2GEJA

Crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp-man
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
373
structure length
361
Chain Sequence
MRIGMVCPYSFDVPGGVQSHVLQLAEVLRDAGHEVSVLAPASPHVKLPDYVVSGGKAVFGPATHRKVKKWIAEGDFDVLHIHEPNAPSLSMLALQAAEGPIVATFHTSTTKSLTLSVFQGILRPYHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVDVASFADAPLLDGYPREGRTVLFLGRYDEPRKGMAVLLAALPKLVARFPDVEILIVGRGDEDELREQAGDLAGHLRFLGQVDDATKASAMRSADVYCAPHLGGESFGIVLVEAMAAGTAVVASDLDAFRRVLADGDAGRLVPVDDADGMAAALIGILEDDQLRAGYVARASERVHRYDWSVVSAQIMRVYETVSGAGIKVQVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL MANNOSYLTRANSFERASE (PimA)
publication title Molecular recognition and interfacial catalysis by the essential phosphatidylinositol mannosyltransferase PimA from mycobacteria.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 122
structure length 361
sequence length 373
ec nomenclature ec 2.4.1.345: Phosphatidyl-myo-inositol alpha-mannosyltransferase.
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13439 Glyco_transf_4 Glycosyltransferase Family 4
A PF13692 Glyco_trans_1_4 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2gejA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2gejA02
2QN3A 4M7PA 1SXQA 3L79A 3ZCTA 1RRVA 2BFWA 5DLDA 2FETA 5ENZA 4N3BA 1EXVA 4G2TA 4KQ1A 3ZCRA 1PNVA 5JTUA 4GPBA 2AMVA 2G9VA 1XOIA 3S28A 1RZUA 3OT5A 3C4VA 2X6RA 1XKXA 3ZCUA 4MI3A 3RT1A 1H5UA 1XL1A 2QNBA 1Y6FA 3HBNA 5D01A 2O6LA 3UYLA 2GPBA 2QN9A 2QN1A 5HXAA 3D0QA 3H4IA 2C9ZA 4N9WA 1P2GA 3IAAA 2QLMA 3COPA 2VG8A 4GZ5A 1V4VA 5I45A 1FU7A 2GEKA 3NPAA 1SXPA 1L5VA 4LDPA 3DDWA 1KTIA 1JG6A 1C8KA 1JEJA 4EL5A 5BNWA 1L7XA 5IKPA 3SYRA 4F97A 1JIUA 3E3OA 3L7DA 2IYAA 3ZCPA 2H1HA 1PN3A 3CV3A 2H1FA 2XA1A 2GEJA 2BGTA 1M5RA 2QRQA 3EBOA 2PRJA 3T7DA 1L5QA 5GPBA 4KQ2A 2XCIA 3CUTA 1FC0A 2JLBA 4PQGA 3T5TA 3BD7A 1XV5A 4MI6A 3NAZA 3BDAA 3QHPA 3MS7A 2QLLA 1XL0A 4EJ2A 3GUHA 4KQMA 2F3PA 1EM6A 4WADA 3SYMA 3CEMA 1P4HA 1JIVA 4X7MA 2G9RA 3Q3IA 4RIHA 4YI5A 1J39A 2IV7A 2GT1A 3CUWA 3NP7A 3PE4A 1Z6PA 1IXYA 2IYFA 2PYIA 3MQFA 3WAGA 2R4TA 1C50A 2VCHA 4LEIA 3C4QA 2F9FA 3S29A 1WUTA 4WHMA 1L5RA 1B4DA 3NCHA 3D0RA 3NP9A 1HLFA 3Q3EA 5TMEA 2QN7A 3ZCSA 2ASVA 5LQDA 2GPAA 2QRGA 1UQUA 3E3NA 3FROA 1NOKA 2VCEA 1LWOA 3G2KA 1UQTA 4CDRA 4X7RA 2C4MA 3CUUA 4RBNA 2AW3A 2Q6VA 1Y8ZA 3H4TA 3OTHA 3OY2A 2ATIA 2XGSA 3L7BA 2FF5A 2QRMA 3DD1A 5D00A 2YJNA 4XIFA 3QKWA 4CTOA 2IUYA 3OKPA 4HWGA 3MTAA 4MRAA 3MS4A 1K08A 3TAXA 2WTXA 4L22A 1YA6A 2R60A 3WC4A 1WV0A 2R4UA 4XI9A 2QRHA 1K06A 1F6DA 2BGUA 2X0EA 3RHZA 3S2UA 4QLBA 3DDSA 1C3JA 2JJMA 3T3DA 2QRPA 2P6PA 1NOJA 4BQFA 4BFCA 3MRTA 3OTGA 3NB0A 3S27A 1O6CA 3VUEA 4F9FA 1P4JA 3BEOA 3MRXA 4MI9A 4NC9A 1GZ5A 2F3UA 3T3EA 1QKJA 4MICA 4BQIA 3OY7A 2PYDA 1Z62A 1P2BA 3MTDA 3MT9A 4YUAA 1GG8A 4RIIA 5DXFA 2JZCA 3OTIA 1WV1A 1JG7A 2KS6A 4MHOA 1P2DA 1NZDA 4GZ3A 4AY6A 3VDNB 1AHPA 4M60A 2R68A 4CTMA 4FZRA 3IA7A 3MS2A 1QM5A 2XMPA 4RENA 2ACVA 1FA9A 3VDMA 4M83A 1GPAA 2VSYA 2XCUA 1E1YA 3EBPA 2XGMA 2SKCA 3HBFA 4N3AA 3MRVA 1FS4A 2X0FA 2QN8A 3VUFA 3DZCA 3AMVA 3BCRA 3Q3HA 3OKAA 4EKYA 3G2JA 2QZSA 3T3HA 2ZB2A 1FU4A 1XC7A 6GPBA 4GZ6A 3HBMA 3GPBA 3G2HA 3MT8A 2IW1A 4RIEA 2PRIA 4EL0A 1NZFA 3ZCVA 3MSCA 2PQ6A 4RIFA 4AN4A 4NEQA 4W6QA 1ABBA 3BCSA 1AXRA 1L5SA 1FTWA 5IKOA 4X6LA 3CUYA 1NVKA 1P29A 2GJ4A 1A8IA 4N39A 1WW2A 1WW3A 5DU2A 1YGPA 1JIXA 3BCUA 4MHSA 1IIRA 1RZVA 3WADA 3TSAA 2SKDA 1PYGA 3D1JA 1FTQA 3O3CA 3MT7A 2ECPA 2XA2A 2AZDA 2QN2A 3T3IA 1L5WA 5C1DA 2XA9A 4YI3A 4WACA 1GPBA 4NESA 1GPYA 4RELA 2G9QA 1NLMA 2SKEA 3OKCA 7GPBA 4GYYA 4FKZA 4N3CA 4AY5A 2HY7A 3CX4A 1P4GA 2GPNA 4RIGA 5TMBA 2QLNA 1FTYA 1Y6GA 2F3QA 5TVGA 3L7AA 2X6QA 4BQEA 2R66A 3CEHA 3UYKA 4F96A 4X7PA 4GYWA 2BISA 1GFZA 3PE3A 4REMA 2AV6A 1L6IA 3G2IA 1NOIA 5JTTA 4AMGA 4AMBA 1Z8DA 3HBJA 2IV3A 1Z6QA 3RSZA 3BD6A 3ZCQA 3MBOA 4EKEA 2F3SA 3S0JA 3RSCA 3L01A 3C48A 1C8LA 2IEIA 3G2LA 2GM9A 2C1XA 5TMDA 2OFFA 2IEGA 3L7CA 3TOVA 8GPBA 1UZUA 2ACWA 3CEJA 3T3GA 2XGOA 2X0DA 1VGVA 3E3LA 2FFRA 1E4OA 1BX3A 2VSNA 3G2NA 4HLNA 4CTNA 2C1ZA 1PSWA 2G9UA 9GPBA 3CUVA 3BD8A 3NC4A 1GGNA 4Z5XA 3MTBA 1FU8A 1WUYA 1LWNA 1F0KA
chains in the Genus database with same CATH superfamily
2E2WA 5CFRA 4C0KA 3H19A 4AZ0B 4YUYA 4V39A 1KYXA 3VR3D 3QEKA 1H2XA 4LE2A 4HLCA 1M2HA 4XOIA 3VR0A 4I1SA 4EUKA 3ZNNA 1RLMA 3EJWA 4TXLA 5G4LA 3W5SA 2B9VA 3BH0A 4BNDA 2QVYX 3V8RA 2O20A 3AVOA 1R4NB 3TPCA 4BMSA 1TF5A 3K70C 1VIDA 2ZATA 4TROA 4IQ0A 4MQMA 3HJAA 4F7WA 4YVFA 1TAGA 1XDWA 2XUKA 3Q0EA 7ADHA 1NMQA 3UMCA 1KE1A 1M8FA 3GN1A 1MAHA 3QUQA 1WKCA 1V39A 1N25A 2CMGA 2EFHB 2HSWA 3QVTA 4MJLA 5LLDA 2Y1XA 1MN6A 2ZSIA 4KXVA 1T26A 2MCFA 3WL5A 4ERXA 4JI0B 5KJ1A 1NF8A 4JC8A 3E5NA 4Q1AA 1W5TA 4O08A 4QGHA 2SCUB 3AG5A 2ZRDA 5J59A 3I2HA 3R20A 1N32B 3TTYA 1T9BA 1GUFA 3RU3A 4RVNA 3SLKA 5BY2A 4I8IA 4WZBA 3RK4A 1KY3A 1EUQA 1CETA 3JZFA 4KMSA 1P9NA 1YMQA 2V3CC 4UEQA 4WT7A 3ILYA 3WJ2A 3O2SB 3G89A 3H42B 3R7WB 1TECE 1ULHA 2ATCA 3WGKA 2VHZA 3D0QA 5ER6A 2F3TA 3ZHOA 4R41A 3EYWA 3LVQE 3QHQA 1I3KA 2GQ0A 4I14A 4HZGA 1NYTA 2YW2A 3O82A 1OGIA 3W3AH 3LQQA 4DEYA 2IH5A 3A2MA 2OG1A 2E6KA 1YQXA 2G6TA 4IO0A 3W9YA 4NMXB 1DWUA 3TSZA 2QYSA 4IJWA 