2GEKA

Crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
373
structure length
361
Chain Sequence
MRIGMVCPYSFDVPGGVQSHVLQLAEVLRDAGHEVSVLAPASPHVKLPDYVVSGGKAVFGPATHRKVKKWIAEGDFDVLHIHEPNAPSLSMLALQAAEGPIVATFHTSTTKSLTLSVFQGILRPYHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVDVASFADAPLLDGYPREGRTVLFLGRYDEPRKGMAVLLAALPKLVARFPDVEILIVGRGDEDELREQAGDLAGHLRFLGQVDDATKASAMRSADVYCAPHLGGESFGIVLVEAMAAGTAVVASDLDAFRRVLADGDAGRLVPVDDADGMAAALIGILEDDQLRAGYVARASERVHRYDWSVVSAQIMRVYETVSGAGIKVQVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL MANNOSYLTRANSFERASE (PimA)
publication title Molecular recognition and interfacial catalysis by the essential phosphatidylinositol mannosyltransferase PimA from mycobacteria.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 119
structure length 361
sequence length 373
ec nomenclature ec 2.4.1.345: Phosphatidyl-myo-inositol alpha-mannosyltransferase.
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13439 Glyco_transf_4 Glycosyltransferase Family 4
A PF13692 Glyco_trans_1_4 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2gekA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2gekA02
3QKWA 1C8LA 5C1DA 3MRTA 1F6DA 1NOIA 3OY2A 2GPBA 4GPBA 2C9ZA 4MHOA 2QN9A 3G2IA 2JJMA 5D00A 5IKOA 1Z8DA 3G2LA 2FF5A 4AY5A 3O3CA 1GPBA 3RT1A 1E4OA 2BFWA 3ZCPA 3ZCRA 2QRQA 1WV1A 2GPNA 1L6IA 1YGPA 4YI3A 2ATIA 2XGSA 1WUYA 3CUWA 1JIVA 2KS6A 3MQFA 3Q3HA 1WW2A 1EM6A 3E3NA 3IAAA 2GM9A 4MI6A 4X7PA 4BQIA 2QNBA 1H5UA 2ACWA 3CEHA 1Y6FA 4HWGA 1JG7A 5JTTA 4RIGA 3BD7A 2C1XA 5I45A 2X0DA 4EL0A 2VSNA 3HBJA 2X0FA 4BFCA 3PE4A 2QRGA 1RRVA 2QN7A 3NCHA 3MRXA 5ENZA 4NEQA 3E3OA 1JG6A 3G2HA 1QKJA 3CEMA 2QLLA 4MHSA 4KQMA 3ZCVA 3OKCA 1K06A 5DXFA 1XL1A 1L5VA 3BDAA 3L7AA 4EJ2A 2X6QA 3HBMA 3VDMA 4N3BA 4M7PA 1UQTA 1IIRA 3OY7A 2IYAA 3CX4A 2PYDA 1C50A 2QN1A 1P2BA 1PNVA 1FTYA 1GPAA 5HXAA 4MICA 3G2KA 2XA1A 2QRHA 4M60A 2R66A 2FETA 3T3IA 3BD6A 3OKAA 4FZRA 2IYFA 2GEJA 1FTQA 4F97A 1EXVA 3HBNA 3VUFA 4RIFA 3BEOA 2QN3A 2X6RA 3PE3A 1GGNA 2H1FA 3UYLA 3G2JA 4GYWA 5GPBA 