2GEJA

Crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp-man
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
373
structure length
361
Chain Sequence
b'MRIGMVCPYSFDVPGGVQSHVLQLAEVLRDAGHEVSVLAPASPHVKLPDYVVSGGKAVFGPATHRKVKKWIAEGDFDVLHIHEPNAPSLSMLALQAAEGPIVATFHTSTTKSLTLSVFQGILRPYHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVDVASFADAPLLDGYPREGRTVLFLGRYDEPRKGMAVLLAALPKLVARFPDVEILIVGRGDEDELREQAGDLAGHLRFLGQVDDATKASAMRSADVYCAPHLGGESFGIVLVEAMAAGTAVVASDLDAFRRVLADGDAGRLVPVDDADGMAAALIGILEDDQLRAGYVARASERVHRYDWSVVSAQIMRVYETVSGAGIKVQVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL MANNOSYLTRANSFERASE (PimA)
publication title Molecular recognition and interfacial catalysis by the essential phosphatidylinositol mannosyltransferase PimA from mycobacteria.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 122
structure length 361
sequence length 373
ec nomenclature ec 2.4.1.345: Phosphatidyl-myo-inositol alpha-mannosyltransferase.
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13439 Glyco_transf_4 Glycosyltransferase Family 4
A PF13692 Glyco_trans_1_4 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2gejA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2gejA02
3NCHA 1P2GA 4KQ1A 2SKDA 3MS4A 3QHPA 1C3JA 1C50A 5BNWA 3MRTA 2C1ZA 1WW2A 1Z62A 4NEQA 3DDSA 4CTNA 4FZRA 2QN9A 1L5QA 3CUYA 3NP9A 1C8LA 3CUWA 4BQIA 3CUUA 4CTMA 1F6DA 2KS6A 4GZ3A 3DZCA 4MI3A 3QKWA 3PE4A 2SKCA 3EBOA 1WV1A 1L5VA 1NOKA 4AY6A 2QN8A 3Q3HA 1NLMA 3GPBA 3HBFA 3WADA 4AMGA 2QRHA 4F9FA 1NOIA 4L22A 4EJ2A 4FKZA 3G2IA 2GPAA 2C4MA 1PNVA 2IV7A 1L5RA 2GPBA 1L6IA 2ZB2A 5IKPA 4EKEA 1F0KA 2ACVA 3ZCTA 1L5SA 3NAZA 3MQFA 5TMEA 3T3DA 2GJ4A 4RBNA 2QRQA 2Q6VA 3DD1A 1KTIA 2AMVA 4RIEA 2R68A 2F9FA 1E1YA 2PRJA 2C9ZA 1GFZA 3GUHA 2QN1A 5HXAA 2JLBA 4HWGA 3D0QA 2BISA 3FROA 3T5TA 2JZCA 1Y8ZA 2QLLA 1P4JA 1GZ5A 4N3CA 2R66A 1Z6PA 3HBNA 3TOVA 3MTBA 3IAAA 2QNBA 4N9WA 1YA6A 3OKAA 3BD8A 3AMVA 3MT7A 3S29A 4M83A 3OTGA 2FFRA 2X0FA 5JTUA 5DU2A 4REMA 3S2UA 2QRGA 7GPBA 2G9VA 2BFWA 2FETA 1FU8A 3BCSA 3S0JA 1NOJA 1WV0A 1XL1A 4X7MA 5DXFA 3G2JA 3D0RA 1C8KA 3BCRA 3NC4A 3T7DA 5DLDA 4G2TA 4N3BA 4M7PA 1V4VA 1NZDA 1WUTA 5IKOA 4NESA 1SXPA 2AV6A 4X7RA 4QLBA 2XA1A 1JEJA 1GPBA 4HLNA 3TSAA 3RSCA 3OTIA 3VUEA 1P29A 3MS7A 3T3EA 4MICA 2QLMA 4X7PA 2SKEA 4EKYA 2PYDA 1IXYA 3BD7A 4XI9A 1YGPA 1RRVA 4AY5A 3MTDA 4RENA 4LEIA 2XGOA 1FS4A 4Z5XA 1XC7A 3OKCA 1UQTA 4RIFA 2G9UA 1P2DA 3CUVA 4N3AA 2X6QA 2ACWA 2GT1A 1B4DA 4EL0A 3ZCUA 3EBPA 2IW1A 4GYWA 2QRMA 4GPBA 3UYLA 1AHPA 4CDRA 3S28A 3CEMA 3OTHA 3BEOA 4GZ5A 1JG7A 4RIGA 4X6LA 3RT1A 4M60A 5I45A 2IUYA 1P2BA 2AW3A 1JG6A 3RSZA 4PQGA 2VSYA 1E4OA 2PYIA 1PYGA 3L79A 4AN4A 4RIHA 3MSCA 3VDMA 1EM6A 4YI5A 2G9RA 1NVKA 2X6RA 1GGNA 1Y6GA 2F3SA 4MHOA 4AMBA 3VDNB 4MI9A 3WC4A 3D1JA 3IA7A 2VG8A 2X0DA 1Z6QA 1IIRA 1JIXA 3MTAA 4YI3A 3ZCQA 3OT5A 3L7CA 5D00A 3COPA 3MT9A 1FTYA 2QN7A 2IEGA 4BFCA 5JTTA 3C4VA 4KQMA 3RHZA 3G2LA 3NPAA 1FU7A 3BDAA 3CEJA 1RZUA 4EL5A 3WAGA 3BD6A 4BQEA 1M5RA 2WTXA 2XGSA 4MHSA 1RZVA 2H1HA 2FF5A 2XA9A 1FC0A 1J39A 2IYAA 4WACA 4W6QA 2XA2A 5ENZA 2F3QA 3CEHA 1FTQA 3H4IA 1L7XA 3MRVA 1JIVA 1FA9A 4GZ6A 3L01A 1H5UA 1Z8DA 2H1FA 5TVGA 3DDWA 3VUFA 3ZCPA 9GPBA 2VSNA 1PSWA 2X0EA 2ASVA 4CTOA 4MI6A 2R4TA 1NZFA 1LWOA 2GM9A 1UQUA 3NP7A 3G2NA 6GPBA 4NC9A 2BGUA 4F96A 3E3OA 3C4QA 2HY7A 3HBMA 3O3CA 1A8IA 3SYMA 4YUAA 4MRAA 1Y6FA 2JJMA 2F3UA 3OY2A 3S27A 1UZUA 4RIIA 2GEKA 4GYYA 1FTWA 4N39A 4XIFA 3G2KA 2R60A 3MRXA 4WADA 2BGTA 2P6PA 1P4GA 2C1XA 3ZCSA 1L5WA 3MBOA 3T3HA 1FU4A 1K06A 5D01A 2QZSA 1HLFA 4BQFA 3BCUA 4LDPA 2IEIA 1QM5A 1GG8A 3E3NA 2OFFA 3UYKA 4F97A 1AXRA 3OKPA 1XOIA 3PE3A 3L7AA 2PRIA 8GPBA 1LWNA 1GPYA 1JIUA 3TAXA 2ECPA 2R4UA 4KQ2A 3ZCVA 3SYRA 1QKJA 1WUYA 3CX4A 3OY7A 2F3PA 2GEJA 2VCHA 1WW3A 2XMPA 1ABBA 3Q3EA 3L7BA 2QLNA 5TMDA 1BX3A 1XL0A 3CUTA 2GPNA 3G2HA 1P4HA 3H4TA 3ZCRA 3MS2A 1GPAA 2PQ6A 3L7DA 2XGMA 4RELA 3HBJA 1VGVA 3CV3A 2AZDA 5C1DA 1O6CA 2QN2A 5LQDA 1K08A 2XCUA 2VCEA 5GPBA 2QN3A 1SXQA 3Q3IA 1XV5A 1EXVA 2G9QA 2O6LA 2YJNA 2IV3A 5TMBA 3T3IA 2QRPA 3NB0A 1PN3A 2XCIA 1XKXA 2ATIA 3T3GA 3E3LA 4WHMA 2IYFA 3C48A 3MT8A
chains in the Genus database with same CATH superfamily
1TUGA 1FYFA 1OILA 1KAGA 3KEQA 3U4QB 4MGYR 4Q05A 1M2NA 5H9WA 1NI3A 3O4GA 3U80A 5CDFE 4MNTA 2GPYA 2ZTVA 2WRZA 4E51A 1IN5A 5LOVB 3GPDG 8ATCA 3WLFA 2FSPA 4JKOA 4UHKA 5B1HA 1Z22A 3LCJA 4PC3A 3SC6A 2R2AA 4KK4A 1PVDA 1WO8A 3Q98A 4TRRA 5I8PA 1NJSA 5FHRA 5ILQA 2Q6KA 4HNRA 3EDQA 3S40A 5F1PA 3P5SA 1JVSA 1ODLA 1P3DA 1U7OA 3IEKA 2AMLA 1TT7A 1V11B 4J9UE 4QELA 4MK4A 4CTMA 1T25A 2KS6A 2ZRDA 4R0VA 5AKJA 3LDGA 8ABPA 1EQ2A 3V7WA 3WLNA 1S9HA 3PSHA 1VECA 1MH1A 2UZ0A 4DG8A 2ZREA 1KK0A 1T0JB 4MKGA 4QNRA 2ZE5A 1FQJA 4HUQB 4ZVLA 4A0HA 2HRDA 3QKWA 4E7OA 3OCYA 3OPYA 1IUKA 1Q7RA 1GUAA 2HEIA 3WLRA 3EQ7A 2QU8A 3G59A 2JARA 2PTHA 4P4UA 1U4SA 1OX5A 1X14A 2PA0A 2QR3A 3KXDA 4WN9B 2A9VA 3ITKA 3R09A 2RGNA 5L7TA 1G7TA 5KS2A 1Z13A 4GVLA 2QVLA 2H57A 2OO3A 3TQTA 3GF4A 1M2VB 4RD1A 5K8TA 3ZCXA 1EE1A 2EJCA 2JL1A 4OG2A 4PLVA 4R9VA 4HYEA 2G08A 5AHRA 1VPEA 2C4MA 1DADA 1YWGO 3HLKA 1C3EA 4GM1A 1T24A 4NYIQ 1WAMA 5I7WA 4KI0A 2B37A 5J2UA 1VCIA 2EFDB 