2AEMA 1REQB 1CYEA 5KQLA 1N2EA 1FFDA 1NKSA 2ZLBA 1AV7A 1KDTA 1V25A 1PW7A 2AD1A 3DOHA 4OD0A 4EG1A 5C52B 1CP3A 5IAGA 3HA7A 1M66A 1FU7A 2YCBA 1AHIA 3Q85A 1KO7A 2DFKB 1U1EA 1UC4B 1TMYA 2Y99A 4KAFA 4C3UA 3MQ4A 3HJNA 3LCCA 4CKCB 3DDWA 2VDWA 4AG6A 3GRVA 4M76B 1WEHA 2YXNA 1C1HA 3FHLA 3I01A 1I33A 3HFJA 4Q4LA 3ME5A 3OJFA 5IBCA 1DX6A 2YR0A 3P27A 1A7JA 4DANA 4YLYA 5BVHA 3DVRX 1TIKA 5T8KA 4YR9A 3GLSA 5FH9A 2BFFA 4G67A 1CDEA 3W5DA 1KSHA 4Z51A 1YS2X 2ONJA 1JE0A 3AJAA 2I6GA 2OBNA 4FFDA 4JBNA 4EYOA 5JH7B 2OZVA 2D5CA 1G38A 3PD7A 4OHKA 4PAOA 2CDAA 2X6TA 3HVHA 5TE9A 2OECA 1N7GA 5ILGA 2OFXA 3JVDA 1MABB 3W6PA 5JRZA 3TRJA 1DC4A 2GXSA 5DI3A 3CVVA 5BQOA 2PUBA 3P0EA 2E18A 5KBYA 3B5IA 4HVLA 1L7BA 4XFJA 1L5FA 2GZMA 4BFUA 1NVEA 4ETWA 1DAIA 1QO9A 2JFQA 3L7KA 4YFVA 4LF4B 3JZIA 3T7DA 2A4KA 4YAEA 4DG8A 5FTJA 2P30A 1CUJA 4ZV9A 5T4HA 3T1VA 3QE2A 4IH4A 3RU7A 3ICEA 3B7GA 2XCIA 4B4KA 5K3EA 5L6LB 1URPA 2DC1A 3MRSA 4UJ5A 3AP3A 1H2HA 3I0NA 1GU1A 4PSCA 5DN9A 1FVFA 1XB2A 1DBWA 2WFMA 3CLKA 1HV8A 3L0SA 3QWBA 3T5DA 3T5TA 3HK2A 2C5EA 2MDTA 2HGZA 2HLHA 1EX1A 2WF5A 2O8FB 4LOLA 4RVSA 4FMDF 1W6RA 1LJLA 2GBLC 1YR1A 4JL8A 3AVVA 2OQRA 5AW8A 1QS0B 5JS1A 1CF2O 1LV7A 1CK4A 2VK4A 3EZXA 4UM9D 1TAQA 3ZTWA 4RGQA 3ZE8A 2Q49A 1DAKA 4F2PA 2OKGA 1JDJA 2RKWA 2P6UA 2Z09A 1KWGA 4BZWA 1U28A 4MINA 5JC8A 1G7SA 2YHBA 3FB1A 1FDRA 2JFPA 1PZHA 5T6MA 4DUGA 5FUQA 5JQGA 4EG6A 5AMXA 3R8CA 1L4NA 2DH6A 1G8SA 5ALZA 5AHOA 3QJ5A 4PZYA 2X0JA 1Y48E 4AIRA 2YN0A 1R50A 5K20A 1I1QB 1G6OA 1I1HA 4RIHA 1W9HA 5I7EA 4BWFB 3DLPX 2GK6A 2AEFA 2OHOA 1R0SA 3BWYA 3OG9A 3Q5EA 3URKA 4AJ1A 1E1QD 2FWJA 4LYJA 4Q3AA 1HNZB 3TR0A 5K4HA 5J3JA 4NBWA 2HUPA 1M3SA 1T8RA 4M9UA 1F2UA 1ISJA 4I9UA 5KYUB 1J25A 1GNRA 1WKVA 3CTPA 3ORRA 4YROA 3VPCA 1EX9A 2JIMA 1R9MA 1CQWA 3D3WB 1WZCA 3DS8A 5ALIA 3ORHA 1NBWB 1ONSA 2BR3A 3S40A 3ZVMA 3OU6A 1PSZA 1AZSC 4FNAA 1EDEA 2INGX 4YAOA 1M7GA 5JQWA 1XDBA 2XUIA 5DV9A 1AGXA 1JALA 1P0IA 1Z8FA 1U0RA 2BGLA 3WK9A 1O08A 5LQNA 4D0GA 5DLPA 1GZ6A 2BI7A 2L2QA 4ND5A 4UBJA 4BU0A 3ELWA 4A8TA 3FM9A 3OCXA 3DL2A 1JG4A 4FFSA 4YR7A 5I47A 4WFJA 2BSXA 3BWVA 3KR0A 4YV1A 2B4RO 3LCVB 5CLGA 4BTLA 2XYRA 1ISSA 2PCLA 3AFOA 5FPPA 1R4AA 4C7BA 5H02A 5I8PA 1CLEA 1Q50A 2FPSA 1M1XB 4G4IA 1I4WA 3I5XA 4K3UA 1Q21A 3D7MA 1ZXBA 5EHIA 4D0RA 2DR0A 2BEWA 5F23A 2J0EA 3ZWDA 4UFOA 3GQBA 1T91A 2HIHA 3CUUA 4NZMA 1UZNA 1WLSA 2YWCA 2Q6VA 3IPAA 4XJTA 5IVDA 4BN5A 5IC4A 1L5NA 4B75A 1FEZA 3H1FA 4P4TA 3O8BA 4WOBA 1AN9A 4HJXA 5ETJA 2V0CA 1QMGA 2CVPA 3HGMA 4HRVA 4PS0A 4RE5A 4WBXC 2JLZA 5J5CA 1E9FA 1Z5WA 4CG1A 1QFSA 3KS9A 1FUEA 1R0RE 2CCGA 2VC2B 1YB1A 2Z2XA 4FQ8A 3Q40A 5D00A 5AOCA 4YIHA 3GUCA 2IY8A 4X1IA 2AF4C 3T5CA 2BE9A 3EVFA 3H97A 5H70A 6REQA 5HZKA 3R0QA 1UBTS 4YRCA 2Y05A 2PM8A 4OGWA 2ATXA 4HWSA 1NY5A 3TAXA 1QWSA 2QQEA 1CVRA 3U7IA 1KC3A 2FWBA 5K01A 1C1DB 1HETA 1XTTA 1W5EA 2FYTA 3RU2A 1YIOA 4U00A 4LGCA 4O1MA 2UXBB 1OE0A 2B35A 1SC9A 2ES4A 4XWYA 1R7RA 5IHPA 4S3MA 5HIIA 4XAQA 4EI2A 5BV1A 3V8VA 2B30A 1LLQA 1VB3A 1G8FA 4AT1A 1H9BA 1U8ZA 2QZ9A 3TCNA 4DDKA 1RDFA 5JC1A 2PT9A 3NYRA 3T3DA 1ZIXA 4DDTA 3QVUA 2C57A 2XLCA 3RBVA 2FUKA 2JAUA 2ZDGA 4UPVA 1DFIA 1Z83A 3KQTA 4JBYA 2OV3A 4PVCA 3IPXA 4MWSA 4GICA 2O8EA 3S27A 1F0YA 1Z2EA 4JB0A 3ODPA 1Q7CA 3BERA 5FI0B 4DC9A 5E3IA 3UM9A 1LS1A 1AKWA 2IPLA 2W22A 3EHEA 2NGRA 5E1DA 2O8CA 4MV7A 1CUEA 1NRJB 1OVMA 1LH0A 1HZJA 1P4AA 2NG1A 4K05A 1QOQB 2PT7A 5JBNA 1AURA 3VSBA 1GRQA 5A6VA 1Q11A 4HS4A 4EHDA 1XMOB 3E6AA 4MKHA 2TECE 1NPTO 1IRIA 1QGZA 2GS9A 5IM4F 3EXAA 4JC5A 4JR1A 1SJ9A 2FPOA 4Y0VA 2QJFA 1G3IA 2AE2A 1O3YA 1W47A 3E2MA 2ZIWB 3MTDA 4G5FA 5CMLA 4CKBB 5JBQA 5KWIA 3DVAA 4WCFA 1AE1A 1SZPA 3OUTA 1O95A 1M54A 2ZRHA 4CV0A 3K32A 3UV6A 3GLIE 1OLXA 1SGWA 3AH8A 1CUDA 3G8YA 3LUCA 3HCCA 3KVYA 3VI3B 1M33A 3E3AA 4GEKA 4ZVTA 3QU2A 1IBMB 3LO5A 3WQSB 4EJSC 4E32A 1VXOA 3B1VA 3MHPA 4JUAA 4PAQA 1PWXA 1QH0A 1YA8A 3W4IA 1PV1A 4E5VA 5DK4A 1QK5A 4JJGA 3R6GA 3S1AB 1ZXXA 1P2VA 3EVGA 4N47A 3GUVA 4R8RA 1BCRA 2XNJA 4O4IF 2BGWA 5JNUA 4QVIA 1RQXA 1DEHA 5K2OA 4O4IA 5DKFA 2A84A 2RD2A 2JHFA 4MGZR 3NC0C 4ZIRA 2XV1A 2ZJAA 1UOEA 3L0PA 2REXB 3ZIAD 1J20A 4DG5A 1UMDA 3BRQA 1NHGA 2G5TA 4RD2A 3AX6A 4QBFA 2FEMA 3LLUA 4ZO7A 1Y5MA 1SUBA 2CXNA 4BQQA 4YCCA 4Z0TA 3JQ7B 3OJ0A 2RJNA 4J03A 3RDPA 2JATA 3T99A 3UTCA 1RQNA 3HUFA 3KR1A 2W4MA 2IBTA 2BP7B 2AZTA 2OFPA 4I4TA 4F3KA 3ZWOA 1MZPA 3VDXA 3E82A 2X1VA 2C5BA 4LJSA 1GNTA 4A0FA 2KM1A 1WXIA 2FPMA 5AICA 1RW4A 1SVMA 5J1TB 1DTWB 4UNIA 5NULA 3WISA 1AKQA 2GWRA 1YRYE 2QN8A 3PXGA 5F76A 2BAGA 3TLJA 3ZHTA 2MYPA 4YCNA 4PG7A 2V7GA 3UK0A 2Q3CA 4M1KA 4Z0HO 1LNZA 3T3EA 4LPSA 1F8YA 5JFOA 1S01A 3F5FA 4MCHA 2AJ8A 4EBBA 2WYHA 5B57C 1VECA 1QGYA 3OAAD 4FGLA 3C7AA 3O7WA 1T0UA 2O2JA 1Y1LA 1K3TA 3BFPA 1P5ZB 3BSSA 4KREA 3MT8A 5FR2A 5GOTA 1Z39A 4RVFA 5A3JA 1VG8A 1WP9A 4RIEA 1W36B 1F17A 2FN4A 4S35A 2HQRA 3PFKA 3MAAC 4TL6A 4E08A 3K9FC 3FXAA 2O48X 1QHNA 3DV2A 4R2XA 3TZ6A 3G9TA 2C9BA 2RONA 3HB4X 3A0UA 4W5QA 1YR3A 5EQJB 1TAUA 1J23A 4AQDA 4HRYA 1EWRA 1J4AA 1AGRA 2H6EA 4HQOA 4MRMB 5A4MS 1LC3A 1S0UA 4QRDA 3W7VA 1Q17A 4XVCA 4JLKA 3WLQA 3WXMA 3KUCA 1H2BA 2GJ4A 5EQDA 4Z0PA 4M0UA 1TYBE 3UNXA 3F5MA 4RS4A 4BLSA 1ZK3A 1CFZA 3B78A 1WL8A 3EEYA 3HRHA 3WWYA 1SM4A 1JIXA 