2GEKA

Crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
373
structure length
361
Chain Sequence
MRIGMVCPYSFDVPGGVQSHVLQLAEVLRDAGHEVSVLAPASPHVKLPDYVVSGGKAVFGPATHRKVKKWIAEGDFDVLHIHEPNAPSLSMLALQAAEGPIVATFHTSTTKSLTLSVFQGILRPYHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVDVASFADAPLLDGYPREGRTVLFLGRYDEPRKGMAVLLAALPKLVARFPDVEILIVGRGDEDELREQAGDLAGHLRFLGQVDDATKASAMRSADVYCAPHLGGESFGIVLVEAMAAGTAVVASDLDAFRRVLADGDAGRLVPVDDADGMAAALIGILEDDQLRAGYVARASERVHRYDWSVVSAQIMRVYETVSGAGIKVQVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and interfacial catalysis by the essential phosphatidylinositol mannosyltransferase PimA from mycobacteria.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords PHOSPHATIDYLINOSITOL MANNOSYLTRANSFERASE (PimA)
total genus 119
structure length 361
sequence length 373
ec nomenclature ec 2.4.1.345: Phosphatidyl-myo-inositol alpha-mannosyltransferase.
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13439 Glyco_transf_4 Glycosyltransferase Family 4
A PF13692 Glyco_trans_1_4 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2gekA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2gekA02
1Z6QA 4M60A 3BCSA 2F3PA 4G2TA 4YI5A 3DD1A 4WHMA 1PYGA 3CUWA 4RBNA 4RIIA 1UQTA 3ZCSA 1WW2A 3COPA 3L7DA 3IA7A 2AW3A 2R60A 2AZDA 2F3SA 2IUYA 3NAZA 1XKXA 3ZCUA 2R4UA 2P6PA 1JIXA 2VG8A 1ABBA 1GPAA 3NPAA 3T3GA 3CEHA 1Y6GA 3T3EA 2R66A 1FTWA 5LQDA 1NZDA 2GPAA 2AMVA 1SXPA 1JEJA 1L5SA 2GEJA 3S27A 3ZCVA 3SYRA 3MRXA 2XGOA 4W6QA 1NLMA 3OT5A 3H4IA 3SYMA 2QLLA 2QLMA 4GZ6A 3MRTA 2H1FA 4YUAA 2FFRA 4BQIA 4HLNA 4GYYA 3MS7A 3CUTA 1LWNA 2KS6A 1FC0A 2X0DA 3T3IA 3VUFA 3CEJA 2PYDA 2IV3A 5TVGA 2X0EA 3T3DA 3D1JA 1GFZA 2X6QA 2PRJA 4PQGA 1P4JA 2G9VA 4GYWA 3O3CA 3G2IA 2Q6VA 1O6CA 1F0KA 2XCIA 2G9UA 3HBMA 3S0JA 5GPBA 3OTGA 5IKPA 1P29A 1P2GA 4WACA 1JIVA 3QKWA 3L7CA 4M83A 3MRVA 2X0FA 1Y6FA 1P4HA 1E1YA 3WADA 2QN3A 4F9FA 3VUEA 2G9RA 2XA1A 3G2NA 1L7XA 3OKCA 3CUVA 4AMBA 1C8KA 4NESA 1SXQA 5IKOA 4F97A 3ZCPA 3S28A 1XC7A 3OY7A 2SKEA 2R4TA 3BDAA 5TMDA 3MT9A 4EL5A 1L6IA 1WUYA 1YGPA 3TOVA 2C1ZA 2HY7A 3CX4A 4M7PA 2XA9A 3OTHA 4X7PA 8GPBA 3T3HA 1YA6A 3GPBA 3Q3IA 1E4OA 5TMBA 1C3JA 1QKJA 3BD6A 2XGMA 3EBOA 1QM5A 4RENA 1C8LA 2QRHA 2ACWA 4Z5XA 3S2UA 2VCHA 5JTTA 3BEOA 1RZVA 2F3QA 5I45A 3MTAA 4F96A 3HBFA 3NP7A 4MHOA 2QN2A 4MRAA 4CTNA 2AV6A 1AXRA 1K06A 1PSWA 4GZ3A 1VGVA 1FS4A 3VDNB 1FTQA 2GJ4A 1FA9A 1XV5A 3ZCRA 3VDMA 3CV3A 2XMPA 1H5UA 3ZCTA 2JZCA 1V4VA 3G2LA 4MICA 1A8IA 1XL0A 2QN7A 1UZUA 3MT7A 2ZB2A 1GPYA 3BD7A 3FROA 4NC9A 3OY2A 2PYIA 3MBOA 3CUYA 2IYFA 3T5TA 3RSCA 2SKDA 2YJNA 2F9FA 2FETA 2JLBA 5JTUA 4GPBA 3UYLA 5DXFA 5ENZA 3WC4A 1F6DA 3RT1A 3HBNA 4N3CA 2GM9A 2GT1A 4RELA 1HLFA 1P2DA 4NEQA 3C48A 1FTYA 1NOKA 3E3LA 5BNWA 4RIGA 2IEIA 4RIFA 4CDRA 4LEIA 3RHZA 3HBJA 1NZFA 3MS4A 2QZSA 4GZ5A 3CUUA 4QLBA 2IV7A 2QN9A 3C4VA 3L01A 3OKPA 1GZ5A 5D01A 3UYKA 1JG6A 2QNBA 3NP9A 3L7AA 1XL1A 4EL0A 2GPNA 3CEMA 4KQMA 1RRVA 4MHSA 9GPBA 4WADA 3S29A 3ZCQA 3QHPA 3PE4A 4RIEA 1WV1A 4AMGA 2XCUA 3Q3EA 1EM6A 3D0QA 3G2HA 1LWOA 4X7RA 3EBPA 3PE3A 3C4QA 1FU4A 2SKCA 3G2KA 4AY5A 1M5RA 4L22A 4CTMA 3E3OA 3H4TA 2GEKA 3AMVA 3MS2A 4RIHA 3OKAA 3TSAA 4N3BA 1Y8ZA 3MT8A 2QN8A 1C50A 4N9WA 4BQEA 2C1XA 1IIRA 1WUTA 2IYAA 2BFWA 2ACVA 4MI6A 1B4DA 1Z6PA 2QRPA 3Q3HA 1JG7A 5DU2A 4FZRA 4REMA 3NC4A 4XI9A 4MI9A 2X6RA 4AY6A 3D0RA 3BCUA 4N3AA 3WAGA 4FKZA 2QRGA 1GG8A 2QRQA 2BGTA 4YI3A 3NCHA 5D00A 1NVKA 4BFCA 3MQFA 3MSCA 1P2BA 2VSYA 7GPBA 2GPBA 3OTIA 4KQ1A 1Z62A 1KTIA 4MI3A 1WW3A 3T7DA 1EXVA 3L79A 3DDWA 1GPBA 2XA2A 1PN3A 4AN4A 2FF5A 1WV0A 2QLNA 2PRIA 2VCEA 4KQ2A 4EJ2A 5TMEA 1PNVA 3TAXA 1BX3A 3BCRA 3BD8A 3RSZA 2C9ZA 1J39A 1AHPA 4EKEA 1GGNA 2XGSA 5HXAA 1L5WA 1RZUA 1UQUA 3GUHA 2H1HA 2C4MA 6GPBA 2G9QA 1IXYA 4HWGA 3E3NA 4XIFA 1NOIA 2WTXA 1L5VA 4BQFA 4X6LA 2IEGA 1JIUA 1Z8DA 3IAAA 4EKYA 1L5QA 1FU8A 2IW1A 2QN1A 5C1DA 2VSNA 2F3UA 2QRMA 2BGUA 3DDSA 3MTDA 4N39A 2O6LA 3L7BA 4LDPA 3G2JA 1FU7A 2OFFA 2ECPA 3MTBA 1K08A 3NB0A 4CTOA 2JJMA 1L5RA 2R68A 5DLDA 2ASVA 2ATIA 1P4GA 4X7MA 2PQ6A 2BISA 1XOIA 1NOJA 3DZCA
chains in the Genus database with same CATH superfamily
1KJWA 3N75A 1Z5WA 2PKWA 1M66A 1WVIA 2VSQA 3AU8A 3KELA 5G53C 4DV4B 1ZNWA 5CVEA 2OUIA 5JCJD 5ES4B 3ZDYB 1P0QA 1USKA 4MXDA 1UZLA 4OQMA 4X1IB 2EU8A 3RWMB 1DJLA 1QCYA 1DRKA 1P7VA 2XYHA 2VLBA 4F3RA 5LXTB 2WVGA 1EWTA 4WHMA 4F84A 2B1GA 4RBNA 1MW9X 5FXMA 2Q8NA 1FVHA 3H1FA 3FJYA 2D0IA 1WWKA 3VO1A 1OXBB 2WVAA 3UV6A 1T6ZA 1MX9A 1QO7A 3F5SA 1EFKA 4GX1A 4QPNA 4QYXA 4Q1VA 3VR0A 2DERA 3FFAA 1J5PA 4DBZA 1WZIA 3ZEIA 3FTQA 3QKIA 3KHKA 1SUAA 1WPXA 2F3SA 2ZS7A 3AFOA 3QX8A 4OOEA 1EAYA 5AIAA 5EMNA 4BTEA 3L4SO 1E6KA 2CF5A 4CKWB 5BMVA 4JN6B 1IH8A 1N3LA 4X84A 1O5IA 4HV4A 3OLCX 2ZR9A 3AC0A 3KO8A 4C4OA 1KRHA 3JD4A 2P67A 2QD4A 3LLUA 3ZW9A 3HE3A 3UHJA 2UAGA 5EYPB 4EB6A 4HXGA 3ICVA 3BCHA 4PLFA 4RFSB 3V2GA 2JLWA 2ABWA 4HNVA 1JHRA 2IPMA 3TPCA 3W1VA 3LUHA 4HL6A 4Y2QA 2CZGA 4DVJA 2C2XA 3H8JA 2O8DB 2QTMA 4KQHA 1VHWA 5M2QA 1JA0A 3M3HA 4KSCA 4KI7A 1NIJA 3WMRA 1GNVA 3QKUA 4MGZR 3N6VA 4A6XA 4XM0A 4Q3LA 3UH1A 3WKBA 2F1RA 2C9BA 3AY3A 5F77A 1CS0A 4BLPA 1Q20A 5LOVB 2H4FA 2PUCA 3IAEA 5FP0A 1J2JA 