSRA 6YASA 2ZBEA 4A0GA 5FOQA 2IHKA 2ZI7A 1V62A 3P94A 5DYWA 3WNVA 3THXB 4JXZA 4PPYA 2CB9A 2CJXA 3FRHA 4MRAA 3LZDA 2WQ6A 2Q1SA 1E1MA 4W5QA 3RV4A 4CMJA 2ZTLA 4ZT6A 4AP9A 1USKA 1NXTA 4IL5A 1I30A 4CMIB 2VBIA 2BFCB 3H9GA 4B82A 2GZ3A 3FSGA 2ZCJA 1M6YA 1PQ4A 1BJKA 1IHOA 3L77A 1C0KA 4Q4DA 5DW0A 2CUKA 3Q2KA 3WVNA 2C3OA 5C8DA 1CRWG 5DGHA 4MPTA 3TB6A 2J8ZA 5BWLA 3QXHA 4H4CA 2D2VA 3K30A 3GJ6A 1OZHA 1XAJA 3TBHA 1JR3D 4B34A 3UMMA 1U7TA 4F3RA 2V3CC 2NN3C 5H0IA 2FJUA 1Y33E 1QZXA 5DW3A 4DDMA 4R31A 3LYHA 1JR3E 3DPSA 1LLQA 3L40A 4KJZA 3KJFA 4P7GA 4XH9B 1NIJA 5HILA 4BLUA 1PEYA 3SUZA 1ISIA 4PQFA 1OGJA 2BGUA 4E5VA 2W6JD 3T1YB 5GOZA 4J76A 3BCSA 3UA3A 2R7KA 1C9YA 1RE1A 1T0IA 2MSLA 3H9BA 3OX4A 3PRJA 3ZWCA 3WLIA 3VH4A 4LJ6A 4QUKA 1LBHA 3UMFA 1VG0B 2ZPMA 2D1YA 2OCGA 3K0AB 4IJVA 4WXRA 5H7XA 1QPBA 1DV1A 2ZVQX 5E38A 2G70A 3ER6A 2TSYB 1AE1A 3HMQA 3HCCA 1QQ5A 3ZK9A 3EVZA 3DV9A 2TMKA 2W6NA 3QMPA 4FGZA 3EQ6A 3KVNA 3WB9A 1C2YA 4YQEA 1M8KA 1ETHA 4MW2A 4C4XA 4P2BA 4Y2QA 4DIFA 1TYEB 5HQ3B 2VF5X 5L6LB 3C87A 4D25A 5KOJB 1IN7A 2RHMA 3MW8A 5ESWA 3UHAA 2ZIXA 3GDUA 3H65A 3KZMA 4UTXA 3WZLA 2DWUA 3GFSA 3IVAA 4WK4B 2AJ8A 1K4MA 3PBKA 3O92A 4UEWA 3NU1A 4B85A 1G55A 2DF8A 3UH0A 3VAAA 3ZGLA 3WYEA 3EC1A 2P11A 4RX1A 3WWOA 1J8FA 2P9HA 1ORHA 3HCRA 3T1HB 3AM4A 3CR3C 4WLNA 4I5DA 2LVBA 1J0BA 2XQFA 3I2HA 4MMYB 3JZMA 5HS4A 1I7DA 4LTNA 3Q8MA 3OQ1A 5AJHA 3PNKA 5HKKD 4Z3OA 1Q44A 1QVRA 3CJTA 3O8OB 4BXOA 1KMMA 3MCAA 2O1WA 3EHEA 5KOIA 4ZAFA 4J4TA 1CE8A 4G0ZA 2QG1A 2PY6A 4R41A 4QDXA 2FWIA 3ZVNA 3P2JA 5TPWB 1ZH6A 3OA2A 3DBRB 1M2OB 5AM0A 4O3MA 4FIZA 4FXPA 1KJJA 1OT5A 2B6NA 2VK4A 4IO0A 