2GEJA

Crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp-man
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
373
structure length
361
Chain Sequence
MRIGMVCPYSFDVPGGVQSHVLQLAEVLRDAGHEVSVLAPASPHVKLPDYVVSGGKAVFGPATHRKVKKWIAEGDFDVLHIHEPNAPSLSMLALQAAEGPIVATFHTSTTKSLTLSVFQGILRPYHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVDVASFADAPLLDGYPREGRTVLFLGRYDEPRKGMAVLLAALPKLVARFPDVEILIVGRGDEDELREQAGDLAGHLRFLGQVDDATKASAMRSADVYCAPHLGGESFGIVLVEAMAAGTAVVASDLDAFRRVLADGDAGRLVPVDDADGMAAALIGILEDDQLRAGYVARASERVHRYDWSVVSAQIMRVYETVSGAGIKVQVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and interfacial catalysis by the essential phosphatidylinositol mannosyltransferase PimA from mycobacteria.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords PHOSPHATIDYLINOSITOL MANNOSYLTRANSFERASE (PimA)
total genus 122
structure length 361
sequence length 373
ec nomenclature ec 2.4.1.345: Phosphatidyl-myo-inositol alpha-mannosyltransferase.
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13439 Glyco_transf_4 Glycosyltransferase Family 4
A PF13692 Glyco_trans_1_4 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2gejA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2gejA02
8GPBA 5BNWA 3UYKA 3GPBA 1SXQA 2G9VA 3ZCQA 4CDRA 4N9WA 3S2UA 5DU2A 3CUYA 1H5UA 3T3EA 5LQDA 3Q3IA 3G2IA 4GZ3A 3TSAA 1P4HA 4XIFA 2OFFA 2VCEA 3BD8A 1UQUA 1GGNA 4AY5A 2R4TA 4RIHA 2R4UA 3RSZA 1NOIA 2R68A 4BFCA 3SYMA 4BQIA 4MHSA 3CEHA 1EXVA 1XL0A 2VG8A 3FROA 3EBPA 3CV3A 4N3BA 3NAZA 4KQMA 1K06A 2AV6A 2QN7A 2VSYA 3MTAA 2G9QA 4N3AA 3VUFA 1YGPA 3T5TA 1LWOA 2X0FA 2XGSA 4EJ2A 1Z8DA 3DDSA 3E3NA 9GPBA 1FS4A 1PSWA 3MQFA 3OY2A 1XOIA 4MICA 2XA9A 1AXRA 2GJ4A 4NC9A 3ZCSA 1O6CA 1SXPA 2G9UA 3HBJA 1UQTA 3G2LA 4RBNA 4HWGA 3T7DA 1NOJA 3QHPA 2GPAA 3OTGA 3T3GA 2KS6A 3EBOA 1WUTA 2ECPA 5GPBA 3PE4A 3T3IA 3S27A 4EL5A 2F3UA 4WHMA 4CTOA 3SYRA 3BD7A 3PE3A 2X6QA 1Y6GA 3OTHA 2GT1A 2QN1A 5JTUA 1E1YA 1E4OA 2HY7A 3OY7A 3IA7A 4M7PA 2FFRA 1F6DA 3S29A 1V4VA 3ZCVA 1JIXA 2R60A 3QKWA 1FA9A 2FETA 3MS7A 2X0DA 2C1XA 1NOKA 4GZ6A 3ZCPA 3C48A 1PYGA 2ACVA 3BEOA 1KTIA 6GPBA 1FC0A 2PQ6A 1J39A 3L7CA 1PN3A 2QN8A 3MRVA 2IYFA 1L5VA 3S28A 1JG7A 2QLMA 4WADA 1AHPA 4RENA 2F3QA 2O6LA 2QLLA 1L5QA 3ZCUA 3COPA 3E3LA 4FKZA 1Y6FA 4MI9A 1QKJA 2P6PA 2PRIA 2BGUA 3MSCA 2IV7A 2QRPA 3CEJA 2ASVA 1Z62A 4GZ5A 4NESA 1FU4A 1FU7A 3E3OA 4YI5A 5IKOA 4RIFA 4AN4A 3VDMA 1WW2A 2H1FA 3BCSA 1Z6PA 4N39A 2ATIA 2XCIA 3UYLA 3G2KA 2GEKA 2JJMA 1NZFA 3MS2A 1XL1A 5IKPA 3L7DA 5DLDA 4YUAA 1FTWA 5JTTA 3RSCA 2GPBA 2F3PA 2VSNA 1UZUA 1WV1A 2XCUA 3BCRA 3T3DA 2XGMA 2F3SA 4EKYA 1JIVA 1RZUA 3NP9A 1FTQA 2F9FA 3DDWA 3G2HA 2QLNA 4FZRA 3BDAA 3WC4A 2R66A 3MRXA 1YA6A 3D0RA 4PQGA 4KQ1A 1Z6QA 4BQEA 2C9ZA 3L79A 4REMA 3RT1A 2XA1A 1LWNA 3CUVA 1P29A 5TMDA 1L5WA 3HBFA 2QN3A 1WV0A 1M5RA 4QLBA 3CUUA 3D0QA 3G2JA 2AZDA 2XA2A 2XGOA 1JEJA 4LDPA 3NCHA 4MI3A 4G2TA 4HLNA 2QNBA 1JIUA 2ACWA 7GPBA 3NPAA 5TVGA 3L01A 4MRAA 3IAAA 3OKCA 1PNVA 2C1ZA 2IYAA 4F9FA 1P2BA 4AMGA 2GM9A 4YI3A 3VDNB 2QN2A 1NZDA 3NP7A 3ZCTA 1IXYA 3S0JA 3HBNA 4AY6A 2JZCA 5TMEA 1GPBA 4RIGA 2QZSA 2SKDA 5I45A 1K08A 4RELA 3H4IA 4LEIA 4MHOA 1GPAA 2IV3A 2IW1A 3C4VA 4BQFA 4F97A 2BISA 1C8LA 2QRQA 1XKXA 1RZVA 1NVKA 2JLBA 4N3CA 3MTBA 4GYWA 1RRVA 3OTIA 3MTDA 4RIEA 1BX3A 5D01A 1JG6A 1GG8A 1FTYA 4F96A 3MBOA 4X7RA 2BGTA 2BFWA 2GPNA 3OKPA 2X0EA 1XC7A 1NLMA 1EM6A 3CUTA 3Q3EA 1WUYA 1A8IA 3L7AA 4X6LA 1GFZA 2IUYA 1F0KA 5D00A 2VCHA 5HXAA 2QRHA 4KQ2A 3TAXA 3BD6A 3BCUA 3L7BA 3GUHA 3T3HA 5ENZA 3DD1A 2PRJA 1ABBA 2SKCA 2QN9A 3WADA 3VUEA 3OKAA 2XMPA 2QRMA 4M83A 1Y8ZA 3HBMA 1L6IA 4M60A 2WTXA 4GPBA 3ZCRA 4WACA 3NC4A 4GYYA 2GEJA 3G2NA 2G9RA 1L7XA 1GPYA 4EL0A 1L5SA 1GZ5A 1IIRA 2X6RA 3C4QA 3AMVA 5C1DA 2PYIA 1HLFA 3D1JA 2H1HA 2SKEA 3MT7A 1P2GA 3MT8A 4X7PA 3O3CA 2AMVA 4AMBA 1WW3A 3MT9A 2ZB2A 4CTMA 1P2DA 3RHZA 5TMBA 2Q6VA 3DZCA 3OT5A 4NEQA 4CTNA 4X7MA 3NB0A 4L22A 1FU8A 1P4JA 1B4DA 2IEIA 4RIIA 3CUWA 1C8KA 3CX4A 1XV5A 4Z5XA 2QRGA 3Q3HA 1QM5A 1C3JA 2PYDA 3H4TA 3MRTA 1P4GA 2AW3A 2IEGA 2YJNA 1L5RA 3CEMA 2C4MA 3TOVA 1VGVA 4EKEA 3WAGA 1C50A 4MI6A 4W6QA 4XI9A 2FF5A 3MS4A 5DXFA
chains in the Genus database with same CATH superfamily
2H8KA 3OSZA 8GPBA 1RRPA 3Q9NA 5BN3A 4EGJA 3SWWA 5C5DA 1MX5A 1QVRA 1U02A 4QHTA 3ZDFA 4XUDA 1OI2A 1M83A 3CW9A 4QSMA 2XAAA 2ZIZA 5IZ4A 3R0QA 1H2EA 3G2IA 3F3SA 5FNZA 4H59A 1UXHA 4HMQA 2RHTA 4JIMA 4PG5A 2ARKA 2IZ0A 1G64A 1XK7A 3R6DA 4AUNA 5CITA 1I2CA 1L7EA 1YRWA 4KMMA 2YW2A 3JWHA 3GARA 2J5RA 2MSNA 3C3DA 4FGLA 4W9NA 4I3HA 3WKCA 3I52A 1S7CA 1YJXA 1Y1KE 4QODA 2R4TA 4MLPA 5D5PA 4H7EA 2DPXA 3C8HA 3ERCA 3SYMA 3IPRA 3EGXB 1USWA 2CNOA 3HJUA 4BFXA 5K45A 2DSTA 3MJ4A 1TAGA 4R1NA 4UEKA 2JVKA 5D8DA 4ZT5A 1F06A 1A1SA 4MJ7A 1WDTA 3U4MA 1XPRA 1XHFA 1NFFA 3BMXA 3OFVA 2V6FA 4ME6A 1XL0A 3B6EA 4GEKA 1ZXXA 1KQNA 1ZI8A 1NNSA 2W2LA 1SQGA 2W83A 1Z0IA 1Q22A 2JFOA 2JI9A 2Z2IA 4ZMRA 3UIEA 3T0GA 1M74A 1B6SA 2O05A 2VSYA 2UVPB 4C2BA 4L0QA 3NHJA 3NUZA 4G1MB 4RMIA 4G6ZA 1Z7GA 2BOVA 5GM1A 4H6WA 2REBA 3KSBC 3PUWA 1FRFS 1GUDA 3ELYA 5FWYA 5FPPA 1J90A 1QANA 3FMIA 2EBFX 4B83A 1X42A 4L16A 3D6NB 3IURA 1YD7A 4PVDA 4HNRA 2IZ1A 5M5BA 1ICEA 3TRHA 4NCBA 