4MW4A 2B7CA 4P8RA 4DJ5X 5E4FA 2WWRA 4LXGA 1KZ6A 3AT1A 4XWTA 1CY1A 5LZ7A 2NU9B 2VP5A 1RWQA 1UPTA 2ZI5A 4MVJD 3T6KA 1FFHA 4MPRA 5K0ZA 4EDFA 1NRWA 5FWYB 3V3TA 3S81A 4IJ6A 4YJ2A 1NUUA 4CEJB 5ALXA 1VLMA 3WHIA 1DAHA 4HHEA 2H5IA 4IOJA 5GONF 1B6SA 4AL4A 2FGJA 3VUFA 4TT3A 2RIRA 1MRSA 3VBEA 3OLZA 1PS0A 3MZ0A 5EJGA 2HLPA 1ENYA 3LGXA 3KALA 1W5SA 2PR2A 2NXWA 2ZDGA 1E3SA 3EW7A 3U81A 5BVGB 3GNQA 4RIHA 4PQGA 3H2HA 4TUYB 2DLDA 5H83A 1IVYA 4TLLB 1F6WA 2D1RA 4HWPA 3JATA 5AI6A 1TVKA 2C2GA 2ZRJA 3FWPA 3AY6A 3WL5A 1DQNA 1P7ZA 2IT1A 3PFWO 4I9NA 5AK3A 4XB2A 4R81A 2BAGA 3TW6A 1Z7EA 3V80A 5BV2P 2R5FA 4QQRA 2G9UA 2ZUCA 4QFCA 1YR7A 3U9TA 1P4AA 1IM2A 1USGA 3SD7A 2A57A 1FS6A 1OHHA 3PC7A 4TV9A 2ZJ0A 1E20A 3G79A 4JLWA 2IZ0A 2Y71A 3I5AA 6ADHA 1THMA 1XN4A 2XGGA 2HIGA 2ZKIA 3B6EA 3GHHA 3OEEA 4NYJQ 4PBTA 4CR8A 4E11A 3QOFA 4PFKA 1FRVA 3DZBA 3JASA 1MEJA 2Q3DA 3KLBA 3RYHB 3UG6A 3WBJA 1XQ6A 3L3BA 2QRZA 4UVDA 3C43A 4MV0A 3NUQA 2BGNA 4P86A 4D0LB 4LOJA 3VNAA 4LHZA 3TSYA 3AHHA 5FTKA 1A7JA 5E2AA 1YQ9A 4EIWA 4ZVKA 4EI9A 4LXQA 5KZMB 2XODA 4G81A 1ADFA 4I2NA 2QYHA 2YXEA 4HP8A 4IS3A 4I4TA 4UDYX 3OZSA 5IVIA 2B9EA 1UWCA 4IFBA 3ZZ1A 2G80A 2DEUA 4UVEA 3A4LA 4YRFA 4UPVA 4RZXA 2DWCA 2VBGA 2XWQA 1WBBA 2XT0A 2L19A 1KDPA 4MRRA 2REOA 1P4SA 1L4UA 4HUQB 1T9AA 1BMFD 3K4QA 2OWDA 1Y6RA 1QPBA 3MWLA 3ACDA 2XDAA 3T94A 4EARA 1FE8A 1I9GA 3L7KA 2F17A 4TXHA 1G66A 4O0MA 3GQBA 4X8OA 1X80B 1V26A 5L7TA 2FU5C 5AW1A 2WYUA 5BNZA 1S4QA 2A9FA 4YIKA 5F7JA 4KDFA 2V9CA 1CRPA 2YS7A 1B41A 1S7GA 2ZTHA 3IMCA 3MWYW 4AJ4A 2CD7A 2YNMC 3PFNA 4ACBA 3PX7A 1C1DB 1UBCA 3AF0A 3OIVA 4ILEA 2VP4A 2HGSA 1YR6A 1JFVA 4FWBA 3Q6IA 5D2CA 1JLLA 3AI3A 4EY5A 1PV4A 1M2VA 4EJSA 3N07A 3DBLB 1WQ3A 3B8HA 2J9YB 3H5NA 3M1LA 4P7FA 4UDXX 5LZ8A 1IK4A 2D0OB 3EF0A 4B6GA 3HY3A 3QWAA 4ZZ1A 4YP7A 3AR9A 5JE8A 4BFYA 1EGHA 3F6YA 3QMMA 1J6UA 3L6BA 3TPFA 3HJGA 5BY2A 4C2BA 2WAOA 5I45A 5IAAA 1A04A 3EPLA 2DUWA 2WZQA 3KS9A 1R7RA 2O2YA 4IWXA 4J49A 4RH3A 2IUUA 4B2LA 5BSUA 4DGSA 1U28C 1Q50A 1PK7A 1UJMA 1PWYE 3LP6A 4MRAA 4F4CA 1OBFO 3M6MD 3L43A 1E9VA 4U3JA 4ZVNA 3TFQA 1HSZA 5KJ1A 3M9XA 4XEHA 5L3ZA 3SF8B 3Q9NA 4BAUA 1N2GA 5AFSA 2JS7A 1Z8FA 1B2LA 1PJZA 5M3BA 4EGCB 1JHPA 2PZGA 1XA0A 3ESBA 5BW5A 3KVRA 1E0SA 4OU4A 5CB0A 1I4LD 5KYUB 3AYXB 2GVZC 1QYDA 4H0CA 2VOJA 2X3YA 3EIOA 1KMMA 1A8HA 5GM1A 3V4OA 2YOGA 5EFZA 5FUBA 2HU2A 5HE9A 3ZI0A 2ODTX 7ABPA 3UCXA 5AVSA 1H2ZA 3UJAA 3REOA 3EZFA 4HNTA 4DB4A 4UVGA 4NXNB 2F48A 5JJCA 1Z26A 4EUEA 3KE9A 4YX9A 2PN1A 3LG2A 1XLVA 1RKUA 2JCVA 2W6JA 4KR2A 2MYNA 3O7WA 4Z49A 3WIBA 1CQJB 4M8NE 3RJMA 1V9LA 4LNHA 3CFYA 4RHTA 4D8WA 1C8BA 5IH3A 1YE5A 2HMSA 1ZD3A 4FE4A 3MWFA 3LT4A 2YFKA 3MGBA 4WV3A 1HQYE 1PVDA 3R9KA 4F2GA 3O94A 2DM6A 4YAJA 3UJCA 1TAQA 3NFRA 5L40A 1FNBA 4YACA 4QHTA 1QGDA 1UEIA 2AFHB 3LZCA 4RSRA 1N6NA 4UXIA 4IDPA 3W0LB 5BWLA 5HPYB 4GI5A 5JMWA 4B40A 1G21A 4P7JA 3CRRA 1KSFX 1P8JA 3WLPA 1CZOA 4R1MA 3FFBA 5PGMA 4AMZA 7AT1A 1N36B 3UYLA 1ZHFA 2OECA 2GK7A 3VVMA 1X7ZA 5IBRA 4UPEA 3SXPA 4X64B 3QGMA 3R0IA 3VNBA 3V42A 4LW8A 4N3CA 4OB8A 5IP5A 4CF6A 2Q2NA 3T7JA 2BEUA 3OPQA 4CIAA 5JRJA 1G2QA 1BXRA 4HRVA 4NV0A 1DC7A 4HVLA 4GKKB 4V0ME 1JG3A 2PGAA 4I5FA 1ZGGA 2K2WA 3E3LA 4LOHA 1CULC 1XLTA 4J0QA 3PNSA 2OBXA 4AD8A 3O3MB 2VDMB 4RIGA 3E53A 2AMJA 2Z30A 4BXOB 1IG3A 3FOEC 4IVRA 1GDTA 1MOPA 1N1EA 3ZWMA 4Q16A 4BFTA 4R0MA 1NNUA 4EJSC 3E7DA 1E1CB 4U7JA 4CMGA 3WGIA 3O93A 2X2EA 3AYZB 3CNEA 3QXSA 4NHEA 1NXPA 1QK5A 3VU9A 1PI3A 5CYOA 5DXJA 3LUAA 4JB8A 1ODIA 3DFMA 1GRQA 3SGLA 3UW1A 2TSYB 4RPJA 1IPFA 1XF9A 2R6CA 3RVSA 4LPKA 2HAEA 3PVCA 3V9AA 4EVSA 2ERXA 1OYOA 2WP0A 4O4JB 1UDWA 2QPAA 1W93A 5ECGC 3NHAA 2FWMX 2P7IA 2FUG6 3PVZA 4O4IF 5D01A 4BE4A 4JXXA 1KIFA 3OD5A 2J9FB 2QL9A 2VWHA 3HUDA 1NSTA 1LPNA 4RVUA 3UGTA 5LUBA 5C52B 3LUJA 3QEJA 4QKQA 5TARA 5A9TA 1UIMA 2Z6QA 3HTXA 3CVWA 3LT5A 4QULA 1DAGA 4QUDA 1KQGA 1PT7A 2A0XA 5DEIA 3I9FA 2DSTA 2NYRA 5K45A 1WV1A 2A0UA 3DO8A 3M4XA 4P4GA 5E6RA 2IHYA 5A05A 2NUAB 5CLIA 1L1QA 2V0NA 1KZYC 5CAEA 1H4TA 3T4PA 1RWPA 3JALB 2PSJA 2A9VA 2HIAA 3S2YA 4EMUA 1VJ5A 5AVYA 4ZQHA 4X1OA 3K70C 4AF6A 3ZHUA 5LD2C 2J9FA 3ZQ4A 4KFCA 3P0RA 2VHYA 3EAFA 4DLUA 4I8XA 3RO7A 3QEAZ 4FLFA 2CXRA 3AP2A 4DA8A 3IHTA 1CJCA 1HI9A 1E94E 1FU4A 1Q7RA 1XSEA 3IVXA 4F86A 4XQGA 2UZ3A 1HURA 1EFVA 3KG2A 3X1DA 1BQ4A 1PR5A 3JCZA 4QGSA 1CB7A 1GAQA 3E2MA 2ILTA 1M9NA 4RGYA 2QG6A 2Z8XA 1E2IA 3OBIA 1RPNA 3PDWA 3OQHA 1HTWA 4V3CA 3TX6A 4B3HA 1YF3A 1W48A 2R1UA 2YXNA 1EFRD 2JFBA 4PYLA 5AK6A 4EI7A 2DWUA 1RE1A 4J75A 1EJ0A 5B7NA 5TDHA 3ZE0B 4NBLA 3U3XA 3VKHA 1R37A 2FPIA 1EG7A 4A26A 4B73A 2GEUA 1RLTA 3KSMA 5JSZB 1HV8A 1RDFA 5FLYA 1RHRA 2C42A 2X9QA 3S1AB 4X65B 5DW0A 2XYGA 1M67A 4YRQA 4MI6A 5KKCA 121PA 2EFYA 2FHSA 3C8ZA 2BBOA 5BUZA 1L7BA 4KN8A 5HFAA 3TINA 1R0RE 2OHGA 4R7ZA 2GI4A 3JARB 1P31A 2CDNA 1DRJA 2C94A 4Q93A 4JYCA 4HQFA 3UAXA 1E98A 1E92A 2X8AA 2WQ6A 3G5MA 4MI9A 2X6RA 3GQVA 3IOMA 4RPCA 3Q5DA 3CA8A 4GPAA 1ODCA 5ECWA 3IR5A 5C5CA 1HX7A 4P7GA 3FM9A 5AVJA 1IN5A 3L4EA 4KXXA 4Q66C 3I58A 4I4TF 1UKAA 2J9XB 2OL4A 1PKEA 3IGFA 3TG8A 4ZDWA 2ZE5A 3LUGA 4GOXA 1MUUA 1XRPA 4L8YA 4F1JA 5JNSA 1Z0FA 4MYRA 1HRKA 3STUA 3QXXA 4P3YA 4HEHA 3G17A 4K9SA 2Y0BA 3GLFB 4MHTA 2WP8J 1E58A 5IZCC 1XZJA 