3DDSA 1M5RA 1SXPA 1NZFA 2SKDA 1C3JA 3MTBA 4AMBA 1AXRA 5IKPA 3GUHA 1K08A 4RENA 2SKCA 3S28A 4XIFA 1XC7A 3MT8A 3COPA 1Z6QA 2F3UA 4AMGA 4F9FA 3H4IA 3RSCA 2P6PA 3G2NA 3BCUA 4RBNA 2FFRA 3ZCSA 3T5TA 2GPAA 3CEJA 3RHZA 3Q3IA 3CUVA 1NLMA 3OT5A 1J39A 2AMVA 3MSCA 2VG8A 3WADA 2QRPA 5TMBA 3ZCTA 2ASVA 2WTXA 4BQEA 4QLBA 6GPBA 2F3SA 1B4DA 1WW3A 4F96A 2C1ZA 3WC4A 1LWOA 2PRIA 2IW1A 3L7BA 4WACA 1NZDA 4N9WA 2XGOA 4NC9A 1LWNA 2IEGA 4CTOA 4GZ5A 4L22A 1FS4A 2Q6VA 1XL0A 4KQ2A 4EKYA 5TMDA 2GT1A 2QZSA 1HLFA 3OTHA 3D1JA 1FA9A 1NVKA 3H4TA 3MT7A 3EBOA 1XV5A 3SYRA 1P4GA 2HY7A 2YJNA 1FTWA 4KQ1A 1ABBA 1PYGA 2G9UA 2JLBA 3T3HA 2XA9A 5DLDA 3DZCA 3OTIA 3WAGA 4RIEA 1Z62A 4X6LA 3ZCQA 5JTUA 1WUTA 3E3LA 3FROA 3T3DA 3C4QA 2IEIA 4FKZA 2C4MA 1L5WA 1Z6PA 5D01A 1JEJA 1IXYA 1NOJA 2VSYA 4NESA 2BGUA 4G2TA 2IV3A 3MBOA 1RZUA 3OKPA 2H1HA 5TVGA 4HLNA 1FU7A 2BISA 3MRVA 3CUUA 3TAXA 2R4TA 1FU8A 3NPAA 2GEKA 2R4UA 1P4JA 1UQUA 3TOVA 4WHMA 2X0EA 3DD1A 2F3QA 4W6QA 1KTIA 3NP9A 3OTGA 4CDRA 1NOKA 3CUYA 3MT9A 2ZB2A 2R68A 1XKXA 1E1YA 1C8KA 7GPBA 3NB0A 3T7DA 4MRAA 1GZ5A 1P4HA 3VUEA 3BCRA 2VCHA 1JIUA 4MI9A 1FC0A 2SKEA 4X7RA 4YI5A 1L7XA 3BD8A 1BX3A 3AMVA 2AW3A 2ACVA 2G9RA 3D0RA 3L79A 3SYMA 3C4VA 8GPBA 2QN2A 3C48A 1L5SA 2BGTA 4RIHA 2AV6A 2XMPA 1PN3A 3S0JA 1V4VA 1AHPA 4N3CA 3TSAA 1PSWA 2AZDA 2VCEA 4Z5XA 3QHPA 2QLMA 2F3PA 4RELA 1L5QA 3MS4A 4X7MA 2XCUA 3T3GA 3D0QA 3MTDA 1P29A 3CV3A 1O6CA 2JZCA 2PYIA 2IV7A 2QRMA 1JIXA 2IUYA 1XOIA 2ECPA 4GYYA 4REMA 4GZ3A 2XGMA 4XI9A 1FU4A 1VGVA 4RIIA 2F9FA 4GZ6A 4WADA 1UZUA 2G9QA 3S27A 4EKEA 3DDWA 5TMEA 1GPYA 2G9VA 3L7DA 4MI3A 1F0KA 2PQ6A 5DU2A 2XCIA 4AY6A 3RSZA 1Y6GA 3IA7A 2O6LA 3S2UA 4LDPA 3NP7A 1GG8A 3UYKA 3NAZA 4CTMA 3ZCUA 3GPBA 3L01A 2PRJA 3MTAA 1L5RA 1P2GA 3EBPA 3L7CA 4AN4A 1RZVA 2QLNA 1SXQA 3T3EA 2GJ4A 3MS2A 1WV0A 2QN8A 1GFZA 2XA2A 3NC4A 3CUTA 4PQGA 2OFFA 5BNWA 1Y8ZA 1A8IA 4CTNA 4YUAA 4N3AA 2R60A 4M83A 1QM5A 3HBFA 3VDNB 1YA6A 3MS7A 4N39A 3BCSA 4LEIA 5LQDA 3S29A 3Q3EA 9GPBA 4EL5A 4BQFA 1P2DA
chains in the Genus database with same CATH superfamily