3FMPB 1ACMA 3K50A 1L4UA 2XCRB 2R6ZA 4I3GA 3L0IB 4E5DA 1QYRA 2AIRA 2SKEA 5ALEA 3PPVA 1Q19A 4IC6A 1LJ8A 2C2YA 2I03A 3WHKA 4NMSA 1PQYA 2YWDA 3FSJX 2PH1A 3R41A 1TCVA 4RACA 5DI9A 5E4TA 4F93B 3HJFA 3RI3A 1HX7A 3TM4A 3R7FA 3WOHA 3GDFA 3T5BA 4DBLE 3M5DA 2CLIB 1X1AA 3O1HB 4HQ0A 1ZD8A 3T99A 3FGOA 2EX0A 4JI8B 1W2WB 2FYTA 5L3SA 4DLNA 4QODA 3EUFA 3ZS9A 1E4YA 1OBHA 1S2GA 1T6ZA 2F1JA 1C0LA 4G4SO 4C0XA 5JS1A 4UU0A 2OV2A 1GZ7A 1QGUB 4BN0A 2RHCA 1NXSA 2NZJA 4GVCA 1MTOA 1YQGA 3NTXA 3DWFA 4P3XA 2B1QA 4CR8A 1G63A 4K9DA 5GGYA 4BQEA 4KX3A 4J0DA 1I6MA 2HFKA 1EVYA 4ALIA 1A71A 1UK9A 3FVQA 3PF9A 1VECA 3LPDA 5DWQA 4PF1A 2Q3LA 4QYSA 1NBOA 3PX3A 1UWVA 3Q6IA 1M1NB 1SZPA 3PFFA 4BIMA 4F21A 1U0BB 1QHFA 1FC6A 1XWWA 3DHYA 3DMFA 4ZOQI 1OXBB 1DBIA 3GFRA 1JKMA 4FMCB 3A1VA 3MLEA 3O8QB 1FY2A 2LD4A 1DAKA 1SIOA 1YCFA 3JWIA 4CQMD 4DMLA 4C5CA 1Y8RB 4KLAA 1NXWA 3HVIA 4CV1A 5EVJA 2E4WA 3I3SR 3I2YX 2IOHA 3X1DA 1I4LD 4F3NA 5JROA 4MB2A 2WP0A 2I4RA 3D43A 4PHFA 4OHZA 4Q93A 4RE6A 3FI9A 5B7NA 3PV2A 4YMWA 3ZIAD 4PAMA 2GPBA 4DJTA 4RS4A 3W5CA 2Q9AA 2QRLA 4D45A 3U13A 4MA4A 2PGNA 4MUJA 4OHVA 5IT5A 4IHAA 1OIWA 3AUUA 3CRW1 4RADA 3ZWQA 1XDWA 2EL9A 3KQSA 5KTTA 1H1DA 1ZH4A 4HZUB 4DR3B 4IUCS 1MG5A 3CUYA 3ORFA 5IG2A 3QE9Y 3C6YA 3HY3A 4JVNA 5HKOA 1BHQ1 3AP1A 2HMVA 1CRPA 1EG2A 1HSZA 4WLEA 4BFLA 1W47A 4TTRA 4QNRA 1GNLA 1DC6A 2Z83A 1ZOLA 4XJTA 2A2ZA 2CUNA 3T3OA 2FRXA 2GUGA 2PBLA 3L8MA 4E30A 1DO8A 3O9MA 3G8BA 2OLJA 1NUAA 2DAZA 2UYYA 1II8A 1SCIA 1Y8QA 1XNJA 4WCDA 3WJAA 5IZCA 2VP0A 3EG9B 3IOBA 1UJMA 3SDBA 5BW4A 5D3QA 3EF1A 4V0ME 3U9LA 2ZK7A 2O8EB 3E3MA 1MO5A 3I72A 2WOOA 1XRRA 1SG6A 5IVIA 