2IZ7A 4RX1A 5DGDA 3ZZTA 1SA0A 4FR5A 1MFPA 5GOZA 3IMCA 3K70B 4ZFNA 2H5EA 1S2DA 2Z0MA 3QELB 5E4FA 4E1AA 1G21A 3AKCA 1B0UA 4OY3A 3TSAA 1NUSA 3UUWA 3VR5H 1Z68A 3G13A 1T3SA 3OM8A 1XRRA 1J5XA 1Q77A 1GNLA 3EDOA 4U2KA 4BIIA 2F8SA 1II9A 2ZSAA 3WLIA 1EKXA 1NDHA 4J1SA 5F4BA 5IEJA 2ISCA 2AFVA 5KVAA 5F9FA 3HDHA 3LQFA 1XLVA 2JCGA 3QU5A 3TIGA 2WD9A 4KXNA 1IZ7A 2RH4A 1SG9A 2JRLA 4JJKA 1IAVA 1L5WA 1L1QA 5D3KA 3CR3C 1YDMA 4WNIA 3ROPA 1IHOA 4H4EA 4RZXA 1XPJA 2PEZA 1RHMA 1DBQA 2OMKA 3UMFA 1J00A 2PGIA 1PFVA 4JZYA 3VR6A 4BO1A 5C18A 2Z5FA 3P0RA 4X90A 4NXMB 3LYLA 4HNUA 5A3RA 4D9BA 1XAIA 1NLMA 2MSWA 1U9IC 3N87A 1DBVO 2OXFA 3DYVA 1EB9A 2D1QA 1W1UA 2NUTB 3LECA 3N0XA 4XWTA 4G5SA 3WAKA 3I1JA 4Q9DA 1ZNWA 3A14A 3F71A 4X20A 3JYNA 4WFKA 1BWRA 1QIKA 3ACCA 4MCJA 1OREA 4C0QC 1K8XB 4PZDA 4PYRA 4FKBA 4YMGA 1XZFA 4BNFA 4RIGA 3ZBQA 2XWPA 1RRKA 3TDKA 3BAFA 2Q1YA 1Z34A 1ZI8A 3FPCA 1N92A 1FTYA 5ALFA 3D1VA 4ARZB 4CL8A 3DO8A 3W5JA 6CHYA 2OAEA 3QXHA 1M2JA 1D6JA 1ENPA 3T06B 1LW6E 1XMXA 4EPWA 4HADA 5TPWA 1J07A 4RZSA 1JI3A 1SH7A 3TLGB 4GYWA 2BISA 5B64A 1XUOA 3PE3A 3EVNA 4WKCA 3SEZA 3VZCA 1EP3B 1YJAA 5HS6A 5FOQA 3I9V6 3TOCA 3MJEA 3IUSA 2Q21A 1D2GA 5LC1A 2ZRPA 3VTAA 3AXSA 5HRCA 1GN8A 1Z0KA 2WOOA 3O8OB 4BO9A 2XTMA 2OSBA 4BP8A 1JHYA 4V2UA 2P5TB 3ESAA 3G0CA 4HFMA 1AZLA 2E6UX 2IUTA 1UBLS 3FETA 2P62A 4ESEA 3F6EX 1EK2A 2ZSKA 3NXKA 1IWPB 3P8ZA 2QX8A 1JHPA 4LGYA 3VR4H 4KAAA 5SICE 4G07A 3KOYA 5JE8A 3G9UA 4R9RA 2OFFA 8GPBA 4FPXA 1CJVC 4PC2A 3UJ3X 3RSGA 1WMBA 4BHTA 3IDFA 3WBJA 4PLYA 3EA0A 3U37A 3LG2A 3DMTC 1YWGO 4CTNA 1NXPA 1OBCA 4DLTA 2PK3A 1Q1ZA 1GGHA 1FBNA 4MH0R 3KXDA 1PAUA 2WF9A 3NC4A 2YZKA 1I7DA 1GGNA 4XSGA 2GXUA 4H7HA 5BSGA 5BWBA 4HYYA 2QYHA 1IHPA 1ZD1A 1F0KA 1PJRA 4LHYA 3I9V1 2R3SA 4A26A 1N5JA 3DBHA 3LBNA 2C2HA 3ZCTA 1JWAB 3RS4A 1C4XA 2V54A 3DLHA 1Q0SA 2H18A 1DC3A 1FQJA 2IP1A 1OWLA 3IR5A 2ZBQA 3PRHA 2WFZA 4G1VA 1IJEA 1U98A 5F9HA 4U7PB 5KO2A 1MC1A 4GH5A 5CGZA 1SU8A 2PGXA 3C4JA 4L78A 3FFBA 4IQGA 3A1UA 5E2IA 3R7AA 1M67A 1EK0A 1VMDA 2AKAB 4AJ9A 5A4AA 3MTJA 4GQAA 1P3JA 4Q1FA 5DNWA 2C97A 1XOIA 2NSLA 4WNCA 5JNSA 4FB4A 1WJGA 1V8ZA 1EAYA 2J3DA 2WIBA 3MPUA 3OUUA 5ESWA 2CFCA 3HFSA 4EO7A 1E59A 3SC2B 5F3DA 1OKKD 1P2SA 2L0XA 4HLUC 1GEEA 2PWYA 4ZVNA 1PNRA 3BJMA 2C77A 5EXDA 4YY3B 2R85A 2VT7A 3QOYA 1UPUA 1VG1A 1Z07A 1TT5B 3AESB 2RBEA 2I7TA 4X5OA 4PF1A 3BSFA 5KOJB 3NDRA 3VPAA 4Y6LA 2DLCX 4RK7A 4GI7A 2PZBA 4C4AA 4TLAA 1LD3A 4Z2YA 1I3NA 4BMVA 1UFVA 2HADA 1N2XA 4RWZA 4TMTA 4IWNA 4BQSA 2XRZA 2CKDA 1RYBA 4ZCQA 4Q1BA 2NACA 1MKYA 1OMOA 2VN8A 3LX5A 1LKZA 4RY2A 2C9ZA 4RZIA 2M6KA 5MN6A 3OETA 3MMPA 2PPVA 3RAJA 3USES 3FKQA 5AESA 2I55A 4DM3A 5IFKA 4EKGA 3KEQA 1W9MA 2D7JA 3DFKA 4WBNB 1J8VA 2V65A 4HDRA 5AW2A 5LQRA 4LDZA 3FSRA 1IBKB 1K5DA 3OURA 1JVBA 1L5LA 5I4IA 4JLUA 5IULC 1JFFA 1X1AA 4B4WA 1YQ9A 1V8FA 2XKJE 2FEWB 3VR5D 2CVHA 2ZT7A 1QIGA 1XXHB 2MMGA 2ENWA 3PI6A 3VAAA 4RK4A 3ZDXB 4KR2A 2QD3A 3Q3CA 2LCIA 3GD5A 3IQDB 2AJDA 3R6TA 4LOJA 1F7UA 3Q9UA 4JK3A 3GJ4A 4BVEA 3X2EA 1CR2A 1RWBA 1LDYA 3QKUA 3H11A 1PUXA 5D51S 4KR3A 3MGAA 5TB5A 2XX3A 2G0NA 3A3YA 2VHQA 1N8SA 1SOUA 4JBLA 2JCBA 3HCNA 4H27A 4TTQA 1HT0A 4G41A 4R7GA 2C03A 1EMDA 5B37A 3JQ6A 3TTSA 3CVXA 3HKEA 3M33A 5CHYA 1A2QA 1XPUA 5EFZA 3A1VA 3LM8A 1QQ7A 4OLJA 1JXOA 4RHUA 4XYBA 2C3MA 2WAXA 3H8WA 5DT9A 1FYEA 5EEGA 1T5HX 4LRTB 3QKSA 4M8IA 3BK7A 2DFVA 1H2FA 1FL9A 1X15A 1D7AA 1QYCA 3O3MB 4JEIA 1SOWA 5IBQA 4EP1A 5K9ZA 4UHCA 1M8KA 3UB4A 2WU0A 1JEDA 1K2WA 1M2OA 2WYIA 2IOQA 4MW5A 4B81A 4BGEA 2PRJA 4RVCA 4UUOA 4ALKA 4GM1A 5IKMA 4LJ7A 5UKDA 3EPLA 1N6NA 2X8AA 4EATA 1PL8A 2BKAA 4WGGA 4LDAA 4M6WA 1UC8A 3GJ8A 4XUEA 5EAIA 3EC1A 1E1LA 2WILA 4F12A 3MERA 4HNTA 4WQMA 1U1CA 4HQ6A 3N0VA 2WA2A 3UMBA 4QC2A 5IABA 1XP5A 4DRXA 1A5AB 1Q1AA 4KFRA 5E6UB 1P17A 1IOLA 2FW9A 3UWPA 3V1TC 4J3NA 3CN7A 1DOHA 1JMKC 1SUCA 1FRFS 1YB6A 2NV2B 1ORRA 5MGBA 2IDKA 1ADJA 1E8NA 3E8SA 4A73A 4JJ7A 3KQKA 3EG9B 3L02A 2X2EA 3IAXA 3ANNA 3FAZA 2Q46A 3PA6A 4F4HA 4J29A 4MV9A 5C4MA 3I3OA 4IXWA 4DSOA 3H2KA 1OBVA 2VK1A 3DGFC 2I71A 2OLJA 2Z8XA 3CSDA 2AJLI 3OCCA 5H82A 3CVUA 4TQUS 2I9KA 3A1CA 4YYZA 5ALMA 3D43A 3R41A 2VS1A 3DKVA 3PUVA 4Q1EA 1PL6A 3QX3A 3FCUB 4J4HA 4OUDB 5DEIA 1U0NA 4CCYA 1RJGA 3KR2A 3QXCA 4G8CA 4UQOA 5AD1A 1BDBA 3VR4D 5KTTA 4FR0A 3R3SA 2GT1A 4PYNA 5E9JA 4RO0A 4IRXA 1SU7A 3UWMA 3LUDA 1VE1A 4G5HA 3EXFB 3IXQA 4EJSB 3CVJA 3UW3A 1CF4A 1PQPA 4Z2AA 4HMPA 2H17A 4OKIA 4MR7A 4HUTA 1BE0A 1EFTA 1VLHA 4RLFA 1PHRA 1UPXA 2RBGA 2WG2A 2J9FB 1CNMA 3C7DB 3K0FB 3QKTA 1U0BB 4TQAA 2TMDA 1RC0A 2E48A 4WLNA 3VQTA 1C4WA 5LSAA 4OMDA 4YMVA 3UHAA 4UAJA 1Q0LA 5J47A 3B6MA 1KK0A 5FNZA 2IY9A 3GJ6A 1JQJC 3AHDA 2HWWA 3CCFA 3T95A 1AD2A 3WWZA 2PU7A 4BZPA 3O3OB 1HLFA 1T5OA 2H06A 3Q11A 1GTZA 3MXOA 1J09A 3L6DA 4X44A 5LM3A 3OBIA 3COSA 4EG4A 3ANTA 3MWGA 3W6OA 2QAIA 2HF7A 2P7IA 4JITA 1Z29A 1REQA 3C7TA 4Y9TA 3J81k 2W6ID 2FJUA 3T1OA 4Z3OA 3EQ2A 2AN1A 2F6RA 1TNDA 2OORC 1MB4A 1F8UA 2CZQA 4UTRA 3CT4A 2WJIA 4F6LA 3IPYA 5J2UA 1A0OA 2OMEA 4KXYA 3T3NA 3Q8WA 1ZKMA 5IJWA 2IWRA 4CKCA 1IDN1 3A7DA 1Y8ZA 2CV2A 3H4TA 3OZCA 4N0QA 4K7JA 5AJWA 5I7UA 3OY2A 4FE3A 3DC2A 4J07A 4OCZA 3D81A 2NTYC 2YMMA 1GPKA 3QPVA 4K9KA 1T4CA 3WZMA 5KDOA 3ADOA 2ZI6A 1T2CA 5JJKA 