4EJ2A 4HWSA 2Z04A 4I1YA 3NOXA 5KTKA 2QQEA 2XHZA 1G55A 3PG5A 4YCSA 5AW7A 1EDOA 1JKJB 4HGOA 3A3NA 4KX5A 4P7JA 5FUVA 3ZWBA 2J59A 1AXRA 2OXEA 1JU4A 2W37A 2XA9A 3PP8A 3EW9A 4NC9A 2Q7OE 2FFQA 5M7EA 3I8OA 1Y1LA 1FNCA 3THRA 3VU8A 3HB0A 2GCOB 2X13A 3FAZA 3LGSA 4TLAA 1V5FA 3G8CA 3N2LA 1D6NA 4OGFA 3T7KA 4NBLA 1DO8A 4R9SA 2J3LA 2OGWA 3ENWA 1IFXA 5LA6A 1O95C 1Q7RA 2LDBA 4GDFA 5A9SA 1UANA 2C5EA 4O0LA 2VF7A 3HYCA 1A27A 1ETHA 3REGA 1KIFA 1WO8A 3SLGA 2VPQA 1LQTA 3ZHCA 4B3CA 1PGPA 1WDKA 3AJ9A 3FJOA 2IYTA 4BMXA 2F00A 1HFJA 3DBLA 5AMXA 2XKAA 3QX7A 1HYBA 1MVOA 4OLFA 5AWFC 2ZRNA 4DM4A 4E03A 1Z28A 1XU7A 3PHCA 2K4MA 4JHLA 1EA7A 5LOVA 3OQNA 1N5JA 3RNOA 1DCMA 2P9FA 3B6JA 2ZRLA 1NR7A 5TR9A 3NT2A 1N2GA 3P96A 3PFFA 4L07A 3II6X 3M81A 2REOA 3TLEA 2VP4A 5K01A 1E4OA 2HY7A 3BFJA 3OLQA 1SKAA 3CIFA 3FKSD 2VOJA 3HDVA 4DQ0A 1ZGJA 1KF0A 1G7CA 4ZREA 3SVZA 5CBPB 4J8PA 4NENB 1Q14A 1JIXA 3H5LA 4KR6A 2V03A 3PLAE 3OSUA 1ID8A 3BK7A 1JLRA 1ZVJA 3I76A 3M3DA 1Y1PA 2Y92A 2ZE8A 3GFFA 4JP8A 4M55A 3RARA 2FN4A 5KJEA 3IRVA 2QT0A 3KQUA 3ZWXA 4BATA 3C48A 4KR3A 2D1QA 2BI8A 3AEUA 1Q77A 3EUWA 4A6XA 2CDCA 2NSYA 3MGCA 2H1OA 2Q1YA 3VZSA 2PMFA 4EEZA 3EFOA 1IATA 1DBSA 1K7FB 2I8LA 1CZOA 1F2UB 2XCLA 3S28A 3VZRA 2QW0X 4AI6A 1QVVA 3OLCX 4KBGA 4QIHA 2HHHB 1B6RA 1H1LA 1WVMA 2PS1A 4YDQA 3OZWA 1G8PA 1GUBA 4PY2A 4GSKA 1SRRA 1C14A 1RLIA 1Z8NA 2PLAA 2QPTA 1J0EA 3HVUA 2BTOA 1VE6A 5EUMA 3NXKA 2HSJA 2GJ9A 3BMOA 5J40A 1I8TA 2QJRA 4JXXA 2HI0A 3OX1A 2EIHA 4RDCA 1QHSA 4Y98A 1XLWA 1UOEA 2YXDA 4J2HA 1RKQA 2R7KA 3RC8A 3O1HB 4IS3A 4XAQA 3EEFA 2ZYDA 4GLJA 1NV9A 4LWZA 2VOEA 4XR9A 5F78A 1J4AA 4JDUA 3DB2A 3PA6A 3SE0A 3HVKA 3HV2A 4UUNA 2YVUA 2RHWA 4TS9A 3R9XB 2V7VA 2O3SA 1XQYA 4FOOA 4X91A 2FW8A 3DQQA 2JLVA 4HP8A 1C9NA 1EJ2A 3QU5A 3LT2A 1FU4A 3Q3JB 2CJYA 2P4QA 1VSUA 4WK4B 2WTMA 5BN4B 2PUTA 3S4YA 5ALKA 1U3UA 3G23A 3WGZA 2DERA 2BMWA 4E12A 4NFHA 1P5ZB 1YL7A 3S2EA 3E22A 3JQGB 1EESA 3BB3A 1SVIA 4Q4HB 3CVOA 3BCSA 2FSSA 4D8WA 4NJOA 4NZ9A 3M89A 4XYEA 1QQ5A 3G2KA 3LZDA 3ML1A 4IOMA 4V0MA 5EUCA 3GZTB 3SLRA 1XVVA 3P0FA 3THWB 1I7DA 1BS2A 1SIOA 4FIDA 3O4IA 1M2HA 1FDIA 1R6TA 3ID6C 4J0KA 2IEYA 4LV8B 2GZDA 3KHSA 1XK6A 3MWJA 3OZGA 5BYJA 5TC4A 2F7SA 1OXMA 2SNIE 4RTPA 2P69A 1XROA 5EPOA 3T9BA 2F43B 2EEPA 4UTRA 5C18A 3DMTC 2B5VA 2FZVA 1OFUX 2LIVA 3JZFA 4H60A 5FF9A 1U1CA 3BVPA 3FYDA 1EP9A 3IVCA 2HM7A 3P1JA 3A3YA 5DLYA 3C85A 1LDNA 1G9TA 4MWSA 2AX4A 4XRGA 2C4HA 4ZYTA 1O4WA 3T3NA 4O1IA 3F9RA 3PDUA 4F06A 3I4CA 4Q4HA 2QYSA 1REQB 4CR6A 4V1CI 1NVGA 3IOEA 1NN1A 4M1SA 4OHRA 4RADA 3NJRA 4RMHA 4UEQA 4NYJR 2ZUCA 4E4RA 1HL7A 3KB8A 3H1GA 3EGIA 3UBTA 1XSEA 4RFLA 5KYGA 5ALNA 4XGRA 5CIQA 3G2HA 2ZWMA 4QBGB 3JVIA 3I2HA 3QYAA 1C30B 4NCHA 4AT1A 2BKLA 3F8WA 4CIYA 4ER7A 2QX4A 2CLEB 2OV3A 5DGHA 4B85A 4D57A 2F43A 3LP8A 2DUUA 4PQGA 1Z6QA 3T61A 1XTKA 2Y9PB 3HADA 1FJ2A 2VUUA 1ZESA 4J2OA 4NWIA 4OHUA 4MPPA 3VR4H 1BDIA 3V32A 4MGKR 1SUIA 3NAQA 4OIMA 1UBUS 1W0KD 4HPJB 1SPXA 1VB5A 2UUCB 5M2QA 4L3WA 3V1YA 3ZHVA 2JVJA 3F3KA 3AP3A 4A92A 2VJYA 4OMCA 4TPKA 4CG0A 3F1LA 2JANA 3DMGA 2V1XA 1LUAA 4KMRA 2O2HA 4HH4A 3BIWA 3K6KA 4W5QA 5ILOA 1VJ1A 5AKEA 2J9RA 3U3JA 1Q50A 3GRKA 1I5RA 4C4ZA 4CM3A 5BXYA 1GCIA 4I1UA 2X77A 1MAUA 1EFAA 3ZJUA 3IH5A 1TO1E 4GYJA 3KALA 1O94D 2QWXA 2J32A 4BU0A 3LGXA 3M6LA 2UYHA 3CH6A 1DVRA 2X7XA 5DYNA 3HEAA 2G83A 3W9SA 4BVAA 2BZGA 3LWZA 4MVJG 2XYRA 4ZOBA 5AUNB 4XWKA 2JB9A 3BZWA 2D0DA 3DFZA 4KHZA 3NHZA 4ND6A 4UZSA 5CHEA 4X1KA 2OWEA 4KPEC 1P2BA 1EBBA 2HIGA 4QNMA 2DX7A 3HXLA 2AFHE 4AS2A 3MWDB 1RPTA 1J8DA 1KAHA 4FBGA 3VAYA 4C03A 1BYUA 4GE0A 4LOIA 4C89A 3BX1A 4R3WA 2CVZA 1JDVA 4Y2GA 4EO7A 4IF6A 2B1IA 3KK0A 3QKSA 4HZUA 4R5HA 2WV7A 1SR8A 1UBSB 4RZIA 4QX6A 5AVQA 1RZRA 1NM5A 1O6ZA 3DMFA 1X92A 4HS4A 4TKMA 1GPBA 5FPTA 2A86A 3ZWOA 3ZWWA 3DOFA 2AK3A 1IOVA 4HYTA 2CEAA 4MA5A 3LPDA 4ZFNA 3PNVA 1D2MA 5B1EA 1LKZA 4JOQA 1CWUA 4O5OA 1XJ0A 3E70C 2HKIA 2XEDA 1OXTA 1Z75A 3OZVA 1NL3A 2QZ9A 4RK6A 4WFIA 5HOEA 3LM8A 3R0ZA 3BMCA 4D4HA 3LZ6A 4GGOA 3CZ5A 2D5AA 5TIIA 1YC5A 2YWXA 4DR3B 3TJZA 1BXRA 2NNLD 3LPMA 3GDOA 4JL8A 4M89A 1QYDA 1IBCA 1GG5A 3WMXA 1ZN2A 5FV4A 5E9WA 2HUNA 5EZYF 3WX0A 1OH6A 4KYVA 3AUUA 3WQSB 5FLXA 5IPFA 1LX7A 2NU7A 2OHOA 2Z3ZA 1H2WA 4G1CA 1R0KA 2ZB3A 2JAOA 1JB1A 4BLUA 3HVJA 3MMPA 4PZAA 4WEOA 4Q5IA 4MZDA 1AH2A 1DELA 3N8HA 3UWMA 3U0BA 3VV2A 1T9AA 4KGZA 2WI8A 3EVNA 2BFCA 1Y9ZA 4F9GA 2LCIA 1YASA 3BZBA 4YCMA 1ADBA 1P7CA 2PX6A 3PI6A 4RABA 4DW8A 1NRWA 5C8VA 5HZHA 3SYNA 4RGQA 1T13A 3DOEA 1UPAA 3QPVA 1N2EA 2VDLB 4YASA 1P7ZA 1U5BB 4US1R 4B6QA 4DTCA 4X8LA 1DIBA 2ERYA 2YIDA 1T3TA 4R05A 1VBFA 1Z22A 5ALUA 5EXXA 3WYCA 3GLGE 1TUEA 5A9RA 1MX9A 2DHRA 3K8YA 3WP1B 4BAZA 4TYYA 3DMNA 4H1VA 1D07A 1FTYA 2OCGA 2WAXA 3V4OA 1WOYA 4KZKA 3TEJA 3TIVA 2WAMA 4ARZB 3RU3A 4NXNB 3DM5A 5H5JA 3AF4A 3HV0A 3RK0A 4GQBA 5I6DA 2O3TA 1RPJA 4E7PA 3B2QA 3T9CA 4M9UA 5IDXA 1ZM9A 2VK2A 3I3OA 4WINA 5HK8A 5C2JB 3MAGA 1Y8RA 3B8EA 3V34A 4MI1A 3NTQA 3DFMA 1ZO8A 5SZHB 4NNPA 5ALYA 2N75A 1BFUA 1K88A 2FRDC 3HSSA 3CRQA 3I58A 5T41A 3GZNB 2J3MA 3RO7A 5JNSA 2YOGA 3BD6A 3E8XA 2NN3C 2PTGA 4J0FA 1X1QA 2B98A 1PI3A 3IAFA 1AGRA 3OIYA 4GLLA 4PEVA 1P2FA 4BVKA 3UT0A 4YAJA 2W8ZA 2GZ2A 4XTRA 1QP8A 1W36B 3STXA 1G98A 4W82A 4DIKA 