4PTLA 3T1HB 4HK4A 4R1LA 2WI8A 2WM2A 4LFCB 2WWWA 3K0FB 3LWZA 5C8YB 5JAIA 2ODAA 4O4JF 1SM4A 1G8KA 1C3OA 3ZWXA 2ZE8A 4BFUA 3UUGA 4X66B 3FB1A 4HL6A 1UKEA 3KL4A 1U2SA 2AXNA 4FJ0A 2A35A 2RGCA 2BGNA 1WLYA 2TYSB 4BU0A 2WSIA 3LA6A 2AXEA 1NONA 4L8GA 4W5QA 1Z8NA 4PYRA 2PUVA 1C4WA 1QH0A 5JSZB 2D54A 2I3AA 1DTWB 1CFZA 3LX8A 4BAGA 1I8TA 4JBHA 3WV4A 1Z7YA 3DEKA 1Z8DA 2EFGA 1QMGA 4I66A 2OGZA 2VWPA 2G1KA 1C5KA 2FSHA 2HA5A 3KZXA 2W6ID 4U8HA 4BIIA 4HV4A 1DDGA 4QDOA 2UZ0A 4Z53A 2JH3A 4BNVA 3ONWA 4BVBA 2GERA 4KBGA 1Q12A 3CA8A 1LQTA 2HT1A 5C80A 4Z4FA 1XJCA 1BHSA 1XQVA 4KPUA 2C5SA 4DTCA 2FG6C 1Q92A 3L6CA 3VOAA 3VZCA 4E03A 3ZCRA 4KLNA 5K0GA 2UZ3A 4R9RA 1Z2CA 5FYQA 4Z9BA 4MQUA 1E2MA 2NUBA 3MCVA 2P0AA 5EE0A 1X7ZB 4NF2A 2POQX 3P45A 221PA 4HJRA 3Q2IA 4YMWA 4DG9A 3ZLBA 1U1DA 2Q6TA 3QBVA 2VDOB 1A4IA 5FBZA 3NTLA 3I6IA 1UH5A 1FYEA 5JUWA 3D6JA 4B0OA 4CMIB 4RJKA 2QT0A 4XM0A 3BILA 3ES9A 1UXKA 3BRWD 2P6MA 2I7DA 3QMWA 1C7JA 2QV0A 3EXHA 1A9XB 4HGQA 3FNQA 1OBHA 1VG9B 1Q1BA 2ACWA 2PQ0A 2ZRAA 2YMLA 3NUGA 3SXJA 1BKYA 2RIPA 4CLRB 3KXIA 5DYNA 2C1XA 2I1WA 2XKAA 4AS3A 1JF8A 3DH0A 4K6HA 5TVKA 4D92A 3W5BA 1WXGA 2VSNA 4JLWA 3HDYA 5ELLA 4F2DA 2PDAA 5CDSA 2IYOA 1YUBA 3IV7A 2E6UX 3JZDA 2BM1A 5KOJB 2IH4A 2VYVA 4V2UA 2P5SA 3WK5A 3VVBA 2HV9A 3BAZA 3N53A 2JGMA 2I6XA 3T9FA 4Z2AA 2YYZA 1TQDA 4G1UC 1WZIA 1Q44A 3R41A 4Z8XA 2FVXA 2FPGB 3CEMA 2VYFA 4KQMA 1XNJA 4MS3B 1USKA 4C0LA 4CKBA 1DO0A 3BRQA 4D8TA 4DLNA 3SLKA 4PLPA 5IT9A 2A0XA 1WKBA 3PDIA 3QJ5A 1XNQB 4JOQA 1OI3A 1UQTA 4JVLA 1IDN1 1VG0B 3F5FA 2CJXA 2OAP1 3CE6A 3Q1LA 3RG2A 2WAOA 1YS1X 3H5WA 4YGYA 2H7CA 5JOQA 1CKEA 4Q4AB 4HEQA 4IQ0A 1PNVA 2Q4TA 3FWHA 1DQYA 4QOEA 4O25A 5L4NA 3O95A 1TYAE 4M1YA 3PGLA 2FY8A 2DWPA 5SY4A 3OLQA 3FYCA 1U5BB 2H65A 4ENRA 1QG4A 2BDTA 3C7KA 3ROKA 3QY9A 1CZUA 3DVRX 3PT9A 5U1PA 1SPXA 2EZ8A 4D43A 1R0ZA 3AVWA 1DTWA 1S3GA 1GLNA 1RVV1 5I51A 5FOQA 3DOUA 3DBRA 2P4QA 4FSXA 3ZPXA 1S8FA 1J49A 2OCBA 1DRVA 3ZVRA 3M6FA 2OM2A 3K5PA 3V7NA 2ZYWX 2DY1A 1LGYA 2YHAA 3BWDD 4BX9A 1Q0SA 3CURA 5J47A 3EXEB 2Y4OA 3OFND 4GKJB 4X62B 3QXXA 1GGKA 1ODJA 1QOQB 3G5TA 3LDUA 2B7LA 1KU6A 2C2BA 4REQA 1PUXA 