2N1MA 3AEXA 3VH4A 5SY9A 1E7RA 4L0MA 4BAZA 5KOHB 1MNAA 1E8DA 5F3RA 5JH7A 2IUSA 1ULSA 4BWYA 4G0ZA 4XRGA 2Y68A 1NXXA 2SBTA 3WIBA 3LVFO 3D5QA 4BMXA 4XPZA 3MZ0A 1D7OA 3AIMA 3AY6A 3AIKA 4L22A 4EY6A 3OE5A 4EB8A 2AMFA 4PIVA 3CPHA 4OFBA 2EP8A 5LNK6 3HPQA 5KNBA 5M2QA 2C9OA 3MWEA 2JB9A 2IGTA 3QFFA 5JUWA 2QXTA 4PCVA 3CXRA 1Y3BE 3QX9A 2R1TB 4J0CA 2IXDA 3MTGA 2AFHE 4M37A 2PEYA 4MVWA 5BV8A 4QTTB 3HU5A 4PZCA 2R6ZA 1OFUX 1U9JA 4I6GA 3AVQA 3RSSA 1GXSB 1NXQA 1CJUC 1GT6A 4J7AA 4LN1A 5KKNB 3KHUA 4F9EA 3M1LA 1Y5RA 2D8MA 4K9QA 4XARA 3TBFA 3C3YA 4K9LA 4YRQA 3WGHA 4ITVA 2YH2A 4WXMA 1CY0A 2QPOA 2GLTA 2F3UA 2QG9A 2Q62A 1RQGA 2P6OA 3KO8A 5C4GB 2F62A 2OCPA 4TTJA 5DTMA 4YXWD 1JKJB 2J1LA 2WKSA 5ITSA 1TYZA 3ESXA 4FMPA 5BYKA 3HV2A 3KDSE 1WBDA 2WFAA 2XDQB 3O6VA 1PZMA 1VCHA 4G1EB 5ECWA 3IDSA 3W5UA 3E5RA 2OTCA 3A2KA 5ENDA 3LOPA 1ECFA 3C1AA 3L4BC 5EIFA 5LNK1 1QLHA 2OCDA 3D2AA 1C29B 3S2YA 2RIPA 4X24A 4UULA 2AJBA 3UOAB 3I53A 2R1VB 4LJ5A 4HNSA 5DYYA 4H3KB 5I7AA 4TUYB 2M32A 4HGNA 5CLLA 3WL3A 3UCFA 3UUGA 4L5CA 3ND8A 2PWZA 4OQ4A 1U3WA 2GZ2A 4KPUA 4TV8B 4PQRA 5I3CA 3D3WA 4HPWA 1KO4A 2FZKA 2G1AA 4LK3A 4OBXA 3VNVA 2QTFA 1ZQ9A 2BKVA 2VAWA 3MJVA 4JLAA 1W4ZA 2FPLA 2P6RA 3GGJA 1ODCA 4MEJA 4OHPA 1P0QA 1MP0A 3FN4A 1KDYA 1XVLA 4EWLA 1JFLA 3MOIA 1EE1A 4DEXA 5A0TA 3RI3A 2EJVA 1AHPA 4WOCA 3WICA 4WXHA 1TFRA 5DDIP 4JQYA 3IA7A 1ZIPA 3L04A 4K6GA 1E0AA 4EF5A 5L3QB 2XMPA 5CB4A 3QXJA 4JLBA 3VYTB 4NJMB 4E46A 3KBOA 3RS0A 3H18A 3IR7A 5G41A 1UC9A 4CEIA 1E1YA 1DJQA 1BMTA 1YXMA 1WHTB 3FWNA 3W6UA 3VBEA 3TZQA 3A0RB 5F7JA 2PKYX 2VWGA 1FS4A 2LXNA 2RH8A 4R2WA 3UF0A 4D98A 2BUCA 4G0NA 4BY9E 3MJ4A 4FDUA 1AZTA 1J1IA 1E7WA 1U8FO 1J7JA 4J3JA 3S3TA 2HR1A 4Y2RA 3U5TA 5H4GA 3JU3A 4PSVA 3DTVD 1O58A 2DFPA 2VYFA 4OQZA 1T36B 5CA1B 1PZFA 4U6NA 4K3VA 4CQLA 3ZQ4A 6GPBA 4MOWA 4W1SA 1RWQA 1K8QA 2YWHA 3BGWA 3KB2A 4GZ6A 1O0CA 2K7FA 1CUGA 1IIBA 4FE4A 3ICWA 4FFWA 1Z0IA 3KD3A 1DOAA 4CQMB 4DLAA 3T7RA 4MUXA 5DIFA 4EL0A 2V45A 1T0IA 3DEKA 4BMOB 4BBPA 1E6CA 1D4ZA 2K7ZA 1ZH2A 4GKVA 2AG8A 3SBDA 2OT3B 3SC6A 5AVWA 2X86A 1GGFA 1ZBQA 2R25B 3HB5X 3IEUA 4RIFA 1U04A 2ONZA 5EWLA 1NQ5A 2C96A 2JCVA 2CLSA 4P3OA 4JLVA 5F5LA 2C04A 3RVMA 2ZYUX 3AF0A 4RPJA 5DCYA 3R7FA 3C5CA 3GFTA 4EHLA 1YNOA 1NUPA 4NCXA 4O2BB 4ZRNA 2XTNA 4A0GA 1G9SA 4HGQA 2A58A 3D2LA 4EG3A 3O4GA 1ORIA 1W34A 3V46A 4Q3CA 1X7XA 2J08A 2X77A 4LE1A 4GECA 3EGXB 1JU9A 1B15A 1DBPA 4NBTA 3IVMA 3FNHA 2XB9A 1WQ3A 2WUEA 2ZAMA 3PCRB 4PBRA 2HNAA 4EB6A 3FYUB 4CM4B 4JA2A 3HDVA 1KA9H 3M6IA 5C35A 5CM8B 3TRIA 4QHTA 4AMYA 3DGEC 1ZUNA 2KW5A 5CG2A 4MA5A 2JLQA 4KLZA 3GZTB 1FDTA 1O87A 2QNRA 2UZAA 1K6XA 3PC2A 2ACEA 4R4JA 3QQPA 1GPH1 1U1GA 4LXXA 2I6SA 1SCJA 4QBKA 5B12A 2VATA 2VAVA 1E77A 2NN3C 3H7IA 4TMZA 3B8EA 3UHFA 1YJXA 4C4SA 3GH3A 3TGPA 4H16A 2LIVA 5EPEA 1R8QA 2I8CA 4YP7A 2H1RA 4NWIA 5FBVB 2B94A 4WZAB 4AF8A 2W8BA 4Z53A 1GPYA 3BK2A 4AZWA 4OFWA 3VM6A 3PTAA 5G3YA 1R15A 2I2DA 2Q5FA 2WPDA 3SJCA 1OXXK 3NTVA 3WYGA 2VWQA 3EULA 1XLTA 4ZDIA 1QC5B 2NO6A 7GPBA 4URXR 3KZ1E 3BFKA 3FNGA 1NSTA 2PNJA 1PVOA 4DBLC 3QBVA 3I6MA 2HA0A 2BH9A 4FN5A 4AY5A 2KPOA 2V3VA 4F4CA 4DBLE 1UIMA 2PSJA 3F2VA 4IIYA 2HEIA 1VI6A 3HA2A 2ZCUA 2JI7A 2NXCA 4JODA 1NUAA 3EXEA 1N2GA 5GVRA 3CZCA 1UIRA 2FKAA 2WWWA 4TSFA 3BMNB 5B5SA 3SS7X 3T54A 2BZGA 2A9KA 3GVIA 1RAGA 3BE6A 2B5OA 4EHFA 4HN4B 4JUFA 3MCVA 4UAUA 5FWXA 1F4LA 1ZOSA 2DJIA 3L6EA 3PUZA 1TJ5A 3ANSA 2I3DA 4OXXA 2IA5A 1M74A 4P6VF 1D07A 3TOZA 4N5IX 5EJ5A 1MHTA 1QGUA 1Q7EA 1ZAKA 3VNQA 3IP9A 1SUDA 2Y0CA 4J0JA 4L5BA 2WSSD 3BTOA 2EKZA 3L8ZA 1LLCA 5TPZA 3ZE0B 2O8DA 3EQ8A 1Y1PA 4M1WA 3I2FA 2ZWIA 1ZJZA 3A04A 3H04A 3H99A 2GEDA 3OC6A 4IIDA 3LWDA 3IHTA 4UNSA 1UBMS 1I01A 5SYNA 3AVTA 4PNHA 4O8ZA 1EUYA 2V7WA 4DV5B 4P3YA 4UTOA 5IG2A 3L4EA 2OILA 3W77A 2IYTA 3T3GA 3QENA 1JIJA 3O8LA 2H2HA 3SDSA 2HHAA 2WJPA 2A9RA 1EDZA 3E8XA 3I6YA 1NBME 3CSSA 2F9MA 3JQFA 1ZW6A 5CIWA 1PDOA 1MG5A 1N9GB 4ONEA 3V80A 2WM9B 3TQRA 4ZVMA 3HJUA 4ZANA 4UVEA 3R44A 3HN7A 1TZJA 2VT3A 2PLNA 3PX7A 4E5DA 4X8MA 2GAJA 1AQUA 3N8NA 1I7LA 4HMOA 4DYHA 5CA1F 5LMZA 3FDIA 1RWWA 3LQ4A 1WUYA 4Q4JB 4Y6SA 4NYIR 3EGOA 4HX5A 1E2UA 3BIJA 3L79A 5DNUA 4GX2A 7MDHA 2IYUA 1EAMA 1M34E 3LHIA 3WLOA 3OP1A 2CDNA 2JLYA 1Z6YA 3Q6MA 4XPIB 2EOAA 4G6ZA 4K5QA 1V5FA 2OC9A 3FHOA 4MQUA 1KYTA 3E9RA 5EXTA 5IMBA 1ZMRA 2BGMA 1EJ0A 3BN3A 5T57A 1FNCA 4FMCB 3D8SA 3HEMA 2IP4A 3A27A 2XVMA 4GI5A 4YRPA 5PNTA 3COJA 3RIXA 1R3DA 1QO0D 2FG5A 2D6FA 1M1YB 1T3LA 3AIOA 2RGAA 3VU1A 3K2QA 3QELA 5ALXA 5AH0A 4DJFC 1PK7A 3LXXA 4OYHA 4L0QA 5DM2A 1ST3A 4HWOA 3GEBA 3FOWA 1F0PA 1LSJA 1JDVA 4LVUA 4O2BF 2J6HA 5DN6D 3HKBB 4XR4A 2O7NA 3VA7A 1ZHOA 2BFPA 3UK1A 2DFTA 3PS9A 4DYVA 2B4AA 3KAJA 3MJTA 2XD9A 1MGOA 4DCMA 3R74A 3O4RA 1Y6FA 2JAOA 4OQQA 3F4LA 1YJBA 3D6TB 2CHEA 1U81A 4YIKA 1IY2A 4QT0A 4YJ2A 3UYLA 3T9EA 1HORA 3CPSA 2DE0X 3IB3A 3NTQA 4BKMA 4AY4A 2HRDA 4N54A 1XMPA 4HH4A 1BOFA 3C97A 2BM8A 4FYMA 1BWSA 1V41E 4ZT7A 5AKJA 3SEQA 5TEVA 2WNIA 3DXZA 2CF6A 5BXYA 4NECA 2XQVA 5C7LO 2XH8A 1JZSA 1VYHA 3VOAA 1SUIA 4AKEA 5A1JA 5IS2A 1GUYA 1O97C 1SXGA 3GIDA 3T4XA 3TFQA 1V16A 3TIFA 4C06A 3OTOB 1KETA 3FTNA 4QG7A 3OEHA 3GMIA 1W59A 2DT5A 2YS6A 1JR3E 4CMEA 3ETEA 2P3OA 2VA8A 4HDAA 4BN4A 2CWDA 3H2ZA 1LNSA 