4F71A 2WU0A 4LYJA 4G5FA 3HO1A 1ESDA 2JAXA 1PK7A 3N1UA 1WWKA 2AFRA 3OLWA 3LUPA 4GOXA 4MV5A 4IVNA 1J21A 3FIUA 4O25A 4BOYA 3VPHA 3PVZA 2FGJA 3T4XA 3X43A 3O83A 5JNVA 1T3ZA 1ZO8A 2P9TA 3G0CA 3RARA 1I94B 4UDOA 1NBHA 3DT8A 2ACVA 2DF8A 4FMBB 3IO5A 2ONCA 2PKQP 1IHDA 2QRKA 3F74A 5EESA 4DBLE 1RZRD 5ILOA 2IXEA 3A4VA 1XPJA 2D74A 1KI3A 2GJ4A 3BB1A 4IVQA 4NMXB 3RV3A 3SYLA 4ERXA 3UJCA 1SAYA 1NVTA 3NRBA 2C2WA 4GRAA 3IEUA 4MKRA 1HEUA 4RIEA 2G5PA 4EMTA 3W9YA 5ISMA 1FFHA 1V7ZA 3KLMX 1X8XA 4TROA 4LC9A 1RHQA 3KLBA 4UC0A 3OOYA 3C7CB 3EIFA 1XU7A 4HN9A 3N3BC 1BYUA 1KZ7B 1G8YA 3AF0A 2KM1A 3WL6A 2AHRA 4O4LA 3W3ZB 4MI1A 1JX6A 2C4NA 3GL9A 3ZKWB 3ORSA 3HLTA 4YP9A 4MW6A 4L6AA 2JLBA 4A2WA 1Z08A 3IOBA 1RVDA 1Z2PX 1MW9X 3E22A 5CPBA 4C78A 5MGBA 5C8YA 3H5IA 1VE3A 2QKYA 3IB6A 4KXFB 2AEMA 3FWPA 3VR6A 1JJ7A 1CV2A 1LNZA 1X92A 4GBGA 3L7NA 4L3VA 4BO4A 1XF9A 5JAUA 2GKGA 3C43A 3AY6A 5DIZA 2P67A 3EEYA 2XYQA 3D64A 3NH6A 4IAOA 3HXQA 4FGJA 3ILVA 2C8VA 1JHAA 2P3QA 1J0XO 1D9XA 3LPMA 4M8NE 4NMWA 2NACA 2AR0A 2P8JA 1X94A 3NS7A 4NBSA 4XRGA 3ICQB 1WB9A 1JSLA 1FDVA 4AZ0B 1FP1D 2CXRA 1YC5A 1ECFA 4RKWA 5B1DA 4EFMA 1L4UA 3L06A 1OZAA 4C4OA 2A59A 4CG3A 3KKMA 2HLDA 4QAJA 5IDVA 4DDHA 3AU9A 3E7DA 3IPRA 3PLAE 3UN1A 2GXUA 1A50B 3QWBA 1ABFA 4ZU3A 1RWXA 2ZRQA 3TD9A 2NV0A 2A7XA 2OEPA 2E4VA 2I2WA 2MINB 5CEEA 3K5IA 2V97A 1AGYA 4HL6A 2BTOA 3MNFA 5KQGA 2FETA 4HYTA 4F11A 4MKHA 3DCYA 4BLSA 1FU8A 1VLMA 3B52X 4D8TA 1SVNA 2J33A 1CVRA 4NBWA 4PBTA 4IVPA 5AVKA 2YHIB 4N76A 3KEMA 4L3OA 3T41A 3GDHA 3FNHA 3HA5A 2BDEA 3WYAA 4MVJI 4O4HF 4DR7B 2YWJA 1MW8X 1ZGBA 2W2NA 2XEXA 3MZ0A 1NUUA 4OHMA 5FKJA 1NN5A 3L07A 3MXTA 1CVIA 4RAQA 3QELA 3ASVA 5LZ8A 2NU6B 4JJEA 3SFVA 1T4CB 4UPDA 4TV9A 1R0ZA 4M21A 1SEPA 1NIPA 2I4RA 1PYOA 2P6UA 5KIAA 1FSGA 3C6YA 1SUSA 3KQTA 5IKOA 5JDIA 1E94E 3PKZA 4WKCA 4ID3A 3FE2A 4M1EA 4NARA 5AVTA 3HFSA 2HFJA 4GGMX 3VC7A 4CKXA 3MRSA 3QUSA 1EYZA 3LIPA 1OLUB 1BROA 1U1DA 3NUGA 3ZY4A 2IHNA 1DC7A 4INZA 1P9RA 1TD1A 3N8DA 5CEJA 4KREA 1VSUA 2C7VA 3CVOA 4ZEVA 1J1ZA 3DXZA 5A9RA 3ACBA 3VNRA 2Z6AA 4LNHA 2DPLA 4UUQA 2WE8A 5FBRB 4Z99A 1DB3A 4OSPA 4S24A 4EQ6B 3SX4A 5BQ5A 4MUFA 5E2BA 5KSOA 2XH8A 3KLPX 1T2VA 1PR5A 2HCTA 2ZAGA 3UJ6A 5JLJA 1AKTA 3COYA 4MB2A 4ZO7A 2OYRA 3RSOA 4EKYA 1IXYA 3BD7A 1YR3A 5A9SA 3TLAA 3FAKA 3E9CA 1B42A 2DC1A 2Z9CA 3N2YA 5FTNA 2CBGA 2W2VA 2XGOA 4D0RA 1J5XA 1GNRA 1YB6A 2QJRA 5FWXA 2RGGA 1H42A 3JQPA 2C9CA 2CZQA 4Z0HO 2WAMA 5AJVB 3ZY2A 2AD5A 2YN2A 5JT1A 3K6SB 4WDRA 2ZWOA 3OKCA 2C5SA 3NXKA 4GVPA 4HDNB 3OZGA 4JB0A 5KTRA 1X8KA 4Z51A 1N5KA 1P2VA 4RIFA 5FTKA 3E3AA 1B15A 5FBQB 3ZX5A 2Q6TA 3GLFA 3L1VA 1Y3HA 2AJDA 4I3HA 2BL4A 1B6TA 3HCPA 3VOTA 2AOXA 2FVXA 4G26A 1R8SA 1T43A 3L9XA 1X3SA 4LKOA 4BLQA 1BU8A 1EGVB 4OTZA 3K9QO 1UODA 4WY5A 2WU8A 2Z56A 4RM2A 1ZZGA 2O0HA 3EGXB 5IH3A 1QHEA 3IUBA 1H8ED 3UYLA 721PA 3OQ6A 3PD1A 1X0XA 4HFRA 1J8MF 2I80A 3S28A 1PZMA 5LOVF 1K9VF 4IDNA 2GJKA 3HZHA 4CF7A 5EJ5A 2X8BA 4BJ1A 3DHVA 3BOSA 3L7IA 2AG0A 4Z49A 2IXAA 4UVEA 2GAJA 3ABZA 2PMCA 3ECAA 3S8YA 3CW8X 3OUZA 4K6FA 3WYEA 3HCOA 2R7NA 5MHTA 3PQEA 4QRIA 2BM1A 2W6QA 2XNDA 2ZUBA 1I2CA 3OD5A 1XI2A 3R5HA 4IOKA 2IYUA 4OAQA 1RI2A 4EJSB 3JSAA 2OO5C 4ODIA 2IYNA 3P9NA 2P6MA 4E5YA 3ZDBA 4PRZA 2XDAA 4IINA 1G98A 4DA6A 1JW9B 1NQ5A 1MV8A 1SXGA 1Z5NA 5A4KA 3RYCB 3ZVKA 2D7DA 1PCXA 3CR7A 3D0KA 4HDKA 2I2BA 1ZUNB 3TZBA 1TOAA 1NL3A 5I01A 5HNKA 1YZNA 1TAUA 1XRPA 1ZM2A 4UOQA 1AKMA 4PVCA 4S05A 4NE9A 1GGNA 2Z8YM 3KQQA 1T2FA 4CV3A 4E2ZA 3A9RA 1N8NA 1FP4B 2P9BA 1E2UA 1IFXA 1MB2A 1I1HA 1KJNA 1ZD4A 4MI9A 4WINA 5ERYA 4GH5A 4MW5A 1CUHA 3U3XA 5LQAA 5ALJA 1UBTS 3GA5A 1EFPB 4XX1A 1QV6A 3JARA 3FTDA 1J2RA 1P2FA 4BGDA 3GBVA 5AOAA 5EHGA 5KSWB 3ESBA 3ADKA 3ZI0A 1RQXA 2WWXA 1F4VA 2I0FA 5JJKA 3KO8A 5D3ZA 2FR0A 3VI3B 3LUKA 2GK6A 5EUBA 2MSWA 5GIPE 1J4AA 1X7HA 1MU0A 4ECAA 1WB6A 3JQCA 2O3RA 3GAFA 4OK6A 4P3KA 3KPUA 2O8BA 2H5JA 1VYHA 1FX0B 1W46A 2BM9A 3DEYX 1JQLB 3KSZO 5DO9A 2B20A 2AA3A 2JFGA 2P69A 1LVUA 2YRXA 4KMSA 1G2OA 3WAKA 1EFHA 1L7QA 1VTKA 1YACA 4DQXA 2YBDA 4DKXA 1U3TA 3TEFA 1T9DA 5HG0A 1M1YA 1W4LA 3QSYA 5JU6A 10MHA 2OQ2A 1Q57A 3PF8A 1JQDA 4GE0A 4UTPA 4IH1A 4QECA 3OBIA 4B4VA 5TF0A 3LSYA 3TQOA 4B2PA 2R751 5ETJA 2ZTSA 2CL7X 3A3OA 1SN7A 4PFKA 3DZBA 2QZ4A 1Z56C 3CONA 3AUUA 4H1UA 3VBEA 1V2GA 2WG1A 1KEZA 3EG9A 3O2JA 2WTXA 4FLEA 1ZMTA 3V4VB 1LX6A 2YJTD 3FZYA 1BA3A 3WRWA 4L0DA 5EJ4A 2EC5A 1QCZA 2X0JA 2XXJA 5HP4A 3VJRA 1VHLA 1ISIA 4XD7A 5LL6P 1UC5B 3BHJA 1IM5A 1YZTA 1SXJD 3QY9A 3QOYA 1B2RA 1GQYA 4GYKA 3ROMA 1MNAA 1HT1E 3HUUA 4JP8A 1OH6A 2RJOA 4AKGA 3ASYA 2PGJA 3CW9A 3QQPA 2BJVA 1MC8A 2CXTA 5KYWB 4JHXA 2QPOA 2VPTA 1P75A 4A1OA 3FZQA 4Z9XA 5CDGA 1XQVA 2JFPA 1GTMA 1I1QB 2JDID 3V8BA 1AGXA 1FPQA 1IBCA 3TO5A 4EF5A 3QFHA 2UAGA 5EJIA 4HGRA 2X14A 1DEHA 2FZGA 1DFGA 1FBNA 3EXIA 1XRQA 4CLEA 4E6EA 3K0CA 4ER6A 3WDLA 2C2MA 1PD0A 1U11A 1XCLA 4NWIA 4Y98A 1UQUA 3NANA 4TQAA 3OJOA 4C0AC 1CK4A 3FIJA 3V1LA 1U5AA 1QO0D 3EXG2 3QLUA 5DVZA 1YHZA 3VYTB 4F21A 3OEED 2ARKA 3JYQA 3SEFA 3KR1A 1KO5A 3B5EA 4MMZB 4FXPA 3WHIA 3U49A 3IJPA 1IOLA 1G38A 4JEUA 3TIXB 4LV6A 1OA0A 5AXAA 1B8UA 4L4XA 3S27A 5BOSA 3NBUA 5K4HA 1RLUA 4RIIA 4Z9AA 5J5VA 4REQA 3W5BA 3NT5A 4DCTA 2PU5A 3WK9A 2XB6A 2WJVA 4IIHA 3P2MA 