3PEEA 3VR2A 1G17A 2VPZA 3JQAB 1QIGA 1I4DD 2VAXA 3KNZA 1WZUA 4HX9A 3VOSA 3IVGA 5AKIA 1V37A 1PJLA 4ZU3A 2AKEA 1P33A 1BFDA 4LRXA 2PL5A 4N5LA 4P1ZA 3TD9A 3WLSA 1TQ2A 1GGHA 5JO9A 1KTIA 2WVJA 3GNTA 5AO9A 4FOTA 5E9QA 4X7BA 4GWGA 5IDYA 4GLJA 1PZHA 2O4UX 3L79A 3ZWCA 3KVYA 2IH4A 5KHAA 2ZQYA 4CDNA 5JAPA 3GRYA 1DZ3A 2HM7A 1LPAB 1RJWA 4HUJA 4AN4A 5EQTA 5KYYA 1CJMA 4R54A 1OLOA 2XR1A 3GRFA 4ER5A 5B1EA 1MCZA 3QK7A 2GFQA 4BEBA 3ZWYA 5CT9A 3KBBA 4KNVA 3A9RA 4UZEA 4B33A 4E09A 1FFEA 2P0AA 2E5FA 1DKOA 1JFRA 1FB5A 3KPJA 1KBOA 4BQSA 3QF4B 2YZ7A 3O91A 3GA7A 3RS0A 4GT1A 1DX9A 2PJRA 3EMDA 3WOVA 4YJGA 1Y9AA 3WV4A 1ZGHA 1IXYA 3DW3X 3SHFA 4KE8A 1U7ZA 1Z56C 2LZ0A 1PJQA 3G7SA 2H8KA 4IIVA 4OYLA 4FDUA 1PGPA 2XXJA 4XIFA 2BFDA 3TNLA 1QZTA 3WK6A 2WTXA 4UU7A 4YP1A 1YS4A 1OZAA 4HYTA 3I5YA 3MCWA 2XB9A 4YVFA 2HRCA 3AM3A 1WMAA 2V58A 2QRVB 1TYEB 4QUBA 1RWOA 1SVIA 8ABPA 1MO6A 1U1CA 2NT3A 3CIFA 1L5QA 1NW4A 1B74A 2FRDC 2Z09A 1DWOA 3PD0A 4IWYA 2MT9A 4LV8B 3RWBA 1IY9A 4AWAA 5LNK6 1XLWA 4EHAA 3G2OA 1AQ6A 4PHGA 4L73A 3E9RA 3KQMA 2XOKD 1W4CA 3L0SA 3OCCA 4J0DA 3RBXA 2AG1A 1NLUA 4BKRA 5LSAA 1DQYA 5C5IA 4C0XA 4CCYB 3K0CA 2HO5A 2Y0PA 4UE6A 4HAYA 3OBBA 3I9MA 4IHAA 3ZDBA 4PC6A 2ZT8A 1SWWA 5DGXA 3VOTA 5KJCA 1XNRB 2E1PA 2IUEA 3LX5A 3WJ2A 2ECPA 5IAGA 3AR5A 1ZMBA 4BWGA 5JNRA 1K08A 1V0JA 3DBOB 2Q0HA 5K0CA 1L8LA 2GN8A 3AVYA 1GP2A 1ZN2A 3RSFA 2NXCA 1EAMA 4FYVA 2HBZA 4KCGA 5LU8A 2DXIA 3RQSA 2JGLA 3DE7X 3V48A 3R3JA 2CUTA 3IUQA 3F46A 1B8NA 4G8BA 1S89A 2IF2A 1IXRC 4FCVA 3R0XA 4QYIB 5HF6A 4L8WB 4Q1CA 4UUAA 4YCAA 1I36A 2W98A 1XOIA 3QA9A 4FOSA 4GLLA 3U13A 4MCJA 1I3CA 2I6FA 4MS4B 2AG0A 2D5BA 4OYRA 4ZMSA 2CLLB 3R44A 1N2ZA 2EDAA 5A62A 2I91A 3OE7D 4YPFA 1ESMA 1V16A 3VGPA 1SRRA 3VV3A 2AR9A 2VZ0A 3BIJA 1W34A 4CM9A 4EO9A 1I3MA 1Y9JA 2H0QA 4DY6A 4BJ1A 1PW7A 1FFGA 3WDMA 3WHPA 1UQTA 3ZCSA 3OWXA 4UU8A 5DNVA 5DO9A 4PQEA 1ZUNA 3NUZA 4DA4A 3HYNA 4JI4B 1QR2A 4C6HA 1KOJA 1R9GA 2HJWA 1BW9A 1FLVA 2X2FA 5JLJA 3RV3A 4M1QA 4B75A 4Q1DA 5DLYA 2VR1A 3EAQA 1R9JA 2J9RA 1MABA 4H15A 3SX0A 1IBKB 3N28A 2R9VA 1JB9A 4M1KA 4HGPA 1IOLA 1E5XA 4AS1A 1HT0A 3SHOA 5TJHA 2QNIA 3Q4GA 4Z99A 4QXMA 2HJGA 2O3TA 2N3ZA 3IPYA 3O75A 5DNEA 1ZRHA 2CVFA 2CKDA 3JQPA 3PSAA 2VKTA 4K6HA 2CXPA 1OAOC 2JLSA 4J03A 5A2QA 3ZJUA 1PNTA 1TF2A 4AAYA 3T3EA 3V4RA 4DYVA 1AGYA 4QQ8A 5LQDA 4MUBA 4C05A 1UT5A 4WNAA 5GIPE 1QK4A 1QXSA 2A35A 4DDKA 3GGPA 3IERA 5CCEA 4CLRA 4ONEA 4JJAA 2W71A 1LB1B 2JH9A 1UK9A 5AVOA 1XD2A 4ASUA 5BSTA 1YASA 1MIOB 3FAKA 3QKRB 4RMIA 3OIGA 3SM3A 2Y8EA 3GBSA 2C57A 3WL7A 2RGCA 2FAXA 1RHMA 2H4JA 2IZ6A 5ALTA 1UKYA 5FBKA 3A7DA 3I76A 3OT1B 4FQ8A 4PR3A 4YLGA 2FFRA 5JVDB 2W70A 2ZTLA 1MTZA 4RTNA 3GCXA 2J1LA 3U7HB 1LWNA 4MK4A 3AERB 3AEXA 2G5CA 1J7KA 5AWFC 4J1QA 5JD3A 5JZVA 4FW9A 5H68A 5HBRA 1Z5NA 1E8MA 2P6MA 1E5TA 3CLUD 3OA2A 3OMLA 4JOQA 3TLMA 2HRDA 1VHDA 1NN0A 2B8WA 2DQZA 5CVCA 3WRYC 3K71B 4GEKA 1AKYA 3OX1A 4GOMD 1RHKA 1J5XA 2R7LA 1QWOA 4JLBA 5AQEA 1M1ZA 2F3TA 4G37A 3V1YA 1S7CA 1VCNA 4LYDA 1DBQA 2NZXA 3RJ9A 4K0KB 4KEAA 4US2R 1DNPA 3QX7A 1C0KA 5CNMA 2XCIA 1LDGA 3O83A 3UJBA 1DARA 4N6OA 5IT9A 4H3HB 1NC3A 4I5IA 4KRFA 4P81A 1COWA 3JX9A 5CNIA 1F9AA 5AJVB 1QFJA 4EO7A 3AFGA 1K8ZB 3MRSA 4OXRA 2OHVA 1QIEA 1A4XA 4Q4LA 2FVYA 2QUAA 2WM9B 5GPBA 4MMXB 5JQWA 1L5KA 4OQXA 2RAUA 4Y2GA 2A3RA 2WTNA 2O14A 1P7PA 2ZUDA 1WNTA 2LCFA 1VZ3A 3FLBA 3GJRA 3P9KA 3ZWKA 1OD6A 1C30B 2FEPA 4D6YA 1SZPA 5FUQA 5KKAA 2EOAA 5ADUS 2GTHA 2Z2YA 1NTRA 1R74A 2VYFA 1ACJA 1TADA 1NUHA 1XGKA 3L0DA 2POQX 4LKRA 1R6DA 3UKJA 2R79A 3RK0A 3TW4A 3LQ4A 4YRGA 1MHPA 1SUFA 1YDEA 1AG9A 1ZUIA 3CUVA 1OY1A 5LMNB 4BLSA 1Q1EA 3U3KA 3EVDA 1RKBA 1VPVA 1E5DA 2JFFA 3BTUA 1YS2X 1JBKA 1R50A 1VPEA 4I7EA 3UO8B 2CYAA 4OYYA 2XNKA 3B85A 1NXQA 4KPFC 4C9BA 1CVLA 2P8JA 4TM8A 2ONJA 4CQLA 2CJFA 2MU1A 3BTOA 1JYFA 3UWOA 4OTZA 2C98A 3ENWA 1VJGA 3LT0A 3PQ2A 3TCKA 2HK9A 4F2WA 3E05A 4MVJE 2XMGA 2J7PA 5FF9A 2P78A 2WIDA 4HWRA 3TEMA 4IZ6A 3RAPR 2E0IA 3DC7A 3QYFA 3VYUB 1U0NA 3JARA 1DLJA 1ID1A 5LFAA 1RKVA 3OUUA 1TQ4A 3L4JA 3IP9A 4K46A 5IDWA 4K05A 1SELA 4G0XA 1P3Y1 2BFFA 4RVOA 5HKBA 4OATA 2XADA 1QDUA 2AMFA 2R6FA 1P39A 1XEXB 4HN4B 5TS2A 3BN3A 2C3PA 1NIPA 1J07A 1VC2A 1Y8RB 2TMYA 4LYFA 4BO1A 2CNLA 1NR5A 1JF8A 4YRKA 2QAJA 5DCWA 5KQPA 3WP0A 4J0GA 4M76B 2IOFK 4JBIA 2CVOA 3EXHB 2CHGA 1O97D 2PLAA 2ZSKA 3SZ3A 1K06A 4X5OA 5AXCA 3HVUA 3GJYA 3NOQA 4HADA 1W4BA 1Q1QA 4J0JA 4Z0PA 3WI7A 4IR7A 1NLZA 4PN7A 3P52A 4S1VA 3RS2A 3I04A 2PX2A 2W6ID 4DWVA 3Q9UA 4XJTA 5FULA 2H59A 3S55A 2G1UA 1UWLA 1SBIA 2Z6VA 3E03A 4TVBA 3SC2B 2DECA 5ADWA 5M7EA 1GL6A 1KIMA 1I30A 1TCCA 3G6WA 3VDMA 1PQYA 1WDWB 2EFGA 4OXKA 3UT5B 2BR4A 1L5YA 3LL4A 4GLFA 4RHFA 1Y8QA 4KP7A 1FDUA 3IUJA 2GJ8A 4RACA 2EX0A 3ETNA 3W6UA 1RNLA 1ZN7A 3CS3A 3ADDA 4ZDIA 4BFXA 4CVNA 3MT7A 3AI7A 1GWNA 1OMOA 1KSGA 4FGUA 3ZIUA 2VK8A 1K4KA 4LVNA 5FV4A 5CRIA 3FROA 1TUGA 1W5FA 1RBQA 4KVZA 5JADA 1T5DX 1RW4A 1KL7A 1JEQB 1R18A 1YAHA 1WM1A 3ICPA 3MBOA 4MAAA 1DKQA 5FL3A 2YWHA 4QDZA 2C7PA 4IXNA 2SKDA 2ZJBA 4UKDA 2A9RA 2AKAB 1P60A 1T4CA 3I23A 2ENUA 2Q3EA 3A4IA 1CR0A 2V6GA 5B3LA 1PNRA 3C7CB 4RXTA 1C8VB 1CERA 1E3MA 4GPD1 3SYLA 4CM9D 4CE6A 2P1ZA 4HWTA 4D9HA 1N7IA 2VI5A 2GBIA 2NO6A 2PXAA 3D54D 3IPXA 4Y9UA 3OPXA 