5C3UA 5THKA 2D2VA 3AY6A 2HMSA 2V98A 3LUAA 3HS3A 1I2ZA 4RPHA 4QSHA 4INOA 4L8FA 1C3EA 2PJRA 1E8DA 4BVLA 3SX0A 4BX2A 2VQEB 3AL3A 2TMYA 3FDFA 1NPDA 1ZD2P 2IQ5A 3WDLA 4CODB 1KWKA 2G63A 2YOFA 3WFJA 3IDOA 2PZBA 2X42A 3IFSA 4G63A 5B36A 3I72A 2XIQA 1QPZA 5D5HA 2VDRB 4UREA 2YWFA 3NGMA 4A2CA 3FAKA 5KX5F 3ILHA 4J16A 5I7OA 5ALEA 2B1GA 1H22A 1L8AA 4HLUA 2N3ZA 2P9HA 5BT8A 2LIPA 4A8HA 4LV6A 2QBYB 1RAEA 2JHGA 2O2JA 1N6KA 3IIJA 4M1EA 5AKLA 3EY9A 5J1SB 4NCKA 1IJFA 3L8ZA 2ZSIA 3QHAA 5DE3A 1HO3A 2J09A 2ZJFA 5ER6A 3S7ZA 1TFUA 3TXXA 2GCIA 2FEWB 3DV2A 4F3YA 3F74A 2ZR8A 4G0XA 4IUYA 1VPWA 1UPCA 2FPGB 3T1QA 4JGIA 3E6AA 4MO9A 5EWJA 1S4MA 2YOHA 4QQ8A 1VI5A 3KG2A 2MSLA 1OYYA 1Y1SA 3CR3C 1W85A 3WLEA 4CTMA 4LX0A 2OYSA 5BV8A 3C98A 4C7KA 3MTEA 4YRPA 1ADJA 1M6WA 4PBTA 4QGSA 1ZJWA 3ZHQA 3SCZA 2Q6VA 2ZYWX 1CR1A 1T34A 2I4NA 1F8YA 3N0TA 2FSIA 3VR5D 2X0JA 4EFDA 2WA1A 4RTSA 5IT5A 3KKQA 2CHUA 8ADHA 2CKDA 2G4VA 4C4RA 3IEVA 1X13A 1FPMA 3IIIA 1E92A 2XXAB 2X8BA 3GYBA 5AK0A 3EVGA 4CKEB 4FT2A 1XCBA 2P3QA 1CULC 4QEKA 4IIDA 3GJ5A 3CVVA 4DV3B 3BDIA 4Y6SA 1CIPA 3C5WP 4GP6A 2Q99A 4AU1A 5JJBA 1SG6A 2OGTA 3Q15C 4OBEA 4DDTA 4DYHA 3RIEA 1M0TA 2ZUDA 4LVUA 2ALJA 1MZVA 2RHRA 5JHHB 1VECA 4XFKA 2ZQYA 1R15A 4UBJA 2W7TA 4D9GA 1HKHA 1MV8A 3P4YA 1QC5A 5KNBH 1GT6A 4DBLE 1JR4A 1JEYB 2AXQA 1EDBA 3H11B 3OWXA 3LHFA 3OUUA 3STYA 1ODLA 3JQAA 1V45E 3PX7A 2ORED 3P9SA 5AVUA 3EOBI 3P2IA 4MULA 2PUHA 2YN2A 2Z1NA 4B74A 1IUNA 5HKLA 3CKMA 3FFTA 1VRWA 5I51A 4EHNA 4JXKA 3VU1A 3N87A 4CDRA 2FK7A 2FOIA 2YIJA 4JZYA 2J0EA 3BWDD 1LDMA 4QFDA 4YJ2F 1GFSA 1GSOA 5DM4A 4XRRA 4JK3A 3C7DB 2A94A 1BGXT 1NF3A 5JASA 1H6DA 4RF5A 5D3ZA 3NM6B 1M1YA 3ZDDA 1S89A 2VP0A 2PKQP 4OLJA 1UEXC 2NG1A 4XLLA 4IV0A 2OD7A 5JALA 3BRWA 1EM8A 2BE9A 3SHWA 2I9KA 1MO3A 1RZ3A 1ILWA 3BD8A 1B00A 3O31A 1KE1A 5YASA 4OQNA 1W1WA 4L9SA 5AIAA 2OV6A 4C6RA 4HKTA 1ZKMA 1UBEA 1MEEA 4FFDA 3O4JA 3K70B 1NOIA 1ZBDA 3WFZA 4AJJA 2Z3VA 1NBMA 3IT3A 1U8YA 4L76A 1YI8A 1NX6A 1T3SA 1TZJA 4HYQA 2GHQA 2C07A 2XKBA 2PRYA 3B51X 3QBVA 4P22A 4GLFA 3KVNA 3Q3VA 2WYUA 1EI9A 3BG5A 3PBKA 2H52A 4G4SO 2ISQA 2R3SA 1Z6YA 4M54A 4OJNA 1YL5A 3OEED 4Y1FA 3EA0A 2CZGA 1SUSA 4FHCA 1Y48E 5AKIA 1LSJA 3BEDA 2GBLA 5DNCA 4W5RA 4HLDA 2FFHA 3O8DA 2AYZA 2QVCA 3KAQA 2ZSKA 1QC5B 1JEYA 4RHUA 4ZYWA 3OT1B 3ZHYA 4IZHA 2QAJA 3FGNA 1F1JA 5LUAA 3THYA 1P7PA 3FPGA 3OOEA 5EMHA 3ETEA 3EAGA 2DFDA 3DKRA 5KWIA 1TVKB 4KLAA 4OHFA 4HF7A 4RK0A 4F1KA 2HXGA 3QXJA 1QK5A 1AKNA 3VZPA 4EQ6B 2EKQA 1QRRA 1KXZA 3LD9A 2XWSA 1CP2A 3A05A 3MM4A 1YZQA 3OZDA 1ES9A 1HT2E 1R64A 1X9IA 1I7NA 3FMVA 4K05A 5EA2A 3U09A 4MDEA 2F8TA 4JXZA 5A5VA 3FYCA 1MRSA 4DC9A 3TFOA 1OW3B 1PL6A 2FFJA 1IN8A 2HLPA 1QRAA 1XOIA 1KJ8A 2GD6A 5BT9A 3V3KA 1KDYA 3L7IA 2JATA 2M6SA 1YZGA 2CJWA 2HWUA 3EQ9A 4I4TB 5CCDA 1WNFA 1LPOA 3RVOA 2F55A 2WHRA 2H5JA 2Q6OA 4GKVA 4CEIA 2AMJA 2ATVA 1NJ2A 3U0VA 2G9UA 3V4VB 4ND5A 2RE8A 3O1JC 1OX5A 1NW7A 1P74A 3MPOA 1B8OA 3WTBA 4CQNA 3TQRA 1PQUA 1ZUD1 1PDWA 1L4HA 2FZWA 2BFNA 4GGMX 3K9CA 3OJCA 3FOBA 3L04A 3VR5H 3X2FA 5E9JA 1TLLA 3D4BA 1R0YA 3OTGA 3NT4A 3QEMB 4I4NA 1RR6A 1QXSA 2E6KA 1GP2A 1S02A 3EXFA 1Z2OX 4UE2A 4NMXB 3EBOA 5EERA 1W36C 3YASA 3VVCA 1K6MA 5GPBA 3B48A 3QUCA 3B5EA 3V8MA 1GY8A 4WFKA 3U7EB 3EG5A 3M9XA 4HLQB 5JQGA 2R00A 3LUKA 3AF5A 1E5VA 1I0LA 2GT1A 1N25A 2PZFA 2QN1A 2WJ3A 5C1IA 3NKFA 4O5AA 1C3OB 4EBBA 1B15A 3KT0A 1TQ2A 3PUKA 3OLVA 1GEEA 5JD6A 1H6BA 3CNOA 2W0SA 2UYYA 3ESCA 5FBWB 3V4SA 8LDHA 1OD6A 1WETA 2H8GA 1HE4A 1OBOA 4B45A 4G86A 2IS1A 2HSWA 3ZXXA 2V7PA 1FP4B 2PX8A 2Z98A 3A9RA 1SG9A 2ZDQA 3HDQA 1NKSA 3GPIA 1QQTA 4G37A 4EVQA 1G0OA 2HBQA 1AQYA 3K7EA 5CD9A 1WEHA 1U99A 1X7YB 1YXMA 2WEKA 3ZWQA 2BCJQ 2ACVA 1W47A 5J3JA 5JNVA 1W4ZA 2I6FA 3L7CA 3ZTTA 1KYXA 2JFPA 1J33A 1NLUA 3S29A 4PICA 2BY4A 4GWLA 4OQLA 2OB1A 3AEYA 3JRWA 3C6ZA 1TZMA 2JD2A 4X5OA 2CXPA 5LQAA 1F8XA 3LVQE 5BR1A 3KKOA 4J1TA 5EHXA 1WCYA 2D6FA 2JF0A 1KFCB 4MRVA 4YJGA 4NR0A 4CM8A 1A4IA 1JKFA 4HK4A 2ACKA 5I7WA 1BC5A 2E21A 3CT6A 1ZK1A 3K9WA 1F48A 5B6IA 1W2HA 3FJ1A 4G1VA 4HGNA 4JI0B 1GAEO 2YHAA 4IV8A 4O2LA 3KU1A 2VJAA 4L4XA 3T52A 1K7CA 1RKXA 1W59A 4EYKA 2QTVA 3NATA 4RKEA 3KCNA 3MA0A 1ESZA 1S2NA 2Z4TA 4NESA 1L9XA 5E6UB 2ERXA 2YRWA 4OFXA 2P3SA 5HG0A 3ZWCA 1WHSB 2JIQA 3LXRA 2PGDA 4B40A 1J0AA 5HRAA 5L4NA 3H9JA 3U7QB 1JAZA 4A23A 4A15A 3HJTA 3ZJTA 2P5YA 4WL0A 1SIWA 3UANA 1K4YA 1HSZA 1RYBA 1Y3IA 2J3JA 3EZ7A 1HI9A 3F6YA 1Z6PA 3MINA 3JZIA 4I1VA 5EPEA 5GIPE 1G6HA 4ZTUB 4R2XA 1IZ9A 1QHFA 3A06A 4I1OA 4QGFA 2OBYA 2HUPA 1KEUA 3SDBA 1L7NA 4B4WA 1Y6ZA 3LHDA 2RIPA 3A9VA 2WIFA 4B87A 4FDTA 2JLWA 4V0NA 5AJVB 4TMXA 4LJ9A 3IBCA 2Q2VA 1WE2A 4TGLA 2G77B 3ANSA 3IDQA 3OE5A 5IW8A 1EX6A 1U04A 4F93B 4K28A 4B5KA 1P77A 2VSNA 4II2A 1UZUA 1WV1A 1U3TA 2L17A 5C8YB 3BILA 3V46A 2H4ZA 2PUCA 3W3AH 1J2RA 4P4SA 2P62A 4PFSA 1GARA 1R0RE 3DR5A 1M9NA 3R5XA 5L53A 2NZWA 4HNAA 4QYSA 5K3FA 1U7PA 5CDSA 2CVHA 5LZ2A 4R6XA 2NXWA 2O8DB 1G8AA 4BGEA 1HBJA 1PV1A 3HU3A 4EA8A 3FOCA 2HCFA 1BU5A 3TL3A 5B3JC 4EATA 5LZ9A 1J9GA 3HB1A 3LUJA 3RREA 4KWCA 2D1TA 2DUMA 3GLHE 3TGWA 4L8GA 3S8YA 1FW6A 2XXAA 1SU4A 3I34X 1K6JA 2BGIA 3GEHA 4R8LA 4W1QA 3VO1A 4DNPA 1H66A 3IUSA 4UCWA 1EVJA 1Q84A 4MV6A 3P4XA 5U4XA 4I55A 5HGXA 3H2JA 1HORA 1JLSA 