1UOOA 2P9HA 4OI1A 4BXOA 1QVRA 4IIEA 1X2EA 4DCTA 3T7SA 3GROA 1OE0A 2D5BA 3WR5A 3ZE6A 4DJEC 4A26A 2GJ8A 4N3NA 3GJSA 3JYLA 1CRWG 4YRDA 5LQAA 1Y8QB 4OI4A 2BCEA 1LZLA 1DX6A 1P1FA 3EA0A 3F9CA 3FLMA 4GRAA 1Q95A 3C0KA 4IXMA 1AGNA 3LPCA 3N76A 4YCSA 1RNLA 3QUTA 5DCLA 1NRIA 4G23A 1W47A 4XCXA 5AXAA 3L06A 1DIBA 1SCKA 3R40A 3DMHA 3H5RA 5BSMA 3BBPA 3TMAA 5I3CA 1SD5A 5JIBA 2YWXA 3Q3GE 1I1QB 4GD3Q 1E6CA 3QE4A 4RVUA 1P45A 2DFDA 4B9EA 4CLRA 2DC1A 1VSBA 1C30A 1J0BA 4XCVA 3AUXA 3GMIA 4YCBA 5T4HA 3TIGA 3X43A 1GQYA 1MG0A 3SN6A 3VPAA 3L41A 1B0AA 1O4VA 1SK9A 1WZCA 2ADOA 2BGLA 3BHJA 3WLSA 3I30X 4LJLA 4ENPA 3STYA 5B36A 2FEKA 3FVTA 1JXMA 2A1UB 2JL1A 1LBIA 1XTJA 2C9YA 4HQKA 4URVR 3F6BX 4CE6A 4CV1A 4LISA 1SUPA 2GPAA 3AHIA 3T94A 4FEAA 1HA3A 5T4EA 3BT7A 1LBEA 2FPGA 2WPNA 1GCGA 1DIGA 3K6SB 2V3WA 3EVFA 1IN1A 1DUSA 3WNDA 2J4DA 3R3XA 2JI8A 1YJAA 3ZWNA 5L6LB 4Q1AA 3JAKB 4HH4A 1J39A 3WA7A 1TJYA 3ET4A 4MR9A 4PX9A 3SZOA 4XX0B 2ZBFA 1E2PA 3WADA 3DP7A 1AZTA 1AS0A 1CV2A 3ZCTA 4EDFA 2OG2A 4BNXA 4ZKEA 4NE7A 3ROMA 5MGNA 1K4MA 4F7WA 4CMEC 3E4CA 1H23A 4JLMA 3CSSA 1BXZA 1P0MA 3LCCA 3P2JA 4WNIA 3TS1A 5J23A 4MH0R 5AJWA 3WGVA 5DN6D 5G2OA 1SN7A 5CH3A 3QVOA 3FTEA 3N2ZB 4C7JA 2IYLD 2F9LA 2MOKA 4INAA 1U5BA 3H97A 1VJGA 1S01A 3H2JA 3IP7A 2FX2A 2DAPA 1WBBA 3RG8A 1D6SA 2D62A 2EF0A 2G72A 2AQKA 4QA9A 1L0BA 3GHYA 4CMEA 3K9CA 2OGSA 1YVRA 4W9RA 3ZV5A 1Z45A 1WXFA 4R2XA 4JY7A 2ZS7A 3ICCA 3AM4A 2TECE 1WMFA 2IYTA 1B3BA 2Y1WA 4YASA 3ICWA 5IUNC 2FNAA 5JROA 4ZARA 4BMPB 1V8PA 1W6RA 2C7VA 4AO7A 2WTEA 3EXEA 1FA9A 3T54A 1R4MB 1IEXA 1JFRA 1VL0A 5FR1A 4DSTA 3D2BA 3MJSA 4HVCA 2B1QA 1ONNA 1T3ZA 3I9V6 4Y2VA 3M1YA 3R5XA 5GJCA 4M99A 1U0GA 2B21A 5FJIA 3UOGA 1GVHA 1PYGA 4DCPA 3GGOA 3HPQA 4MJLA 1O94C 4Q3LA 4TM7A 1YR7A 2W2QA 3U4GA 1IUOA 4M0FA 1T9HA 5EMMA 3TQCA 3PC4A 4J2OA 1GTJ1 2C2YA 2B2NA 1GZDA 1PNQA 1WPXA 4PFQA 2OESA 1L4UA 4KR0A 2I4IA 2V96A 1EGMB 4A0FA 4ZEVA 4NFLA 1ZUWA 1PQYA 1ULUA 3ZLJA 1RQNA 4A8JC 4IQGA 2X1LA 1MF7A 4ZV4A 2QA5A 1D8AA 1L7AA 1M2VA 1O94A 2R6DA 4Z8YA 2OYRA 3U4AA 3SAJA 4ZCTA 1RCFA 2ZJ6A 3QPAA 3UEOA 5AI6A 3OG9A 