1WY5A 5BSFA 4H7IA 1UANA 1JSXA 2BEVB 1UODA 2FSFA 4MUFA 4GL4A 4DR7B 1JLLB 3SZUA 4Y1RA 4B4UA 5E7QA 3WNDA 3CX7A 2BSXA 2EGHA 3DVSX 4GPIB 1YQUA 1M6HA 4A4DA 1TEVA 2EKQA 2P91A 2OV4A 4GL2A 4U6NA 1G5FA 3JYHA 3ZD6A 3OWOA 1VCHA 4B5LA 3LUCA 3NEJA 3B3JA 4M9XA 1Z4KA 4YRIA 2R8YA 2IEIA 3DEFA 4D3DA 4GKJB 4CDRA 4PNEA 2ZYHA 1UBUS 2TMKA 4Q00A 5EAIA 1YJBA 4BQPA 1NBEA 1D1TA 1AS2A 2ZSIA 1H0KA 1I0ZA 3DHYA 2EV9A 4ND7A 4R84A 4D9FA 3J80A 3G1UA 2JIQA 2Q6IA 3HDTA 4RQTA 3MUEA 4GZ5A 3TZCA 2J9ZB 1QNLA 3RARA 1SA0A 1YQWA 3KT3A 1YK1A 3F7OA 3BZUA 1UMCA 2A9OA 4OQQA 4MMYB 4LV6A 2VDWA 4EW3A 1ZNYA 3HSKA 3I9V6 1W9HA 2P5YA 2BTQA 3D6VA 3O95A 3QUBA 1GZUA 5AW6A 3FKSD 5JD6A 1K68A 1FPMA 1DWQA 5EN4A 6AT1A 4UTRA 3T1NA 1DT5A 2H07A 5T6BA 2DH6A 5L4LA 4GYKA 2ONZA 3DKKA 2HRRA 3UWMA 5JCOA 5FNVB 3ESDA 3EIWA 4IDDA 1SCUA 3I01M 4YA6A 1FUKA 5J5CA 3EA0A 1G291 2M1ZA 1OPXA 2EYQA 2IPLA 3VU1A 1X1BA 2OBYA 3OJFA 1YMVA 5EJAA 4RIEA 3V4SA 1JEQA 4TKVA 4RYLA 2DKNA 2WJWA 1DO0A 1YUNA 4HYQA 2RHGB 6NULA 1WPGA 1GA1A 2AX4A 1T5OA 4C1BA 1OASA 1TJ5A 2MSDB 2HF9A 3KYIB 2I4NA 1AX9A 1ORWA 3HXTA 3HJTA 4FZJA 4PYRA 2G40A 3E84A 2UUOA 3N05A 4BWYA 4L08A 3U19A 1CRQA 4OL9A 5BURA 1JQDA 5ALGA 1LLUA 4PGFA 4ZI3A 3O73A 1P6UA 2IXEA 5IYZA 4BATA 1ZU4A 1W30A 2O06A 3CR3C 1ECLA 1K9SA 1Z7YA 2BFCA 5EXSA 5HSGA 4OXYA 4BVBA 4J29A 3I2YX 2RHJA 3IQZA 3EGEA 1J0EA 3IQHX 3OCYA 4LDAA 3C1OA 2CMHA 5T6MA 5HIKA 4X6XA 2OEPA 3I9KA 3K1JA 1EINA 1PV2A 4IUBS 4PLZA 3THXB 3WL6A 1CSEE 2VTVA 5DI9A 1IM5A 2VHCA 1VBNA 4QYSA 1SKMA 5F1YA 3DTYA 5JS1A 1O8BA 5AP9A 5A4AA 2VNSA 4TS9A 3RIMA 3X2EA 3G59A 2PJDA 4QJBA 3KEOA 3DB1A 4KBGA 4YH1A 3D6UA 3CURA 4NV1A 1ZSVA 3UFXA 5KNBH 5CR9A 1Z2OX 3F6RA 4B3SB 2X23A 3PUIA 3QE0A 3ZJ4A 4D4IA 2LNDA 1GHTA 3BB1A 3WMEA 2REXB 2FOIA 4LCBA 4QTTB 4IM7A 3SAJA 4E6EA 2I66A 4B3GA 3RH0A 4QVIA 4KXUA 2Z2XA 1H4QA 1JDSA 1TAHA 3BS4A 3ECCA 5IARA 1JDZA 1C29B 2LTAA 1IZYA 3DYVA 3FYSA 4HAUA 4LZLA 1JTFA 2VXCA 3CHYA 3FNIA 3KTFA 4PC7A 2H2FA 4JP2A 5K2MA 1WB4A 3WBBA 1SHLA 2VXBA 3IEUA 5BMVB 4R1TA 3C1AA 2I87A 3JQ7B 4IRMA 4WKBA 2H0AA 5DHUA 1JZSA 5L7WA 4NU0A 3MQ4A 2BEJA 1O3YA 2R8XA 3EG5A 3LVBA 4HBGA 4DMLA 4JU8A 4GI3A 8OHMA 2NO4A 1VIDA 1VLLA 1OBCA 3AR6A 1CPYA 2Q3JA 5F3RA 3HXQA 1I2MA 2W4QA 2ZB3A 3BRQA 4FFDA 1X1SA 3B2EA 3DEHA 2FZ4A 3JQDA 1ZINA 1F12A 3E5RA 4HDSA 4ZAXA 4BNIA 6PFKA 5JMTA 4RZUA 4F12A 3EPRA 3GLQA 4G25A 2GCOA 4OF4A 4OBEA 2XUPA 4QDJA 4DCSA 1U8CB 5EUBA 4DT1A 3BMCB 2HUNA 1HE5A 5IBCA 4IHQA 2BT4A 5BQXA 1E7QA 1TEXA 5TMEA 4DMMA 1YR1A 3E9CA 1KYVA 3EXHA 3WAJA 2FH5B 2PWBA 3EOBI 2Y2UA 3OD1A 3OP1A 1BRMA 2RKWA 3AB8A 4A3SA 1AK2A 1W1IA 4IAOA 3DVLA 4XLLA 4XE5A 6CHYA 4CUKA 4OGFA 2QZZA 2QXUA 3KJZA 5IW8A 2XVAA 1V3QE 5E95A 4J4TA 5J9FA 1M0SA 3EWSA 1UPCA 4HQ6A 3DHNA 1V7ZA 2HWWA 4Z9AA 6GPBA 2I1WA 1PR0A 3QJYA 4JEMA 3SLKA 1H3FA 2GLUA 4FQ5A 4NCNA 2YYAA 4Q4DA 4XDGA 5FKJA 1XT6A 4E33A 3AETB 1KY2A 1X1EA 3FDFA 4Q7LA 2D5CA 4IIBA 4U7HA 5BWMA 5JNWA 2BM0A 5KQGA 3SI7A 5LQNA 3B70A 1T4GA 4P34A 4HF7A 4JI8B 5I7VA 1YBFA 1J0CA 3HN2A 3L7OA 5D6OA 3S68A 1QPGA 2BMAA 1VE9A 1Z47A 3ND9A 3IAAA 3AOEA 4BO2A 4YMVA 4ZDJA 5AHXA 3QYJA 4K8RB 4RX1A 2YBDA 1NUPA 2VAMA 2J48A 1L1RA 3H8SA 1UH5A 1I3KA 4CMJA 1JIJA 3F3MA 1EHIA 2QY6A 1T15A 2GK6A 3QI2A 4LISA 5THKA 4TYWA 2WUDA 4RDIA 4R3NA 2NGRA 3DDSA 2RGWA 1PEDA 1P9NA 4HI0E 4O33A 4A0HA 5JT1A 5KEIA 2IEDA 4RH0A 1ZMRA 4C88A 1NI4A 3H3JA 4YJ3B 1DJQA 1CJKC 2Q3MA 1HEYA 1OBHA 2R7MA 1GZ6A 3BFPA 1JHOA 1LDMA 3B78A 4Y8VA 3L46A 1BEUB 2FZLA 2JGDB 5I47A 3E1GA 5FNVF 5KVSA 4LF7B 1UBNA 2R68A 3FI9A 1RM3A 2BFPA 3FWHA 4X0EA 5CNKA 4YUZA 3GLIA 2PT9A 2RKBA 3D1LA 3PHCA 3I6IA 3UAWA 4OLJA 4W1QA 4NXMB 2R751 1BH2A 1FMTA 3M6IA 3KAQA 2QUZA 1GG5A 4CMIB 3EH1A 1G3QA 3FCSB 3PITA 2K87A 2PA0A 2G04A 3BFXA 3G5TA 1N6PA 4G2TA 4BMOB 1PYOA 1YONA 2PBFA 4C7XA 2J6IA 4K40A 1XZDA 3GAFA 1HYHA 1UUFA 3DXYA 4R4JA 1ACLA 1J8YF 4OHWA 3U3MA 4BNVA 4Q9JA 1VHQA 3SMVA 5FR1A 1T2UA 2ZAGA 1VLZA 1F48A 2EZ9A 3LC2O 5IKEA 2GMWA 1TTQB 2RDMA 2KSQA 4L6AA 3YASA 4CHGA 1RE0A 4TX1A 4YRZA 2W5UA 1EP2B 3M7IA 3IUPA 2IBMA 5K4GA 1W44A 5AKZA 2ZIZA 3MPUA 1S3IA 4LY3A 4LF9B 3BIWA 3OM9A 1QGUA 3DGFC 3KQUA 2QUHA 1L7MA 4X8LA 3HJNA 3NXSA 1GPAA 1TMGE 1X39A 3V6MA 2VJQA 1J8FA 2C0QA 3FTEA 1E1RD 4NULA 4Q9IA 1NZDA 4M0KA 5F64A 3PD1A 4CCWA 3O4GA 4KFUA 2V59A 5FOXA 5JPDA 1BFUA 2HA7A 1Z0ZA 3ZU5A 3P0EA 1UMBA 4MS1A 2VN8A 1KH2A 2EZ4A 2GBLC 4TLBA 3WLLA 1BN6A 3SDZA 2JBHA 2VYND 3PZBA 2CHVA 3RG2A 3L4KA 1T2AA 2JI7A 3SQOA 2MDTA 5FOTA 3VSCA 1SN7A 1QF7A 5B37A 5I7OA 1RFLA 4CKZA 4JR2A 3TL6A 4G01B 1R5NA 4B17A 2J3JA 4ACAA 2G5GX 5TQ2A 5JBIA 5JBNA 1TCVA 4OHPA 3IQFA 4EHJA 4MGHA 2C4VA 1RRFA 3K8OE 2G76A 4ZYXA 2O1SA 1QIDA 3ETCA 4FMCB 4A1FA 5HCUA 3N1UA 4I1IA 3CEJA 3PWKA 3TZKA 1XRSB 4JVNA 4UTVA 5AW9A 2ZE7A 1TU4A 3W5UA 1XD9A 2J32A 2X6QA 4JODA 3W6NA 4QGGA 3WYEA 1M72A 3PUWA 1YDHA 1HSOA 2AS0A 1F2VA 3BB4A 3GGDA 1KZ1A 4P7KA 5AKLA 3EZ9A 3WLKX 3RSLA 4A23A 1RXIA 1XDZA 4H18A 1AZSC 3ZDEA 4EHHA 1MG0A 2B8NA 1FJGB 1O6CA 2W48A 1F0KA 5IN4A 4XYBA 4G4SO 1G9XA 3LD9A 3WK4A 3L4BC 2A5JA 2B5OA 2I67A 3GGOA 3BKXA 4X9XA 3WGYA 5L51A 3CH7A 1GPLA 1SUPA 1X3LA 1GGEA 2FE4A 4YYZA 4LF4B 3GO4A 3INRA 2I2FA 4JLSA 5INTA 2JLRA 3LUFA 1H65A 4DNFA 5IS2A 4RHUA 3GQBB 2CNWD 2I1QA 2WK1A 4F06A 1I0IA 2X8JA 