3CNHA 4KRFA 5T4EA 2A9RA 3GPCA 2I87A 3TTWA 4AYTA 1SUAA 4MKGA 2DFVA 2XUDA 4OM8A 2BE9A 5NULA 1L6RA 4EQZA 1NLZA 3R3ZA 2H8KA 4L57A 4TV9F 4PC2A 2J7PD 3ZXUB 1UFVA 3N58A 4O33A 2A9JA 3NNNA 1IQPA 2GWHA 5CR9A 2LC6A 3QMWA 5HCIA 4JOSA 5EQJB 3W5HA 1AK9A 1QWSA 1LDEA 2E85A 3VQFA 5FTJA 2JFFA 3HCWA 2VYFA 3K4HA 2A1UA 2WWYA 2CN1A 4EDFA 2X1HA 1I4DD 2VIIA 4RSGA 1C5KA 4QE3A 4JHXA 3O47A 4KIFA 4MUEA 3A6DA 1AQ6A 2CLEB 3S2FA 2W2KA 4EUEA 1EDZA 5IWAB 2DFTA 4AJIA 4YPOA 1ECBA 5DM70 3NANA 2C8JA 3CONA 4EPXA 5IZ4A 4OGKA 4LGCA 5LWQA 4PICA 3N0TA 2FVXA 4QYXA 1E77A 2YVAA 3IAHA 3NWPA 3SHUA 3RYTC 5CCEA 2XBLA 2R8OA 3A1SA 1VJ5A 1SXJD 1EUDA 2E5FA 3AUSA 3W5UA 1OILA 4TTTS 1PSWA 4QFCA 3WLTA 1KBZA 4U7PB 4ZCQA 4HRAA 1SXJE 1XPJA 3AGPA 2KOHA 2BJWA 3KZ1E 4KFCA 3OLVA 4L3VA 1QP4A 2WV9A 1FLAA 2WFZA 5D51S 3ZW9A 4Z7QB 4AMGA 1E0DA 5K4AA 3H2HA 1FYWA 3OZDA 2UUPA 1T2DA 1P8JA 1PJRA 1U5BB 1UMBA 2JHCA 1OZFA 3FDIA 3HXTA 4FS3A 4Z7JA 1QO0A 1W9EA 5JI2E 4DL9A 1V11B 1OA0A 2EARA 3MN1A 4LZNA 3V8RA 3G5MA 4A8JA 3AVWA 5J58A 4MWZA 5JXGA 3FCCA 5KNDD 1JUDA 2C1XA 3FUUA 4FGLA 4KYIB 4NBVA 5B6PA 2H4YA 2PSHA 3H16A 3OQJA 4Q82A 3D59A 2MSDB 4IYRA 3CH4B 1X8LA 1R9NA 3KT0A 5BQOA 5F9FA 5JYBA 2A35A 1RAIA 1DOHA 2C5SA 1TTPB 1NI4A 3ESXA 1GNRA 2ZSKA 1Y9EA 4RI0A 3O8CA 3Q0EA 1OXUA 2AA3A 1YVEI 3QKRB 3B20A 3TLBA 1FZQA 3VVMA 3V2HA 2JLUA 3BJZA 1ZCFA 4IXWA 4MP8A 2PMBA 4HHEA 4ZU1X 3CZMA 4RF2A 3C6KA 1T5BA 2GVZC 4KVFA 4M1MA 2I0FA 1E2QA 1PT9A 1RBYA 3IAAA 3L8CA 4N6OA 2V74B 3GV0A 2EGNA 2BI8A 5L45A 2YVLA 2W7RA 2IDKA 4JFRA 1QJCA 1E8DA 1DO2A 1O94C 1C1HA 2R6HA 4P0CA 4RJLA 3OY7A 5DMXA 3K70C 4RULA 2FZKA 2YCLA 5CGQB 3OA0A 3QG5A 