3G2KA 5EE0A 2PJUA 4E11A 2HF7A 3MUOA 1PAUA 2QRZA 2AE2A 1B76A 2P6PA 1CY6A 2HGZA 4S0ZA 3ZU6A 5ADHA 5LSAA 3AR3A 2I1QA 1P1HA 1GPDG 3TLXA 1HDGO 1F3LA 4X63A 3Q4GA 1C2TA 4BE7B 4BCDA 4CKZA 5LQRA 3LXXA 3RVMA 2ZIXB 2QMYA 3SF8A 4YONB 5KAPA 3I4CA 2I5PO 1O5TA 2EX4A 2BGRA 3ZWKA 1E8DA 3EEIA 3JQQA 3HXLA 3ODPA 4MKFA 3GLTA 3IAXA 4UTRA 4BTVA 3MQ4A 4G5YA 1F7VA 4DYVA 2EP5A 2Y6UA 3PGMA 4QPPA 1UJ5A 1IZ7A 4UVGA 4C30A 1QUFA 3UW3A 1U2SA 2G0TA 4RS4A 1J6UA 1TCAA 2HJRA 3WGLA 3DZJA 3FNBA 2RCYA 1A2QA 1O97C 3IQXA 4M9CA 5FWYB 2XUOA 3GARA 4CGZA 3K9FC 4LFBB 4YRCA 5E8RA 2FEKA 3V1UA 1W36C 3FUCA 5KMGA 1AS0A 4BU1A 3KBBA 3RK4A 2CCGA 3EQZA 4FCWA 1S8OA 3QUBA 4U9IS 1HOTA 5CNJA 3JQBA 3IE1A 4UBKA 3HYLA 1OZ0A 3UWOA 5CDYA 2AI3A 3M4YA 1CEQA 1XDWA 1YBFA 3H8VA 1ZVKA 3NTQA 4HAYA 2FAXA 2AOUA 3N5CA 4RLFA 2F55A 1GTJ1 2F3PA 2VDRB 4LUCA 4D46A 4F3CA 1GEGA 3IRVA 3T61A 3TCNA 1EINA 1HL3A 1MRSA 1MNQA 1KU6A 2HL6A 1KR5A 2XDYA 1Y8CA 4QTUB 3BDVA 1R12A 3T7JA 1LI7A 5M2QA 4OEHA 3FM9A 1NG1A 1RLTA 4OA8A 3IQWA 5JFTA 3P9ZA 1L7AA 1FQOA 4Q1DA 2DPXA 4B31A 4O0LA 2QR5A 3ZCRA 1XZKA 2ZITA 4MINA 4KO3S 5DSTA 4ITUA 2I6SA 3ETNA 4YAFA 3HBJA 1NSTA 4CLDA 3TSZA 3BICA 1JEQB 1AT1A 3AEQA 3JZAA 2YZGA 4EHIA 1S3SA 2HJ9A 4K6MA 4YPOA 1UBHS 5AHWA 1A27A 4GWGA 2QI9C 3VV3A 3WKCA 2AQ8A 1RAIA 2JFWA 1MJGA 2XSZD 3GMDA 4JUAA 1OFGA 4KN6A 2A9OA 3BH7A 4X95A 1YZGA 1PDOA 5C8VA 2XXAB 4X6UA 1P0MA 4WTOA 1IY0A 1MAAA 1LFAA 2VF2A 5CM8B 3PRHA 1E8NA 3SFZA 1QP4A 3GRRA 2JC3A 4LV5B 4RA6A 3R2JA 2HU5A 4DT1A 4AUNA 2VP0A 2FDXA 2DHCA 1I4WA 2OKGA 1ETHA 4R9UC 1AUPA 2GZSA 3NHMA 2FB9A 3HFRA 4E1BA 1P4AA 5LN1A 5EUCA 4G0QA 1OMOA 1ZVJA 5JSKA 2WIDA 1JHZA 4GRIA 4JBIA 2NU9B 4O4IA 4PLWA 5FR1A 3SBOA 1EFRD 1R8JA 2CLMB 5IFLA 3PI6A 1LQUA 3PHIA 3PXDA 3N0XA 3QHPA 3EGDB 2VTBA 4BLUA 2IKQA 4N6NA 3KKNA 4EVRA 3QWFA 1XZGA 821PA 2HPVA 4FDUA 5KPJA 4CL0A 3Q3VA 1A71A 1P5RA 4QOSA 1J5PA 1BYIA 4M8IA 2G70A 2NADA 1XZFA 2J4DA 1Z16A 2VSQA 3JPYA 3AUXA 4FZVA 5JASA 2Y3IA 3FCUB 3MOGA 1E7WA 1P1JA 1JG3A 1YA4A 1ANKA 3RJMA 4MB6A 1F12A 3OOEA 1OAOA 2CVZA 4IZIA 3ZJ5A 4LF6B 4D25A 2J0EA 5LP6B 1VJCA 3QTLA 2EKLA 1F6DA 1DRWA 2GZDA 1VCNA 2IOQA 1IEVA 1EJ6A 2C82A 2QTCA 3JRXA 4OJKA 2PKWA 1NQAO 2HJHA 4S2UA 5B58T 1KDYA 5BNTA 3EVNA 2XUFA 2DPHA 4YFYA 1P31A 1OTHA 2AXNA 2QSYA 5COQA 3MYYA 1PQPA 1P5FA 1WF3A 3K2BA 2GO1A 3L8GA 4MKXA 5CB6A 2PBZA 2PS1A 2Q5EA 1XVAA 3JD4A 3JQ7B 2GM3A 1F38A 1ORHA 3IILA 4WLVA 5FJIA 4RTSA 3UQZA 3GRZA 3DAFA 2QLFA 1D0SA 3I3OA 1NW5A 5H3CA 1MEJA 1YQTA 1PVOA 1FTSA 4J43A 4B3BA 1PJ4A 1IHYA 3KZ1E 5KHOC 3I83A 2FPIB 1GV1A 1TYZA 2QTZA 3GLIB 3SJZA 1E1KA 3VYSB 3ZLJA 4BXOB 2P0AA 3JD3A 1UOQA 2NSJA 3C39A 3V9AA 2JVKA 1TUIA 4IL5A 1CE8A 3DEIA 3GVXA 2K7ZA 4B2LA 4K40A 1BWQA 5EIOA 3UHAA 3W4JA 1L6IA 2VCYA 5CD1A 1J2UA 4V0SA 5GOZA 3CXUA 4ZTBA 5ALDA 3TGLA 3MT0A 1VFNA 5KTOA 1N34B 5LBIA 3CKMA 4MTCA 1QHYA 2C2ZA 3I1IA 2F1JA 2FV8A 3U48A 2PUBA 1IVNA 2R3SA 3AEZA 4NEHB 3RQSA 3IURA 5HUHA 1TKBA 3NAZA 4MO9A 4RF3A 1YUMA 3ZPXA 1VIVA 4J90A 3ELBA 2P5YA 3QMVA 2E1RA 4M46A 3N2IA 3DL7A 3NX4A 1NVVQ 4ZTUB 3B60A 3A4NA 1PEAA 1N32B 4D3DA 1E2HA 4JJZA 4LVUA 5SZHB 3A6ZA 5DNVA 1JDPA 1PGOA 2D00A 2G8NA 4ZYLA 1A97A 2A1UB 2JLYA 1WB4A 2ZJ5A 2WQ7A 4P5DA 1Y8QA 3GFPA 4IDOA 5TJHA 2Q5LA 4BE9A 4YMTA 1OBHA 2NX2A 1ZH4A 4LRWA 3ZYZA 4YP0A 5JCXA 5JQWA 2H9IA 3KJZA 3GN1A 4FKMA 2W9XA 1DAMA 2DOKA 1H0RA 2WM3A 4YK7A 3D0QA 3AYZB 5HMLA 1JSRA 2G6TA 3Q9NA 3FNEA 3V8RA 4BMNA 3ANXA 5CJ2A 1L5HB 3CGGA 2O4UX 2V9CA 2DQZA 3BJZA 2V7GA 3MA0A 2ZVQX 4B9AA 2G63A 3HGMA 2I2CA 1BQ3A 3KBOA 4IDCA 4ZK6A 2O0JA 1NGSA 1P4JA 3HRIA 3ROPA 4EDHA 3U16A 1MC5A 3ORQA 1RWQA 3L8HA 2WILA 3LYUA 4NYJR 4QWWA 3EN0A 4CEIA 2VZ0A 3FHCB 4G4IA 1G16A 4IYRA 3HKBB 3R0JA 2BFBB 2C5HA 2HCFA 3OE7D 1MAWA 3ESAA 1OXBB 3VX4A 1AURA 1I36A 3ROKA 3SI7A 7MHTA 2OZLB 3V00A 1ID8A 5HHTA 2IWRA 3ZWWA 1ZCBA 4QOIA 2AR7A 3AZOA 3MT7A 2CNKA 4Y1RB 4Y0AA 4D2IA 5JTUA 1JIQA 3UUEA 1OLOA 2O19A 2X5NA 2AG6A 3SG0A 1QANA 2LKDA 4ND7A 5E1OA 4KITB 3UENA 4LI3X 4MV1A 4C5BA 3GJ5A 4G56A 3R44A 3HB0A 4ZQGA 3S2GA 3WOVA 1XX6A 5ABPA 5EYPA 1T35A 3N59A 2JGDA 4CW7A 5AVOA 5TARA 1TJ5A 2ZB7A 4LZPA 3T7DA 4ZN6A 2A0FA 5LWQA 1J23A 2J9RA 4ZREA 2WWGA 1PX0A 1EUZA 3AUYA 1G8AA 1RYNA 1W2HA 3IS3A 4I9UA 4KWIA 4N3BA 4EKNB 3OWHA 3IDZA 4F91B 4XM0A 1H9CA 1RM4A 3ETHA 2PSEA 2IS4A 1ONPA 3A1FA 5LMCA 4HDQB 5AVJA 3AM4A 3O1JC 3NJRA 3N8GA 4E2YA 1DAFA 3FVWA 1QE3A 1WKVA 4FFPA 5D5HA 1BSVA 1CIPA 3I2KA 2HHHB 2XA1A 1LLFA 4JLVA 3W2EA 1Z7EA 4P3OA 3UT6A 5EEHA 4EB0A 2VNAA 3SDZA 4AX8A 5IM4F 4ZVPA 3FTNA 4G0ZA 1I51A 2CLHB 1A9RA 2FP3A 1XEFA 1EG2A 4U9HS 4JR1A 4MR7A 1OAKA 2IZ6A 3TSWA 4EBBA 3I2JA 2QT1A 2NVUA 4CG2A 3U60B 1DJOA 3CRW1 3OU7A 4IEIA 1O97D 2VNSA 2ON6A 2QLMA 2RI6A 3D8HA 4ZVTA 2DH5A 2H3EA 3RKSA 4HRYA 4PX2A 4PZYA 1F2VA 4R1OA 3RRBA 1YR9A 4FGWA 1GPNA 1R6TA 3JRNA 3W5VA 4ZZ1A 3MCVA 2PYDA 1N1DA 1R3DA 4K3UA 4WVFA 4XI9A 2Q8NA 4IHAA 1RRVA 4NCKA 3HTXA 1SUIA 1O96B 2O1XA 1C1XA 3DOUA 1Z88A 3K31A 4H18A 4EGSA 1L5NA 4EEKA 4AF6A 2WYHA 4MVJH 4DKJA 2RG7A 1V48A 4CIBA 5DM1A 4QWMA 2WM9B 4JL5A 4KQ9A 5CA1A 4US2R 5I48A 3SQLA 1CF9A 5HR5A 1G5FA 2H0QA 3B6IA 1BH2A 1BNCA 1TMGE 1EXWA 4J07A 5A6SB 2YMLA 1JQEA 2WWTA 4MDFA 1JKFA 3M6MD 3VR5A 5C7IO 2AXEA 3HEBA 1B1CA 2M6KA 4P8RA 3WQSB 2VDNB 4ER0A 3ZE6A 