4BVBA 1I7SB 2JAWA 4WJZA 3HEBA 3ZH9B 3ECSA 1WXGA 2NZYA 3R6LA 2VNIA 3DFUA 2A78A 1X80A 3MM4A 1FPQA 2ARKA 3R4VA 4EL5A 4TYNA 1BYUA 1HL3A 3L49A 1ZITA 1QBGA 3B6IA 2QE7D 3EQ6A 1IZ9A 3AB3A 1VLJA 2OR3A 2QUAA 3T9DA 3WGGA 4HOYA 1YZHA 3ZVLA 2HA2A 3EDYA 4M0CA 1C41A 3HKDA 3MFYA 3DMNA 4IDFA 4QELA 4JKIA 1NAIA 4PCAA 1P7CA 2Z2IA 1PT8A 1XD2A 3QWAA 1PR1A 1PWYE 2IL1A 4KKXB 4FHGA 2HU8A 4TMWA 3TGWA 4Z6KA 1Z6XA 2Z95A 1BXGB 4RVUA 3KXLA 5EMMA 4AYWA 1B74A 4ZVUA 1G16A 2IDMA 3BWEA 3ANMA 2B7BA 3CLSC 4IFTA 1QFXA 1PLKA 3DEFA 4D5EA 5AVSA 1XTSA 3QV2A 4O2AA 1WIWA 2VP9A 2Y1DA 4C7JA 4TS4A 2J0SA 5CDTA 2C4WA 2GBCA 3CUTA 4D3XA 5CB8A 4DCSA 3NNDA 3KSZO 2JLBA 3H2JA 3QY0A 3PGVA 2WHXA 4JLMA 4HYTA 2HA3A 3IVAA 4RW0A 1PT5A 3WWDA 5CFNA 4LQLA 5MFZA 4N7MA 4ZJPA 2RGRA 1UKYA 1V9SA 2AQ8A 2PY6A 3GRCA 3K2EA 3LH5A 3BDAA 3QU9A 4MI6A 4WVFA 3TZHA 4U7HA 3ACBA 4NS4A 4AK9A 3L06A 2IXFA 4A27A 2JI8A 4BO8A 2JIQA 4EJ2A 4E1VA 4B3HA 1T6NA 3CJTA 1WNFA 4B6EA 1RPTA 3BRCA 2F3PA 1KO5A 5CTAA 2Y0EA 4U9UA 4O63O 4DY6A 2RGBA 4GSKA 4I5IA 1RNLA 3DSRA 3K6SB 1T2VA 1TX4B 3AVPA 1XKQA 3IL2A 2OESA 4DIOA 4ZHSA 5GY7A 2RHTA 1VG9B 4GMKA 1ZI9A 3N8DA 2VUSA 5DYTA 3IUQA 2ZSUA 1GV1A 3RVJA 3U3RA 4L9SA 5K3AA 2OAQ1 3UT0A 5I7FA 4A1FA 3VBCA 1ZBDA 3H6HA 2A1IA 4JBIA 1MB0A 1UZLA 2XYQA 1E5XA 1ZINA 1H42A 4FMCF 1TT5A 3HWWA 3U26A 3B6KA 1SC1A 3RABA 3EIOA 1WUKS 3QJYA 5AR1A 1E2EA 3FJYA 3TSYA 4WGFA 4QYWA 3IAEA 3WNDA 2CUTA 4B6JA 4D57A 1A9PA 4EYQA 2GWHA 2VNHA 3TQFA 1V11B 5EL0A 4OBWA 4EHAA 2FDRA 3O26A 1P60A 2EKQA 2AOTB 2ZPTX 3O0TA 4D4GA 1D3AA 2VYNA 3KPWA 1OLOA 3DBRB 3WLSA 3NCHA 3GP8A 3PUKA 1UZMA 3IP8A 2XCSB 4V1CA 3PBKA 2WY2D 1IH8A 2HU7A 4HB3A 2CXSA 2CB9A 3C6ZA 4O33A 5BN3B 5IFLA 5LZ9A 3OIVA 5AOBA 1RWPA 1C7QA 1OXVA 4LIPD 1EJ6A 1RBMA 3RR2A 4WBNA 2G25A 2ZDHA 2RHJA 4MCAA 2G04A 2VCEA 1UMCB 3GVPA 1BSVA 4AJEA 5I51A 3QVJA 2IXAA 1TO6A 3T3MB 1Z4MA 1XTKA 2XD4A 3O93A 5CYOA 4X7RA 3KZXA 4Z4FA 1XXHA 1JECA 4L28A 4RBNA 1U0GA 5KVSA 4JBGA 1ID1A 4QVKA 3IUPA 3ICCA 2IZ5A 2R96A 4QEDA 4YRSA 2QTLA 4KBYA 4NICA 1GDDA 1YJCA 4PX3A 2HWYA 2QD2A 3D8UA 1WO8A 1PX2A 3KSRA 1X1RA 2H51A 4QEZA 2DHEA 1M73E 4WI1A 1MC5A 1PFKA 3R3HA 3VHXA 3IV9A 4OBEA 1D4FA 1Z12A 3UO8B 1B14A 2Q0HA 2J33A 4QPPA 4IKPA 3T1NA 2OHIA 3EUWA 3H0CA 3FTFA 1WRBA 2XEXA 4MPRA 5M7EA 2ZRJA 5AVOA 4HN2A 4Q3DA 1I10A 2ODEA 1HTBA 1BQ3A 1FW8A 1N2OA 3E9NA 2E5WA 4YCAA 4CMIB 2O8NA 2YC4C 1NTRA 2FFBA 1G3UA 2WF7A 2VO1A 2G36A 4OI1A 3U7QB 2Z6AA 2JLXA 3SXJA 1G2IA 1XMVA 5DMXA 3RIHA 1FP4B 1MOPA 4HRXA 1K06A 4IQ4A 4LXIA 4MS4A 4WTOA 3UJAA 1FSFA 3IVCA 1L9KA 2FDXA 3PWZA 1NRWA 1I4TD 2FSPA 5E4YA 1EHCA 1CJBA 2WNHA 4JMLA 5G3ZA 3TWOA 3E2PA 4MWGA 4QBGB 3WMGA 1TTQB 1QV6A 5EWMB 2XMDA 4OJTA 4UM8B 3S2GA 5BWNA 3F9RA 3I04A 1UJ6A 1UJMA 4IDOA 3T8YA 4WW0A 4U0KA 1IY1A 3C3JA 1WMSA 2FVXA 3BEOA 3C5WP 3DNFA 3MRXA 3EPKA 4ETIA 1J21A 4TQ9A 3EB9A 2B82A 3FOEC 4BFSA 3EG9A 3JQBA 1MMFB 1UL1X 2VEDA 2O19A 2FWRA 4R9SA 5B3JA 4EPYA 5JJLA 2ZQ5A 1QHSA 2XQIA 4RLHA 5AKIA 2MMCA 3EWNA 2WK1A 4F1WA 5JSZA 4PYIA 1VHTA 1SBHA 1UJBA 1VCMA 4CKWB 2UYGA 3GJYA 3H5VA 2DPYA 5C81A 1DTSA 3NM5A 3BGIA 2CB0A 3M89A 4DUGD 3EDCA 2RJ3A 1QOZA 1RBQA 3KKZA 1ODJA 2WM8A 3MFQA 4DCPA 2IYSA 2EGHA 2GVDC 5IJ0B 4HEHA 1KZ9A 3QOWA 1HQCA 1JYFA 1KTVA 5FFFA 2XGGA 2FP4B 1JTVA 1C4OA 1ID8A 3EXFA 3KFLA 2ZANA 3OTIA 4RFSB 5FV7A 2JIZA 4ZEWA 4C1NA 3P9RA 5CLJA 3WK4A 4MVJM 1BEEA 2FPGB 3WQHA 4JI2B 5ALGA 1GCIA 4D96A 4GR4A 5J63A 4WDQA 5DHPA 1OZHA 3K0FA 5AP9A 1NWHA 5KZMB 1P2DA 4X92A 1RLOA 4JFAA 2A1UB 3MJRA 3HI6A 3VDNB 3GZJA 2Z9BA 2DTEA 3T38A 1U7TA 1MAAA 2HXYA 2W2KB 1PRYA 4MUIA 4HNAB 4PINA 2UAGA 4CR7A 4M60A 2OQ2A 1VPLA 3E22B 4PZZA 3SAJA 4NH0A 4D9GA 3EDRA 3M5CA 3AEZA 3DM9B 5KYXB 2NTJA 4LYGA 5CM2Z 2IUEA 5DF1A 3G2QA 1H6AA 3SHVA 2YYAA 3HNRA 5CYFA 3H2SA 3I72A 3NDJA 3RVKA 5C8ZA 3DKKA 1I2DA 5L40A 1RQRA 3TCKA 3DMRA 3G0GA 2R87A 2XY4A 1YV9A 1EZZA 3MRVA 4M0LA 2C20A 4E5MA 3L6BA 1CNFA 2BL4A 2QMYA 3JD4A 4UBNA 3PENA 5E3HA 4BX8A 4DTIA 1QU3A 1EFHA 2CNOA 1Q7TA 2AMLA 1G4AE 2EXXA 4OHFA 1E2LA 4TL8A 4HXGA 4OA5A 1EWTA 4XD7A 5HKLA 3GOQA 1JQBA 2IJGX 1MX9A 5IT0A 1BYIA 4H7JA 5HMMA 1XC7A 1KFKB 5LLSA 4DR7B 4DOMA 3DZFA 1X7HA 2QRJA 5K05A 3TKYA 1DAOA 5C7IO 3S4YA 4F46A 2WHQA 1W4CA 1AHNA 2OHFA 5FHRA 5TGDA 2PRIA 3A32A 1YC2A 4IJ6A 1IUPA 3D3JA 4I9HA 2ERXA 5TX7A 5J4VA 3X1DA 1YIDA 3NT5A 5IHXA 4MS3B 3GYBA 1EPUA 3RTGA 3VVMA 1OUMA 1Z6AA 3IQIX 4WKBA 1XWWA 3U3JA 4OK3A 2TMGA 4Q4HA 4G23A 2NADA 3CNHA 2V9CA 1FXUA 2C5SA 2CJFA 3CPJB 1BA2A 3UOWA 1KAGA 3SSMA 2C2XA 3K9LA 3TBKA 1M34B 2R8BA 3HCFA 2GAOA 1EE9A 1Z4OA 3EFHA 3VR6H 1VE3A 2PSDA 3B1ZA 1ZJ6A 2RHRA 5AHXA 5KTRA 1MH9A 4LHXA 2HMAA 5KTSA 3AHFA 3DPIA 3I34X 4HDKA 4N49A 4RY0A 4BBZA 2HW8A 1CDZA 3KJEA 2O8BB 1BH2A 1PHPA 2PX6A 3EMVA 1EHYA 2R6JA 3AR2A 5CFQA 3NWJA 3KB8A 1GZUA 4RD0A 4R71A 1ORDA 1KI6B 2R65A 3P9XA 4TRJA 4TYYA 4JDUA 2PZAA 5M3BA 3Q0IA 3JYOA 2MYNA 3E3MA 4JUIA 4U5QA 2R751 4CVNA 4EZEA 2Q8PA 3W4KA 1GITA 2VL7A 4C4RA 1CUIA 1EFLA 1UOQA 2NW6A 1XAJA 3AEUB 1P45A 3E03A 4CL3A 1KEKA 2WQ6A 3A37A 3EPRA 4KI7A 1MCZA 1NBEA 1TAHA 4FCTA 2QD5A 1OD6A 1OIVA 2WOJA 3AHIA 3F9CA 3M6AA 2P41A 4RQBA 1KYZA 4W7SA 1QVVA 3EZ2A 4YI3A 5DNVA 5KNDA 4NESA 3N6RA 1COZA 5JJCA 3NMUF 2HTFA 4MQBA 4HAYA 4II3A 4PPGA 3UHJA 2P5YA 1EXWA 1N2CB 5LOVA 1LA2A 