2JD0A 2X6QA 3KEQA 4KPUA 1UEPA 4OHXA 5HIJA 3QBEA 3RC3A 4A15A 1X77A 5HR5A 1MA0A 1T29A 3ZCTA 3O2JA 2FN3A 4TLBA 3S1AA 1MG0A 1CVLA 1M6NA 4I1YA 3IP7A 2RI1A 5ES3A 2FEPA 2EX1A 2BLLA 1TVKB 2ZUDA 1ESMA 1MO3A 4YRPA 2DUUA 2VDMB 3GLSA 4MITA 4O2AA 4R6XA 5EIEA 3OT1B 4DLTA 4NCBA 3U7JA 3ABZA 3VR2D 2Z6UA 4GRAA 1ZL0A 1ADBA 4LXIA 1OFHA 2GAOA 3C3BA 3KKEA 1ZONA 3EEQA 3IP8A 3SYNA 3IPLA 4LDJA 2AHRA 3GK3A 1KFBB 3NOVA 3PCRB 1V5FA 2DECA 3G23A 2P3SA 3NM6B 2WNSA 4MWBA 4PFKA 2N3ZA 2GLXA 2JEZA 3R40A 2CF5A 3FAKA 4DUGA 3VISA 3VNAA 4W9NA 4M6WA 1XZGA 5G0WA 4KDRA 4EG8A 2E5WA 2RHDA 4G4IA 1ZIDA 4QDOA 1ABFA 3ETDA 4EI8A 1FUIA 5AHXA 3WLFA 1E2UA 4DDVA 3WB2A 1ZMBA 4POAA 4WAUA 1YUBA 3U80A 4IP0A 2OCDA 1M75A 1B73A 1SEPA 3PS4A 1SVSA 1WL8A 1XA4A 2IUSA 2Q99A 4NE7A 2KQFA 5MN4A 5IDQA 4CG1A 4FOLA 4L78A 3BULA 3AL2A 3W1EA 1FRZA 2B5WA 4LRUA 4LSZA 4QBHA 5K2OA 2D7CA 3OE4A 1TIPA 3HJCA 1I1NA 1HH4A 2RGNC 2CFIA 3ANLA 1NR1A 1ORRA 4TLAA 2H16A 1OKKA 2WICA 2H65A 4RVSA 4ED9A 3PQEA 5AKKA 2C4VA 2PUBA 4X63A 1KF0A 1MIHA 1CJUC 2XMCA 4IUYA 4N3CA 2A1IA 4JLJA 2QN2A 2WJWA 5P8WA 4DANA 2IITA 5CTAA 1TZCA 2V1UA 3Q2IA 2D0PB 2QK4A 1U2ZA 3C3KA 1QHEA 3Q9NA 4E1BA 4W5RA 1N34B 2XUQA 4DRYA 1HNXB 1EE1A 2BRUC 5FNZA 4I08A 1N3YA 1R0BA 4EKDA 2IKQA 3T8YA 1OBZA 1LZKA 1JPJA 1LFAA 2BFAA 2E3JA 3DL2A 3TI7A 5IAAA 1SVNA 4CEJA 4C30A 1SWVA 1MC8A 3T7EA 1HDOA 3V4FA 1ILWA 3RAGA 1WHTA 3SP1A 4RY0A 1MO6A 1SELA 4MV8A 5CFNA 2GZMA 3EVBA 1P2DA 1KZ4A 2ZU6A 1WBDA 5ARCA 4ITRC 4MUNA 5TB5A 3NFKA 3UMVA 3HCAA 3OPQA 2LNDA 4KAJA 5CB4B 2XGMA 1ZKMA 2QM8A 1Z8NA 1JAXA 1N9ZA 2XVXA 4RXMA 2G9ZA 4CEIA 2Z56A 5TGTA 1STOA 5K03A 1AUOA 1BOOA 1QS0A 