3KK0A 1ODTC 1QP0A 3EVGA 1HE8B 1XAGA 5D3QA 3CJQA 1JMVA 2RGRA 2FSPA 2GUGA 4OQFA 1P2GA 1T5SA 3A9SA 3OE1A 2AG8A 5FAXA 3BJIC 4IZIA 5TPWB 4BO8A 1LLDA 1ZRNA 4WNIA 3TL2A 1QOQB 1U7UA 2O1WA 2AOTA 1F2UA 5KOJB 2IITA 1J09A 1E1YA 3SNHA 2E89A 1WHSA 3ELBA 4HJRA 3IE1A 3PPYA 1UJCA 3A1WA 2BZ0A 3G0OA 3QF4A 4WDRA 2XQGA 1Y48E 3D6TB 3GEGA 4OSOA 1B3RA 2YMLA 3PT5A 4EENA 3IBGA 2SHKA 3EWIA 2C92A 2CHEA 4XWYA 3NQ41 1O87A 1U28A 3E9YA 1GUBA 1U02A 2OXFA 1K5PA 3ICQB 3T7AA 1GQRA 3H42B 4TRMA 3SC4A 5DTQA 3OJEA 2EBWA 4NBTA 4YRPA 3R09A 2BGJA 1P45A 1UDRA 2PX6A 3PTLA 4OHCA 4XYLA 2QRVA 1JE1A 3SZRA 3TM5A 2D54A 4QOGA 2HY7A 1PGOA 2MYUA 5B6PA 1HG1A 1Z0AA 3OF5A 3NKFA 3ZQKA 2QSJA 3TTSA 5I9TA 2G9ZA 2XIQA 5ESXA 4DF3A 1NW6A 2C2WA 3BD6A 2QA5A 1RJGA 5EIWA 2BYTA 4ILKA 4HXYA 3VC1A 4YV0A 2YFHA 3FPFA 3QU7A 1HM5A 2F1OA 3FYCA 4K03A 3W6PA 1JB1A 5JZBA 2FXVA 3UJDA 3HA2A 4E2YA 2HPZA 3ZGOA 3BEOA 9MHTA 1S8OA 2R0QC 2QLTA 2WT4A 1T10A 4WLUA 5KU1A 2IHNA 4MHOA 4OQ4A 1FNMA 4ZT2A 2VNAA 1N5MA 5K0LA 3L6DA 3CCBA 3FTCA 4FR0A 4INOA 1VGVA 5D85A 1FUEA 1CR2A 1YB6A 5DBEX 3KJFA 1D2RA 5EXPA 1AY0A 4J0HA 1B3BA 1ELOA 1M10A 1BTOA 1GNSA 4X3CA 5CTAA 3RHTA 4C01A 3NTUA 1CY4A 1XZLA 1V8OA 2O54A 1R6TA 1FA9A 1UXIA 2Q99A 3MA0A 4RZIA 5FWXA 1E8DA 2PBZA 3B1VA 3ABZA 4OHFA 2FR1A 3U7FB 5F51A 4HB2A 3H2GA 2GCPA 3KZMA 3LW7A 4RV4A 4F7WA 4ZI2A 3ELDA 2DLNA 5LQSA 4PXYA 4H4DA 1TU3A 3MG9A 3PUVA 3ZDFA 4NSNA 2ZWMA 4IQ0A 3TQOA 1Y3HA 1WCXA 4QBFA 4LYEA 3E5MA 4LG1A 1WBJB 3FYUA 4PHFA 4IDQA 4TSFD 1XWFA 3DAFA 1YDWA 3IVCA 2NXJA 1Z16A 3U1BA 3THWB 1Z4IA 4U0KA 3TLAA 4TQAA 2YUIA 4O4IB 2QD5A 4EYQA 1DTWB 1XE3A 4J4HA 2XQIA 1JEOA 2C78A 1AN0A 1FK8A 5H0IA 5JPIA 3FFTA 4Q7QA 1T8TA 4QHYA 3LHIA 3SEAA 1GKLA 3CE6A 3ZG6A 4A9AA 2DFKB 3NHWA 1GCIA 1OWNA 3JQRA 1JT9A 2CVPA 3FCAA 5K20A 5BN5B 5JTUA 3L8DA 4S2UA 4KH0A 1P61B 3BE5A 4L4XA 4M0MA 2OAEA 4WMLA 5GAJA 1UEXC 3BDVA 5K3FA 1RVDA 2VUHB 4F4JA 4P08A 3K0BA 4W5OA 1YVEI 4GMFA 3KOYA 2YIJA 4IIXA 4NBUA 4ALIA 2FG5A 1FUYB 2GM9A 4L4RA 1QUEA 1JIQA 1ZWKA 1J90A 3LCJA 2PUAA 2N42A 1JX6A 1KAHA 1OH8A 4ZO8A 3R7DA 2ZJYA 2GKSA 1WQ4A 2FR8A 2GNAA 1AF4A 3GVXA 1QMPA 3C3WA 5CNJA 1WUHS 1X86B 1K86A 1Z0KA 2CJWB 4GZMA 4P4LA 3G8BA 3L49A 5EIHA 2QTBA 5F5NA 1FS5A 4LWPA 5JY1A 1CZNA 1MZVA 2EJCA 1KY4A 1LDBA 1NW5A 3PDIA 2V3VA 3RYCA 1ZIDA 2APJA 2JIPA 2WFAA 3EDCA 1NW7A 3E9EA 5IK2D 2D5LA 1P91A 1WO8A 1IOWA 2ZATA 4YJFA 1G20E 5DM4A 5AK4A 5L53A 1U0SY 4LZOA 1TLLA 2E82A 4PX2A 1GZ5A 2G6BA 3HEAA 4L0DA 5KCZA 2NYAA 5CXQA 1AURA 1T35A 2ZUWA 3HCCA 4MS1B 4RC9A 1C9EA 2FMXA 1K97A 4XSHA 5D6NA 3TYXA 1MB9A 3GRZA 2P9BA 2UVQA 3PRJA 1YCFA 1CRWG 1B0ZA 1I94B 2I3GA 4JUBA 2FPWA 1JPNA 3C7KA 3D5TA 2H06A 2HR1A 1EBFA 4YRMA 1NBOA 1ZH2A 3WWPA 1IXKA 2DLCX 3HWWA 4RQBA 3TCXB 3EZ7A 3FCOA 4QXRA 4YO8A 2W90A 2Z8YA 1I1QB 1L2TA 3HFRA 4ZVQA 4DB2A 4ER7A 1HTBA 2OQ2A 2Q50A 1VJRA 2Y77A 1BX1A 3BJZA 3FWZA 3F5QA 3KQQA 4Z7JA 2QE7D 3H1BA 3FZGA 3IP3A 1P17A 4NK5A 2XYRA 2PUGA 2QP3A 1AE1A 4MAFA 2JIZA 3GUCA 4Z9FA 5CFQA 1DO8A 3AEKA 1JSRA 4MUNA 1X0VA 5ALJA 1QFMA 4HEA6 4HDNB 3TRHA 3G2HA 4FFNA 1NVVQ 4YLEA 1U9IC 2I1VB 1UPUA 4LX0A 4JGGA 2QX6A 1UPAA 1ZM2A 3DUWA 1NAIA 1XVTA 1LTQA 2D1FA 2F6RA 2OHJA 3A04A 1XDGA 1Z4OA 4N5DA 4QC2A 1DAOA 3ZU2A 4BFWA 4DIDA 4R1NA 2OXEA 2ZJAA 4S04A 1Q7TA 2SKCA 5H3CA 1TU0A 1W9MA 3WFJA 4GX0A 3IUMA 3LDAA 3KEMA 4FFMA 2CV2A 1BZYA 3UT6A 3VHXA 1OIWA 2AL7A 1ZXBA 3KE8A 4Z9XA 1GG9A 4DWOA 2J45A 3E7WA 4G0QA 1NM5A 2ZRNA 4RJLA 1RHUA 1PIWA 1VCOA 2JIDA 4HN2A 3ZHXA 1Y5IA 2C84A 3BTVA 4BNLA 1OXTA 4XIYA 1S6YA 1AXGA 2Q07A 3HCNA 3MGKA 5BNTA 1H1LA 2HHHB 2BIFA 2C99A 2C3YA 3VSDA 4IXDA 3IMKA 4BMXA 2DUUA 2HSGA 4F9GA 4KR3A 2PGDA 4OX9B 1KE1A 1DG3A 1VA5A 1I3NA 1XZQA 2A14A 4UAVA 2ZUTA 2PL1A 3TEJA 3W1EA 5HUQA 4RXUA 2XTAA 2ZM6B 1LJ8A 1AZWA 3U49A 4EHKA 4X61A 1II8B 4ZOLA 2B0JA 1Z6PA 1HEIA 3EE6A 5DHQA 1DVRA 2F8LA 2GZ2A 5E1MA 1SVKA 3ZE8A 1TJPB 2GD0A 2F43A 4ZYUA 5C1BA 1Z34A 2X1HA 3AFMA 3WNBA 4UOEA 2IIQA 1SUWA 3WLMA 5BN4A 1SB8A 1ST3A 1XZFA 2CCKA 2WAMA 3NVAA 1G9TA 4I8IA 3NC4A 3NT4A 2Q29A 1QLJA 3ASYA 3OF3A 3F67A 4GUDA 5L4SA 1U9ZA 5HZGA 3EVCA 1K0FA 3A9VA 4D8UA 4CEIB 4G8CA 4HEQA 4JR1A 3WSVA 2GPYA 2C7RA 4EMSA 5JAIA 3GGJA 3L5KA 1RRKA 4CKBB 3VVCA 3VPXA 2QD3A 4FS8A 3S2FA 4CL2A 4YTEA 2ZYSA 2GF9A 3THYB 1KGDA 3A36A 3DF7A 4ARVA 1N3IA 3IOCA 4FT2A 4DIBA 2J5XA 3DBLA 5KVQA 1GTG1 3CX8A 5ICEA 1DZIA 4W5WA 3OUZA 2XMZA 4FYXA 1FFWA 4ZT4A 5JRDS 4FVTA 3WQQA 3Q12A 4B76A 2VSYA 1SHZA 4L28A 5EEGA 1B0UA 4NFSA 5E0KB 4B74A 1E9RA 2LBPA 4U2EA 5T4BA 3O2NA 4H1UA 4YAOA 5A2GA 1I7SB 4ECEA 1YB1A 4LZAA 2BBWA 3PUYA 1QC5B 3C15C 3HEMA 1OBVA 3PX2A 3FYHA 5SZJA 1WV0A 1XR3A 4L07A 4KQ2A 4E14A 1KAMA 4OL0A 5FDFA 5K8IA 3AO0B 3H11A 4GPEA 1X2BA 4HH3C 3DFKA 3WYFA 1NU8A 4GM1A 4K26A 5JNUA 1N6RA 4A36A 1DSSG 2GJAA 1ZM9A 3JZFA 3R5SA 3I4CA 3X1YA 4EGQA 2UVDA 3THXA 1PEAA 4BCCA 4ZN6A 3C3KA 4IKEA 1U04A 1U2QA 1J39A 1X7DA 2R8ZA 1KPIA 4OMCA 1ODFA 3NETA 5JATA 1NYTA 3QPBA 1TE2A 2V3WA 1DI0A 5H9VA 4C08A 3N7UA 5LQCA 4BFZA 4I4IA 5BV1A 3PPXA 3VYRB 2H1HA 1YS1X 1G2OA 2CLCX 2HA0A 3IYLW 2MMGA 5C31A 1V5FA 3PGJA 4EHBA 5IDQA 3LCMA 1N4AA 5DCLA 1ZS9A 3FCUB 5BW6B 4IHJB 1YI0A 2DGDA 2GN1A 2BKVA 4NKRA 4B2IA 1DAMA 3WRWA 1A1VA 2XCOA 2HWYA 2J5BA 1VHLA 2IQ5A 1DQSA 1JIUA 2KLHA 3QMWA 1HMYA 2QR5A 