3KX2A 4MLDA 5K0TA 1DOHA 1EUCB 3EMDA 4NJEB 2NP6A 3VPBA 2P2YA 1DC5A 2AL7A 4FW9A 5EIWA 1M5RA 2G9ZA 2ZS9A 1YIAA 4IOKA 1TI7A 1UFOA 2BBWA 3WNZA 2HHAA 1CUAA 1O6BA 1JZTA 1M5UA 1TCBA 4I9UA 5EP1A 3EQ6A 1BJKA 3AR6A 1DAPA 4QVGA 1G7SA 5HCNA 2ADMA 4DUPA 4AO8A 4NULA 1VB3A 1VE7A 1WPXA 2A67A 4HUTA 1IBLB 3GRAA 4TYMA 5B3KA 5DM1A 5JY6A 2AN3A 3EIUA 3Q7SA 1EDEA 3QPUA 2GD2A 1NNI1 4UHDA 1HTBA 3IAAA 3KL4A 3RVKA 5BN5A 2KYRA 2Z9BA 3H2GA 3OPNA 2DPGA 3UK1A 4BFVA 2DCUA 4P5DA 4FJ0A 2R6ZA 3N8GA 1P2VA 2DXIA 2ZLBA 3EHDA 2W6QA 5AHKA 1XCGB 3S7TA 1OB2A 1A04A 3AVUA 2ZI3A 4B32A 4BUCA 3PHBE 2HRZA 1TQHA 1A8SA 4MQEA 1PSZA 3A4VA 1GRNA 2R5FA 3MERA 3R6WA 4M38A 5ECDA 5DHQA 5JS2A 4CM1A 5IT4A 2KPOA 5DSTA 1VYVA 1N75A 3U3ZA 3B3GA 4BNNA 4TLMB 3SG0A 4W5JA 3QVJA 3EH2A 5CDFA 3AM1A 1CUZA 1FP2A 1QKKA 3DSRA 4M9SA 3DE6X 1GRQA 2EX0A 3TQQA 4YCNA 5KCZA 1XZJA 4HRXA 1L3CA 3QBDA 4J1TC 1OLUA 2EFEB 5JAIA 1MABB 5KCMA 1ZM7A 3RBXA 5IBQA 5ALXA 3CF2A 5BUQA 4HDMA 3CS3A 3C5VA 1AVTA 1T3LA 1K2VN 2ZJYA 2I6QA 4DUGA 4D4KA 5ICFA 1C7RA 4RFSA 2JEYA 1LBSA 2PANA 4IXDA 1LD3A 4LRTB 5CGQB 2J6CA 4JUFA 2XLBA 5ARBA 1LSSA 1ACMA 1PZHA 3D7KA 4YHHB 2IDKA 3U4GA 5ALDA 2Q9AA 4BOYA 1DB3A 1FCJA 5G0VA 4CCAA 5FTMA 3IJ5A 4ARSA 1RAHA 1CCWA 3P19A 5KU7A 5E1DA 5K3AA 5L8VA 2QRNA 4CKWB 1T1IA 3UMRA 4UASA 3VHRA 1Q1GA 1W76A 4PSKA 1EG7A 3F4KA 4WRRA 3UCEA 4GOLD 1YA8A 2DWQA 4NQRA 1NW5A 4UMEA 3TAHA 4F8EA 4CCSA 1ZOPA 5ESRA 5E0KB 3KJZA 5SV2A 3GGSA 2MSKA 4GO1A 3IT1A 3PD0A 4JLVA 5FB3A 2DTXA 4G2NA 4GXQA 5KQPA 1N5DA 3KD3A 4OQQA 2B20A 1YWGO 3GZNA 3TSOA 3H9GA 2Z8ZA 4G5HA 1ZCZA 4MQEB 1R3DA 1VRCA 2JHFA 4ZIRA 2IXTA 1OA0A 3F8TA 4NP6A 3CPSA 3QW4B 1DBQA 3TPZA 4OLAA 3D4PA 2BFWA 1TRKA 1J22A 3E58A 2RGUA 1F7VA 1MT0A 3H7AA 1LVGA 4JQZA 2HDHA 3QXSA 3HPQA 1FJHA 1HA3A 1G5TA 1HURA 2WPDA 2XBUA 1MFPA 3Q6MA 3DWFA 1CB7A 4FDAA 4H0CA 1SG0A 3FX2A 4CCYA 4FMPA 1QONA 3AL0C 3OMXA 1YVUA 1AS2A 1TT5A 3EZ6A 4OHVA 5I9LA 5HXAA 2I6SA 3AY7A 4G5YA 2NACA 4GR4A 3TN7A 1PR6A 4XWOA 3NEPX 4XCXA 2O8FA 1MDBA 1OT3A 3B60A 3INGA 4HI0E 2G76A 1QZTA 3QFFA 4Q3DA 5EJ4A 1KVUA 3HCCA 4O1HA 2O1WA 3LHIA 2ODPA 3Q5DA 2ZJAA 3GDFA 1TX4B 2SKCA 3L7YA 3MD0A 3DLHA 1NAHA 3F7MA 2Q62A 4NV3A 3TW8B 1XJCA 2FPPA 3I64A 5HS6A 1DEHA 4KWHA 1SZJG 2WIAA 4U7PB 4BKRA 5JNTA 3U1BA 2CV1A 2WDPA 2FWJA 5TSDA 3HU2A 2EL7A 4GPBA 4BFTA 5CRIA 4FLEA 4BC1A 4K5QA 2RGNC 4DIOA 3EVZA 5LP6C 3F0TA 2DZDA 1AJEA 3G0BA 2G82A 2J5QA 1T2DA 5AK3A 1Q0QA 5C80A 3L0SA 2I87A 2QMUA 5AFSA 5FOQA 5TF4A 1Y63A 4EL0A 4MYDA 1IIRA 1CK4A 1J2JA 5KOHB 4IKPA 3ADBA 1T5HX 1QOPB 2I3AA 5CDGA 5EKTA 3B52X 3PTZA 3DMDA 3MWLA 1I36A 5F3WB 4FQ8A 3BXPA 5EAIA 3ZHXA 2QTLA 4E94A 4LOAA 1E4EB 4R7ZA 4C7OA 1G8HA 1T3HA 5JT1A 1CR0A 1OVMA 4FVTA 1NUHA 4MVYA 4KSBA 1ZH0A 1YQGA 4RHXA 5DIFA 1T0UA 2IEAA 2H16A 4Y2JA 5D51S 4AMBA 4MVJP 3AHHA 2VT7A 3IQIX 2WJIA 5FI1B 1P80A 2R65A 4NICA 3CWZA 4AXBA 4XCQA 1WEKA 1HF3A 1BE8A 4TMYA 1EP1B 4CLHA 4K9SA 1E0SA 1E1KA 3GFTA 1U8CB 1Q2UA 4KPUA 2G7ZA 2Y1KA 4MUNA 4D4LA 4MPRA 1SQ5A 4ZVNA 1P1IA 3IUNA 4RWZA 1Y8QA 1C3XA 1ZA2A 1OHHA 1Q2XA 2GRJA 4I0WB 2C58A 2ANCA 1IY2A 2ONCA 3FSGA 4QYIA 5AT1A 2OYCA 1E69A 4I4LA 4RFVA 1A8QA 1ZGZA 2YZ2A 3PQFA 1NT4A 2QSZA 4TQ9A 3DJFA 1PX0A 5CJPA 1KARA 3JQEA 2R87A 4D3SA 4RQAA 3W5BA 4ISCA 5GWXA 2L42A 1JSXA 1LNQA 1HT3A 3ZE2B 4JSRA 4IDOA 1DQZA 2C4KA 1TIKA 4P4NA 4W5OA 4XOIA 3G1UA 3GAAA 1CUVA 4EO9A 1XMOB 1X3LA 2DFLA 3PIIA 3G9XA 3BD9A 2WYVA 3LW8A 4V0LA 4DVGA 1K8ZB 4W7HA 4ZA2A 5EP4A 1KP2A 3BJIC 2M6KA 2IEGA 1MB2A 2OV2A 2XQJA 4DA6A 1J8QA 1VGVA 4MKZA 1COWA 3FSEA 3TJMA 3HYRA 3ROEA 4IJKA 2HA0A 5JVDF 5CTAA 2WICA 4X9XA 1DINA 2ZK7A 3HZHA 2B2NA 2IBSA 4G0MA 2C78A 2G9NA 2NM0A 5DF1A 3A6HA 4FE7A 4HUQA 1KZ7B 3RVMA 3TLYA 5GJWC 4PAQA 3H83A 4Y9TA 3E82A 3X43A 5KYWA 1FVFA 3HPRA 4R2LA 1RWMA 2A78A 3MRSA 1QE0A 4FB4A 2IYZA 2AEMA 4DJAA 3JYNA 2RAPA 3A6FA 3AR7A 3D2BA 3IRUA 3B3QA 3K1ZA 1ESMA 3L1JA 3NM5A 4ODIA 4OP2A 4X65B 1US8B 2R7NA 3T7AA 4GAEA 1T1SA 3VPHA 3U7HB 3UFXB 3OPQA 2HMVA 4Y2XA 4OHXA 2WJAA 3T54A 1JPUA 3H2HA 5EMLA 5GV7A 4FD2A 4ALIA 2FG7C 3AR9A 4F2HA 5AKYA 5ARCA 4ZQIA 3VO8A 4BFCA 1XEWX 2PH1A 1Y9JA 3K53A 1LLFA 1UAYA 4Q19A 1T4GA 1WTCA 3OECA 2WG0A 4WBXC 2OAP1 3SR0A 2BW0A 3G8BA 3G68A 4MPJA 2OCLA 1EWQA 4MV1A 4PV7A 1QG2A 2YNMC 3N74A 3DT8A 3ECAA 1MZPA 4LY0A 4ETIA 2XUFA 1X1CA 1VYHA 3I6ZA 3SS9X 3KZMA 4TRMA 2CLOB 2NUBA 3BRCA 3CV3A 4KQMA 2X3UA 5JPDA 2C5FA 4OA5A 3CRZA 4OB7A 2P3OA 3JSAA 3KQNA 2NNWB 3ZI0A 3DNMA 1EFVA 1TFRA 2HJVA 3GLQA 4F4CA 3FDXA 3EPKA 1F14A 4JYZA 2VBFA 1PVVA 1EDDA 3AEXA 2BJWA 4OV6B 5CK4A 2EFHB 2NQ2C 2R1UA 3UMJA 4ER5A 4QXAA 1BQEA 3TTWA 1Y3AA 3KNZA 2WSSA 1UKCA 3ED1A 1E4YA 4IUCS 2RI1A 1OI3A 3DDSA 4FFLA 1U65A 5HCUA 1KZHA 4YEDA 5MFZA 2BFFA 3T1TA 2D3TA 2W2MA 2YBEA 1I3OA 1KYTA 3QSGA 4HAZA 4UEJA 1NQTA 3IXLA 4ROTA 1ILEA 1WDMA 2XDQB 1RXYA 3DE1X 1GWNA 1R5NA 3KDPA 4M36A 2VXBA 2YWCA 4LZJA 1U9IC 1Z0UA 5GVRA 2FA9A 2QD1A 3KEGA 5EMNA 2BR3A 5JCOA 4ESEA 3UFXA 1G6OA 2AUNA 4MRMA 5JCJA 4CETA 2PWBA 2DJIA 2YHBA 1F2VA 1NXTA 4IGFA 2VYVD 1CG6A 2VHTA 4CMBA 2AZTA 4XX0A 5TMPA 1QHEA 4PX2A 5AW9A 4AQ7A 2B83A 3IC5A 3OIGA 1B43A 1D2HA 2OQ2A 2HQ1A 1GR1A 3QHPA 1T15A 5FI3A 3OU7A 3VYRB 1XT6A 2H57A 3H5RA 4JT8A 1KMIY 4MCAA 1PS8A 4UU7A 4LRYA 5EJGA 4CR8A 4RMGA 4E31A 1XP5A 1DX4A 2VEOA 