1RJGA 4OQMA 1DVRA 4U4AA 4AROA 5LLTA 3IX7A 4KKXB 3DTNA 2PVSA 2Q4DA 2E48A 4H7HA 3V8BA 2ZXUA 3O4FA 4YJGA 1XJ0A 3F6PA 4MICA 1H6CA 1SJ9A 2V9CA 1K88A 1EA5A 4P3OA 2EHDA 3SIRA 3WGTA 3CUKA 4Y8VA 1RI5A 3O03A 3QELB 1IG0A 4C7XA 1LLUA 4D3FA 1J4AA 2P62A 3C85A 2WSIA 3T41A 4US2R 1FLDA 5COBA 1DBVO 1N0WA 1V8BA 1QFMA 1CIJA 2Y0EA 3RK1A 1E7MA 4QU8A 3F3SA 2XVZA 4AMBA 1ZH8A 3B7PA 1D2NA 5FTNA 1Z5GA 2J6BA 3ANNA 3D7MA 1RPAA 4U8HA 3F3MA 3GRRA 3PNYA 1C7RA 1BE8A 2J0UA 1A9SA 4HYTA 1JHUA 1NWCA 1Q5PA 4B6JA 4IDHA 4AZVA 3FXAA 2VJBA 2GWRA 3SJAA 2LC7A 4JBYA 5AKGA 4I66A 2VUIB 2BGTA 2W2NA 1YL5A 1YNSA 1CZUA 1XT6A 3QHPA 3R0XA 2KPOA 4MJLA 4OA5A 3CLVA 4OQQA 3UWOA 3WTBA 5JCPA 2X5NA 4KSBA 4HOPA 2GLUA 2H5IA 3WKMA 4KX5A 1O8BA 5EE9A 3PRKE 4BFTA 1H4SA 2ZPAA 4DLBA 1GPWB 2PE5A 1T0JB 1X1SA 4ADSG 1TU3A 4JL7A 1NQUA 5EP2A 3E7FA 2IF2A 2NVUA 1M83A 2B82A 2F59A 3TZEA 3R1IA 3HA2A 4URVR 1OYYA 1EB8A 3WL4A 4S12A 3QXXA 3P1JA 4JB8A 2IUUA 1YZTA 1TF5A 2H17A 2VK1A 5FJIA 3E9MA 2RJNA 3F4LA 3CVVA 1HY3A 4QPJC 3I5AA 4YGYA 3PCXA 4C3VA 2IH2A 3BFPA 2DC2A 1KO1A 4DVJA 4QXMA 2IBTA 3A4IA 1T5DX 1ZCJA 3IBFA 4FJ2A 4JLKA 5EP3A 1YQWA 4FP9A 4OHYA 3AZOA 4PQEA 1EFPB 3WL6A 4JVLA 4F84A 2WYVA 1GL3A 1TU4A 1YE8A 2DFNA 5JMOA 2RK3A 5B4UA 2BUAA 3FHLA 4P38A 1KU6A 4QRHA 4KR0A 2FNAA 1I92A 2Q1YA 3OC0A 2WYUA 5EMMA 1TTTA 3L8ZA 1R0CA 2EGOA 3CPEA 4TTVA 3U6BA 1GADO 3ZHTA 3F8TA 6AT1A 4OUKX 3GFVA 4X5OA 5BYJA 3R24A 2VPYA 5T57A 3KKQA 3QFHA 1HT0A 3GGEA 1EJ0A 2UYGA 3O91A 1L8AA 1BFUA 4K6HA 4CM6A 2LRHA 5JVDA 4QEKA 2DC1A 5BQXA 1E3QA 4NVRA 3C1AA 3HB5X 4CETA 2GDJA 3Q6NA 4B3SB 4X54A 1MT0A 3BBLA 3BK7A 5ADWA 2IT1A 2RGBA 4RELA 1CQIB 