1V95A 1IFXA 2NUPA 3H5AA 4BFSA 4EKYA 4BMCA 3DV0B 4DV2B 1XA3A 4LXTA 1BDMA 2R00A 5DSXA 3ZTWA 3GR6A 3HCOA 1C2YA 2IW1A 3IHKA 4L72A 3FVWA 1E62A 1O1YA 1GKKA 3FNHA 1VLHA 4R40A 4DG9A 2B20A 1XMOB 3B7PA 4DV3B 4H6PA 2AXQA 2HLNA 1EFHA 3WVNA 2HF2A 2JHFA 1N2BA 1OLSB 1JEDA 2VHZA 1SC1A 2QX7A 2AC4A 4RCYA 3RAJA 4A8TA 3OQ6A 1RYMA 1TEHA 3E9QA 4U5XA 3ZE1B 3JSXA 3E3AA 1FU7A 1D4OA 3OP4A 1LA2A 1NJ8A 3KYCB 2Z1MA 3A37A 4ZRDA 3ON5A 1YH3A 2DKOA 1VOTA 1C3XA 1M5TA 4CKXA 1LPSA 4DR4B 3NB0A 2PAFA 4Q6WA 1L5RA 2HRQA 2QMYA 2ZGVA 2JFGA 4G56A 2P2CA 3KB6A 1PR4A 3A1DA 2JGFA 3PXUA 3QF7A 3QLUA 1RAHA 3CZ4A 3M6UA 4RD3A 3AHIA 4J9UE 4JOBA 2A2ZA 1T8RA 2PQ6A 4ISCA 4RVNA 1R8YA 2GO1A 2BISA 3LY5A 5EZSA 3ZDRA 1RZ3A 3A06A 4B45A 4WDQA 5IXYA 2NVWA 4IH9A 1OZ0A 4X8MA 1ZM3A 1BOFA 4JT2A 5CA1B 3CZQA 2OCYC 2AX3A 1H9CA 4QNMA 3Q0TA 1V41E 2FB9A 5AJHA 3O8CA 5CYFA 5IHPA 5AHOA 1CDZA 4DTIA 1K7SN 1Q12A 1V8BA 3G8AA 4LY9A 2FW0A 5KSPA 3UMBA 1KJJA 1WDLA 5TE9A 3CLSD 3QVJA 4MYCA 2H5EA 1YZVA 3JQFC 4WE3A 3RHSA 3UXHA 4DR3B 1W36C 1KBQA 4Z4FA 4L0CA 2A0FA 4RSMA 1KAEA 4UCFA 3COPA 1DEAA 4WK2B 5TXGA 4BNYA 5K8TA 4C6TA 2VJKA 1QWSA 4JS0A 2R60A 2PIAA 4GNRA 3AEUA 2V7XA 2C31A 4N0QA 5ABPA 1E2PA 3JTEA 2CLEB 3C0KA 3TJRA 4MP3A 3CLTD 3U9LA 4ERNA 4UHCA 4FC7A 3VSBA 3MJ4A 2YZNA 5C8ZA 5C8DA 2R4UA 1Z9BA 1G5PA 3M3PA 3W9SA 1XRQA 3RUHA 2VG8A 3DL4A 3CEHA 1V39A 1Z0JA 2XMBA 1JDUA 3AJDA 3IKJA 2P9QA 2W8BA 1I2ZA 3FYUB 1OXMA 3GJSA 1XZMA 1FUUA 2HQOA 1KE2A 1QP4A 4QICA 1L5HB 4UM8B 3MHTA 1JEJA 1BN7A 1TLTA 2JGDA 2WUEA 3TZ6A 4E51A 2HREA 4E5UA 5G1PA 1KI2A 2OBLA 3NM6B 4NJMB 4RLFA 2CFOA 4LJLA 1RAIA 4IQ8A 3O4IA 3EGWA 1RP7A 2LW7A 1G6HA 4GGPA 3SYRA 1R5JA 2HNKA 4W6QA 4LRTB 1PTKA 3UK2A 3LNCA 1D1PA 3ZE9A 4KXNA 3D3WA 4W8HA 4ZIRB 4UU0A 3RIEA 2AMLA 1A96A 1CJSA 1WG8A 4BO4A 4L2IA 4CKYA 4ZCMA 2BY4A 4QYMA 4ZPXA 3VPFA 3R77A 2HIMA 4MKIA 3HL4A 1UBSB 3IBYA 1PFKA 1FX0B 2ZRIA 1WDTA 2OHOA 3K09C 3HDJA 4TKUB 3UB4A 5J63A 1IJFA 2JAXA 3E2PA 3I1FA 4FZVA 4QTUB 4H60A 2CHFA 2QVBA 3K5HA 1DCTA 4MKFA 3TRFA 3WFIA 1H94A 3EK2A 2I78A 2BEUB 3MT0A 3TMYA 4JJGA 5IXSA 3IEVA 2PRJA 4NZYA 4E30A 1BW9B 2FW6A 4YBRA 3M8KA 1N1DA 5THQA 3A6FA 4IW3B 4UU1A 2G9NA 2ZRKA 2XSZD 3ESCA 3L8ZA 1NKSA 2Q0QA 3EY9A 2O2GA 3DZIA 3GOHA 1H8ED 3VI3B 2ZSFA 1LVGA 4M46A 1NVUQ 1JTEA 3Q8KA 1IN1A 3GZNB 2OAGA 3D02A 3JQGB 1D1SA 1XZPA 4A15A 1GOTA 4FT4A 4XYEA 4FEAA 1SUBA 5KJEA 1RU3A 5F9FA 5B3AA 4P38A 1XRRA 4KG7A 5AKXA 4TTJA 4IMRA 1K2VN 3D81A 3V7UA 1USWA 4UFPA 2JFWA 4Q9LA 1ZM4A 1JU4A 3MJVA 3ZV5A 3ROMA 2PG3A 5BQ3A 1IRIA 4U8HA 1NNI1 1P29A 2RBGA 3L6UA 5LQJA 2OO5C 2Q2QA 1JIVA 3K9HA 5F4ZA 4DNOA 1O94C 3BX1A 3VSEA 4BO0A 4EWLA 1RQLA 3JWJA 3OHPA 4M38A 4O2AB 1KMCA 1ZVVA 1IY8A 2CHUA 4RSGA 2O3QA 3M4YA 2YOHA 2WZDA 3UXEA 1YJ8A 1ZGAA 2WW8A 4WBSA 4ENRA 1BQEA 5C34B 1ZD4A 4MQ4A 1T43A 3QU2A 3SHTA 3G2NA 1Z6YA 3W2TA 1K7CA 3HB9A 4NESA 5HZKA 2HBQA 4B32A 2Z57A 4LF5B 1FNSA 1H2EA 3GCZA 2PX3A 5IKOA 3G0BA 4KNWA 1ZJWA 3L6EA 3TUIC 4RPGA 5SY6A 5CB4B 3SXUA 4HK4A 2P2DA 4WIAA 1NFFA 4R2XA 2VT6A 3LCRA 4FKBA 4HEJA 3GUUA 4EL5A 4G1CA 4MQFA 2EXXA 1VSVA 3TOVA 3UJHA 4BVHA 4B8ZA 2WIJA 4B81A 5EWJB 4TL8A 1A8UA 3GJ7A 4MB2A 4MKXA 1H2HA 5EUQB 4TTQA 3V8PA 4LYHA 1NP7A 3HRKA 4ROTA 3T3HA 3I5UA 4YWJA 3LC7O 5JXIA 2ZXUA 2BRUC 1CF4A 1G5TA 1V48A 2IOFA 3MJRA 5BN4B 4YRNA 1IZ7A 1DCMA 3WMFA 4BNNA 1YB2A 4EECA 1JEYB 2R7AA 4GWKA 1YDGA 2I4RA 3EB9A 4W7IA 4LV5B 3AIKA 1A2BA 2RJNA 4R01A 4R6XA 1ZR2A 3Q7EA 4H2DA 3REFA 3N5CA 2HPHA 5IHXA 2Y92A 5HCIA 1OWPA 4ZVRA 1LPMA 1Z18A 2VCHA 4DCOA 1ARZA 2R5WA 3P9RA 1P8AA 3QUCA 4QEDA 4W5TA 3SVLA 1VYVA 4ZVPA 3SQLA 2J3QA 2FFJA 3KR9A 3SKYA 4XSGA 4AICA 3ZDZB 1AXRA 4ARCA 2AI1A 3HYRA 2B1QA 2XRFA 4TUYF 3VYVA 5HK9A 1XJ0A 3GLTA 4W9NA 5CB4A 3HJFA 4W4TA 1S8NA 2PO7A 3U61B 2X58A 1ML4A 5EJ2A 4AM8A 1T6XA 2JEZA 2C3MA 4X41A 3S5JA 3R3YA 2OQVA 1NU6A 1XEWX 2H1IA 1B16A 1WF6A 2DWQA 1J0AA 4HTFA 2HO4A 3I4FA 3T9CA 1JAYA 4R68A 1F2UB 3R0JA 4BZZA 3VR4A 5KOJA 1Q6YA 2OAQ1 4H6XA 1LI7A 4YCLA 1ADJA 1V4VA 1HMPA 2AWNA 5FQOA 1BROA 3WLQA 4EYEA 2OCKA 4WLOA 3WL3A 3U4GA 3UBTA 1RPJA 4PSDA 4PFSA 2ID7A 1KO8A 2ADMA 1RLUA 5A9SA 1KK0A 4GHWA 2H2WA 3IVAA 4IEFB 1WSDA 3JQQA 1H4VB 3DT9A 3ITKA 2QRKA 3NX4A 2GAFA 2REQA 4KQKA 5EY5B 2PNJA 2C04A 1QIJA 3CY6A 5E6UB 3Q3VA 1LK7A 5AIBA 1UDXA 4DCTA 1TIPA 1TFUA 2VQDA 4X92A 2IIVA 1IYZA 1XXLA 2WM3A 2ZP1A 3ISVA 4P80A 4D9MA 4DANA 4YRSA 2AQ8A 4IIFA 2WVHA 4ZJUA 1H1TA 1YBAA 1W581 2QY9A 1ZLYA 3DJFA 4CT0A 1I51A 4CWAA 2O8EB 2JZOA 4OJKA 2A5DA 4J2HA 4IVPA 2D06A 4UBIA 2UYQA 2QLJA 2QQEA 3SJBA 1EE1A 1NMQA 2I55A 3GJQA 2N0SA 1JP7A 3OAAD 3KWMA 1NXTA 2I2BA 3K6SA 2RAVA 2GT1A 2YV1A 4LXUA 4M98A 1CRLA 4DWWA 5JSHA 4I2VA 1K89A 4RF2A 2Q28A 4BB9A 1U8ZA 1UMDA 1E79A 1US8A 5C46F 4G5FA 1H8HD 2R3SA 1EA5A 1H66A 4RKEA 3MAJA 4OI2A 4WCDA 3LPMA 3T9DA 3D4BA 3Q7PA 3RHZA 4E46A 3HBJA 3CG4A 1E9FA 1NVVR 2W7TA 2XE7A 2JJ2D 4G65A 4J1TC 2G4LA 5HJ5A 3LGSA 2OV3A 3K70D 3AVXA 4NLLA 3ZVMA 5EWLA 1JHAA 3MS4A 3W7VA 5BP7A 3ZD7A 1WXGA 5BR1A 2Q5LA 4RHEA 2DX7A 4CDGA 1FNCA 1NG1A 5EXTA 2XUZA 2P2ZA 4L0QA 2LKDA 2O2HA 2I2WA 2VJNA 5B7PA 1DDOA 3H19A 3OKPA 4EY8A 1KAGA 3IURA 1Z2PX 2I2AA 4NJMA 4DM4A 1W2GA 1W6UA 2QQ5A 5KYWA 3LWBA 4BBJA 3DO5A 1R66A 1R3UA 4TMVA 1WB5A 4D4HA 2HYIC 3AVPA 5JZSA 4H4CA 3RM3A 5EJMA 3COYA 