1BGVA 1ZCAA 2W6ZA 1C7FA 3A2LA 1D3AA 2A0WA 1GTVA 3IDSA 2R1VA 2C4WA 1TMYA 3LPCA 4EL5A 5DBEX 4GP9A 4Q1FA 3DA8A 4DANA 4PO8A 1CRPA 2GSDA 1MENA 2VL7A 3JD3A 1ZEJA 3CO0S 3KCQA 4RYDA 1Q0TA 2H7CA 5FEUA 1XF9A 4EHFA 1U7WA 3C3CA 2RH9B 4ENQA 4RY2A 3DXFA 5IABA 1FE8A 3OFNA 1SA0B 4WK2B 1O5TA 4XEHA 3VNAA 1OE0A 3VNVA 2JASA 2W6ID 4CU5A 2ZT6A 4HEQA 3SEZA 2ZGVA 4B3JA 1E94E 2C54A 3LLMA 4K6HA 1EJBA 3GWGA 3IB3A 3N0VA 4RL4A 4R8MA 3AFHA 5AM2A 1EA5A 3IP1A 4FFBA 4IJMA 2H9YA 5A71A 4RPLA 2RGDA 2GBPA 4WPGA 5E1OA 3DKIA 2C5AA 2WD8A 1NIJA 2ZJ3A 5IAOA 4B2IA 1ZH8A 2NO5A 4JLBA 3VH4A 3W7VA 3FYSA 3OVMA 1UJBA 3R0XA 3REOA 4DKXA 3DZBA 4F6RA 1OU4A 3D2LA 1WW8A 4YPVA 5E9QA 3R5SA 5JZOA 4MYUA 4RPJA 1RM5A 1O58A 1E9EA 2NTYC 2QN8A 4LDJA 1UPBA 5FPKA 1L5VA 1JNYA 1NRJB 2DB3A 4WNCA 2CLLB 1FDWA 1B76A 1KZ1A 4DGSA 3DLCA 2JGMA 5C5EA 1Q1EA 1ZUIA 1HLGA 4WNIA 1LPPA 2RKWA 3B3AA 4FOPA 3GUUA 1VCHA 2ZI4A 4GF5A 3AC0A 3W9YA 3WHLA 3E5MA 4GC5A 4U8HA 3FNBA 3UB4A 4FYKA 1EH5A 4S3MA 5DN6A 4CFZA 4L8LA 3VX3A 3PXDA 2H5EA 1KIAA 4D02A 4LDAA 3FRIA 3ZXIA 1TKAA 1XKLA 2IXGA 2JJ2D 2LP4Y 2P6PA 2XUDA 3AKEA 2BGUA 5DTRA 1P72A 1NFRA 4MJ3A 4I9NA 4KK3A 3CW8X 4JLNA 1K6EA 3V4LA 5CFOA 4YXFA 1XU4A 1T2UA 5KVAA 4FFNA 5AI6A 1PR1A 1EUZA 3IAUA 4NBSA 4OQDA 3NHFA 3PTAA 1SQ0A 3GAFA 3JQ7A 4P3XA 4LGCA 1V7CA 1AK9A 2F4NA 3H5IA 3HUDA 3LUCA 3QV2A 3W5DA 4XTCS 4AN4A 2AQHA 2YY5A 4AKSA 1E7QA 4ZIRB 3BGOS 3IXQA 1PVDA 2JRLA 4NYIQ 5B57C 3UMMA 4GOXA 3JX9A 4KL8S 3WG9A 3NDPA 5AVJA 3W06A 3AU8A 5IASA 4OK6A 1O03A 1D0IA 3IVMA 5A2QA 4IIBA 3C1AA 1AXEA 1V71A 2AFRA 1YCHA 1X7GA 4OUDB 2WHPA 4UAGA 4R1UA 5AHRA 1U7OA 2OFPA 1XZ8A 1Y8RB 2Y05A 5FOXA 1XRSB 4KR2A 4E15A 2ZSAA 3KSDO 3OZBA 4I2NA 4KKXB 1ARZA 2JCGA 4Y6GB 2ADOA 1H8HD 1MG0A 1ZSNA 2FU5C 1OT5A 4RGVA 3VTZA 3VYVA 5TGDA 3A3OA 3WRXA 5HUHA 1NXWA 1GKLA 3BF8A 4HCJA 5MHTA 2ZPAA 4GMHA 2VPZA 4X66B 4P81A 4U1RA 4DG8A 1QG4A 3FNFA 2C9YA 1TEXA 3JCZA 4GBED 4HY3A 4NYJQ 4D79A 2FPIA 2WYOA 3GCZA 3RWBA 1XMQB 4HDRB 4FD3A 4L5AA 1F6WA 3BGDA 3QEJA 4E2YA 1KBQA 3ER6A 4N8DA 1ZUWA 4OUKX 4GRDA 4RUKA 4URUR 4ZTBA 4F84A 4C9BA 1P9OA 1M8JA 3BDAA 4GUAA 4XYMA 1C7ZA 3V5NA 1J20A 3MRXA 2R6FA 2Z8XA 5JDIC 2DETA 1ZGGA 5B2FA 3A6PC 4OVKA 3BFKA 1PZMA 3A70A 2DBRA 4Y9DA 2YFHA 3VPCA 4PW0A 1CRZA 1ONNA 3FGZA 1DBVO 4ZD6A 3SHTA 3ZOKA 1ENZA 1SZCA 1VCOA 3NBYC 1L1FA 2F48A 1X9HA 3WLMA 4EMBA 1B23P 2EFJA 1SVWA 2XITA 1V8DA 1LH0A 2Q2QA 2FQ1A 1ABFA 3A31A 2PLRA 3EZFA 5BY2A 2QRZA 5J2UF 3UVEA 4C29A 2RC5A 3PCRB 3ZV7A 4IW3B 2J3DA 3H5WA 4KPFC 4CCWA 3JW8A 1H8EA 3E7WA 5JRJA 5LNK1 4L8VA 3H7IA 4HTFA 1NA5A 5LL6P 1RYFA 1EVEA 3OQIA 4XOUA 3R6LA 4B76A 3U4QA 3DV9A 1UKEA 1RXVA 3K1JA 1MW8X 3KKEA 3OWOA 4Z53A 4LJ7A 3A9SA 3D0KA 3LC0A 2MT9A 1P1HA 4HXFB 5KNCD 2JGFA 2CLFB 5LMCA 3MWYW 4IX9A 4HNQA 2C1ZA 4BV8A 5ALVA 2Y68A 3CMCO 4Z54A 4HAYA 1U0LA 2Q7DA 1TC1A 1F17A 4YROA 1CUSA 1MA3A 2VKTA 5BWNA 1CS4C 5KYYA 3B13B 3PQEA 4FCTA 2HXSA 3H0CA 4EPTA 2Y8EA 1QQBA 3QYFA 2L69A 2WKQA 1GN9A 1TEZA 4IIJF 3HM2A 2IY9A 4I66A 1JPNA 4UNNA 3FCYA 5EWMA 1O2DA 3BGWA 2X4GA 2OBNA 2EHJA 4LHSA 5LSAA 4K9KA 3R3VA 2VPPA 4TQAA 5A3VA 1NJ8A 1NASA 4O2BF 3WMGA 1O94A 4B3SB 2ZVJA 1B0UA 3GW8A 2DECA 5A5EA 4JR0A 3RCBA 1UZAA 2WFMA 5DYWA 3ENQA 4RVCA 4KIGA 4RPKA 1XI2A 4LXIA 2C77A 5I45A 1JEAA 1FNSA 1UMCA 1DG3A 2R25B 2OUKA 4D92A 1XN1A 4AG3A 3VOAA 3ONNA 4GLBA 1PJRA 2H9AA 2QGNA 3OZCA 3WL4A 4RXUA 3W77A 3KR0A 1B1AA 3FLBA 4G8DA 5C4IA 3Q6IA 4FM9A 4F4HA 2XSZD 5TS3A 1BO6A 1H69A 1KO1A 4W1PA 1P0CA 1GRCA 1Y5IA 1O3YA 3H75A 4PYIA 3GFBA 5DBGA 3R4CA 5FUXA 1VDZA 4ECAA 1H05A 3OEWA 2RCNA 2WRZA 4S1WA 3H87A 4DMGA 1IEVA 4FI3F 5KWEA 1R3UA 1GUFA 2H06A 2HGZA 3O9VA 1V3TA 2P0AA 2QDXA 2XUQA 3CNLA 1N57A 1MAWA 2GN4A 2CVOA 5AK6A 1IUPA 2YWBA 5D85A 5B7PA 2ASEA 3MBIA 4TXLA 3DGFC 5BO5A 1PL8A 3M2PA 4XJVA 4K6CA 3OIUA 3LOQA 4I7EA 3KKZA 4ZVLA 4CMCA 1Q7BA 1FQOA 1OB5A 1T6ZA 3BFXA 2WTNA 3HXTA 1I2MA 1X1SA 5IAJA 1TUGA 1JHQA 3MTIA 4S1OA 4QXQA 4NTZA 4Y1GA 4UHEA 3VKUA 1UUFA 3HEMA 3IP8A 1N4AA 2OA0A 3QP9A 3BWMA 3W3AA 2BFOA 2PZAA 1CIJA 2GK3A 4TYPA 3DDOA 3CFYA 4RPCA 3B6MA 4W8OA 3MJDA 4IIXA 5F51A 4JJAA 4NU5A 4G8BA 2NVUB 1DFIA 4JMLA 1DTSA 3EQ2A 1CUDA 5LKRA 3OF5A 2Y9MB 2AOUA 3RGWS 3QNUA 4F7DA 3EBLA 3FOWA 1HE3A 2C5GA 5AHOA 2XX3A 1KY4A 1T1EA 2OHGA 4X45A 2IQIA 1TA0A 2IU0A 2IHKA 4NMHA 2FWBA 3WWEA 4RYLA 4LRSB 4A5SA 4GSYA 4WEQA 2OHFA 2IS2A 4GI1A 2WU1A 4IY1A 5CVDA 4EB0A 1DKLA 2WP8J 4DDWA 1ZD5A 1XIVA 5IMSA 2OFWA 2C2OA 2DBZA 4PX3A 1W96A 1L7BA 5BNZA 3RKRA 1G2PA 1WVIA 1RC0A 2YFYA 4MLZA 4W6ZA 4EVSA 5HKAA 3ADDA 2X6TA 4HX9A 3NANA 1SJ9A 3REFA 1OV4A 2B7BA 2TMGA 2IS4A 1NJ1A 4IHAA 2WFZA 3AETB 1NE2A 4I5DA 3IIMA 2UXCB 2CFIA 3HBMA 4MUGA 2XRFA 2EV9A 4TZKA 4KWIA 1RXUA 2O06A 4CM9D 1CE8B 4ZI7B 1BKYA 1GADO 1GNLA 3C6MA 4N5DA 4DXHA 2ID7A 2W2OA 4DEYA 1GNQA 3WICA 2RHOA 5F23A 2H1RA 2Y2UA 3UC5A 4LWQA 5JC1A 4DB2A 3OO0A 3SY8A 1AE1A 4LSGA 3TE6A 1NF9A 1QBGA 2P2ZA 5HS4A 1BDMA 4J4BA 1S3SA 3X1KA 2RGRA 2NT3A 3DCNA 4Q9AA 3CINA 1YU6A 2REQA 2GPJA 4IVNA 3FWNA 2B5WA 2BELA 3DWGA 5AM3A 2QPAA 1WPRA 2EYQA 3EIXA 4XD2A 1GXSB 2P6MA 2AFIE 4QE3A 3TIFA 4BLQA 2ZE5A 3MT7A 4K6MA 5EJEA 1Q6ZA 2FVYA 4MMXB 1T5IA 1LF5A 4JY7A 2VPYA 3ONFA 2OCBA 2XJ4A 3O3CA 1QK3A 4ND4A 3DLTA 3WIVA 4ZPXA 5DM60 2O0HA 2HLNA 1AKYA 2QX8A 2H2DA 5I8PA 3E9QA 