1SZCA 5ELXA 1XBTA 1YRBA 2HAEA 4E4RA 1CUIA 1KP9A 2VJQA 1U7PA 2RH9B 1V2HE 4EG1A 1ZMOA 4Q7QA 4H60A 4ZVVA 3OEYA 1ULZA 2CL0X 4CDRA 2YVAA 3DB1A 2KLBA 1S2GA 4M2LA 2VDPB 2AX4A 1NURA 4NOJA 2AFIB 5D3KA 5GY7A 3RAFC 1Q15A 1XRLA 1Y7IA 1QS0A 1K5PA 1X1AA 1SELA 1BCSB 2QW8A 4MA5A 3ZOKA 4KBGA 5FWAA 3D2CA 1WPQA 3FCOA 3QBEA 4TLBA 2QG6A 2AHOA 2OCLA 4TVKA 4YR9A 1VRCA 3HHPA 1IB6A 3TR6A 4F84A 5KWSA 2R87A 1L4FA 2HQSA 3UKDA 2IP4A 3DVRX 3R5XA 5LP6F 2EYUA 1XLTA 2ZDQA 4GGPA 4L9AA 4CKBB 2VOJA 4YRIA 1AA6A 3ZEIA 2PLFA 4LY0A 5CXXA 1NW7A 4GLJA 3VR4D 4ZI7B 4EHKA 2ZJ6A 3ER9A 1UDCA 1VIYA 3PFBA 1QWSA 3JQFA 4UTOA 4WL0A 3UB3A 3MSCA 3GYBA 3VXKA 2CVQA 1DQSA 3WWEA 4BIIA 3ZV5A 1WHSB 5BURA 4M0LA 1LH0A 3COWA 4ZCRA 3GCXA 5FA5A 3IP5A 1ECLA 3CBGA 1A9TA 2EJUA 5ALZA 5HIIA 5B2FA 1E1NA 4H7HA 1ENPA 2OG1A 3HUFA 1CZLA 5C7LO 3A6PC 4I5FA 1TNDA 621PA 2G77B 2BFDA 3D02A 4KUHA 3IEXA 4NSNA 3IQHX 3B7GA 3K5WA 1T15A 2I78A 1L5OA 2QTGA 4TV8B 4BX0A 3E2MA 3OWOA 2Q0HA 1C7IA 4PQFA 3LY5A 3LXUX 4YWJA 5JW6A 5CT9A 3WK7A 3D1JA 1BMQA 3LHFA 4HCJA 4DE5A 2CMKA 1QK5A 2JKYA 3TDNA 2LUOA 1FDRA 4KQIA 4RQUA 1J8VA 2E5FA 4F46A 1Z6QA 3PQ8A 5ITVA 3RVQA 2OM6A 3QVXA 4J7XA 1XP8A 4ZCLA 1U7ZA 3SQNA 3GEBA 5F23A 1O54A 3BE8A 5F77A 4D3YA 2CE2X 5D00A 3VVBA 1C3OA 1ZYUA 4UNQA 4EBFA 2BONA 3QA3E 1QYRA 3KTOA 1FUUA 3BMNA 3ZD7A 4JJIA 1XWWA 1MT0A 1WIWA 4UW9A 1QQAA 2QWXA 1YJ8A 2IYYA 3ZTYA 4BFCA 3W9SA 5BW4A 1XZNA 4DNXA 4I2VA 4GWLA 2OB2A 4P82A 1CFZA 4YAOA 1UJNA 1WSAA 5T3UA 2GHQA 2WIBA 2XYPA 1JJBA 4LE2A 1QCYA 1U2DC 1YOVA 3CXRA 4OREX 4I36A 4WKOA 3JS5A 3QENA 1FRNA 1P44A 4CKWA 3GZTB 5K0EA 2XV1A 3C7TA 3D3NA 4D9IA 1M5RA 3NOOA 4D0GA 3L84A 5JY1A 2FEPA 3L1KA 2OC4A 3NHWA 4O8CA 4FEGA 3T7EA 1HUQA 1N6HA 1NVEA 3T9FA 1N75A 3W5JA 1T2CA 1RWPA 1B6GA 4BNVA 1J0BA 4FBLA 3TQHA 1SUBA 4NPHA 5GM1A 1IWBB 4EAQA 5CVTA 1PT7A 4QOJA 1P0IA 3OOJA 3CF0A 2QL6A 4IO1A 1JIVA 4U00A 1T1EA 1Z8DA 1NONA 4YMWA 1IHXA 1M8JA 1UBGA 4KJZA 1W5TA 2NV6A 2JASA 4WZAA 5TVGA 4JYCA 5U1PA 5IVKA 1XZPA 1IONA 3K9NA 4M0MA 3WIEA 3IHLA 4QYMA 3R9IA 4BAGA 2QGNA 2PLNA 4PQRA 2H8GA 3AR5A 1PJQA 1B6RA 1F2UB 1KOJA 2IZOA 2OGTA 2WFLB 1Z0AA 1K6XA 3INTA 3O21A 4NATA 3GEPA 1OC4A 5SV2A 5B58C 2ID7A 1PV4A 4Q7KA 3EW7A 3HY6A 3NBYC 1EB9A 3KZMA 1AQUA 2AYZA 4IIFA 1YDHA 2X6TA 5BT9A 1YB7A 1X7WA 3G7UA 4CEHA 4CNBA 4XJTA 3PTLA 4AUMA 4YUAA 1E59A 4E09A 3LLUA 2AZ4A 2VT7A 3WB0A 3CZ9A 1Y6FA 3RV4A 4F3KA 1NBAA 1U7DA 1QHGA 1VL1A 2GEKA 1DMRA 2NXEA 1QVWA 4DV1B 3EJ6A 5TX7A 1FMLA 1KAQA 1ZOPA 4XIFA 3UY4A 2SICE 4DF3A 2R60A 3DZIA 3EE6A 5SZJA 1JT2A 4WZBA 3ZLTA 2QTRA 3LQ4A 1YZQA 1DNPA 4XEHA 4HTFA 4G0XA 1I4OA 4IFBA 1CJBA 2GA8A 3T0GA 5AK4A 1OYVA 3HSKA 2IEYA 1G2IA 2D0IA 1AHHA 4QUAA 5L45A 2ECOA 1OLSA 3A6KA 4IKOA 1T4BA 4JUIA 1IY2A 1XD2A 2YV5A 3FVQA 1VXOA 1JKMA 2Q3LA 2QMOA 3SPXA 3MTGA 4PG4A 5HW0A 4EKGA 1WMAA 2C9BA 3TX6A 5EERA 1P0QA 3Q87B 5LQJA 1WKCA 5IJ9B 3R41A 4QC2A 4BFSA 1FUYB 1II0A 1P0FA 1T26A 2EKZA 4UU1A 2QVBA 1VYTA 3KYCB 2OFFA 4QBIA 4N4AA 3RD5A 4EW3A 3GA7A 3U61B 1JBEA 1PEKE 3INGA 8OHMA 3OM8A 5B7GA 4BNZA 1X80A 2QRJA 3L7AA 3MG9A 1D7AA 4JC5A 5CPFA 1YQUA 2GB4A 3A32A 4QIHA 4Z0TA 1RQPA 4DWJA 4JUDX 1SVMA 3TKYA 4ZGGA 3OLCX 3SJCA 2C59A 4IQFA 3VZCA 5C52B 4DA0A 3OMLA 2R4UA 4O2AB 2I6GA 2VTDA 4S1TA 4WK6A 5IRCD 2G5GX 3SAJA 3FCYA 4BNDB 4NENB 4EH1A 3RS7A 4Y0NA 5NLLA 1ZOIA 4QM6A 4Q4HB 4ZC8A 1OXSC 3U19A 4TRJA 2XMPA 2J6BA 4OK5A 1NT4A 4CQJA 3Q3EA 2B8EA 2V7XA 3HGTA 3KB2A 5DHTA 4DBZA 1XA4A 1KSHA 3FOAA 3IAFA 3T34A 2PWAA 3BEDA 3LPLA 1XEAA 1NKVA 3HXKA 3OBBA 3H1PA 2YVQA 4FBMA 1PJBA 2FPGA 4MS4B 4R81A 4JL8A 4JVSB 4P7GA 3RIMA 3SJ7A 2C2XA 4J3FA 2QRUA 2X40A 3U9SA 1E98A 4D6PA 1HSOA 1WXIA 1ZDMA 4RELA 3EMBA 1DT5A 1OWPA 3BXOA 3L6DA 2J1LA 4Q9NA 1BKSB 4OHYA 4MQEA 4YAUA 5JATA 5FH9A 3ME5A 3PEYA 3KHTA 5GPBA 4DLNA 3UPTA 2QXUA 5FL7D 4MQUA 2AC4A 3HXTA 3I64A 2C00A 2C4KA 4FYVA 2J3JA 3NVDA 4N5HX 2HCRA 2O57A 1SQGA 2NIPA 1Z7WA 4RSHA 2O6LA 3VZQA 2OT3B 3W90A 4PLTA 3ZZ0A 3HC7A 2O52A 1KE2A 5MN4A 1HLDA 2UXDB 1HEIA 2XZTA 4WX2B 4C4TA 4FOPA 4DLBA 1JR3D 1E3LA 2YV4A 4O63O 5EJ2A 2CLSA 4XRRA 2VHXA 1H1TA 4WSOA 5KU1A 4D9KA 2PKRA 1R66A 3F6YA 2EVWX 4I1PA 2GDJA 2GN9A 2JATA 2XQJA 1A9ZA 4PZPA 3NCHA 3SXJA 2WG0A 1YQQA 3P8ZA 1GAEO 3P9IA 1J07A 2PGIA 3EVDA 2OSBA 4KQWA 4P32A 4LJ5A 1Q84A 4EB6B 3DHNA 4J7CA 4ZI7F 5BNWA 1IZ0A 3TB6A 4FOLA 1EFVB 4OLFA 3VV2A 1Z62A 3HJUA 4FJ0A 5JI3E 3MWYW 4R84A 5J4HA 1G8KA 5DX8A 2QN9A 4QZVA 1EAYA 3E58A 1T3SA 4GXNA 1E5QA 4DRZA 2HD4A 4YMVA 1VL0A 4HGZA 1S9DA 1QHIA 5FCDA 1Q0PA 1QRTA 1RYMA 2XDQB 4PEVA 3AESA 5KYKA 5L3VA 4CFSA 2EJBA 1JLMA 1M83A 1DKLA 1NA5A 2ATVA 2I6TA 4MW1A 3PT9A 4Q34A 5AKHA 3VZDA 3TTWA 3ET5A 5CYPA 4LJ6A 5FTMA 2J9FB 4GQIA 1GZDA 4Z9YA 4ZVOA 2BF7A 1SHUX 1ZMBA 3MEQA 2PSJA 4UEKA 1NMQA 2CJWB 2DBVO 2WKRA 5DWVA 3ZZTA 5LZ4A 3A1DA 3QK7A 3VX3A 2BEUA 2DHRA 2I62A 3GPBA 5DI3B 2VP4A 1W9MA 2ZYWX 4JYMA 3FW1A 3RVKA 5CDFA 2Y0CA 1U1GA 4MWZA 4DEVA 1W44A 4LJKA 5ALKA 3EMDA 1F20A 1NM5C 4H0CA 4FQ7A 3AEUB 2NTNA 1Y4ZA 3R3WA 4V0RA 5F1YA 3IPXA 1JU3A 4BQSA 1LVHA 4YROA 4DY6A 3QHAA 3GRKA 1U28C 4KKVA 1E9SA 1T34A 3SE7A 3WDSA 3CGWA 2W90A 2VAVA 4JHLA 3ZTWA 6LDHA 1E0AA 1ESEA 1Q91A 2FMHA 3M1AA 5FNVB 3GJRA 1E4EA 3KPWA 3I9OA 2C2KA 4HNHA 2UUCB 1QFSA 2V6IA 3G0GA 1KKLA 4NCXA 1P2UA 3BQMB 5AJZA 3N53A 