4Y2JA 3AEKB 1KMQA 2O3UA 3FG9A 4QDXA 4AROA 2J4DA 2AWOA 3VKFA 3S29A 1M34E 2BFBA 2PLWA 1P0CA 4AUNA 3NHZA 3WKEA 3B53X 3OQIA 2Z5FA 1A3CA 4I50A 3JRNA 1KJ8A 2OGUA 4L1KA 2KHZA 4PPYA 3FSJX 3A6DA 3VH2A 3WIEA 5I8PA 1N34B 4NU6A 4QQFA 1LBQA 1CQXA 2IEZA 4O08A 5BWOA 4QAQA 1E1LA 1I4EB 2X15A 4PX9A 1J56A 4MWZA 4I1PA 4U2GA 4B85A 2BBSA 1AKQA 1WMSA 2JD1A 3UUFA 3EVFA 4KXLA 1H9BA 1ZPDA 2VAPA 2VP2A 1TM7E 1DX6A 1LRKA 1ULSA 3T5DA 4DJFC 2A5YB 5EXXA 2OCAA 2VJMA 5B4TA 3GI1A 2DUJA 3P9CA 1WSWA 3FVQA 2FP4B 1NRXA 1Z73A 3UT5A 3WP1B 5M29A 1M2GA 4N0MA 4US1R 5HFNA 4Z86A 2P9EA 1KDZA 4CM7A 3TE6A 1Q74A 4IEEA 2QTFA 3R7WB 3MUNA 3P0IA 3UEOA 4KRXA 2J7PD 3GLGE 3D4NA 1HC7A 3UMRA 3WNCA 3KQKA 3MS2A 1WVMA 3T7EA 5A4KA 4ZEVA 5DNYB 2QN8A 5JWRA 4CNBA 3T7CA 2ZLBA 3L2OB 3C6BA 2ZIUB 1KK3A 4WXHA 1KYXA 1JR3E 2JK0A 3DNFA 4MQEA 4GF5A 3K5WA 3FPGA 2ZAOA 3KLOA 3K16A 4R5MA 2MINB 1K6EA 4D8YA 1WUTA 1K6IA 2CE2X 4DY4A 1L5FA 3VX3A 3K0AA 3KHSA 1X9HA 3LLCA 4HNAB 3V6LA 5ERGB 1TDJA 3HNPA 4CPDA 2OLKA 1TQHA 1W5AA 2VCYA 1YDFA 3PYLA 5G0TA 2E21A 2GFHA 2ZRFA 5HS6A 3RVKA 4F3TA 1XLTC 2WTEA 5BRNA 4LMAA 1QHHB 3EGXB 1UBGA 2YXPX 3L07A 1GSOA 1EFTA 4ENTA 1U65A 4XI9A 1VKNA 1SPXA 1W59A 1YA4A 1XPOA 4E08A 1R64A 1IEWA 3PR2B 2EJTA 3A0UA 5KQSA 4TTIA 3A8TA 1MB2A 4IX9A 2RI6A 2GFIA 1DXYA 4EUHA 4LZPA 2OAP1 5HOEA 3D8UA 2QRGA 4P4UA 4WAUA 4KR7A 2QRQA 1OXUA 1R4MA 2J0VA 2QZPA 3GT4A 5A6SB 3LBIA 4BJ6A 3AR2A 1GA4A 1ODKA 2RHOA 3A3OA 1PLJA 5EJ7A 2O19A 1WNFA 5DF1A 4F9TA 3DZKA 2C07A 4RMJA 3M0EA 6LDHA 1CE8B 3KXPA 2DC1A 4OAQA 3K4HA 5COQA 2W6MA 3IPRA 4FBGA 4XB1A 3W5JA 3EPJA 3ERCA 1NN3A 2GBGA 4JNKA 3IAM6 3R3UA 1BOOA 1XTQA 1Z62A 2FLKA 2R1VB 1DG9A 2GRJA 4M54A 5AVVA 2XAUA 4E07A 5I3ZA 4XQEA 1UC8A 3QLUC 3KJQA 3ROPA 3E8MA 1GRCA 3ND5A 4N40A 3L06A 1OWMA 1YZGA 2PRIA 4W9MC 2CUKA 2A92A 4MW1A 2AFVA 4UTNA 5B3JA 1QVRA 1OYVA 1V1RA 3TI7A 1IQ0A 1N75A 4Q34A 2OQIA 4WOJA 4UOQA 4CT4B 2BHNA 2R8RA 3DTVA 4E2WA 4LNAA 1MOSA 3RC2A 1CR4A 4L57A 4KKXB 2X6TA 3HMQA 3W5HA 4IJUA 4ENQA 4KE7A 1Z17A 2QL7A 5KYNA 4AQYB 1QHSA 1RZUA 3M89A 2CDAA 4HNSA 1D09A 1UQUA 2YRFA 1SKYB 4X97A 1D0SA 1JLSA 3ASZA 2JRCA 3ACBA 1JKMA 3I39X 3KR0A 3NYWA 4KB5A 4PG6A 3R74A 3UAYA 2IDJA 3BSYA 4F4UA 1E0KA 3BFKA 5JC1A 4OI4A 3S8YA 1YJAA 3PNLA 2WFZA 4BZQA 4BLTA 2ZS9A 1KU6A 4BQFA 5ICCA 2WKWA 3G9XA 2JI4A 3TEFA 3E27A 1Z3CA 4MVYA 5EWJA 2JJ8A 5EJ9A 3OJLA 3OLXA 3G0GA 1JSLA 4K9MA 4WTOA 4EK9A 1ONOA 4NBKA 2WJJA 3R3WA 5TGDA 1MF7A 4IYJA 3H1PA 4ARSA 2IWHA 3GAMA 1KI6B 2B34A 2A67A 4URVR 1E2QA 2VUIB 3FKSA 1ONSA 5K51A 1N5KA 3MLAA 2HU8A 4U9HS 3DMTA 2DTDA 1XNGA 3AJAA 3F5FA 2O3RA 3EZGA 2X14A 3I12A 4KQ6A 4XR9A 3WK5A 1F5SA 1G16A 5F98A 4KAJA 2JDID 2V7WA 2F1HA 3EIQA 1ZOIA 4BX0A 3GPDG 3W5VA 4RKWA 4R0NA 2E4XA 2AOTB 2FCRA 3UGKA 1MV5A 3R7AA 4CTOA 1DUSA 3Q9SA 4E21A 5LCXA 3N0WA 2VUUA 3AOGA 1U1IA 2ZWIA 5ALZA 3TKLA 4E2ZA 4FWIB 1JQEA 1KU0A 2G1PA 3CE9A 3W8DA 1VKJA 4XTRA 1Q0LA 4N6NA 3MB8A 8LDHA 3ZKWB 4F92B 3L0PA 1O97C 3PQ8A 2IU0A 1ZN9A 3NHBA 3UC5A 1XZEA 4D97A 2ZTUA 1G3RA 1XZHA 4PC3A 1N2JA 1W46A 1QFXA 3C8UA 4JLMA 5C1IA 1L3BA 2XUAA 4AO6A 3BMCA 1Y98A 2I6GA 2OTCA 1ULUA 2VDPB 3IP7A 3A6PC 2WA1A 1Z7WA 3PGLA 3IDAA 3DV9A 3GMTA 1H0SA 2WUVA 3KHUA 5HKKA 3DEIA 2ZVQX 2H9YA 4IUDS 3CUWA 3PCXA 5EINA 1M1NA 2GA8A 4IVQA 1C1XB 3FPSA 1XJCA 3QYPA 4UD2A 2H2IA 1WF3A 4EJFA 5CIWA 5AJUA 5ARDA 1A5SB 5JEEA 2I0FA 4AXBA 3H0CA 4OQPA 5CB4F 3AHJA 2Q2OA 3T99A 3WB1A 1UZAA 3K9LA 3QHAA 3KPVA 4QFBA 4QIHA 2I7CA 4YJ3F 2GHIA 4ICIA 3I5XA 2IY8A 3Q2OA 3HADA 1N2SA 1JWLA 2X8LA 3M5DA 3N9IA 3GAZA 5KJ6A 1QZZA 5J2TA 3OIFA 4PVCA 1ABBA 2YWGA 2O2EA 5IC4A 1X6VA 1FEZA 2HD4A 1R6VA 2L82A 4U7WA 1EWKA 3F3KA 1CFZA 4WXMA 3ZD8A 4RNDB 2ZEJA 4MR8B 4XD7D 4KOEC 2XDQB 2AMVA 2Z3VA 4YMWA 1ZVQA 1L5SA 4C2UA 3ZJTA 4GM0A 2F1KA 3UENA 3F6EX 3GF4A 4NS4A 3H1EA 3IRUA 4IMPA 4ALKA 4BVKA 4X95A 4KRGA 2B8TA 1C2TA 1PUIA 2VPTA 1P7WA 3BILA 3UQZA 4BFVA 5CFLA 2P4EA 4BZPA 1BHQ1 4EY7A 4Y2YA 1C0EA 1CX9B 2GD1O 2PKCA 1NLMA 4L3VA 5IFKA 2HL6A 3SYMA 3ER9A 3G0HA 3PQCA 4YXWD 2WICA 1E69A 2ORWA 3EGOA 3BQMB 4G1EB 3AEZA 4G4IA 4JJKA 3S2ZA 1CUZA 1D07A 3W34A 4ZVSA 4CMIA 4LIPD 5FX2A 1N9KA 1Q0HA 1PZGA 3AINA 3DJYA 3HGTA 3H97A 3MS7A 4ND6A 5C8YA 1LC0A 5FWYA 3KR2A 3QVGB 5HKOA 5LKRA 4EOGA 1OPRA 4QQNA 5JJKA 1I13A 3KWJA 2WYWA 3CVVA 2H4ZA 4I3GA 2LKCA 3IMGA 4FTWA 4NABA 3ZVRA 3TBKA 2ZB4A 2OQRA 1R5BA 1Z5PA 1UMDB 1US8B 3MIIA 4WH0A 4G5YA 4ZGWA 1Y1RA 4XX1A 4PQYA 1JXQA 4KR9A 4C6TB 4EEZA 1E8NA 1PK8A 5TQ0A 4KWTA 5TJ9A 4G3XA 4NONA 5D3KA 3O3CA 1TO2E 3BB3A 3R7LA 2OG1A 3LE8A 1E66A 5J2TF 5K3FB 1ND6A 1E9SA 1KI8A 2VNKA 3IEKA 5FWAA 3WNZA 2R6JA 2XDQA 4AJ2A 4YV1A 1GPUA 1Q15A 1F4PA 2PXXA 4HYYA 1UBHS 4TQUS 3RB8A 4LBZA 4TV8A 5HQ3A 5FTWA 2QKYA 4MV3A 3WKDA 1E3QA 2E7ZA 3DOHA 3RSQA 4G9GA 1W8DA 2Z3ZA 2FY8A 3QFTA 3TPZA 4MQFB 4FS3A 5JZOA 1G6KA 2HHLA 1SEVA 2ZRCA 1B42A 3OC6A 3DCIA 4YAKA 2JHPA 4NK4A 5HFJA 3IAS1 4FFPA 2DT5A 1XHEA 1NN5A 1K6MA 3HNOA 3RS3A 3AVWA 3AEUB 1QRSA 4ZU6X 3TTYA 3L7CA 3X1XA 3P0HA 1ZIXA 3PC3A 3ANTA 3NEYA 3C14C 3PP8A 4RD4A 5DTMA 4D9EA 4IIJB 5J4YA 3O8RA 3ODGA 2VDQB 2YVQA 2ZJ8A 2YVKA 3GVHA 2GZHA 1U63A 4UEQA 2ID4A 4WUTA 5T67A 3GFFA 3WADA 4D6XA 2SBTA 1CNEA 3MOSA 1YULA 2XA1A 4PSUA 1BWSA 1LX7A 1ZUD1 3HBAA 1NRJB 4DCMA 2DB3A 1GR0A 4AMBA 3AR4A 