5D1HA 2H2FA 3D7NA 1DV2A 3O3MB 2XF2A 5CD1A 2K7ZA 1KL7A 1UDBA 4X1KA 1ZN2A 3AR6A 2PWZA 3PHBE 4ARIA 4AK9A 5G0VA 2CKDA 3MTAA 1RXUA 2HNAA 2R7NA 3BZUA 4WV3A 4F9TA 2BCJQ 2RH5A 3GGCA 4FHEA 4R71A 4BO4A 2D5AA 1H93A 2JEOA 3IDZA 4MYTA 2IUEA 3H11B 4C78A 4Y6LA 4P82A 4HPJB 4XVCA 4EJ2A 1IPEA 3D6JA 3QE1A 2JCVA 2JW5A 4N3BA 3G89A 3UAZA 4ZYYA 4DG9A 1M6EX 4G1EB 4CKEB 3QVKA 1GHTA 1U7UA 3O73A 4QXOA 5C8YF 2FMFA 5I7SA 3AB7A 3EWSA 1UMKA 4LOAA 4NZNA 4P5DA 1GZ4A 3NAQA 1KHTA 4FQ8A 1KI7A 4YJ3F 2EWVA 2A9FA 4D4LA 4OYRA 3LK6A 1XEAA 5KNCA 1GGEA 4FVTA 1NN3A 1LQUA 1J7JA 2R6R1 4S2EA 4RDCA 1A76A 3ZPXA 2A58A 2Q8PA 5DHAA 4YUWA 2Z08A 3ZH9B 4J2HA 1F51E 1H69A 1K89A 2XMRA 3FD8A 1M2HA 4NATA 3DTVA 3IBSA 1CK4A 3DHEA 4FZVA 1GPBA 3C39A 4O4IA 2AE2A 1N8NA 4QUJA 4E4TA 2DKNA 2PVCA 1F7UA 4IDNA 4I50A 2WTUA 1LTHR 5CVUA 4GLJA 4BLOA 3NBYC 2JLRA 4BVKA 3I9MA 2ZLBA 3PXBA 3S7ZA 2C2BA 4YO7A 5EI5A 2DBVO 1N2BA 3T6KA 2CXOA 2JVIA 2X0IA 3ETGA 5ETJA 2JD2A 2FSSA 2BSAA 2C5GA 2ZP1A 1WF6A 3ROEA 4G86A 2E2WA 1ORTA 3BXHA 4EYKA 5A06A 2BJVA 2IU6A 4HOYA 4DLYA 2AJBA 3FCAA 1XYGA 4UFOA 2VDRB 1KIFA 4C6HA 1L4KA 2UV8A 4ZI5A 1Z6GA 2WMNB 1VA5A 3EIWA 5JO9A 3ZQJA 1NG9A 1BRMA 3HRKA 1WNTA 2C9ZA 2FZEA 1YB1A 2KI5A 3JQGB 4O2BF 3OD5A 2CMHA 4QSHA 1QRSA 3H8JA 1WO8A 5A9TA 3L7KA 1WCXA 4L5BA 5LP6C 2H2HA 2I54A 3K9GA 4HKTA 3GRFA 3IIEA 4W9NC 2J3QA 3ZG6A 1T4GA 3ZU3A 1FTYA 4DRXA 4XEHA 4DG5A 4EHFA 3C0KA 3AIIA 3I5UA 3H99A 4MVJI 2ZYIA 5JDCA 3W9BA 3OZWA 4HFNA 3L0ZA 1LGYA 3ACCA 3MCZA 1EFCA 1WHSB 5LKAA 2ZIAA 5FF9A 4UHCA 1FB5A 3V2IA 3ZKWB 3GMDA 1VA4A 3AIMA 3GIDA 1JFFB 3OEEA 4H6XA 5H4HA 4AS2A 4CQNA 3G0CA 4TZKA 3ABSB 3FYTA 1DC3A 