2PNJA 1VKOA 1QNLA 4G01B 4GXRA 3BK2A 2CXHA 4C0BA 3GQBA 3TXAA 1L5MA 1AUPA 1CEXA 1LI4A 1WKVA 1GKIA 2OUIA 3T1NA 2EZ8A 4FLFA 2CXUA 2O14A 2XYQA 3NEYA 1QUEA 1FVHA 4ADSG 3K8ZA 2QRUA 1C9MA 1P7VA 3DF9A 1RXWA 4H7HA 3CX4A 2OBBA 1UBHS 3AR2A 1KS9A 6ABPA 1DE0A 2ZCJA 3IVGA 1LPSA 4R7TA 3I12A 2QUIA 3GH3A 1QHGA 1WMDA 5KYWB 2AI1A 1IAVA 1QGYA 1SXJB 1TC2A 1CU1A 1KFEB 2H2AA 3ETHA 5A6SA 5CDYA 2ONJA 1T8SA 4EX6A 2AHRA 4IS2A 1ZICA 4N7BA 3S3TA 3ZE6A 3DZIA 4YMIA 1RVDA 3VSAA 1T0HB 1Z29A 4TMFA 2PGXA 2PKRA 3ICQB 1HTTA 3E9NA 4F6RB 1D2CA 3B1ZA 4NFYA 1G21A 3VR3D 3ABZA 3I05A 3IJEB 4M0MA 3M8KA 1RU3A 4DIDA 2ADFA 1PZNA 2FF5A 4AS1A 2C9BA 4OPMA 5JMTA 3VR5A 1OBHA 1JDSA 3GPDG 4BHTA 4TL9A 1WPGA 4FTWA 3OPVA 4LDQA 4YN3A 2Q1XA 2CLSA 2NPFA 4ZHQB 4MR8B 3S2UA 3TQOA 2P4UA 1PJCA 4M53A 4XE5A 4YAOA 4BV3A 2ONZA 5JEDA 4B4DA 1V8OA 2CNBA 1CUYA 4TKUB 1V25A 1XZCA 3RB8A 2C59A 1NTRA 4JBLA 3CF6R 4KP7A 2VQDA 1DBWA 1XP8A 2RGGA 3FPSA 3OQIB 2XJ9A 3U9LA 4E21A 3G5MA 2OFFA 1EFUA 5IDQA 3RUPA 1OLOA 1XU9A 4AJLA 1QH8B 4M1QA 1VPLA 1MQ9A 3S55A 4ESOA 3AHJA 1RRCA 2BUAA 1GGNA 5JMWA 3O2QB 2V6GA 1QAMA 2C5HA 3QWHA 4KMOA 4MWEA 5HF5A 3ROMA 5IX8A 1ZN8A 5G0TA 1A9YA 2BD0A 4FOLA 1G0NA 4X85A 5EE1A 2VQ3A 3ZCXA 2DC1A 3TGLA 3ZY2A 3B82A 4ESVA 1SXIA 1FFHA 3KYDA 3LE8A 4R1TA 1JP7A 2YS6A 3FCOA 5ALLA 5J2UB 3LPAA 1KYZA 1Z0KA 2NIPA 4R40A 3I39X 1V8BA 2GCNA 1GNSA 3LPNA 3P9PA 4PXAA 2VDNB 1NXQA 3LLSA 3UJHA 1JT2A 3W9UA 3VR0A 1C7EA 1GZVA 1DDOA 2CFSA 4HDCA 4KTVE 1FX0B 3NAZA 5B3JA 3STTA 1DWQA 1K06A 4KQ9A 5JO9A 1W9HA 2PR2A 4PGAA 1KI9A 3X2SA 1F3OA 1KIMA 1J8YF 2IP4A 4GR9A 1E1QD 1JUDA 4JJ4A 1MXHA 3PQ6A 4N03A 1WSBA 3H2KA 1IG3A 4G84A 2WK1A 4ZZ0A 1U63A 2HO5A 4D4MA 5A0VA 1YGPA 3SJCA 2Y2VA 1DFGA 4WKCA 2LW7A 1AG9A 1DTWB 1PYDA 2Q45A 3E27A 4WTOA 4CF3A 3CRW1 3GBPA 2PJDA 4B35A 1E60A 1O5OA 4KE9A 2X0RA 4IH9A 2YWDA 2HCJB 4J9UE 4UNSA 5BQXA 4OGLA 1PSWA 5JAMA 2RFLA 1SHUX 3TPCA 5CVJA 3ZK9A 3EZNA 2FMTA 3KSAC 1TL7C 4UU0A 3AHEA 5CLLA 3RSGA 3N28A 3E5RA 2HA4A 3G6WA 3O0DA 1KAEA 1XZLA 3P7MA 1Q7TA 2P3LA 4JVNA 3N7AA 1K7EB 3X0DA 5K0LA 1H1TA 1TDJA 5LQUA 3RIMA 1W581 1F0YA 2DYKA 3KWFA 2O0JA 3HY6A 4N9QA 4OXXA 4WCFA 2O2YA 3M5PA 2CEKA 3MXOA 1ISHA 3QWFA 4LYJA 2XXBA 3R9KA 1WKCA 4N47A 1EZ1A 3HQ4O 1E5DA 4LNUA 4UMFA 3THSA 3RYIA 4WI1A 3VAAA 10MHA 4DR1B 3TKYA 4B4UA 1B1CA 4DDMA 1Q6YA 3O91A 1AM4D 2P5UA 2HDNB 3U4CA 1I4OA 3S81A 3UAGA 1YBMA 1AZTA 4FFBB 1ENPA 2CXNA 2DUNA 2IYWA 2VUIB 4GWKA 5FHRA 4EHAA 5IXYA 4MHTA 1BROA 4WOPA 3WDSA 4DADA 4QUKA 4F45A 1J97A 3OOSA 1EWYA 4V39A 4ALLA 2QTWB 5H80A 4CEIB 2NQ8A 5EJMA 4LTDA 3OZEA 3MAAC 1WP4A 3BBLA 2X6QA 2AOUB 3D6FA 1FMJA 3TDKA 1GCOA 3NBZC 3IUPA 1EUYA 1DJOA 1XDUA 4CV1A 3ADPA 4YRSA 2JGLA 3BBPA 4QEZA 4URZR 3GHYA 3NAGA 3F7NA 2HRDA 5A9SB 1CRQA 2WE8A 4P6VF 3ETNA 3KSMA 5KWVA 5KX5A 3DHVA 4MUHA 4NEHB 1U2DA 4US0R 1XRMA 4ZAGA 3T8YA 1N2SA 5H82A 3T34A 2RGNA 3W3AD 3O74A 5JANA 1IHUA 4RA9A 3FPCA 2RHDA 4ND2A 1W44A 1OFHA 4DV0B 3H1FA 1R6BX 2H7XA 1YZVA 3QKIA 1PYGA 3GLHB 1ZMXA 3GQVA 2C7BA 1HMYA 3LC1O 4CQJA 1H42A 2HHLA 1XEXA 1A2QA 1L4GA 3D3QA 1GYPA 2XD4A 1KDOA 1JKXA 1NJFA 4MUEA 2I33A 1JAIA 1JG7A 1R2QA 2R48A 1P4RA 3DXYA 3PDIA 4AS3A 5JZMA 2GN1A 2H29A 1T26A 3ZDQA 5D1HA 3M6WA 1RHKA 1Z0FA 5HM6A 1ZD8A 4YMTA 3IT2A 4QUGA 2N46A 3FZNA 3EUFA 1Z9BA 3I8XA 2C4TA 5EMMA 3TSCA 2BUBA 1MO6A 3E03A 4G1UC 2ZJOA 1FP6A 4BLRA 2F8LA 4XZ3A 3O21A 2IBTA 5TS2A 1G20E 1Q0ZA 2R8RA 4PCUA 3DONA 3OJFA 1OKKD 4Q7KA 1L0BA 1QR6A 4EJMA 2I4IA 4EG7A 1EWKA 2CMGA 5DCLA 1OGYA 3HKEB 2H0QA 4WD3A 4D81A 4GZ5A 4PFJA 2A9QA 4L4YA 1QG0A 1Y4ZA 3E3OA 3JAWB 3U56A 5BV2P 4G8JA 1HT0A 3PJDA 1A0OA 3IODA 1OZFA 5DBFA 4GPD1 4EMSA 4IFEA 3Q11A 4XGNA 4U00A 3GZJA 4KG7A 3IILA 3IVRA 4NONA 4D8XA 2PVSA 5J2TA 4I4TF 1YDMA 1DS6A 2R7AA 4FSXA 1DSSG 1A95A 2APJA 5CB0A 1A9ZA 3H1PA 4P08A 3AR4A 4L8YA 4DPLA 1EXMA 2AF3C 2F9MA 3W4JA 5LKAA 4TTJA 2IDZA 4KRYA 1E0JA 4DTIA 3I42A 4LXTA 4MR7A 4E5YA 4DAOA 4A82A 2AEFA 4MRPA 5HDBB 4YC7A 1JECA 3AZQA 3FBTA 3ZU6A 4CQMA 3GMSA 2WINI 1O0CA 5FL7A 4UTPA 3RVDA 2XMBA 2HSGA 1CS0A 3L05A 4DSNA 5LLTA 4AF7A 1U8FO 1H8ED 4NE9A 1Z8HA 3H2BA 3O8NA 4I1PA 2VJBA 1AGPA 2HQBA 3ZIAA 5EKXA 4JASB 1XEFA 5FA5A 4L9WA 3B1KA 5IMBA 4EFKA 4MCHA 2OHJA 3P2KA 1U0SY 2E1PA 1ZRNA 3QRWA 3QVMA 3MCVA 4NARA 1E7YA 2W93A 1A98A 2P9GA 3G5LA 3UFBA 2D06A 1DARA 1GTL1 1ORDA 2V3WA 4LJRA 2EKZA 1A82A 5IDWA 4LV5B 2UXBB 1OAOA 1L4UA 4U9HS 4S04A 2WYIA 1T4MA 3ZJ4A 2HW8A 1T4CB 4QDUA 2XE6A 1U6IA 4DCUA 5TE9A 5TQJA 5C32A 3CUVA 2VP9A 3H9CA 2QN3A 1S2MA 4B6GA 1MG5A 1SUAA 4INZA 4O2AA 1N8SA 3O4GA 1G17A 4P7KA 4H4EA 1HEIA 2A9RA 3LY9A 4EP1A 4N0DA 4QG3A 1ZN7A 1CJSA 1GL9B 2AZDA 3N1UA 1SCBA 1IG0A 4URHA 1GQQA 2G70A 1Z5WA 2DQZA 1ZGBA 4LJLA 5IZCC 1K4MA 3LC7O 1US8A 4IYRA 4HLNA 2FDCA 4EVIA 2I1QA 4KVAA 1VIDA 5F5XA 1MAHA 2YBDA 3Q7EA 5FJJA 3VZQA 1JPVA 2CB9A 2DHEA 4BO6A 4S2EA 1A8HA 5CFQA 5BUZA 2V3CC 1QBKC 2ZE7A 4IQ0A 4OQMA 3W5SA 3V6MA 3P9QA 4XVQA 4ZCIA 8OHMA 1C1DB 1C4XA 4FS8A 3FUVA 3DVAA 4IFBA 1H4QA 3CZPA 2I4TA 2IYAA 2BTQA 3R77A 3DUWA 3R3HA 5JCXA 1JXQA 2WQZA 4YT4A 4LZPA 2WLTA 3X1YA 2GM9A 4GHWA 3TO5A 2ORIA 3LKZA 5C52B 5DBOA 1RTKA 1VJ5A 2EAUA 3S2IA 2QIOA 3JS5A 1T0JB 2I71A 3LY7A 1M34E 2Z2KA 2QR3A 3V8NA 2B1QA 2PGAA 3HBNA 1BMDA 1RRMA 4C7MA 1IUKA 3KQKA 3FA2A 4YRDA 4PFKA 3TR5A 