3ZGYA 1JPJA 3STHA 3EB9A 3RF7A 3PGKA 4CYMA 1U2TA 1AV7A 1NQUA 1I32A 3KXIA 2JJQA 1NF9A 3DZKA 3B38A 1G8SA 2J85A 2ZE8A 1JKIA 1PBTA 2GD6A 3ZDYB 4NABA 4DUGD 5T4FA 1AMUA 3DBVO 1DS6A 2A3NA 1P5ZB 3D7KA 2B8TA 4IXWA 4QE3A 5T8KA 1YQXA 4H16A 3VYVA 1U3GA 2ZRIA 4EHAA 3RFXA 4A8HA 1K3TA 1Y42X 3Q7TA 2RHDA 1E9EA 4U2GA 5CFLA 4Q3AA 3ZZ1A 2DB3A 4LSWA 2X5JO 1WCWA 1VJDA 3GUHA 1XD9A 2NO0A 1JHYA 1OVGA 2LDXA 3LRXA 3F5FA 1L4GA 2JAWA 3BJEA 3DGEC 3QX9A 4M99A 4NBRA 5ALUA 5F35A 3ZXUB 1OSNA 4D4KA 4RDXA 2ERCA 3ZDEA 3IIJA 3R24A 2H52A 2WE7A 4AQDA 2Q5CA 5HJ7A 1QHHB 2ZVPX 2FEMA 4BC1A 1MPTA 1N5OX 2HQOA 3FGNA 3M6AA 4KWTA 2EV9A 1K3UB 3O8NA 5EUQB 2IZZA 3AI1A 2AZMA 2CLLB 1U3VA 4RVFA 1L4EA 2DBYA 3H75A 2P2DA 3P9CA 1WPRA 3C8MA 1E2FA 4MVJG 3GIWA 1V3VA 1UJ6A 2JEZA 1T0IA 3AFHA 4ZFNA 1VKRA 1VJ5A 1ISHA 2UYYA 4WK2B 2J3KA 2BP7B 4FPXA 3ONVA 4HRAA 4IDEA 4C7KA 3CNQS 1UADA 3IGFA 3IUMA 4RZXA 4U3JB 4RACA 5THKA 3F1KA 2RD2A 3H17A 3NHZA 3BD8A 2IY9A 2FG7C 5HTKA 4C0JA 4UOZA 5JC1A 3MUFA 4JOSA 3ZDRA 1IZYA 3BJMA 2NM0A 2ERYA 2WICA 4WJLA 2B9VA 4G89A 4N5LA 2PUJA 4RZSA 5DPMA 1KI8A 2R6CA 3A4LA 4OI0A 5A3SA 1TZCA 2ZZNA 2AEEA 2QRGA 4C3VA 4QRHA 4TWJA 1TYDE 3U62A 1EFKA 2YWDA 4M76B 3QOWA 2P4EA 3OIWA 1D2MA 2O23A 1AXEA 4YP6A 3JV7A 3ZHOA 2PUAA 2D3WA 2FPKA 3TJRA 4JN6B 3MF4A 5HOQA 3V2UA 5CM9C 3GEIA 4I08A 1KVTA 1PLLA 5KYTA 3KWMA 1OC2A 2AFIE 2UZ1B 3PNYA 1T9CA 3OF2A 2Z4TA 4DQ0A 3MC1A 3I39X 1M5TA 3SHVA 4DC9A 5JPDA 3VU1A 1EFCA 4R2KA 4CG0A 3LDFA 4OCZA 3OQMA 1UT8A 2H5IA 5BSTA 2GZ1A 3DE7X 1O6GA 3SJAA 1MCZA 4OHKA 2XWBF 3PBKA 1W0KD 1YIAA 5CDHA 1ZUHA 3N2NA 5C1PA 5JSHA 3QE0A 2XADA 3AHDA 2HDNB 2AT1A 3SF8B 1V8BA 1XFDA 2P5UA 3BULA 3V48A 1Y0BA 4AXXA 3DBHA 1MDBA 2E4WA 4OMFG 1AK9A 3FB1A 4O2AF 1N5MA 4D3XA 4EFLA 4LX0A 3DF9A 3VHQA 2OXEA 1JECA 2X8JA 4DSAA 1KQNA 3S2SA 2GPSA 4V3CA 4Q4JB 4UATA 3EYWA 4MV6A 1DPFA 4QYIB 5KB3A 1XA0A 2WZQA 3RYHB 1KJYA 1VRWA 2R8EA 4QQRA 5G4KB 3DLHA 3PXBA 1TCCA 3MAAC 4FJ2A 4XYMA 4DMKA 2QL7A 1G9XA 1CU1A 2BGNA 4MS1A 2HF9A 3RTEA 3SQXA 1EI9A 3NYQA 4RTOA 4G97A 4W1PA 4R1TA 4GPEA 3SICE 2P40A 1MABB 3RWBA 2C29D 3QJ5A 2BJHA 1LV7A 4IOJA 4Y9SA 3ZJTA 3AVVA 3RUCA 4JJ4A 1LV8A 5JHGB 1TT5A 1V8DA 2B6NA 4Q12A 3D2AA 3GJQA 1SQFA 1J0DA 2ZJZA 3JAWA 5E4TA 2CNNA 4EATA 2XCRB 2WPDA 1GZ7A 3RFCA 4KAXA 1PVVA 4TL6A 3PU6A 4AK9A 2VOEA 1A88A 3GELA 2I4TA 4ONEA 3QW2A 4E12A 5FA6A 3THXA 3ZQJA 5IAKA 3EWAA 3G0BA 4LQCA 1YIDA 2BELA 1B8VA 3DFKA 3MSXA 1PWXA 4Q9JA 4MYRA 5K0GA 3O4VA 1RSZA 3GP5A 4CQMD 3DO5A 5L4NA 2WJGA 2P2CA 2YFQA 5L8VA 2XBUA 3UK2A 3TG2A 1W36B 3LBHA 2GKOA 5SYAA 1N7HA 4UD6A 3CUVA 4N3AA 3CVVA 1X7ZB 3K0BA 3JD0A 4H6PA 2G7MC 1LDEA 4KFRA 3JZMA 4NCNA 3ZHTA 5B1EA 1ZI9A 1EEHA 1RXSA 5EMKA 1Z12A 4A2PA 5SYMA 4F5WA 3QI7A 1J7JA 2BLNA 1HYHA 1VHWA 3NWJA 4CIYA 3HKCA 5IKEA 1THGA 4DR3B 1E2QA 3EVFA 1W85A 3CX3A 4PPNA 1Q3KA 2EHJA 3PC2A 1NXXA 3WRXA 4ARIA 2I2AA 4ACAA 5KNDA 3PQ7A 4HZIA 1ADCA 3N2GB 5FOTA 2ESRA 5FV4A 4TVSA 1S3FA 1FZTA 1E2MA 3JTEA 3E4CA 1CY1A 3DLCA 2VF5X 4TTQA 4PQGA 2O05A 3T3MB 2ZYHA 1I5RA 1N57A 3VDXA 2PYIA 3KAJA 4K03A 2ZUUA 5FI3A 4XLLA 4YCNA 1X7DA 3HU5A 3L79A 1IATA 1NFRA 1XCJA 1V1JA 1ZVMA 3HRHA 4DQLA 1C9MA 4KODA 2ROQA 4HYQA 3C85A 3IUEA 4PLCA 3GZNB 1DDIA 3HJNA 4YIKA 3ROQA 3VDMA 2XQIA 1QRAA 4GX0A 4TLDA 4D74A 2GZMA 2IW3A 1GQFA 3EIWA 2V4MA 2X6RA 4HQFA 3ZR4B 2ZBPA 1UDWA 3T5AA 2J31A 3NM6B 4WBNB 2CLEB 2CXXA 2P2YA 3RLIA 5AVQA 1GTRA 5IYZF 1ENYA 1SUEA 1SXJE 2HT6A 3THSA 1IBLB 3GHHA 4RWZA 5KYGA 3L0IB 3PRYA 2RB4A 3IJ5A 3FCAA 1ESCA 1E7RA 2Y66A 3BGWA 1YDFA 3B2EA 3HWX1 2FJ0A 4HGNA 2C31A 4JBGA 5HILA 3NU1A 1Z47A 2BGLA 2D5AA 3BMCA 3LQ1A 3M6LA 4X60A 1QRUA 4PSDA 1V4NA 1NWHA 4KO4S 5HZMA 1SB8A 3B3QA 3IBGA 4LGYA 4YV2A 2ZTMA 1ZA2A 4ZEMA 1GVHA 2O8VA 5PNTA 3OZEA 1AM4D 3GRVA 3DR3A 4UFPA 2H1OA 2NVBA 3IPCA 3OT5A 5CX1B 2DULA 3ZZNA 4BASA 5LJLA 2P2SA 4N5NA 1M6NA 5IAEA 4ENUA 3ZKAA 1P61B 4IGFA 1FTYA 3TG8A 1J2EA 3R0XA 1MTOA 3BMOA 4GSYA 2PUFA 2BIFA 3FLMA 3TVTA 1KRWA 1CY7A 1VMAA 1U99A 2F67A 3C4VA 3G2QA 3AP2A 3D6VA 2V03A 2RHLA 2QD3A 3HVIA 2HPZA 5DBGA 5LA6B 3ZE1B 1QOQB 1SKMA 4L2IA 3U5ZB 1ORIA 1OIXA 3IESA 4Q4AA 5EXPA 2CV2A 3QWIA 4X6YA 2DQSA 2Q1XA 3SXPA 5BMOA 4I55A 4YPVA 5ESRA 1E3WB 3FZNA 3DAPA 1V1MA 5EIAA 3FR8A 4R9NA 4GNKA 2V58A 4YMSA 4BV3A 4XUDA 3SQDA 3MINA 5ICMA 5CB4B 4JZYA 1F2TA 4X8HA 3L02A 2XECA 1Q12A 3WNQA 5FOQA 1K5HA 5B6PA 5F3WB 3LG2A 3DTTA 4UUAA 4I9FA 5IS2A 3Q5GA 1X6VA 4BMXA 3T4EA 2VDOB 1IN7A 1XJWA 2ODTX 2MR5A 1R74A 4FSDA 1H5UA 3DH0A 5TRTA 3UJBA 1OLXB 4MQLA 2Y71A 3ENKA 3L5OA 4JT2A 2WAYA 3ZCPA 4XDZA 3MJHA 4ARUA 3GLSA 1U6JA 4UTVA 2H5LA 3SWWA 3UPUA 3EA5A 3IMCA 1JRLA 2QJTA 3AYXB 2GBCA 4CIAA 4IDGA 3I9KA 5TT0A 3W7AA 2JIQA 5CAEB 3ZWBA 5KX5B 1CIJA 1MORA 2W7TA 1NJ1A 3WX0A 1QH8B 3LVQE 4B48A 5F52A 6GPBA 5BN4A 3OQIB 2ZVJA 4OQYA 4PTZA 2NZXA 2NUAA 2CHEA 2FFAA 1AXGA 3WICA 5LXTA 4EO9A 1XPRA 1S7GA 2D0OB 2L69A 3L8FA 3ODGA 1DKMA 4WFKA 4X1IB 3SXUB 5GGXA 3NHUA 4TUYF 3ZD9A 1PZNA 4BX2A 4C1BA 5KWIA 3LUBA 1ACMA 3E05A 1VM6A 1N77A 4ZT4A 4FUQA 2CKMA 1JFVA 1Y34E 3R6TA 3JQ8A 4JL6A 3H5LA 4TSRA 4YBRA 3HUTA 1EZ4A 3JASA 3LHDA 2PMWB 4WXPA 5DLPA 4YCSA 2PA3A 3I05A 3KYDA 2WF9A 3T7AA 2FZEA 2HQ1A 3E03A 1YXMA 3DZDA 4EY4A 1OBFO 2VL7A 1RYYA 2OQVA 2C42A 4W82A 4CGYA 4DA7A 5F7ZA 3MBOA 3EUAA 3IVRA 4EEZA 