4OJQA 1RP1A 2G07A 3A25A 2BFEA 3HDYA 3QMPA 3G9UA 2B4RO 3PPWA 4RM3A 5FTLA 2JB9A 4MV8A 3GGCA 4AN0A 5HF5A 1Z8HA 1H1DA 3OY7A 5EOVA 2EIXA 3CUKA 1ZEJA 4R71A 2QX8A 2ONYA 4OSEA 3RYTC 2NUPB 4RPKA 4LUCA 1AM4D 2C2ZA 1YVRA 2IUTA 1OLXA 5KQRA 5AI0A 1XTTA 1PUXA 4MDEA 2E49A 5CA1F 3QI7A 1PJCA 2E4AA 3CX3A 2WUGA 4DUPA 3Q41A 2X76A 2XWJI 2Q3BA 2A30A 2O9JA 2VHVA 1NV9A 3NKLA 4ND3A 4EJSB 4TN1A 3ABQB 4D8XA 1J22A 3CJTA 3FOBA 1GM5A 3SC3A 1FP4B 1VRCA 1K3UB 3GEDA 1PQUA 2HQSA 3PRKE 3IBSA 1V7CA 3BAFA 1I5OA 2PO5A 4KWEA 2BF7A 4JL5A 1NDHA 3B9BA 3RG8A 1YOBA 3TIGA 1OB2A 3DQZA 2X1MA 3HSYA 2QD1A 3DMPA 1BMTA 3VR3D 2IHKA 3IAS6 1JILA 4BDTA 1QORA 3EQZA 2NU9A 4Q19A 1SKAA 1F0NA 2EERA 2FSUA 5LB4A 2BFEB 3BE6A 3CRNA 3ETJA 4KGVA 3DBRB 3C3YA 3GH1A 1DV1A 4AQ7A 2W4IA 1W87A 3OZDA 2PFSA 5DYGA 1UOQA 1J0DA 4TKZA 1NV8A 1Z6TA 3E2IA 3AM5A 4XFDA 3UOWA 1L7DA 5CHEA 3ELYA 3KTAA 5IH7A 3UMFA 1Q14A 4L27A 4BMNA 3C97A 2VPIA 3MFYA 2N1MA 5ICSA 2E85A 3ZKAA 3HUUA 2HH9A 1R4NA 1WX1A 3R5FA 2VL7A 3BPSA 2NVBA 4UMEA 4AC9A 5C9ZA 4B3RB 4OO3A 5IUKC 1U2DA 1R1DA 4FUQA 4BRZA 4X94A 1F38A 2EQ5A 2QTTA 1Z0IA 2NQTA 1SCNE 1QNFA 1SULA 2BUAA 2FSVC 1TKCA 2OVFA 3BDIA 3MWDA 4KPUA 2OV2A 2GJKA 4BP3A 5IU6A 1UC4B 2Q2WA 1O94D 1FRNA 3JZIA 3MXTA 2YJNA 4YMIA 1M2EA 1HXHA 3ZK7A 5DCYA 5L3QA 2G0TA 1ISMA 2JLBA 1PRYA 3SZMA 4ZGGA 2QMHA 5JFTA 3CVXA 3PUHA 1OI3A 4NJEB 1NUQA 4WCFA 1V45E 4O2LA 2DTXA 5DCUA 5KTKA 3HACA 4IFEA 3U31A 1HORA 2WHQA 3MJCA 5I7SA 1ISRA 5LXTA 3H6KA 3CLHA 4RFLA 4YCSA 1PT5A 2VXOA 1BJRE 4O5AA 4UTXA 3K31A 4EW2A 2ZBEA 2OR3A 3LAWA 1MB4A 4O8CA 1SVUA 3GLRA 1BKSB 4HCJA 1BQ3A 1LDEA 5U4QA 4M1MA 3W5AA 2V5UA 2OORA 2Y1LA 2AN3A 2GWHA 1EFAA 2BR3A 5FTJA 4DYHA 2HCFA 1GQYA 5C4GB 4YFYA 1OE0A 2D1SA 2HMWA 1Q84A 4P0PB 4E7OA 2IU6A 4DPLA 1HUQA 3SZOA 1FXWF 1EM8A 4H7KA 2O05A 2YHIA 4PSKA 3CIOA 3GG9A 2QZSA 1O89A 2VK1A 3OT1A 3TTVA 5C7LO 4P82A 3RK4A 3VHXB 1H6BA 1O8CA 3FNQA 3NEAA 3Q0IA 1W85B 1O08A 3JWHA 2SICE 3HO8A 5D86A 2IV7A 1DRWA 1MEEA 2GXAA 1E7RA 4M53A 1BNCA 3LKBA 5LYJB 4PFQA 5H9WA 3QTBA 1UKCA 3JRWA 1M1YB 3BZWA 3M1AA 3NH6A 4J16C 3PXGA 5J43A 1RPTA 1DCKA 4MEBA 3L1JA 4IKOA 1XU9A 5DGDA 3C85A 3D43A 5JDCC 1SOAA 3R7SA 3ADCA 2RGXA 3L7AA 5LDDC 1XNHA 2LR0A 2QSUA 1C9MA 1RQ7A 3OOYA 2FWIA 4TLDA 5HCNA 3RHFA 2PKYX 2LD4A 3BIOA 4I9UA 4DCJA 1I2AA 1O7JA 4GLOA 1V7PC 4N5HX 2DETA 3WGVA 1ADBA 3ECSA 5SY4A 1ISFA 4EB6B 5JAMA 1CR1A 3ZC3A 1HNZB 1AOXA 1FDIA 1E2FA 1ZRSA 4ZCPA 1ATIA 3IODA 2PZEA 1GQSA 3VYWA 4KLZA 1KYQA 1ZJ4A 2YNMA 5CFZA 4AMGA 1PZMA 1EM6A 3NASA 3M34A 1EIWA 4DZTA 1JKXA 3TIIA 2A5LA 2ISSD 4FNAA 4MPJA 1U11A 2VTKA 3BH6A 3O82A 5EZQA 4PC2A 1T8WA 1IWOA 4HD8A 5AVKA 4X7RA 3QJGA 1U9CA 4NJEA 2RG7A 2QU7A 2OZLB 1NR7A 5B6JA 3TXXA 4HSGA 5ALRA 3HPRA 1SKBA 2PZMA 3O4FA 3A10A 3SBOA 5D3MA 3LIIA 4L22A 1PR9A 1T4CB 3C98A 1Y1LA 2OE2A 3LQKA 5EIBC 4OHZA 2IS2A 2KWIA 4MV5A 3PLRA 1GLVA 3RT9A 4OX9Y 3WQSB 3IS3A 5B6IA 5T8KA 2DR0A 1GTSA 4KFTA 2AYYA 2DPHA 3RYCB 2WABA 3S2SA 3W5DA 4JB0A 4NV3A 4OHOA 1XIVA 1WJGA 2HA3A 3KOMA 2Q1WA 1YRAA 2PUFA 4FI3F 2CL5A 4NPAA 2ZRHA 3ZJYA 4TV8F 2O0KA 3CZRA 3ADKA 3CB4A 3W8EA 1TA4A 2C1XA 2I8AA 1B1AA 5IJ9A 2O5EA 5ICGA 3PGVA 3FE2A 4EBBA 2C9MA 4BUJA 1RI3A 4YK7A 1SZJG 3E8SA 3O2JA 4IJ5A 4XSVA 3DOFA 2XOEA 4FB5A 2WU1A 2IODA 5GINE 1G2PA 3K96A 5IF3A 2JLCA 3SR4A 5DU2A 4AP6A 3K6RA 1XQ9A 4B48A 1NJ1A 2UZ1B 5ITVA 2BDTA 4U2DA 4CQMD 4RY2A 2NO5A 2JAOA 2VHWA 3HWRA 4GUAA 2Z2IA 1TRHA 4EG3A 2OK8A 1OFGA 2CLMB 2W6OA 2MJLA 3O38A 1YZHA 1L0BA 3WLIA 2HDNB 4X8HA 1J2UA 1F0YA 1UK6A 1DJPA 1BWRA 1U7OA 2JD0A 4C21A 1AMNA 3FDXA 5A02A 1HE3A 4Y9SA 4Q9DA 1AHNA 4YP9A 3T3OA 2OCXA 4UHKA 2DBZA 5LMCA 5NULA 3NHKA 4WPGA 3U56A 5JXJA 2Q4BA 2OM2A 4XOUA 4ZARA 4PG7A 1LDYA 3A9TA 1MABB 2OBFA 1YAJA 2PZAA 3RFCA 1X1DA 4CETA 1GAXA 3ROEA 3D7RA 3X44A 3STXA 1IIBA 2X5KO 3JVVA 4C7VA 2GD2A 1GVNB 2H1WA 3L04A 4P0TA 5EQDA 3GEBA 4DQVA 4QTXA 1L7OA 1GN8A 1BMDA 1A1SA 1VLVA 2AH5A 4QDKA 3CZAA 2A5FA 1OI4A 2P79A 3TJZA 1T24A 1MJHA 4UUMA 1WDMA 4ZV4A 3IIMA 4RGVA 2OHHA 3NBMA 4W82A 4QPJC 2XUHA 1FSZA 3QEMA 4V0NA 1IEVA 1YZQA 1PHPA 2R8PA 2C7VA 4JEHA 5TQVA 3GPIA 3QZUA 4CZ2A 2FF5A 5JV5A 1Y4ZA 2QZ9A 1GRVA 4DTCA 2BGWA 4JLVA 3T4XA 1CTQA 3KV3O 1EUQA 3AVQA 5LP6A 2NU6A 2NTYC 4QOJA 2Z8YM 1HOTA 1BX3A 1JJ7A 1P1KA 1R5OA 4MA5A 2Y0CA 3RC8A 1NMXA 1E1KA 2HV8A 3OPNA 5CYPA 3MC1A 3IR7A 1XA4A 5H7XA 3RIGA 1MC8A 5JH7A 5AT1A 3TVDA 1KNQA 3A2MA 3B1KA 5ALQA 3TOZA 1UFKA 1WSAA 1TT5A 3D6HA 4YUVA 4TN5A 5FHRA 1U5AA 4W99A 4DOMA 4TTRA 2VP3A 3ZV3A 3TTWA 1QTQA 3NRBA 1MKYA 1E6MA 4RL4A 3JAMA 2ZDQA 1CFJA 3U5ZB 4M37A 3LV8A 5FOWA 1O77A 4RETA 1EWYA 4GR9A 5AJXA 1EDOA 5IKMA 1WEKA 3B1FA 1C0LA 1B6RA 5EMHA 2C58A 2MSCB 3DCYA 3SXJA 4IO0A 5JEDA 1GYQA 3I52A 1B76A 1L5VA 2O2JA 3O1IC 1RQXA 2ODPA 3ZK9A 4B7XA 4K2HA 3KCNA 4QT0A 4FN4A 1NRIA 1F06A 1ISHA 2WPDA 4Y2SA 4YJ3A 4CW7A 4F6RB 1FJ2A 1GZ3A 5F7OA 1TL7C 3IP1A 5EMMA 1KY5A 4HRAA 2H1CA 2WWYA 4JYAB 4GXRA 3AERA 5EG5A 4REQB 1Y4UA 1QRTA 2ZYIA 1Z0SA 4TVOA 4F85A 5DMHA 3EJ6A 3C7DB 5A4JA 2UXDB 3DOIA 3FLAA 3TZHA 2OXIA 3KQTA 5DNAA 3I1YA 4F1WA 1OSNA 3O47A 3HA3A 4H4EA 4I08A 4L16A 2XYVA 5DTEA 4NBSA 4R5HA 2PZLA 4N39A 2ODNA 1NBHA 3FIJA 1PGQA 3L7BA 4EW1A 2IYQA 4M1TA 1ZOOA 1NVAA 2N46A 2V65A 1GNTA 5JSZA 2NV0A 2XDWA 2JJMA 1P19A 4RXMA 4CIXA 4JI0B