1F0NA 1DADA 1NVAA 1XCPA 1T24A 4JT4A 4WKBA 4TVSA 2XUIA 1Y3CE 1WMSA 2DWPA 2MIIA 5DNVA 2WZDA 3WYEA 2ZCVA 4WZBA 2GWRA 1WY5A 5KOIA 3KB2A 3BAZA 4DLUA 3UTDA 4LGVA 1H3EA 3NWPA 3H4IA 4BGVA 3NTXA 2AQKA 9MHTA 2ZFUA 3JALB 1KPIA 2PCLA 1KS2A 2VF2A 3A25A 4YRAA 1V5IA 2QX9A 3BXZA 1E3IA 1O96B 4MHOA 1KKUA 3OZIA 2OOKA 4MVJH 2VDKB 4KDRA 4P0QB 2QTAA 1U0TA 3PNLA 1JR3D 3UBMA 1NBIA 1N7HA 1OBVA 4F5YA 1QYIA 1T1RA 3WYBA 3W8RA 1FMLA 2GFQA 4WCFB 4DCNA 1IHOA 1BZYA 1TTHA 3RJTA 3ZXYA 2AG8A 1IY8A 3BULA 4WCDA 1DNPA 3OU6A 1NVKA 3M1AA 1T0IA 1PL0A 3C3PA 2XTNA 3KJNA 4KYIB 5CR9A 1LC0A 2B7CA 1RLJA 3B9BA 3FYUC 3EZ2A 4KQEA 4RZQA 3S44A 3UK7A 2BGWA 2PBFA 4BYMA 3LIIA 3SQMA 5EXEA 3OHMA 2DT5A 3F7OA 5A04A 2ZREA 4MV5A 3TX6A 3SBXA 3TLXA 1AC5A 4IGIA 1I10A 1GSAA 1TZKA 1U3CA 4D6YA 4DLWA 1U3FA 3OJOA 2X8JB 3JWEA 4HDQB 1W35A 2NSLA 5TX7A 2AOTB 2W4MA 3IUMA 4ML3A 1V2HE 4TVKA 1JLLB 1UMKA 4IEIA 4CM5A 1ELOA 2FOLA 1OJ7A 1O4VA 1X8JA 1TOAA 4JJZA 3SF8B 3G0HA 4DYDA 2A5YB 4MCIA 3VR1A 5IAGA 2CYAA 4LIPD 5H0IA 1QTQA 2PHZA 4DJJA 1DIOB 4JEUA 1IJEA 1IC6A 2VYNA 4YRTA 2BLLA 4FCVA 1N5LA 2Z5FA 2C7OA 2IUYA 2YH2A 3JAMA 2IU6A 3C0KA 1ZIYA 1GGEA 2X4LA 4PGGA 4JI5B 4DABA 1E3MA 1V47A 1Z15A 3ZNQA 1NW9B 4CKYA 4B9AA 3TAXA 2VP2A 3BC1A 1TMKA 1IZZA 1ORIA 2C2ZA 4MIOA 3ZU2A 4ZJZA 3C6KA 1C80A 3QLVC 4B33A 3H42B 1TXGA 5BW8A 3DD1A 4UAVA 3AR3A 2PRJA 3K4QA 3QMWA 2A3NA 4R54A 2XBLA 2J45A 3ANMA 1DJPA 4FMDF 1NJ5A 4ZHSA 2FLVA 1ZLYA 2EZ9A 1B8NA 1JMYA 2CLDX 4JUIA 3H5AA 3DC2A 2IHYA 3G02A 3OKAA 4MQLA 4DSTA 2VAVA 1RRFA 3WMRA 4RAQA 2CKMA 3QJGA 4UD6A 1TM4E 2EERA 5JJKA 1JKJA 2DGDA 1W9MA 3GXOA 1YE8A 4KCGA 2C9MA 4LHYA 4Z51A 5HSGA 4CXMA 2I7TA 1WG8A 1U4NA 1L7XA 2AZ4A 2QMEA 4XEUA 3UK2A 4K9DA 5K6AA 3NDBB 1UC9A 3BIFA 2X6RA 3OJWA 4U2FA 4QELA 3EDMA 3K2EA 1NF8A 5COBA 2XT9A 1RFGE 1IRIA 1FFXB 1LRJA 2BFDB 3N0XA 3M4NA 4KXYA 1LVHA 2V1UA 2UZ0A 1ORRA 3UGKA 1RJ9A 2PIDA 3FVQA 1YBFA 1KY5A 4GR5A 3W8EA 2OV1A 3AZOA 1W5TA 3H2SA 3MB5A 1ZBQA 1YS6A 6REQA 1O5IA 1Y7LA 2Q28A 5FNVF 1IIBA 1OLXA 3K9GA 2CYBA 2OHVA 1WXQA 4JEHA 1USGA 2RI0A 1KGSA 5J2TB 3JPWA 3VZCA 5BSHA 5E4JA 2QVGA 4HN4B 3LRXA 3EA5A 2VXOA 2DE0X 5DM2A 5EN4A 5HK9A 2WHPB 2PVCA 4QBHA 3ONWA 4YPOA 5I9IA 4QTTB 2YJGA 4X92A 1E8MA 3T4XA 4JX9A 2YN4A 3NB0A 4TWRA 4JI3B 1XF1A 1QGUB 4LCJA 2I0FA 4ZOEA 3IUQA 4ZXPA 3ASYA 4U9UA 2FN7A 3A9UA 5SYNA 3VJRA 5C7YA 3TECE 1AQJA 4S2UA 4G26A 3HY4A 1MEJA 3QG1A 4K9MA 3GUYA 3JVUA 3WHKA 3WQQA 5IULC 3JD0A 3MPUA 1MD9A 2RAFA 2QRGA 3KZCA 4HNGA 4LHXA 4XQGA 4KV7A 5FHQA 4JI1B 4YUYA 3ZWNA 1QM5A 4DFDA 1MGOA 3S8MA 4EWLA 2GXUA 4HVTA 4B3XA 2PYDA 1H93A 2PXXA 3DAFA 5IYZF 1GZ3A 1X7WB 1JDTA 3A14A 4NE2A 2PJUA 4RFSB 5EUQB 4CF5A 1SK9A 4UHBA 2Q0SA 2LE0A 3A11A 4EQZA 3PNBA 3N0WA 2QPOA 1KAOA 3Q85A 1SC1A 4F8JA 3DQPA 4ZO8A 3SXUA 1QB8A 1LPAB 1Y9AA 3D8HA 4EGQA 2HOQA 4XI9A 4AMUA 3PDIB 4F2GA 4DWWA 2XNHA 3LY8A 1KORA 2I8AA 2UZ4A 1PT9A 4D0LB 3W5CA 3D6UA 5JLJA 1TUBB 3N2GB 1AHHA 1AKRA 3RAPR 2YUTA 2AI3A 1JHRA 1TYCA 1NW8A 3URKA 4B09A 1KZ4A 4FNOA 4DXDA 4R51A 3LQ4A 2QT9A 2NUTB 3DMPA 1RBMA 5J23A 4KHPB 5JIBA 2AR9A 3N39C 1UBMS 3DEJA 5IF3A 3PGMA 3C6XA 3LQRA 5LYJA 4FWBA 3CGWA 3TSAA 3R5TA 4WK0B 1ZSYA 3BHIA 3UHPA 3S8EA 3WB0A 5L7TA 1XLVA 3WJAA 2XE8A 1D2GA 4C4TA 4J0GA 4V0OA 2AR7A 4D42A 2QJOA 4UOZA 1YZYA 2DPLA 4Y6OA 1M2GA 4C0LA 4O4JF 1I13A 2W48A 3ESQA 2IV2X 2RDMA 3CRMA 1UQUA 3C3KA 2Z30A 4OFBA 4LFAB 3GNTA 1QIFA 4TL7A 4CJXA 2J4FA 1KR2A 2DQSA 5G0UA 5EJ5A 1JL3A 4WFJA 4YJFB 4ZCLA 4AZ0B 2BBOA 4Z4FA 2O2ZA 3PNPA 2YJ4A 5EWLB 1M2NA 3ND5A 3R20A 2HEIA 2IUUA 3G0IA 5TLSA 3RS5A 3EXHB 5DN6D 3RRJA 1DTWA 4UXJA 3O1IC 3CKKA 3WQBA 1RAFA 2VATA 4UHCA 2WSYB 2C8KA 2H63A 1QIHA 1NVWQ 3SJUA 4XVUA 2PPLA 2DKOA 2VHUA 2C98A 4KIUA 5DP1A 4UUBA 4DZTA 3SM9A 1KFBB 1L4YA 4WZZA 3CY6A 3IHKA 4IV5A 1ML4A 4HWTA 4V3BA 4RCZA 1E7SA 1UK6A 4QBIA 3G49A 1TCAA 2JVIA 1H85A 4N5MA 3LK6A 3LUHA 1JTEA 3PSAA 5HQTA 1D0VA 5DT9A 3E3AA 5K8VA 4N3AA 3UPDA 4WWHA 3NFYA 3NWOA 3F5DA 3ANNA 5DM0A 3SS7X 3A37A 2ZETA 5J4YA 4NBTA 4IHJA 1M33A 2CHQA 5I3ZA 2FR8C 4M86A 3R3ZA 1MABA 1FDSA 1MQ8B 1FRNA 2QS9A 4RE5A 4TRJA 3ZNOA 2Y3IA 4BVHA 2R11A 4FEAA 3HJFA 4MS1B 2QI9F 4NZOA 3MJCA 5HBGA 1E79D 3MQFA 4CM4B 2G04A 1PJQA 1OQAA 5JRZA 2CSXA 5HKKD 5MGNA 3CE9A 2YW9A 3J7TA 4XD7D 5CH5A 1M7HA 2RCYA 2Y1GA 1JHZA 1LBIA 2YJZA 3CG4A 3PFGA 4O3FA 3OPYB 2GJ4A 4HH3C 3T6KA 1XZAA 2RARA 5F2KA 1OX4B 3B6IA 4JHXA 4RF3A 2GXAA 2QRKA 3ONVA 1GQ2A 2FSPA 1YL6A 2VWGA 3L7KA 1A9SA 2I1WA 3NHBA 5I9SA 4CM6A 4ERXA 1QVZA 1TVKA 3ILYA 1PDOA 3MG9A 4ISBA 2MOKA 3P9ZA 2F2TA 3GN2A 4PRKA 2C82A 5J5VA 3ETJA 4BL5A 3SBDA 4ZI2A 3P9RA 2GPAA 13PKA 5GJVC 1NKVA 1XZNA 1C8VB 3UJBA 2GEDA 2WKPA 3HDYA 4YQEA 1AX9A 1OAOC 2E4AA 3DKVA 1VKNA 4MINA 1XJ5A 3CJTA 4Q24A 3QBEA 4ZVOA 3ZD9A 2POCA 1CNMA 1FRQA 1JQKA 2EZ4A 1GUAA 3AI7A 3DCJA 3EIQA 1MJFA 4KFCA 5HTOA 3T9DA 3LXXA 4X1YB 1UOQA 3CKYA 2CCJA 4KXMA 3TX2A 1CNFA 1U3DA 5FORA 1XTIA 2JH9A 3FYUA 3B1FA 4A6DA 4ZO7A 2XPCA 3OZAA 4MWBA 3ZPXA 2BDUA 3TLJA 4BFZA 4BQSA 4YYZA 3JWGA 3DAHA 5JCJD 4ND3A 2V7UA 3TZCA 1QUFA 3LLVA 2CD7A 1VJ0A 2RBKA 5KQLA 1KE2A 1JXMA 2WJVA 4LJYA 4XYGA 1BGWA 3IA7A 4K6FA 2JD0A 4BFWA 3C3MA 1FPQA 4KVGA 3HC7A 2C7GA 3TPFA 5AJWA 1YAJA 3HCPA 1KQFA 4P84A 4RH0A 4K8RB 1QJ4A 3BMOB 4WY8A 3GNSA 3L7MA 1W0CA 4HPWA 1BMQA 4M0KA 