5C18A 2WM8A 4S1PA 1R0SA 3C3YA 2Z3WA 5EUMA 2ZGVA 4CVNA 1BMFA 2W2MA 5IBRA 3TXXA 3U4CA 1UAAA 4QGBA 2RI1A 2JGJA 2WQZA 3EVEA 3NTVA 1H0HA 4L3WA 1FXUA 2HNKA 3QLVC 2DSTA 4GLFA 2KJQA 4YASA 5TQ0A 2X1MA 4ESVA 1L8QA 1L7EA 3L05A 3ML1A 4HUJA 2D2EA 4NAUA 4J4BA 2D1QA 1WVIA 2AWNA 1WABA 1KH2A 4FOOA 1YBHA 3THWB 2HHLA 2IHUA 2F3RA 3PUXA 1XOIA 1V26A 3WL3A 2C8KA 2DWCA 1KARA 2C61A 2WHRA 3ESYA 4G4SP 1FNBA 3KEFA 4KZPA 4XARA 1G1MA 2OC9A 3S4YA 4NE7A 4CM9A 3B1VA 5BSVA 3CZ4A 3EDMA 4ZCQA 1GU7A 4UAVA 4YRGA 2OWEA 4R1LA 2FSFA 3D7RA 4NJMB 4PZZA 3BWVA 1P0PA 3WL8A 2IVZA 4B3IA 3EZ7A 4TYWA 5FT9A 1C9KA 5LU9A 1AUXA 1QO7A 3Q9UA 1QKJA 4V0ME 2WD7A 1FDTA 5JBQA 2R8ZA 1EE2A 5ENVA 1W0JD 1RYEA 3N28A 5TE9A 3WV5A 5BV7A 3EXHC 4KUGA 3CWCA 1JFSA 1U6IA 2C84A 1T4GA 4L74A 2XOXA 5TMDA 2Y1FA 1ORDA 2G6BA 2O2GA 4U2KA 1VJGA 1F60A 2IEAA 3M89A 3K92A 5A9TA 2OMEA 4MCIA 3AJAA 5CG1A 2WD8A 2H65A 3QKUA 5FUXA 5H5JA 4AYXA 2EFJA 4UAJA 1ZONA 4CCYB 1P5JA 1SHLA 3NRJA 4QU5A 3RREA 4EG5A 2QN2A 3OKFA 1GZ4A 2FMIA 2LBPA 4L6CA 3PWSA 1EHYA 2Z4SA 5EKTA 3PX2A 4I1OA 4R2XA 3KELA 1WMDA 4Y6SA 1PQYA 3BPSA 1E79D 3ZLBA 4RTRA 1SA0A 3JQGB 4D4MA 1V11A 1Q1GA 4GD3Q 2D1SA 2X1LA 3CWZA 2R6GA 5TMBA 5I7FA 1VYUA 2HHJA 3BIWA 1KGDA 4DDVA 1N1MA 1NLYA 1RTKA 2QP3A 5TDHA 3WRYA 2TYSB 3FFBA 5DULA 4XGRA 2HO4A 2ATIA 1YCHA 3AJEA 3VHRA 2WD9A 3PFCA 2VJNA 4QPCA 3KHKA 4P2BA 3ENWA 2FEWB 2FP4A 1ZCZA 5J63A 3FDXA 1ZN8A 3RIEA 1M2VA 4BNYA 1R4NB 2A5GA 4BKMA 5EHQA 4XFDA 3FOWA 2C1ZA 3QVGA 3AFIA 1KO4A 4I3GA 1MR3F 4ENPA 5IEJA 1GCAA 1QONA 5DGTA 1U7WA 2WDPA 3BTUA 1OYWA 3G9XA 3RYIB 3ZE8A 5TQ2B 2YVUA 1C8LA 2OESA 3GCZA 4GMXA 3FETA 4LX8A 4ETMA 5AI0A 3QE4A 3CUWA 1PW5A 3ILYA 2CUNA 5DEOA 4BQIA 4WBNF 3K20A 1ZW1A 1T5TA 3OO0A 1OREA 4KEAA 3O3OB 3UWPA 4J0HA 1ESNA 2VHTA 3ZDAA 5J4YA 1S6YA 4PC7A 4FYPA 4DDMA 2R8XA 3WGTA 3UB4A 3A4MA 4UEJA 3W5SA 3ER8A 2FSIA 3K0FA 1IY9A 4C03A 1QG6A 3UWKA 2D2XA 3ENQA 3EBOA 1V16A 1WXHA 1UK8A 1XZBA 1WG8A 3VGJA 1MVLA 1L5VA 2IZ0A 3AP1A 5AI6A 2VJBA 1Q1ZA 4DR1B 2PH1A 3EGCA 3UWSA 4QG3A 1X9GA 1K4YA 4U0KA 3SIPA 1UMDB 2J3LA 3CN9A 5BR7A 1P1IA 2GH1A 3AUKA 3H9GA 1U4OA 5JRJA 1UEJA 3L8DA 2IXFA 1Z0IA 2PRSA 3FSGA 2RI0A 1G21E 4FYKA 4MMYB 2B4YA 4R2LA 3WYFA 4W7HA 5B64A 1E5VA 3GGJA 4XSGA 4IGIA 2VDQB 4NYJQ 1YVDA 5IN5A 2GBGA 3PD0A 5LA6F 2ZB2A 5EGSA 2Q5FA 2XMGA 3JYPA 2KQUA 4OUDB 5AKZA 4JROA 1WZIA 2YV1A 2YDXA 1LDMA 4C05A 3W3AH 1OZGA 4FYWA 4R7TA 5KJ1A 2MSEB 2DGDA 2H1CA 4I9GA 3V1MA 1V45E 3F6EX 5T4BA 5DLEA 2OL4A 4C20A 3PWKA 1EFUA 4OP2A 5DGDA 1I3LA 3CURA 3S2ZA 2EHDA 1NVAA 5CB4F 2OO7A 4ND8B 3D5QA 5DBHX 4A6PA 2ZRFA 3V4OA 2Z98A 3C41J 4TS1A 3Q7EA 4R2WA 4C6SA 3C3DA 3GFGA 3UV7A 4YREA 3VO9A 3TKAA 1T5SA 3LP5A 2I3BA 4IDHA 1PJCA 5AW8A 4N5DA 1GLVA 3EJWA 1YAJA 3H8WA 1ZK2A 3ZS9A 1KZYC 2LGJA 2OECA 1YMVA 3LX6A 3PFIA 4O1MA 1YFKA 2ZSJA 1XEXB 3GU3A 1X8JA 3M4ZA 1LRKA 3BFVA 1WF6A 4X94A 3DV0B 4DDKA 1ZNQO 2PAAA 4II7A 2W58A 5KX5F 2ZQZA 1JJVA 2CWDA 2HRZA 5HKLA 1U0JA 4G65A 3NHLA 1V37A 2F9LA 5A2GA 3EIXA 1O77A 3L43A 4J0GA 3PIIA 3F4KA 4CFYA 2G09A 5REQB 1OJ7A 3SBXA 5KEIA 3VSEA 5L3QA 4R1NA 2ZRNA 4MUYA 2WK1A 5M3BA 1YR6A 3QUTA 4QJBA 2NVOA 4TMTA 1SVLA 3T1QA 3VH1A 3U5TA 3M3PA 1EIWA 4C2BA 3HEMA 2C96A 2Q5JA 4DHWA 4WKGA 2P0YA 2XWSA 1MAHA 1S02A 3WSVA 4W1RA 4RK5A 2HDWA 4LXGA 3V9PA 4YMGA 3KXPA 4LHYA 2G0NA 2HBYA 3LQRA 4H08A 2FFRA 2WNIA 2XOEA 1QRDA 1VG9B 3BT7A 2PPVA 3B85A 3LMKA 1PLJA 2JI6A 3JQEA 1FEZA 3PHHA 4EMUA 4KWEA 1TVEA 5F4BA 1GG9A 3TW6A 3A6EA 4KAFA 1CS4C 1NOJA 3S0JA 5AD1A 5BQFA 5JUWA 1Q1EA 2RKBA 2Q0QA 3L6EA 1Z15A 3WGZA 4UDXX 4B75A 1C8KA 2ZR0A 4JWKA 2WHPA 3R0QA 2X9VA 1E63A 1YD7A 2EEPA 1Q1NA 5KDLA 2I76A 1HTWA 3BA6A 4CV2A 5LIRA 4RKRA 1I5OA 1PW7A 2BUBA 3I3SR 5JROA 3B7WA 2ZR9A 3QEKA 4C06A 4LI0A 4TYNA 2BWJA 4O4JA 4QDOA 4YCLA 1AU9A 1D2EA 5BVGB 1HNXB 5BWMA 1C0KA 1UWCA 4GQBA 4Y2JA 4Q1VA 1AF7A 1M73E 2ZIGA 4QQNA 2H06A 1YB1A 1E2LA 3KYJB 3W2FA 3TLKA 4QLBA 5AUOB 5SICE 4D9BA 2Y0EA 2HT1A 4EKDA 2R8YA 2W6NA 3QEOA 3JU3A 4HNSA 4HLNA 1XG5A 1IZ8A 4HQ6A 4MW2A 2WWFA 4WGFA 4WXEA 3H0CA 3RSCA 1SQ6A 1NV9A 3EDYA 5B4TA 3PX3A 4UHHA 4GAEA 4E14A 1MAVA 4EKIA 2ORIA 1Y5LA 3F49S 5MGNA 2AN5A 1AQIA 2Q4BA 4XFJA 1R6BX 1RJEA 2QD1A 5L51A 5KSZA 1EK2A 4LBZA 4HEJA 1KC3A 4M8SA 5D2CA 1Z5UA 3SMVA 2GVNA 2OORC 3TNFA 2XKBA 3M5WA 3LH5A 2NWQA 1JXOA 3KB1A 3NKLA 1Q95A 1J70A 1Z6ZA 1R9MA 4HLUC 3R4CA 5IANA 2DP4E 3UC9A 5I9NA 5KQMA 1HDYA 4JXKA 3BHMA 3G9UA 3GUVA 3UGTA 4DWWA 3G13A 3PENA 1Q0ZA 4X90A 2NZJA 1FLVA 3GO4A 3D9QX 3P0FA 4ZQCB 1YDMA 3V6LA 4A23A 1WY5A 5TB5A 4RFSA 2WA1A 4TMWA 4WXHA 4MH0R 3RSHA 2C83A 4G0OA 5CGZA 1MVOA 2Y99A 3BE4A 3KEOA 2JFQA 1R9JA 4MLZA 5K3CA 1B26A 1DAHA 2MSCB 2RSLA 4E5DA 3RYCA 1CZNA 3AIIA 3C8HA 2X5OA 1GNVA 3T5DA 1M8FA 4FFBB 2BM8A 1SEVA 1WW8A 2OUKA 5EZQA 4BYGA 1TW3A 2EFHB 1PNTA 4C4RA 3JR3A 4TKUB 1H22A 1ZMRA 2BKLA 4HZUA 3T99A 3N6VA 2XWQA 3ISJA 4UFNA 5DYYA 3EBPA 4WD3A 5T67A 2F48A 1I7SB 4RKFA 1F6WA 1RWOA 2H2HA 1QQ5A 1EGHA 2Q9UA 1MC1A 1VA5A 2XHEA 3LY9A 5DP1A 4OU5A 4ZU6X 3ZHQA 4TMYA 4NV1A 1SUFA 4PNEA 3EEFA 5C32A 3W4KA 3EZ6A 3GRYA 3TIIA 4LQ4A 3AM5A 5CBKA 1E6MA 4AS2A 1TM4E 1WUIS 4H9GA 4JQZA 1TQ8A 3LYHA 4KQJA 1PG2A 3RT1A 3TNLA 1VKHA 1S89A 3C8DA 4I2NA 4X97A 4ZT6A 3RSZA 5KNBA 1SKYE 2CXPA 3B3JA 3Q2IA 5C5CA 4BO8A 2ZT7A 2ZYIA 1IXZA 4M7WA 