5HPYB 3PR1A 3PFIA 2OXCA 3PVCA 2PUJA 3E5HA 3TZBA 3R7DA 1VRVA 3ZK8A 2NMVA 5DMHA 5B6LA 1KJZA 2XUOA 3O93A 4FGSA 3UZUA 1KZGB 4JMLA 4C5BA 3RD5A 2ZZMA 5CH8A 1NNLA 2ODWA 4YRCA 4E03A 2PR2A 4FILA 4A8TA 1G59A 1CJCA 4JP2A 3E48A 5HM8A 3NC1C 3QUAA 1RYYA 4HEJA 1ONSA 2R97A 2YS7A 4L07A 2QR3A 3P96A 3RS0A 4BLQA 5A3JA 4Y9TA 2FFAA 4ERXA 2HYDA 1J07A 3W8FA 1FLVA 2OE2A 5B1IA 1W73A 4H27A 4NX2A 5TV2A 2Q3HA 1WB6A 2E21A 4UE2A 3S2UA 5JWOA 5ALPA 4DR2B 1J6UA 3I3OA 3HPMA 1W1UA 2FCAA 5EEHA 4X65B 1LV8A 2J3HA 3PDUA 3KHFA 3NM5A 5KSOA 1RWPA 4EFNA 4P4SA 1XZLA 1VL1A 4CQMB 3GRPA 3IP3A 3KZDA 1GDTA 1ZIYA 3KD2A 1QORA 1TE0A 3AP2A 1PSZA 3DEJA 3DSRA 2Q5OA 3THRA 5B53A 2QT9A 3ZI0A 4O5AA 1VLMA 4B3IA 4UVEA 2J3MA 3U44A 1FQOA 1R4NB 5FL3A 1DEHA 2FWPA 2WWHA 1VHLA 2PH3A 3HI4A 3VOBA 5LKRA 3NFRA 1P44A 2AMFA 1X6DA 2NU8A 2I4SA 4B84A 2Z2YA 1GFSA 2K7FA 4K6YA 3RARA 3BWEA 1FMCA 5SV2A 3IKTA 3ZDAA 3EA4A 1ULBA 2QN9A 4ME6A 1NAIA 1G5HA 3HQ4O 4URZR 1AXGA 3AEQB 5TMBA 5CFZA 3FOZA 1EWQA 1OFTA 2H3LA 2VWRA 1VKHA 4KXWA 2CEKA 4JJGA 3E9NA 4HH0A 2AR9A 5B6IA 4NFSA 5FOWA 3VJLA 3P26A 4D9BA 4GLOA 3NOOA 4CIAA 1JIKA 2VT3A 3BXPA 1P6QA 2G36A 2EQAA 3RUFA 3W3ZB 1BMDA 1NUSA 1I36A 5G53C 3WKAA 2EDAA 4X62B 1MMFB 2NU6A 3QG1A 2Q50A 2QX4A 4KACA 1BMTA 2J07A 2W5UA 3CHYA 2NO1A 4TGLA 5HZMA 3ITNA 3G5UA 3KOYA 3HBNA 4B80A 5B7QA 3HBMA 4J0JA 5EWLA 3UJPA 3VUEA 2WMOB 3COZA 2VCHA 2IP1A 2AXPA 1N7HA 1FVHA 4P83A 3LY7A 2GHIA 4ZVKA 3BWDD 3IR7A 3ZKAA 2ONZA 4I9HA 1QFJA 1NI5A 1W0KD 5EAIA 1KJQA 3ROPA 4QHYA 1KZYC 1KY2A 5DM0A 3F5FA 2KMLA 3WICA 3A6GA 2R85A 3EVDA 5JRZA 2R11A 1HPLA 2ZTVA 4IHQA 4DDHA 5CT6A 3WFZA 2W6QA 1XX6A 1FNCA 2GXQA 