5J4HA 2B9VA 2IE8A 1C9KA 2X0DA 4C2AA 4D82A 5EVCA 1PEDA 2I2XB 1DCKA 2I9PA 4TTQA 2V59A 4GQAA 4NABA 5DGTA 3BJRA 1JSCA 2I2BA 1KTIA 5JH7A 1YK1A 3FPEA 5E6RB 3MUNA 1FLDA 3HN2A 2ZJ6A 5LIPA 1J42A 3OM9A 1WIWA 3AH8A 5KSZA 4PNHA 1ESNA 2JLYA 1QAQA 4JXJA 1QHHB 3KC2A 1KVRA 4E14A 2I62A 5BW6B 3LHSA 3ZGNA 2F3QA 1K2WA 1S7GA 3B53X 3TRJA 1N32B 1OR8A 1UBKS 3T1OA 1CUUA 3QMPA 2O6LA 3OHPA 4P7BA 3OQOA 3C4JA 4GI7A 5HM8A 5HZGA 1BE0A 3LFUA 1MR3F 4G5FA 5I48A 2WAAA 5KIAA 3QLTA 3PDHA 3T7EA 3OJLA 1EVZA 4GI5A 5JECA 1CEEA 4J91A 3WYNA 4IXWA 5DHPA 1UBOS 2IV7A 4DUGD 5C7OO 1TVEA 5EEHA 4F86A 4PYRA 5AESA 1ZIOA 4XCVA 1JE1A 2ZBPA 4MVWA 4HVCA 1C3OA 2CUNA 2PZJA 5T5QA 4FKBA 2W71A 1PJAA 4R5MA 5A3JA 1E20A 2O6HA 2ZTMA 2VSFA 4WBNF 4C06A 4YJ3B 4YK7A 2AS0A 1T9KA 2G72A 3BXFA 4A0RA 3MYYA 4CQMB 2PZEA 1HRKA 2RG7A 4RIFA 5DB4A 3GDGA 1NUUA 1SBHA 1YZKA 4BN5A 5A4JA 3OAAA 1OOEA 5K3BA 3JARA 2EKLA 4K7JA 4Z7JA 3KTFA 1RBYA 2QZZA 4I8IA 4N18A 1JBEA 3VTAA 3O0TA 5T7BA 2W6JD 4DE5A 1YZHA 4FJ1A 1SOVA 4TTSA 1B42A 2ZXUA 5CXUA 1R0LA 4BASA 1YONA 3N53A 4MP3A 5DLDA 1YKFA 4M9CA 6PFKA 1FTWA 1JR3A 2V4ZA 1E1RD 1JILA 3K0FB 5MN6A 3BTOA 4RQUA 3HO6A 5DTJA 1MLDA 1I3LA 2PKQO 5KJ6A 4COKA 1EFVB 4TWJA 4A4DA 1BWSA 3KUKA 4J03A 3VA7A 4LF5B 1SU6A 1BVRA 2OFOA 3KKMA 3BSYA 2AQ8A 2XCUA 4N3NA 4OO3A 1CLEA 1AF4A 2PDAA 1FQWA 2Z4SA 1KK2A 3C87A 3QVOA 2B2XA 4HB0A 4KFUA 4RZ2A 3TZBA 2WIJA 4FFOA 2GB4A 4EB6B 5EGNA 1G6Q1 1FTQA 4JUDX 2D5IA 3UW1A 3A6LA 1ONOA 4L78A 1ZKDA 4IDCA 3B1JA 5DSXA 1M66A 5C1OA 5IJ9B 2QLNA 1F5SA 4NJMB 4HRYA 2AOVA 5LBTA 1J00A 3E1KA 1CHDA 3QK7A 1OI4A 3SR3A 2CMFA 2P1RA 3H9QA 3NPMA 1T5TA 3FCUB 5FA8A 3OO1A 3B70A 1KHTA 2NU6B 2FOXA 1AF7A 1XMSA 4X20B 3UAXA 3A2KA 3N7UA 4YJ3A 3HLTA 2F1JA 3DVAB 3H17A 1LWNA 1WUIS 3WAJA 3QOWA 4BNFA 2PGIA 3EDYA 4AECA 5BSEA 2IEDA 1PAUA 1CDEA 3RE1A 5K4AA 1UINA 2G0NA 4LNHA 3L5KA 3LWDA 3DEZA 3DW1X 4XPIA 1F5NA 4RVFA 1Q57A 1PV2A 1YZUA 2OO7A 1SQ6A 3UAOA 2K7FA 1IH8A 1JEOA 3ESZA 1XZGA 2Y0BA 4RVDA 1U8TA 2H7YA 1JV2B 4AJ4A 2A7QA 5BSUA 1Q16A 1XNJA 4HQLA 2GHIA 2CJPA 3HCRA 3HGTA 4PPGA 3VX4A 2BFBB 2P2SA 3PD7A 5EJ6A 3FR8A 3JQ9A 2AJDA 2UKDA 1O89A 5JJCA 5TNXA 2DWUA 2VIIA 3BF7A 2VWPA 4RD4A 4W99A 2R8BA 3SJZA 3GI1A 4LZOA 5FWDA 4BNKA 1EZ4A 3HJNA 4FT4A 4Q4CA 2P0EA 3FIUA 2EF0A 2DH5A 2Z2YA 3G3EA 4X0EA 4Z1MD 3RD5A 4EB6A 3KUUA 3QLUA 4F4JA 1QGED 3M6MD 4QTUB 1U7DA 1FF9A 2IX3A 2Q9BA 1PZFA 4D44A 2EJWA 2YZ7A 4BBZA 4EF5A 5EIEA 2GN8A 4CF4A 3FLAA 4EJSC 1R18A 2GZHA 2PAAA 3GIWA 4DARA 4ZDKA 1DGQA 1P8AA 2IH2A 2XADA 4WFQA 1Y33E 5AW3A 2NT4A 2X0NA 2E85A 2XOEA 3WYFA 2XZPA 3D6JA 3ROXA 3UXHA 1Y0BA 3GWZA 1J0XO 1KO4A 1XD2B 2PKEA 1YO6A 5C1BA 3ZUPA 1XQWA 4Y0AA 4UDXX 3PEUA 2LNDA 3QE0A 2BM9A 2TYSB 3B5JA 3DLAA 3F6PA 5B1HA 4F3NA 1DJMA 1I30A 2PS9A 1YRAA 3SXUB 3Q9SA 4LEIA 1LA2A 4EOGA 4DC1A 3TQCA 2BMVA 3RYHB 3IELA 3SZMA 3COVA 6ADHA 4Z7NB 1R6VA 2WNSA 1RKBA 1U2TA 1Z7YA 2CUZA 3GG9A 3JQ6A 3MJFA 4MUXA 3IR6A 2WIKA 4JJGA 3RVPA 1E2EA 1NUTA 4GM1A 2HTEA 2GRUA 1KWGA 4FILA 3RYIB 2JL1A 1NP7A 3IQXA 3IKJA 3QVVA 2GCOA 2B25A 3CCBA 2FTKE 5G1OA 1K1EA 1L5KA 2PNFA 3ZI7A 3AFIA 2GVNA 1Z83A 1F2DA 2ZSDA 3PEFA 5GOZA 4C6TA 3CSUA 4BMVA 2BBSA 3HRIA 2R6JA 3KJEA 4NMWA 4OL9A 1K6IA 4BFLA 3WYAA 2XOKD 1T5SA 3OZ7A 1XAIA 4Q3EA 5I7VA 3KKNA 5FRDA 4LYAA 4CL2A 1NU8A 4UM9D 1BCSA 3M6XA 2EDAA 2MYUA 3LP5A 4PLWA 2ZPTX 4PWYA 1NG1A 4WCFC 5AXBA 2VJMB 3PENA 3SLKA 4WDQA 1N2JA 4PXSA 1DRWA 3MCTA 2C20A 3LX5A 4M21A 4QT4A 4BLWA 2X4IA 3NS7A 1NY5A 3RS8A 4YV7A 1E2QA 3QFRA 4LHVA 3F9IA 3RANA 2RGWA 1DC6A 1RM4A 3WGGA 1SO8A 3BGIA 1DQSA 1M8KA 4I8XA 4PR3A 1QP0A 1DQNA 1R8QA 3ZE8A 1LB1B 4CGYA 4Y9RA 3AP1A 4IZ6A 2BEJA 1E5LA 2G25A 3H3XA 5ENZA 5FL3A 1V26A 5G0SA 3ZE1B 1R6UA 1L5NA 1HV8A 1TVCA 3Q98A 3ZW7A 3ETGA 2XGJA 3N76A 1GAWA 2XUJA 3OIVA 4JROA 2VK1A 4FMCB 5EE3A 1JJBA 1CQJB 5TDHA 1ZM2A 4TS3A 2NUPA 3KU4A 4OM7A 2AN1A 4MR9A 3F71A 1OXSC 2QG4A 1ADYA 4OCZA 4QZVA 1E6MA 2P4SA 3HDTA 3WV4A 5J9FA 1LK0A 3WGHA 3WJ7A 1XZDA 2PK3A 1UIRA 2AF4C 2OP1A 1Z4LA 3HKBB 4BCBA 3LBAA 2FEMA 2GDZA 2PL1A 2K5UA 4Q4AA 3KDAA 2DM6A 5I4CA 2GJAA 1XWIA 2FPLA 1JHVA 2VP5A 2I6XA 3DOOA 5FBRB 4KR9A 1DBPA 5KPDA 4M9XA 5KTMA 2AFHA 4BXOA 2D5BA 2VKQA 2HPHA 2VHVA 1W30A 4TUYB 2E4VA 2PYIA 4DY4A 2PRZA 2NUPB 1NI3A 4JL6A 4PO1A 1E0KA 2GZ1A 3N2NA 1OU0A 1PJSA 1YB7A 1WSWA 1EFRD 2J3KA 3PC6A 5CA1B 2XVXA 4HDAA 2C4VA 4Y2PA 4D3YA 3AHDA 2VT6A 3IUBA 5B37A 4YUWA 1ATIA 4Z0PA 2O0MA 1Q1AA 3WZ2A 2I7DA 1HDZA 4R31A 3AG6A 4D43A 1T5DX 3THWA 1W0KA 1O87A 4DB4A 4YJHB 1GZDA 4FEYA 4RULA 3PXBA 2X0KA 5MGBA 1SEPA 4UJ5A 1XPOA 3GY0A 4CM7A 3DZCA 3USCS 3ICEA 4Q1VA 1QIIA 3VQTA 2QG9A 2V65A 3W1EA 5KTTA 2XUKA 4CLXA 4CTNA 5IM4A 3BUSA 1VHTA 1DEXA 2QTRA 2W2KA 3QENA 4L2IB 1JR2A 2OWDA 1E62A 2VO1A 3ZWKA 1D1SA 4ZI7F 2FMUA 4P2BA 2PR7A 1BOFA 1CQJA 2GZ3A 5KO2A 4LY6A 1RAAA 2IYPA 2VNJA 1GTSA 3BDVA 2R8EA 1KDTA 4EA6A 2XDAA 3MLAA 1KJNA 2PBRA 1LCIA 2Z09A 4W8GA 1FUYB 4YALA 2CVFA 3Q3HA 5AKZA 3HCFA 4KOAA 2ZW9A 3IS3A 3DUFA 1FFGA 2ON6A 4LG1A 3HHPA 1Z5VA 1YB4A 4MUAA 4OMFG 3ROFA 3TTXA 4YJHA 4MYRA 4MMYB 1SURA 1PNQA 3KEMA 3TMKA 4WLUA 1Q11A 3RRFA 4MGHA 1YRYE 4MW9A 2LKDA 4WZAB 1REQA 3NORA 2I2FA 1JZQA 2BGGA 2N0SA 1KZ9A 2HFKA 1EM8B 4OHMA 1E7WA 4C6HA 1JF8A 5FO0A 3EGOA 2I1LA 4MI6A 1E1RA 3BWEA 5HIJA 2XRMA 3I2IA 3NBFA 1XQ1A<