1R0CA 5ELMA 5T5QA 3T9BA 2Q4OA 3L0ZA 2Z04A 2I6XA 4FU0A 4RPKA 1E2PA 3GA0A 3VJMA 4YT8A 4C7JA 2BGJA 2AUMA 4JI1B 2JJ1A 3HL0A 1NW3A 2NQTA 3PQ2A 3ED5A 1T2NA 1FLDA 1UZAA 1V6SA 3JW8A 4LWZA 3LO5A 4B7AA 1LTHR 4YI5A 2D1TA 1MB9A 3DUWA 1TM1E 2P35A 2VAXA 1OJLA 3I6ZA 1J49A 1QE5A 3H9CA 4PSUA 3UMBA 2YJ5A 1M0WA 4EDFA 2NU7A 3D4IA 1UBOS 1PS0A 3FUWA 8AT1A 2PX5A 5GZ6A 2V7QA 4GE3A 1JXAA 1ZI6A 2NSHA 4GFDA 5A5FA 4UQLA 1ZC4A 1P7PA 2VSOA 3TJMA 1KSFX 3QNUA 3PFGA 4ANFA 5FBZA 4F3YA 2C5GA 2JGFA 4UJ3A 3GG9A 4U0JA 5IJ0B 4G24A 1MQSA 2YICA 5JZVA 2IUUA 4DLRA 2CL5A 4I50B 3VOSA 3KQUA 4B6EA 4LRQA 4LXHA 1A82A 1VMIA 4X8LA 3SK0A 2BJWA 3DKPA 3QMPA 3W5UA 3L0DA 4YRKA 1R8QA 3QUQA 1NP6A 5EZ5A 1PDVA 2JD0A 3M9WA 2J7KA 4ARZA 4MO2A 2APJA 1WP9A 2OFXA 3AQ4A 3BRSA 3TRDA 4DZZA 5LMZA 3O9MA 1B2LA 4DSTA 3WKBA 2EEZA 2PZKA 1B3RA 3KX2A 2AFVA 2YXNA 1JG4A 3DC2A 5DRYA 1VJ1A 1U0SY 3GVPA 4XDGA 4E13A 5JTTA 5EVJA 5DTMA 2QUZA 1SOWA 4MWCA 1L9XA 1Z63A 2EYQA 2CNLA 3R77A 1A2OA 2LDBA 4RTQA 1KSGA 4WIAA 2NUPA 3T3PB 3IR5A 1QSGA 4QYWA 1U7HA 5JAZA 1USVA 2B8WA 2IYPA 4A0SA 5H1YA 1EIZA 1KYZA 3A7EA 4EG7A 1XXHE 2OHHA 2FR1A 3AXTA 3G68A 2H5EA 1I4EB 1QGUB 3IJRA 2IDJA 2ZRHA 4MTLA 3VTFA 2WVGA 3K8OE 5AOBA 5F2KA 1Z28A 3F97A 1JNYA 1WUHS 1NQVA 1P77A 4Y9RA 3CX8A 4IH4A 3PPIA 1DQYA 1YGYA 2WR8A 1DJNA 1EJ0A 1W1IA 2VKQA 3OIVA 3OZFA 1JHOA 4G01B 4RNCA 1L7XA 1OHHD 4RY0A 1QR6A 2W00A 4BJ5A 3NWBA 4KRXA 5JALA 2DBQA 2E4ZA 5A2QA 1ORTA 4IGEA 1UM9A 3T6KA 3B36A 1KORA 4ECEA 3CLVA 4KXNA 3M1YA 5CT5A 2VSNA 1WUJS 2HQRA 3NVAA 4W9NA 4X84A 1A8PA 1GY8A 1J0EA 4CTOA 5EXXA 1WY7A 3BQNB 5ERGB 2R4TA 5ADWA 1N3YA 4F93B 4ZTZB 2PGAA 2GM9A 2Q3FA 3BBPA 3PVSA 4MVJE 1NW9B 4GKAA 4AYTA 4XX0A 2XUQA 4RV9A 1DELA 4CTKA 1FFYA 4U2BA 1XQ9A 2UVPB 2AFHB 3A8TA 4R2IA 2XRZA 2PUEA 1NRIA 1VLJA 2V6FA 3HACA 2OCIA 3O3CA 1BIFA 2FG6C 4FWTA 2MDTA 4IEFB 2PS9A 5KKAA 3N8IA 4BECA 4Z4GA 4PLPA 1A72A 2A57A 2F3UA 4BB6A 3W8FA 3QPVA 2FSVC 1IH8A 5JNTA 2AN1A 2HRBA 2YBEA 3A9VA 3ZIDA 4ZEWA 4OIMA 3K09C 3S1SA 1MLDA 3BK2A 3HCNA 4BRUA 3PYMA 3BTVA 4AZ3B 1T2DA 2F17A 3A3KA 5ER9A 4CCAA 1RE1A 1CUCA 1JFLA 1WZCA 3GUZA 2WDZA 5BN1A 4YJ3B 1MT3A 3KAPA 4NDZA 1UFQA 1SIUA 3KUDA 3CLTD 4RKYA 1VGQA 4I6EA 4GMFA 3SS9X 1O0CA 5GVRA 3AVTA 3G1UA 5DGIA 3ND9A 4ZP1A 3GNTA 3BCUA 4G1UC 4JOBA 4WFIA 1MOPA 3OWXA 1U2EA 5EA2A 4FNMA 4C4ZA 2O7SA 2GZRA 4PCVA 2IU0A 5C5EA 3ZDCA 3D7NA 1JMKC 1CP3A 3KR2A 4YYEA 3I72A 3M4XA 3TK1A 4BDTA 3INYA 1X42A 3ZW9A 3G9TA 4YWHA 3HN7A 3W4IA 1PHRA 3I04A 3A2LA 3TDMA 4PLZA 2GN4A 4UUNA 3U4HA 3OKPA 1DRJA 2PVCA 1NP3A 4OA5A 1KF0A 1OPRA 4NFYA 4CE6A 4DLPA 1VKOA 1OH8A 2O8FB 1RMYA 2GF9A 3AHIA 2NXJA 2ADFA 1JR3E 2HXGA 4WBSA 2JCYA 5CNKA 3C74A 3WZMA 1H2WA 2C2HA 4IDAA 1SPXA 4XCVA 4QQ8A 2FQQA 4YDSA 1GGKA 2G9ZA 2VDJA 3S1LA 2ENWA 3O8RA 5DYIA 3Q8KA 5DIFA 4N6GA 1Z5VA 3K71B 1X77A 4BNIA 1LUAA 3PFFA 1Z5PA 2V74B 1C0LA 3DXXA 3C7KA 1TVKA 4MGHA 4B3HA 2OENG 4R8LA 1ADGA 2YVKA 3BERA 4X93A 3EMVA 1GLGA 3HCWA 4LZJA 4AP9A 4CMIB 1KQGA 5J1SB 4PINA 1DG1G 1SXIA 2OHXA 5C4GB 3DFMA 2C3OA 2QLNA 3H11A 4I6GA 4P22A 1E5XA 2O6HA 4LOLA 5CA0B 1T36A 4MITA 2C9YA 3TL3A 2OP0A 1E7YA 4B9EA 5I7SA 4IIJA 3DLIA 3EGDA 3KQHA 1DQZA 3AB3A 2HA0A 4QFMA 3IMGA 3K9WA 3PIRA 3TQIA 2DERA 5K3FB 5C2JB 1FNSA 4I5IA 3MTIA 5ESDA 1AN9A 1P9NA 3C6KA 3Q85A 2EWVA 1Q20A 3TLYA 5JXIA 2F00A 3JYNA 3WLPA 2Q3BA 3QKTA 5B3AA 5K2MA 5LQDA 1TQDA 4B45A 2ASEA 3IERA 3UQYS 5K7SA 1XV5A 3FFTA 3M1IA 3ZH2A 3IDSA 1VBMA 5ANRB 1GT91 1H69A 3A6JA 4NV3A 3U44A 5CLGA 1WKBA 2PGOA 4H7FA 4XPIA 3TQFA 4A0GA 1MOSA 2G9QA 2DT8A 1A9OA 1BXGA 1PF7E 3SKXA 4BQQA 4FR0A 1NBMD 3STYA 1PBNA 2B0JA 1Y4DE 2P0EA 2IS2A 3WNVA 3FFXA 5DHUA 3T9DA 4M9SA 2GRJA 2VR1A 3LAWA 4WCVA 3M3HA 1W93A 1KQOA 3PNPA 2D5IA 5BNIA 1R88A 3QE9Y 1O57A 1U8YA 1E6KA 1TYAE 1UMBA 2F4VB 2ZSUA 2ABWA 2JFNA 4L5CA 5D7NA 3VAYA 5L9AA 5HGJA 1ZD8A 4LXXA 3CX6A 1W4BA 3OEWA 3OSUA 1HZZC 3V8MA 4MWSA 2WBLC 3DTYA 3PUJA 4Q9HA 1JDUA 1EHCA 3UT5B 3DDSA 3KZVA 1GG2A 2LP4Y 2C03A 4X44A 2Z0MA 3PTZA 4DC0A 1CJUC 2FG5A 1BWSA 2H1IA 1AKEA 2WSIA 4Q3BA 2KE5A 1I01A 3OETA 2EFYA 1U3WA 1M2OB 3D43A 3FTPA 2OLJA 3LQYA 3V7UA 3ZU3A 3MELA 5H80A 3FPJA 4U6QA 4ESOA 3AP3A 2C97A 2O2JA 1XZMA 4AKIA 3V4PB 2FZCA 2B7CA 3A1TA 1TZMA 3AQIA 5T6BA 3TJZA 5JJ5A 2O8DB 3S7TA 3TTVA 3DZCA 5EIHA 4TT3A 5EP3A 1G20B 3WP0A 3MOIA 3HXPA 4W9MC 2FMFA 3A0UA 3PE4A 1N3LA 3ZI7A 4I50F 3OZCA 2CHFA 4LTDA 4UEOA 2GCIA 3OC0A 1XK6A 1TZ2A 3WGMA 2ZLBA 2WFAA 3BWYA 2A0XA 2V6MA 2NNWB 4QSMA 5DSZA 1J24A 4PV7A 2QRHA 2VK4A 3RUHA 5D5QA 4A8JA 1Z74A 2I3GA 4Y6RA 3IKJA 2O2IA 4FFLA 4MKZA 1S0UA 2GPAA 5JIBA 1HDXA 3C97A 3ONDA 4O2BB 1GVNB 3TNYA 1JPUA 5C9ZA 1TJYA 1Z82A 3TRHA 4QARA 2IYQA 3R1IA 4JI0B 2G07A 2QY6A 1CBUA 4Z3OA 3WIBA 5L6MB 1DOHA 5F5NA 4H77A 1EJBA 1CR6A 2BI4A 2VJMB 1M6EX 1GRNA 1SCUB 3O7MA 4RZ2A 1R9NA 4ZXFA 4D3SA 1TUBB 3AGPA 4YCCA 5ARBA 3QQ5A 5L4SA 1M1NB 4EKEA 1NUTA 1SCNE 3Q12A 2PBRA 5BMVF 3EC7A 1X7GA 1S8FA 1US8A 3NBXX 3QKSA 5DSXA 5JYCA 1C7JA 3R5FA 5IVDA 4YJFB 4TTIA 4NEGA 2ZYAA 4YJHB 5BW5A 3PL1A 1T8TA 1UDXA 2P30A 3N70A 4KV7A 4XCQA 1Z0FA 2QRQA 2X2PA 2GN6A 2SBTA 4O8ZA 3PKJA 3QE3A 4YJDA 2ZAYA 2OLEA 4BJHB 2OZLA 4ZJPA 3FYTA 5DBEX 5EC8A 2NN3C 4JASB 1LVGA 3GVCA 1UPTA 1Z34A 1JMYA 2NUBA 4HQRA 4UPEA 2GKSA 4BPRA 1MB4A 2QAGC 4S35A 1GTZA 1AVTA 5FFMA 