3X43A 1NBIA 4F2DA 1EK1A 3K5IA 5DX0A 4LYDA 4OGLA 1O95D 1U2DA 1O0SA 3T9FA 4AICA 1NJ5A 1Z5NA 1M2GA 3R77A 4CRWB 4D1YA 4ZJYA 4NNJA 2EBFX 3L8CA 4TV8A 1U7DA 3H5TA 3TD6A 4WOJA 4OX9B 3KDAA 4I1OA 4LFCB 3QMPA 1V1MA 1NGSA 3DJYA 5JW6A 1C0LA 3KQWA 2BF7A 3BD9A 4O2RA 3SF0A 2X0NA 1RIFA 2WD7B 4RD1A 2GA9A 1Y6GA 4FOLA 2DAPA 1M72A 1XO1A 1Y9DA 1HT2E 4KQEA 3TLZA 3BUSA 3OPYA 3A9SA 3V00A 5LQAA 1JIKA 4PM4A 4PFJA 1XZ8A 1T6XA 2DCMA 4NS1A 1K7YA 4AMGA 4B3JA 4E13A 2CHUA 1ZN7A 2ZOSA 2TS1A 2W6CX 5CW1A 121PA 4EVSA 3ZOKA 1PZNA 5J1SB 2UDPA 3A1EA 3PFFA 1R2QA 4EHHA 3ZJVA 1C7RA 1EJBA 4ZVRA 1YJ8A 4JBXA 3RSCA 1AUOA 1JA9A 1ZN8A 3C48A 3G68A 3KSMA 4O02B 3R7BA 3HFRA 1T36A 4OB8A 3EXIA 3RLFA 3WJAA 3JYQA 3WLFA 1E3DA 1NLYA 1XMSA 2AHRA 1JBQA 1XTQA 2PDAA 1Z2CA 1FFXB 2IEGA 3L43A 1UBKS 2ACWA 4H15A 2EX0A 1WHSB 5GJVC 5K0LA 1EFRA 1Y9AA 2BFDB 5FA6A 1G5RA 2H4YA 3F5DA 4L07A 1RJ9B 4EUNA 3T7KA 3TJRA 3LC0A 3OWXA 1U3VA 4QUKA 1QHXA 5HOEA 2IVFA 2AOUA 1LTQA 1R66A 2RFLA 4TRMA 5T5QA 3RS8A 2O2YA 1TU0A 2OAGA 2V97A 5J23A 5ARCA 1JPNA 2LV8A 1S2MA 4QXQA 2JLUA 421PA 2VK8A 4BXOB 3D8TA 3OI7A 3OLWA 4JT2A 1CE8A 3NRCA 4DMMA 4DSZA 4ZI7A 1SXQA 5LA6A 3IAUA 4LF9B 5HM6A 3IEVA 1YJQA 5EWJB 5DP2A 3PLAE 2BKLA 2VXCA 4N3BA 4D0SA 5HF9A 4XX0B 1EXVA 4FFLA 3ZCRA 1SBTA 1U1IA 1XVTA 4MPPA 5T4BA 3WNCA 1XPRA 1C9DB 3P9PA 3LY5A 1ODTC 2B1IA 4ZCSA 2X0RA 4AURA 5JTUA 3CZ5A 1SUAA 2P4EA 4EFKA 5IK2A 3ZC3A 1NBHA 4FOTA 4MWTA 4XE5A 3EEFA 5ER9A 3C5VA 2IEDA 5E2AA 3S28A 1JTFA 1YGYA 2VP0A 4IIHA 3AIIA 2XYVA 2QM3A 3FHCB 3AL2A 1IQUA 1T34A 3OX1A 1A9OA 6PFKA 1QHIA 1T13A 4LQCA 5CPBA 1ZA2A 3RJTA 4A03A 5K8JB 5KQPA 3EVBA 1QAQA 5BUCA 3DF7A 3I73A 1ETHA 3IR6A 4FBLA 5DULA 4IY1A 4BVKA 4XWOA 1YFKA 3DYBA 1N9ZA 3TUIC 3J7AC 4KDEA 2VIIA 3I5UA 1GN9A 3MTQA 3S2ZA 1QZ3A 2X1HA 5FWYB 1Y7IA 4LMBA 3OOJA 8ATCA 4CLOA 3AINA 2QX6A 2YYZA 4WZAA 3STHA 1W73A 4PAMA 4DDWA 5A4JA 5BSEA 1HQDA 5JV5A 2UZ1B 1P9RA 1J1ZA 4ZOAA 3EGIA 3K1AA 4R3UC 1XMJA 1QE5A 1H1DA 1M2EA 1VDMA 3AJ9A 3EZ9A 3MT0A 2K2QB 3OESA 5GM2A 4BNVA 5FUXA 2HCFA 2HYDA 2X8JB 4UUBA 1JSZA 3VR6D 1QC5A 5DCWA 1C8VB 3FMOB 2V5UA 5KU1A 5HGJA 4WNAB 1V35A 1HSZA 3HJBA 4NBNA 1QOPB 4BKQA 2J3MA 1R8XA 2ZRCA 2IH2A 5EZSA 4FS8A 1NNLA 1S89A 4B0PA 4G5RA 1GLGA 1N6HA 3BZUA 1ZNYA 2FOXA 3FPLA 2HRBA 3CM0A 3JRNA 1P33A 5K0TA 3ZGXA 3C39A 5KQMA 3DCNA 4B85A 4EEKA 2HX1A 5ICFA 1TQ4A 1UBGA 4R7ZA 5BSMA 2CVQA 2FK7A 3GLHB 3NIFB 4HB2A 4LDPA 1IONA 1WQ1R 4PE5B 4OMFG 3GCZA 5KVQA 4BKPA 4C89A 3K9NA 4U2EA 2QVXX 1YB2A 2AYZA 2X7HA 1UKVY 2ZYHA 3E0XA 3GJ3A 4BRUA 2YIDA 3QW2A 5J40A 4EO9A 3AEKB 3HNOA 1OX4A 3HJCA 4QYMA 4J2TA 5E6SB 1QYIA 2UUCB 2P0YA 4A6PA 3TCXB 2EBHX 1KBOA 2O2GA 1YB5A 4NYJQ 4RMNA 1KP3A 3BWDD 3CGGA 4MQLA 1AQLA 1PN3A 3F3SA 3ZCPA 3EIQA 3SVLA 4R9UC 3E53A 2BHTA 4F04A 4B32A 5ARDA 5F2OA 4FTWA 2C99A 1EUCA 5JAZA 5JYDA 2XE6A 2HV9A 1P7PA 2MSCB 3R1IA 2GNOA 4J0KA 4UBMA 5CBPB 5CJ2A 1RWNA 5E95A 1KAEA 4EGQA 4KQCA 5F2NA 1L5QA 4TWJA 4NPHA 1YU9A 5PGMA 2MSNA 2JFBA 3WIVA 1CVLA 5ALWA 5CXQA 2CFTA 1AKMA 1LK0A 1MOZA 1Q5PA 4B3FX 3PVCA 1CFJA 1FRNA 1GHTA 2VR1A 4LWZA 3GT3A 3E7PA 1N9GA 2QTVB 2ZBUA 3TEJA 2ZIUB 1JA0A 5LDHA 2NPIA 4QLAA 1W7AA 2YWXA 4B84A 4V0LA 2J3HA 1LXCA 1UBCA 1WULS 1ZLYA 2NZWA 4CBVA 1ZUD1 3WA6A 3Q8XB 3ND7A 2B7CA 1TEVA 1IHDA 3BA6A 2VP6A 1SIUA 3PUIA 4BO6A 4ASUD 4GKJB 1SXHA 4EGSA 4XGNA 5BRNA 5AI0A 1H05A 2HBRA 3QX8A 5B1HA 4LSWA 3ITNA 4GM4A 1KMNA 2GM5A 4R6XA 5CBKA 3THYB 4BE7B 3IOCA 3UANA 1EM6A 1E79A 4E2XA 2D0DA 1O94A 4IZIA 4S2UA 4JI6B 4X93A 1NQUA 2JGDA 3VX3A 1C9JA 1T8SA 5DEOA 3PUWA 4QYTA 5K0GA 1FFEA 3JYHA 1JILA 3K09C 1HYQA 2YZNA 4WKGA 3FDJA 1EWYA 4P98A 1YASA 5CB4F 4LFBB 3SZGA 1MD9A 3E2IA 4RMGA 3U3DA 1N3BA 3V6MA 3DMDA 5J4KA 1HDIA 5KMGB 4A4DA 2PIAA 1GSIA 1YSCA 2FJ0A 1CTQA 1O7JA 4HNGA 1R1DA 1ADCA 3DFFA 4JN6B 4IVQA 4S0ZA 4Y9SA 3WIUA 3PB3A 3WLHA 2WD8A 3DBOB 3W0LB 4K46A 3RVDA 4JQZA 3R0IA 1ZGHA 4WY2A 2J0UA 2ZRFA 1ZCBA 1TK9A 4CM9D 1QZZA 4G01B 5BQXA 4C6TB 1T9KA 1E96A 2HRZA 4XEUA 2JBAB 4LV8B 2EZTA 3WHIA 2F2TA 3K71B 4YXFA 1XRJA 4REQB 3A9CA 4NBVA 4ER0A 4M1MA 2GM3A 2XEDA 2C7RA 3WBFA 1E92A 2BBTA 2WFLB 3GBVA 3IXLA 2WUGA 4GIBA 5DBFA 1VL0A 3OFKA 3OPXA 2ON6A 4DLNA 1VI5A 2O23A 3GNTA 4B8YA 2AQIA 2WF6A 4QGFA 2UZ3A 5KNBH 3STUA 4Z7QB 2PJDA 3DE2X 5EA2A 1Z4KA 4FZ5A 2R6CA 5IEBA 4LRYA 1VE7A 3IILA 5SZIA 5DNYB 3NHKA 1QRSA 4RABA 2VYVD 4GE0A 1N6KA 4C43A 3KOMA 3R0XA 1U7PA 3NTXA 2P9HA 4EHNA 4GRIA 2IPAB 5BSVA 2ATIA 4G81A 5GZ1A 3H6GA 1UFQA 4QODA 1OWOA 1VXRA 3S2EA 1AUQA 1ZZEA 5BV2P 2NP7A 1PJBA 4I4IA 1OFIA 1QGDA 2ID8A 3IKMB 1XU7A 1KJJA 2EZ4A 2V7UA 3K9WA 3T41A 1KQOA 1ADFA 2AMJA 2CD9A 5C5EA 1RJEA 3D6UA 1CRZA 4TT3A 5DLEA 2OSVA 1ECBA 3WRVA 5J4LA 3R0VA 1NNSA 4ZD6A 3VYWA 3OSUA 2WTNA 1ZJ4A 2XXJA 3HL4A 2NU9B 3TQQA 3MTAA 4X9XA 5H0IA 4CM5A 1L4FA 2XKAA 5JZVA 1G2OA 1ULZA 2EJBA 3B52X 4WUVA 1D2NA 1H5QA 1ZJ5A 3AL3A 5C3MA 3TL3A 5F1KA 3ZOZA 4WAUA 4EUHA 1TMKA 4LXQA 1QPBA 1ULTA 1EVLA 3LXRA 4RVOA 4HZUA 3A9TA 1SCDA 1GPUA 1I6KA 2WDPA 3ELUA 2R4UA 4UU1A 2PL5A 2HB6A 3S7TA 2PANA 2Y4NA 4TS9A 5IH3A 4C3OB 4D6YA 3IDZA 3E84A 4I9FA 3NHZA 3KJQA 4NMMA 3NGMA 5P8WA 4F45A 1BVRA 1FFSA 1BKYA 3RASA 4CGYA 3U4HA 2OHJA 4BFCA 5AK6A 1MOSA 4JOBA 4YFYA 4U2FA 1RQPA 1DXHA 1KZ6A 1HF3A 1YBMA 4YRDA 3R5JA 1MTOA 2UYHA 4FFRA 4LCJA 1K27A 1NAHA 