3DMRA 1L9KA 4N8EA 4BLWA 2H54A 3UMBA 4UTRA 3I1YA 5A5EA 2FRDA 1B6SA 3SMVA 3N3BC 1AV7A 4ZZ1A 3ZDZB 3BSSA 2F3SA 3B12A 4XXHA 2L82A 3H42B 3G2PA 3M33A 4K1LA 2I71A 1QCDA 4WY8A 2FEMA 3KBOA 4MLCA 2VRFA 1T2VA 3ONFA 4EJMA 5CDUA 3DQQA 4DADA 4G0VA 4D9IA 1Z0IA 4ND5A 5G1PA 4IDFA 5L3ZA 3EVCA 1OX5A 4KW7A 3D7SA 3DC2A 3CF4G 2R79A 4DXDA 1JHRA 1SXJB 2B4RO 4R9VA 1Q0ZA 3CVJA 2FMXA 1HDZA 2C0QA 5BPHA 1R64A 5DYIA 1LZLA 2EJTA 1ZCZA 3RODA 2AW5A 2WWRA 3PWKA 1P9OA 1DFIA 1RCFA 3DZ8A 3JQPA 2AC7A 1FYDA 2WR8A 3U6KA 5FLYA 3PJFA 1QUEA 1Y8TA 3AEUB 3ETHA 3HKEB 2G07A 4UUNA 5KTMA 2QTRA 3UJ6A 1QH8A 2JFNA 3RW9A 1Q16A 2H11A 2G04A 3EMDA 1MVNA 3G7NA 4MDFA 4GKJB 1X7ZA 2B34A 1ZHHA 5BSHA 4PNEA 3M6VA 3CLUC 3OX3A 3WQBA 3INGA 1Q0RA 1PE0A 1UBCA 4K9QA 5EYZA 2ZS8A 5D5QA 3MJ4A 2PL1A 3UOGA 3TUJC 3PXDA 1MQ9A 1R9JA 2W37A 4KVGA 3UY4A 3IP1A 3WLSA 1PYGA 4KGVA 4BKUA 1MB3A 1A9RA 1IM5A 2WT8A 2X42A 4NZ9A 1LI5A 3FJOA 5A5DA 2GCOA 2EDZA 3O8NA 4MO2A 2FN9A 4QUBA 3UAYA 5LQAA 1T8PA 4BYGA 2H3HA 1Q0UA 4HDQB 1COWD 3E9DA 4TUYF 1PW5A 4F5EA 2Y77A 1B8PA 3M1LA 3NRJA 1IK6A 3VNRA 2BGKA 2DJ5A 2UZAA 2LV8A 4GBMA 4NKRA 1L7DA 2NZUG 4A73A 9LDTA 2Q49A 1MJFA 3ZUGA 3MCVA 5BT8A 2VBCA 4Q34A 4M9RA 5DXAA 2ZRBA 2CHUA 1YR3A 3C4VA 1S3IA 1O5IA 1RQPA 2HA5A 2J9GA 1PG2A 2VOJA 2C00A 2WL7A 2Z58A 2ZUBA 2KBSA 2OKGA 2PSDA 3DTTA 5ITWA 4QJBA 4OHPA 4I1IA 4EI7A 1FF9A 4KYTA 3VV2A 2KBEA 4NCXA 3D0OA 1JVBA 4KXVA 2IIQA 2R5WA 3L7JA 5CT8A 1D9XA 1EEXB 4FM9A 1QNFA 3I9V1 1G6Q1 5KO2A 1JG4A 3IA7A 2XHZA 3SBDA 3X1KA 3OPYI 1F12A 2X8JA 4ZDIA 5H16A 4GMFA 1YDWA 4PVDA 1AKTA 4OKNA 2QMEA 4BZZA 4ZODA 4I55F 4S1PA 3EGCA 2O9JA 3UAOA 4PCAA 2YNMD 2JFVA