3IDAA 4OOEA 3KSMA 1PNRA 1HE5A 3DTNA 1P1KA 1R1DA 2I7DA 3PDWA 4G36A 1QP7A 2A9FA 3LPAA 4MIOA 2COUA 3QUCA 3EXAA 5ESWA 1E99A 3K32A 4JT8A 4EJ0A 2FW1A 1C14A 5DGXA 1OTXA 3DVAA 1CULC 3DT9A 2H31A 4WOJA 1BQEA 3P71T 1RD4A 4C76A 3AO0B 1Z18A 5CVEA 1TJPB 3WKDA 2HBQA 3E7PA 5EZYA 3RVOA 3CRRA 4M1OA 4F56A 2J41A 5MF6A 4W8GA 1DBRA 2JAUA 1LCIA 3UJAA 2RAVA 2K7FA 3M33A 2QUKA 4RKQA 5AJHA 1V96A 2IOFA 3IVAA 2FQWA 4TGLA 4HNUA 4Z4CA 3R9XB 2LRHA 1S1CA 2E21A 4G23A 2I4LA 1WCIB 3MK31 5AVUA 3FAZA 2H16A 3RTGA 4CRWB 5JSZA 1F8FA 4RYDA 2IKSA 1BVUA 3MIZA 2IITA 3IVGA 3SS8A 3K8YA 3PA8A 1EXDA 3VPAA 2PHZA 3JTMA 3S29A 2WB4A 5CT6A 2J67A 3AEKB 1Q74A 3B1JA 3ESXA 3KXKA 3RM3A 1Y6QA 2X2EA 3CWQA 3KU1A 3L4BA 4AS1A 5B57C 3LVFO 4LRYA 7GPBA 4DANA 1L1RA 3OAAD 5FOSA 3G49A 3WL5A 4LTMA 3DFIA 2J4CA 4R1PA 4S1OA 3WMXA 2E9SA 4MUGA 4ZDJA 3LLMA 4HAVA 5AJTA 2VI5A 2KYRA 2VSFA 2PGNA 1VMDA 3BSSA 4PIPA 3AVQA 4COKA 1AKVA 2F1OA 2XNHA 3R7WA 4DAOA 1E62A 2VQDA 1BN7A 5H4HA 4E5SA 1J99A 1E69A 2XTJA 5B1IA 3T0FA 4AJPA 2JH3A 1ODFA 3E9DA 4CM8B 1GR1A 6NULA 3MB5A 1RT9A 2VHEA 2ZXEA 4MR8A 4BZZA 4PN3A 1QORA 4Z7QB 1CWUA 1K4MA 3D6AA 3QPDA 5C7OO 2GYVA 2BGWA 1D0VA 1HWYA 4ZDKA 2UYHA 1X1BA 1N78A 1FVHA 1VCOA 4KX5A 2YWFA 1EFLA 1UBJS 1O87A 1N2EA 4P6VF 4D0SA 4LFAB 1ELOA 3RAEC 2VYVD 4OJQA 3WLLA 5CB0A 2M1ZA 1UKYA 5K9ZA 3VPGA 1QVAA 1R4ZA 2O20A 2WUFA 3QF7A 4J0EA 2FN7A 5DN9A 1W73A 4A0FA 5A6SA 5DH9A 4IIGA 1MB3A 5GGYA 2B5VA 2XCSB 4EARA 1X9HA 3PXUA 4Z54A 3JZIA 3P52A 2FPPA 4PFSA 4INPA 4KR6A 2QG4A 5LCXA 4C4YA 1B41A 3DEJA 3P0JA 1DKPA 1T2EA 5CA0F 2ZBDA 3RFUA 1XYVA 4H27A 1TJNA 3AWIA 1BX1A 1DTWA 1UC9A 3U3ZA 3ADOA 1EBBA 4FE3A 4OQZA 2AFIA 4OQFA 2XMQA 4B80A 4LF8B 1P3Y1 2ACEA 3QNWA 3DCJA 4A73A 4D8YA 1X2BA 3SSAA 4BJ3A 2ZYSA 2BEVA 2H1LA 1Q3TA 4MWDA 1HZJA 4KR7A 1IAVA 1IC6A 3UO8B 1UKZA 3LQFA 1UKAA 2G17A 2AEJA 3OT1A 4JQSA 4XM1A 4R01A 1JALA 1P91A 3B48A 4HNGA 4YN3A 4DG5A 3DSRA 1FIUA 4ZPJA 4WNAA 2F90A 4KO1S 4WOPA 2NNLD 1Q0TA 4YRQA 1YRHA 3P9QA 4E5PA 5ALVA 2QA5A 5HF5A 2IJGX 2WM2A 3HADA 2HQBA 3D0OA 4MAMA 3TQQA 1I6LA 2IL1A 3O03A 4E5NA 2EWMA 2CDRA 4JDUA 4TWRA 4YY3B 3I6QA 3KB6A 1P1CA 3AF2A 3VMFA 3VSCA 1OOEA 2EJWA 3LPNA 2EKBA 2HF8A 2IHKA 1OASA 2XTMA 1QH1A 1YZVA 3PEUA 4OK3A 2C58A 4C89A 1I13A 2XLCA 2IW1A 4CNQA 1EK0A 1KEUA 2CJYA 2XUKA 4LK3A 2D5CA 4NDNE 4YMLA 4QDTA 2FKAA 4JI2B 1T9AA 3EPPA 4QBKA 3RU3A 2PBFA 2YWBA 3FOEC 2EF0A 4MVJP 1JI0A 1KNXA 4KB5A 4TV8A 2B25A 3GPCA 5EP4A 4BTLA 3QVSA 1XAIA 4BBJA 1ZICA 3ZTTA 3CUSA 2IU3A 4QUGA 3SM9A 1VCHA 1W87A 2NZUG 3F7OA 4ID9A 4X6LA 1RAFA 3HN6A 5CFPA 1QIGA 3EXG1 1WMBA 3LC0A 5CK5A 4RK6A 4FFRA 3SC4A 2C5AA 2AKAB 2ZS8A 3RR2A 4BGEA 2V8BA 2H0AA 4KVZA 4MRMB 5JSUA 5KHAA 5MN5A 3DTVD 1EGQA 1V3QE 2EFCB 5BYJA 3AIKA 2XB2A 1HI9A 4N9QA 2I3ZA 5GV8A 4R6XA 3PUVA 1TO2E 3RFFA 4AN4A 2QUIA 4AMZA 4CDNA 4QICA 4QO7A 4YAWA 3ON5A 3QEAZ 1KI2A 3HDVA 1NI4A 2PFSA 1O0BA 1MEEA 3HDHA 3ZWMA 4M4SA 4YP1A 4ZODA 1PJLA 3Q5EA 2ECFA 2EARA 2VPQA 2XAAA 4YCDA 2B3DA 2C88A 2F3SA 1GAWA 4AG6A 5FBKA 3JVEA 1GARA 1PYDA 4LDZA 5A1TA 1NXWA 2CMDA 2ECQA 1Z06A 4E32A 3AF4A 4O2BF 5HBGA 3JWHA 3MJTA 5DX0A 3NIWA 1QZZA 4MLPA 1G5HA 3IA2A 1R6VA 3WC4A 2XOKD 1J22A 2GAFA 4M88A 4KRFA 1KBOA 4Y9TA 3A06A 5CFZA 4K9KA 1GZSA 3A28A 2X0DA 1I3OA 4UBJA 1ZISA 5I4KA 3AL0C 1J90A 3RBVA 4TLCA 3KUKA 4LFCB 4I1UA 4PYQA 4OJNA 1SD2A 4G09A 3GMSA 3L0SA 1UKCA 4RJ2A 5EIXA 2CJXA 3AVPA 3B1YA 4BCBA 1YZKA 1EK6A 1THTA 4K8RB 5DCLA 1OIVA 4OMUA 3HA7A 3ZEAA 3DNPA 5EJ9A 1Q5PA 5KNCH 4XKJA 1E2EA 2R6R1 3QKRA 2LZ0A 2WV9A 2JLVA 3OTWA 4HS9A 5CB8A 5DNUA 4OD0A 4FHGA 4KXWA 4OPMA 3TW8B 5J58A 2Q07A 1I10A 3AR8A 1BWPA 4WERA 4QVIA 1RABA 4K7JA 3ITEA 2QR2A 1JMVA 16PKA 1SXJA 5CXSA 3GEEA 3ZXXA 1T1IA 2ZJ8A 1KMHB 1URPA 1NR5A 1UDAA 2BFOA 4R71A 3WL7A 3J81A 3JATA 1XAGA 1MA3A 1SRRA 4BVAA 2R8RA 1NDQA 3LYAA 4WLEA 2WYWA 2CHGA 3QBJA 4RK7A 3U39A 3ZE9A 4L85A 4LCJA 3O4IA 2JDIA 2Q2NA 5ENZA 4P4LA 2ODQA 5JWOA 1FTQA 1U8XX 5IBCA 2JLWA 4M8LA 2OWDA 4BE4A 4XJXA 5TQJA 2G06A 1KZ9A 2P4HX 4I4TB 1CNMA 2EW2A 2IQIA 2IVFA 4Z3DA 1O3YA 5I3CA 5KVVA 1R00A 4M89A 4PSVA 3CH7A 2XVAA 3VNBA 5D5PA 3IV9A 1QO0A 1DAEA 3DDWA 1GZUA 3UXMA 1NKTA 4HPXB 4LHEA 3OEEA 4MR9B 9GPBA 3O38A 3OFND 3H3FA 3TLCA 2J3QA 3TKLA 2HSZA 1I6KA 4YUVA 3OE5A 2HSJA 1SU4A 3CC8A 1GNTA 2JAHA 1XNJA 2R7MA 3CY6A 1BGVA 2XT9A 1JKJA 3UJ7A 3V3TA 2I34A 3NUZA 4HATA 3EX7C 3J7AC 5CDUA 3FGZA 4KPUB 3NUQA 4UEWA 5TNXA 3X1JA 3NH9A 3QU9A 1W9HA 1FRZA 2DUWA 4YEDA 3WFJA 1IN1A 1PR4A 3EVCA 3PS9A 3NRCA 4XQGA 1B73A 4EHNA 5LLTA 1CEYA 1XMJA 4PVDA 3DEAA 4KMOA 1BEZA 2VNKA 3DM5A 1E6LA 1QIJA 3VO2A 1LDGA 2QM3A 1MO6A 4GYYA 2JKZA 4NCHA 1P18A 1TGYA 3JZFA 4YT5A 3TIVA 4GI5A 5HTOA 2P4UA 1PKEA 2ZTUA 4QXMA 5EXEA 3SIRA 1A4XA 1K66A 4QBTA 3ZE0B 4NMHA 1TLTA 3ZVMA 3R6WA 3EPHA 5L40A 2IGTA 1P39A 2DFVA 4DWOA 1L7OA 1ZJJA 1SH7A 2W2LA 5JLAA 5E3HA 4D44A 1UXKA 3DEKA 4NENA 1NXSA 5CK4A 1K06A 5JZBA 5JG7A 4INJA 4QU9A 2OVBA 4ETWA 1JLLB 2HU8A 4MDYA 3T9EA 3G6WA 1ZSNA 4BB5A 2B1RA 1DLIA 3UC5A 2WTUA 1NRJB 1ZIYA 2JW5A 4L5IA 3MJVA 2ZSIA 3OCCA 3DFFA 3GR6A 3LVBA 2FWRA 2O2XA 1SQ0A 3KE9A 2ETXA 1EA7A 2VPIA 2J9YB 4DCJA 4B7CA 2MSDB 5ECWA 4JIGA 3BDIA 1F9AA 2FZKA 3DOJA 3NTXA 3RS5A 2ZAOA 3HM9A 1C4KA 2WJPA 4OXNA 5FTWA 4FLMA 4AZVA 4F6CA 3PRKE 5L4LA 3S8EA 1ST2A 3PDHA 4KZKA