1NVTA 1YVDA 2X1LA 3C3MA 1CZOA 4QTUB 4CIAA 1DO0A 4DXHA 2QTCA 5SYAA 4MICA 1RPNA 2PR2A 1WCYA 2XADA 3GMTA 3QX7A 4I81A 3RWOA 5ICEA 4X66B 4KU4A 2ZK7A 4BMNA 2ID9A 2CLEB 5FPQA 3OY7A 1PS0A 1TKCA 4IIGA 5COBA 1H9CA 1ADYA 3KOOA 2EHJA 3V1LA 1SK8A 4BV8A 3PGKA 2OBBA 1IUKA 2GXAA 2CUNA 1XROA 2OO5C 3FR8A 5ILQA 5K03A 2HU2A 5KHLB 3NOQA 3OFSA 4OSEA 5B3KA 3NEJA 1W87A 2GETA 4ZZ0A 3KKEA 3L7LA 4RIIA 5GMOA 3PNSA 2R9VA 1B0AA 1PKXA 3GEGA 3GZNA 3R5XA 2X8LA 4F86A 2HO5A 4KTVE 1U0SY 3F47A 1VMKA 1TM3E 3JX9A 4ETMA 1XNHA 3RV4A 5KTPA 1UAAA 1NHWA 1R6AA 2HNBA 5KYWB 3AU9A 4B5KA 5K8TA 5FEMA 1LEHA 1PI3A 1NQWA 1PT6A 1ZOPA 5AI8A 3AHEA 2HK9A 4MKFA 2NYUA 3QEBZ 1V11A 1X1SA 3BMXA 3WL8A 3FVVA 2Y76A 1I2CA 4A0RA 5L3ZA 2AOTA 1KQNA 1HDCA 4NULA 3EFOB 4S2EA 4HB4A 1P6XA 1GYPA 1RHJA 4GS5A 4AJNA 3IO5A 2QLFA 1ELOA 4ENRA 4EHJA 1JFRA 3ONNA 3NR2A 2EJTA 4MROA 5BN3A 2A9JA 3ORFA 4LDRA 4CMBA 3TLKA 4XIIA 4XOUA 2ACVA 3LZCA 1FA9A 2F4NA 4RPHA 4WH0A 3SM9A 3ZWYA 4YV7A 3IE1A 1UMCA 2P8JA 2XNKA 4WJLA 2G3YA 3S8MA 3F96A 5TMPA 2ZR7A 5C53B 2BWJA 2C8LA 5C32A 2X5OA 4JU9A 3QLVC 3N6VA 3OJLA 4I2VA 4LNAA 4QQKA 2I3GA 4YWJA 5HKBA 1ND5A 2HO4A 3WNQA 1X8XA 3AMVA 3N7UA 1OAOC 2AL7A 1MX3A 4L3WA 1Y4SA 4I66A 3TTVA 3ESYA 3L92A 3U62A 3WKCA 4DLVA 3BVPA 3I6QA 4P82A 5JADA 1QH8B 1YR7A 1KRWA 3CLUD 2XIJA 3QPAA 4MW9A 4D97A 3UXYA 1CCWA 2OGUA 2IK8A 2DJ5A 3GPBA 1HDOA 3BXHA 5CH8A 4DE5A 3IBTA 3PC8C 2CYCA 4D56A 4CIYA 4KK3A 1DC7A 5DE3A 2TMKA 3Q8LA 2FMXA 4ND4A 3TQTA 5ALHA 2HCRA 4FBGA 1DEAA 1KSJA 2HMWA 2JFUA 4W5JA 1S7CA 5CVUA 2A14A 1JP7A 3BBLA 1KVUA 2NPOA 1EDBA 4TKLA 4W6QA 4AN4A 1QIMA 3PSHA 4NYMR 4B33A 1UOPA 3A4LA 2ZVQX 5B58C 2B25A 1FP4A 1WXFA 1N6RA 4BO5A 1D2MA 1HY3A 3OZ7A 1XNGA 5FBQB 2NAPA 4Q7QA 5KNBD 3KQVA 2JAQA 4NU0A 2FNAA 2G4CA 4YJ2F 4RADA 2ZPAA 1AMOA 3DL4A 2IH4A 1K8RA 4CHGA 2IYNA 4G0OA 4IV5A 2JH3A 5F1YA 5A2QA 4NCAA 5CLFA 4KE6A 1DNPA 2VJOA 4GYJA 3MWDB 1N1EA 1M7BA 1T1GA 2JGNA 3H05A 4KSYA 4G0WA 1IIRA 1A5TA 4BFYA 4PW0A 3BMCB 3WIOA 5A62A 1FFGA 3PPXA 1XQ6A 3ETHA 2EGGA 2JJ8A 2O7RA 5HMLA 5JO9A 1JR3D 1JU4A 1TM1E 1NVMB 3CF6R 4G0PA 3S2SA 4EENA 5I7SA 1MW8X 3X44A 2JZNA 1OLUA 1U4NA 2GDZA 2VJQA 3O3CA 2Q8QA 1KK3A 1W29A 2PIDA 2XE7A 3M5PA 4OKNA 2V0NA 4TWIA 1CR4A 1Y8CA 5FOTA 2BEJA 4Q4AA 4WLUA 3ROEA 2PWBA 4EG5A 5AVKA 1Y4ZA 1Y89A 2YY5A 4BEVA 5KREA 4DM7A 2C2MA 1KS2A 4KFCA 5DVZA 1C4KA 4KQKA 2JFNA 3H2BA 1T25A 3ZU3A 1GPMA 2GHTA 3R0JA 1C80A 1ABEA 2CHVA 4UE3S 1D04A 1YBHA 2CBZA 2VDLB 3PUXA 1C3LA 1GQRA 3NANA 3I1YA 4PHGA 3V33A 4EHIA 2G9QA 5IM5A 1PVVA 1DV1A 2H2IA 3PHIA 2C54A 2BI4A 4TM7A 2NZJA 1WCIB 3M81A 3PI7A 2XE8A 4UDYX 5JCJA 5JYCA 4RFSA 5KC9A 2CXTA 1QV9A 1V3TA 4RM3A 1GAEO 2Q5OA 1Q0RA 2FWAA 4BO0A 4YJHB 4CEHA 1NYLA 2FN3A 2PX2A 3I39X 4JSYA 4GKBA 3F1LA 1IEXA 7AT1A 3VVLA 1O4WA 1N5RA 4WCDA 2A1UA 5CLHA 3SMQA 4DKXA 3U49A 1V5GA 5ECGC 1J33A 1GP2A 3RRXA 4UMDA 4C7KA 4ZOQI 3CLSD 2C0PA 4TLCA 3GN2A 1MQ8B 5TVGA 4WKNA 1ILWA 2MSLA 4G0MA 2QPLA 4LMAA 2YRFA 3KETA 5EVJA 1X8LA 1IY9A 4J1NA 4CIDA 1PJ3A 3MB5A 2FW1A 1GY8A 1SCNE 3JQAA 4ND7A 5IBRA 4M9XA 4US1R 2CLHB 5K1ZA 4IOKA 4F56A 1SCIA 1KI3A 2G06A 2W6QA 5IT4A 1GFZA 4JYPA 1U11A 1O94C 2JGFA 2P9BA 2Q5JA 1NJ8A 3FFAA 1WBJB 4NBUA 5DASA 2H5LA 3BE5A 3WGVA 5F3WB 5A2GA 2DWOA 2YXEA 1Z8DA 3TAUA 3OOSA 4MW0A 1JHAA 1HYHA 5AKLA 4PXAA 5A0FA 3ZN2A 2E7ZA 3ZCQA 4RVGA 4JB2A 3DPSA 4JI5B 4B40A 4INAA 3GRYA 3FTCA 4TVSA 4MVJA 2EKPA 3V48A 3HP4A 1T8UA 2XVXA 1DZIA 3P32A 1C8LA 3PL5A 2IGBA 1MVNA 3ASUA 1GL9B 4TVOA 5KSPA 2C1XA 3D6MA 4RKWA 3JWJA 2PSSA 5KYNA 4BATA 4MV4A 4D99A 5J9FA 4F1KA 4B44A 1ZZGA 2FFRA 3G2NA 3FNBA 3RUDA 4NVRA 5AUNB 1LW7A 2A9FA 3IGFA 4R01A 1PSWA 1C7FA 1X2BA 2PX5A 3FA2A 2JJ2A 4WKPA 4U8GA 4XTCS 4R8MA 3TX2A 4Q7LA 4LK2A 3WYDA 2VP3A 5A5FA 4M1EA 1W5AA 4I4LA 1E32A 3SR4A 1GDTA 1QQBA 2O7SA 1G3QA 3JCZA 4BKUA 5KTNA 4NX2A 3KX2A 1Q1QA 4Y2QA 1DCTA 4QRHA 2PWAA 2POQX 2QV0A 1P7YA 4CNQA 4MRRA 3ADDA 2OCKA 2H52A 1HMYA 3GT0A 1FJHA 2W2PA 4ZT6A 5JAHA 2QMZA 4GSYA 2CXHA 3RYIB 3IOEA 1FP1D 1VKNA 2K5UA 4M8LA 1PNVA 4JHLA 4YAKA 3A6FA 1SXJA 3BHJA 4DWJA 2GAAA 2YJ3A 2VPIA 3AJDA 4U7WA 1VFPA 1JDSA 3NO4A 1IULA 1KEPA 2FE1A 3RYFA 5AUOB 2ERYA 2EARA 4KV7A 4EA6A 2IS4A 1KI6A 2XPCA 3A9RA 2EU8A 1QONA 4UXHA 4A0SA 1EQUA 1I9GA 1XALA 4JMPA 5L95A 5HDQA 2E0IA 1UDXA 2XJ4A 3TLXA 3INNA 1WF3A 3I83A 3NKLA 4C4TA 1W46A 3GFGA 3VPSA 4EMTA 3KXIA 1ADBA 2JLSA 3AEUA 2RCYA 4KO1S 3RFFA 3T5GA 1R00A 2VHTA 2XQJA 2ASEA 3PNYA 4RVHA 2IU4A 3ZVNA 4DJEC 1L5HA 1UQRA 1HI9A 1PV2A 2I67A 2DECA 1BN6A 1KS9A 3CR7A 1T1IA 3DL7A 3UJ7A 5K7SA 2IIPA 2FHPA 3ZWMA 4AMZA 5E8RA 1LF0A 4FSDA 1PUJA 2QN1A 4E09A 1N2CA 1DSSG 4TGLA 2Q0QA 2KLBA 3IDQA 1C7JA 1AHHA 3KR9A 1Y0BA 2E4AA 3BOSA 1V9LA 4N01A 4N8EA 4Q12A 3NBAA 4MWCA 1QQ6A 4MWBA 1Q2UA 4PHFA 5EQFA 5TXGA 3IAAA 5BYAA 1ZSVA 1NW4A 1OZAA 4HG2A 4OYYA 2OD7A 5DGHA 2WPDD 3LC2O 1DAEA 4DT1A 2J9RA 4R2MA 1UBHS 3NHPA 1JNYA 4EX6A 3GYGA 3LTEA 4C4XA 1KK1A 3O92A 1PBTA 3P0JA 4ZO4A 4URYR 1FE8A 5AI5A 4DA4A 3LUFA 4L5AA 1PEYA 1VFNA 4A9AA 3E4CA 3KYIB 4QUBA 5FDFA 4WY5A 3W9UA 1C9YA 3DCIA 2EQAA 3M4XA 4H7IA 4YAIA 3K9QO 5CA0A 4TSFD 1KI2A 1XCLA 4ZYTA 5HCIA 1FFCA 3BGVA 1EFUA 3LPAA 1BQ4A 1RRGA 3G1UA 3X2FA 2A3RA 1XXLA 3P7MA 4XIYA 4DZRA 4PYLA 3DLBA 1OTHA 2V96A 2P2DA 3KTFA 5AVJA 2G1JA 2X40A 4CLHA 2BYTA 1LDNA 4UDNA 4MUJA 2XA1A 1DG9A 1JDPA 2O3UA 1QB8A 1UC5B 2REOA 1Z35A 3IO3A 1VGRA 4OM8A 5DM0A 3SGLA 1E5DA 1V7CA 1N33B 3N8IA 2PPLA 1BNCA 1JNXX 2JCYA 1AKVA 1EBBA 4WFIA 4B4UA 2QM7A 4K28A 3JWEA 4CIWA 2X9NA 3A9UA 3NBZC 5BQ5A 3WQQA 1CC1S 5GPBA 2GRAA 2VK2A 4HRAA 3UHPA 3HU1A 1C14A 5B4VA 4EMBA 2ZYTX 4DQUA 1RJ9A 2NYAA 1IVYA 5G1PA 2RHDA 4EH1A 4PQGA 1ISHA 1JXAA 1IC6A 3DWGA 3MQ2A 5BQFA 3I9KA 3OJEA 3RKUA 1F48A 4O1HA 4IYJA 5JI2E 3RK1A 3NWOA 4EW1A 2KMLA 3NAZA 5K3OA 3HVJA 3UXEA 3V4ZA 4OO3A 3K3PA 2QQGA 3MOGA 4KDCA 4L8VA 4F3NA 4ZZIA 1N2JA 1NW6A 1XL0A 2J30A 2VRCA 3D59A 3KEFA 4P38A 3RW9A 5GZ3A 3F5SA 5HNKA 2AC2A 4M36A 2Z2YA 1TC1A 1SD1A 3IJPA 4RH1A 3ENNA 4TRNA 3PXAA 3WLMA 4UOEA 1T9GR 4OJKA 3FX2A 2IX9A 2WZQA 4ZT4A 3RNLA 4JLDA 3VZPA 2VA9A 1NJGA 3NYWA 1OXSC 3R75A 4NABA 2Y1FA 5E0OA 3BSWA 1OYWA 2XF8A 2BE7A 4FVTA 4BC1A 4AULA 1BDIA 3R3VA 1IU9A 1LTHR 3UFXA 4Z7OB 3A3NA 1FP6A 3LT1A 1E5QA 2YJTD 3OPYI 1PKEA 2QG6A 3PDHA 3BHMA 5LYJA 1Z6PA 4BAUA 3WBBA 1Z6ZA 3Q7IA 2NUPA 4G0QA 1U80A 1LDGA 4DIBA 2Q6LA 2FGJA 3P2YA 3WRXA 3ZJYA 4S1OA 5L51A 4CODB 4NDZA 3SHFA 2QZPA 3DP9A 2C7VA 4GL4A 2P9QA 4JQCA 4OK5A 2VAXA 2QSUA 1QYVA 1G7TA 1I1NA 1USVA 2IHVA 1I0IA 2UZ1A 3SFVA 5I3ZA 1L0BA 5CNIA 1A50B 3NP9A 4MA4A 4OLFA 4Q05A 4RE6A 2QN7A 5H9VA 4BJHB 1I24A 1Y5LA 3VMFA 2C2OA 2Z6VA 3UPUA 3NOOA 5BMVA 1RR6A 1DC8A 3I4CA 1I4DD 4I5DA 2I5PO 4U3JB 2GPAA 3E9CA 1E4VA 3GAAA 1WQ4A 1MU0A 2PUJA 4ZQGA 1G4UR 4M46A 4UZEA 1N4AA 2OCBA 5AXBA 2QAGC 2ZBGA 1CRWG 1N34B 5AQEA 4F5WA 5BSKA 4KXLA 1RRPA 1RBZA 1JN0A 3FMFA 1OLSB 4KLCA 2G63A 4I46A 5CAEB 3GLHA 1SWWA 5DX8A 4NBKA 3LDFA 2I6UA 4I55A 3V42A 3TECE 1HLPA 3TNLA 2GEUA 1GEGA 3H75A 4AB1A 1EH5A 1TJNA 3H3JA 2BT4A 5JHGB 3BHIA 2MWMA 4FQ7A 5ALPA 1B2LA 1I5EA 4GI2A 2IKSA 3KJNA 2ZE5A 3H1EA 3SZOA 4HEJA 1EEHA 4YRAA 2YXPX 2ZBVA 3I2IA 3Q41A 3T4EA 1KI8A 4V0MA 1KMHB 4HR7A 1ZL0A 3H17A 4NBLA 2CLLB 1TZ2A 3H6KA 5LKAA 3HCBA 2QAJA 4Y9UA 4LECA 4GBMA 1CEEA 3KU4A 2C9DA 2DHQA 3O1JC 3UEOA 3TR6A 2WTXA 1VIVA 1WPRA 1YCFA 2XMSA 4RKFA 5COQA 5BOSB 4P92A 4BX0A 2OCYC 5HZHA 1NI4A 1H23A 1KO8A 1Z7EA 3IAS1 7REQB 3KJGA 1TDJA 2VH2A 5E4TA 2C7OA 4OQDA 3TRDA 1R6UA 1BZYA 3RV3A 4E3ZA 4FCCA 2PGLA 2I87A 5EIHA 1HWYA 1QZTA 5JARA 1H3NA 2RH5A 2J4FA 3EWAA 3I9JA 2X0EA 1HE4A 4MS1B 3AC0A 2COUA 4KYUA 1R0CA 4WESA 2GN6A 2JJMA 4QLBA 4Q9AA 3I62A 2V6MA 4Q0MA 4UUNA 3DEHA 5I48A 8MHTA 2X0IA 1PJ4A 3M8KA 4PYJA 5LOVF 3QE3A 2DEUA 1CRQA 2P4QA 3AF6A 3R9WA 3WGOA 1L7NA 4P4UA 2CFRA 1TFUA 1T6ZA 1WMDA 5EN4A 2MSDB 2A57A 1VMEA 3A2NA 5B1EA 4GRDA 1DAMA 3W5IA 4RTJA 4CEJB 1WPGA 2XUPA 3STXA 1LU9A 3P0IA 3THYA 2NVOA 1M2VA 2Q2VA 1UFKA 3DZKA 3NI2A 4MQEA 5SYMA 3R7LA 5IUNC 1E60A 2FMHA 4Q37A 4TYMA 1E61A 2IIQA 1CYDA 1OWPA 1W25A 4FQ5A 4XJVA 1YZQA 1WMFA 5FA8A 1Y9ZA 4P0QB 3IOBA 3O91A 1X0VA 3INTA 4AYXA 4RAQA 2DMRA 2W8ZA 3GU3A 4AAYA 1KEEA 2ZU0C 5C8YB 4HQFA 3AJRA 2ZAOA 1NFQA 3MT9A 1OHHA 5FTWA 2VDOB 1W35A 3NHSA 1LGYA 2XYGA 3OMLA 3B1FA 1Z28A 1IZYA 4MGEA 5B2FA 2KLHA 1M0SA 1WD7A 4YPOA 2XT6A 4DC0A 1HNWB 4HAOA 3OX4A 4YP0A 3OE7A 1FVOA 3M2PA 4KSCA 2UKDA 4U7JA 5TJHA 1LRLA 3A1SA 5KTYA 2Z1MA 3LPMA 5D85A 5FAXA 3T7IA 1L8QA 3RKSA 4EUEA 1HE5A 1MORA 2IPMA 1KMQA 4F5DA 1P6QA 3G0IA 1TZKA 3CO5A 2NU6A 4UXIA 1CX9B 2GZAA 3EXHC 3RUAA 4AC9A 3IIEA 4RK0A 2HBYA 4ISBA 1X92A 3QVGB 4IM7A 3K8YA 2QY9A 5D8DA 2VYND 4DNFA 2ZUBA 4P54A 4WDRA 2J4CA 1GKKA 2BELA 2IHJA 1XI2A 2RC6A 2TMYA 3VDMA 4YRNA 1BXZA 3W8NA 4C03A 3Q3JB 2JI6A 4WXRA 4M1YA 5SZKB 5LN1A 3EBPA 1KY5A 4J9UE 3BXEA 1BMQA 4EGJA 4UAVA 5D5QA 3DZCA 5EXSA 3ZKAA 4UEKA 3QYJA 4JA0A 4J6FA 3I45A 2FRXA 4QOJA 1FDSA 4R9VA 1VA5A 2Z3WA 4HGZA 4XVQA 3X1WA 5AIBA 4YQYA 5KX5B 3FGOA 4U2DA 5FI1B 1AKEA 3D7NA 4MUNA 2GVNA 3L0BA 3T1HB 3IQZA 4QXOA 4PBTA 1R8SA 2HZ7A 1T9ZA 4HP8A 3LUAA 1VJ1A 2AG6A 1O6FA 3B1YA 2PUAA 1SBCA 3ZHVA 1NW3A 1YL5A 1TO2E 2D59A 2NU9A 5FKJA 4B79A 4EY3A 3L1IA 2R62A 2X9QA 2NMVA 1EP1B 2PH7A 1FTNA 2OM2A 4KQHA 1L4BA 1G8YA 1PGPA 3TIIA 3EX7C 3B70A 4TSRA 4KXXA 1U94A 4IGFA 1DBIA 1K88A 2C78A 4NEQA 4IFEA 3C74A 4FJ1A 3JAKB 1XTVA 2Y77A 1CJTC 1VL6A 3AERA 1BVHA 3FF4A 4H4DA 1NV8A 2G17A 1JBKA 5DPMA 3CLTD 1T1JA 3DAOA 2UZ0A 1X3LA 4UZFA 3A05A 3H9EO 4ND2A 4IP0A 3HKCB 4X6LA 4CTKA 1T24A 1Z4LA 2ZUCA 4D0LB 3PJFA 1N0WA 5TARA 1T6YA 5B58T 2EQ5A 2VFAA 1V48A 4CXMA 4I1UA 3TLAA 3UT5B 1QCZA 1EFPA 2PVCA 1RP7A 2ZCVA 1XDDA 4RSHA 4Y2SA 5J2TF 5AW0A 4GR5A 1U4OA 5LXTB 3HYNA 1E6LA 1Z6GA 2ZB4A 3H9JA 4Q34A 4Q7EA 1WSBA 4RL6A 4UCWA 4I4CA 1RZRA 2XQFA 4ZPXA 2XOEA 1I80A 2PKCA 4YP5A 3ZGYA 1QRAA 4RY9A 4F06A 3ENVA 1D1TA 3D8NA 3KAQA 4RV4A 2O2SA 2XA2A 4OSPA 1ZP6A 3WDLA 1PO7A 4JH0A 4ARSA 3DQZA 4PCUA 2R1UA 4PSDA 4EKNB 1E0SA 3PQDA 3JATB 4NCBA 5CUQA 3Q72A 2Z5GA 5CDFA 1XEXB 3A4MA 5DYIA 4ZT5A 4GUAA 3PF8A 5A6SA 3SE0A 4FHZA 1RD4A 4DA0A 3KT3A 4G0YA 1P0FA 4YT2A 3H5NA 3IQGX 2VQ6A 2H08A 1CZNA 1T9DA 1HKHA 1F8XA 3JAWA 2QTNA 1OGYA 4OKSA 5JY6A 3ZU2A 3FVWA 4BEWA 3ASZA 1EFVB 2ZR9A 3IP5A 4BYGA 3ISJA 4RJTA 3IH5A 5KYWA 4X71A 3DP7A 1U2ZA 1QP0A 3O5AA 4HDMB 1V26A 4LXTA 1FSPA 1KYVA 2P91A 1EWVA 3L7NA 4GBGA 1ZA1A 1QE3A 3HHPA 2R97A 5BVGB 2J5KA 3CIOA 5JNLA 4XVUA 1Y5IA 2QDKA 1TYEB 4N18A 4URZR 4QBIA 3EFOA 3UMVA 1MQAA 4FYKA 4BWVA 5K8LA 1FUYB 4UQPA 3ZIDA 2JLVA 3DLTA 2N0SA 2N42A 1DT5A 2ZUFA 4R16A 2R66A 1ECLA 2FLVA 2D06A 1XQ9A