4F2WA 2Q2VA 4U7DA 1WBJB 4INZA 4ZAFA 4AKIA 1USVA 3OKPA 4N41A 2C84A 3SR3A 1KO8A 3LW8A 4JJFA 3KYCA 4A8JA 3I9MA 3OIVA 3H7AA 1JHDA 1NI4B 2I6QA 3NTOA 4NKRA 4XD7A 1GKIA 1CQWA 1WNFA 4YR9A 3GEPA 3TZHA 5JPCA 1KSFX 2OXFA 3AUYA 4GOOD 4E2FA 2G0TA 2R4UA 3UCEA 5LJIA 4TTPA 1RYHA 2JHPA 5I9SA 1ORDA 3JAWB 3NW9A 4MGHA 1F9AA 2NGRA 3BXOA 1UXIA 1UKAA 2O1XA 3BWMA 2F62A 2DX7A 4GECA 4NCIA 3HL0A 1CRLA 3IT1A 4D7AA 3N0RA 3EOZA 5LOVF 4WASA 1KTIA 1CE8A 4H6XA 1RDFA 3UAYA 5DVZA 1R16A 1CETA 1WTAA 3D5QA 2AYYA 5K9ZA 5CA1F 1GTG1 4P08A 1C1HA 3FSEA 3NB0A 3ZW8A 3KDPA 4BB9A 1P4HA 3D3QA 2VDPB 2X23A 3K0EA 3MGKA 4QREA 5TPWB 1B73A 3ZHSA 5MF6A 3KCQA 4Q3EA 5DZSA 4C0HA 3BKWA 2SKEA 4O2BA 2ZANA 3ND7A 4NATA 4P98A 1WL8A 4B31A 3ZWOA 4EI9A 4RJTA 1XJWA 3M6MD 3BD8A 4BKRA 2YVLA 1XBTA 3X1ZA 3AMVA 5HIIA 5KWIA 2H2DA 3PHHA 4S0XA 3R3UA 3VKVA 3E61A 3KYDB 1TADA 4U6SA 5K3FA 3SYMA 5C7YA 1ZBDA 5EG5A 4OSEA 4F3NA 1UPUA 1U2PA 3ICOA 1JDJA 4V1CI 1JA0A 421PA 1P77A 4DUPA 2BKUA 4S1OA 2XBLA 4HMOA 1T3LA 2OORC 5B58C 1PJ3A 2CHQA 4GX0A 4KCGA 4WW0A 4AJIA 4FB4A 2XMPA 5L51A 4HB3A 1Q21A 4GNKA 1XZAA 3E15A 1Y0BA 5BYJA 5NULA 2MT9A 3PA8A 1P7VA 5DGHA 1VFNA 1LTKA 5C31A 1GM5A 4HZUB 1PV4A 4FLEA 2PUFA 2P2GA 3CINA 3O4FA 2XWJI 3DKKA 3LK6A 1QKIA 1SVSA 4FZJA 4GUDA 4GDMA 2OORA 2OR3A 2D5LA 2PH5A 3L92A 1W5SA 4KQXA 2FUKA 4HEHA 1JR3D 3ETHA 2UYHA 1R2QA 2OV2A 4L9SA 4NU6A 3L5OA 4YRRA 3PQEA 3PEWA 1OA1A 2JZCA 3LQRA 3SSNA 4K05A 2QRMA 1SKYE 2Z58A 3B3QA 2B37A 1KYQA 1MIOA 4ZU1X 3U1BA 3ZY6A 5KTNA 2NV2B 2XTMA 1RSZA 3VPXA 1W44A 3P5BA 2FSFA 4L02A 4LI3X 3V4LA 5KPDA 2Y1LA 4P4LA 4BMVA 4BE7B 5EHZA 1BQ4A 1LCIA 3PJGA 4HUJA 1IBSA 4OQDA 4WLUA 2P9YA 2GNPA 2P3OA 4DILA 1BHQ1 2Q4BA 4L75A 2IWRA 4JZYA 2NXCA 2X9VA 4ZZ0A 1EDZA 1ZM2A 2WYWA 2XRFA 4X1YB 1XHEA 3TOXA 2Z2IA 2GXQA 2G4LA 3U3ZA 1ZH6A 4EQ6B 1XU9A 4OXQA 4W5WA 3AZOA 1X9IA 3BTOA 4LDQA 3SXUA 3K3PA 4TL9A 4GW3A 3WLIA 1VPWA 3PGXA 4RYDA 1FSZA 3DAGA 2WUFA 3CH7A 2XGJA 3MAAC 3PB3A 5D87A 5AJUA 1UWKA 2O2DA 1SCQA 4YUZA 1M5UA 2C04A 5FL7A 1J9GA 4D8YA 8LDHA 3HADA 2GARA 4WIAA 4UBLA 1NBHA 4JH0A 2QJTA 1TT7A 2WOOA 1EESA 3TMYA 5D6NA 3M9XA 4KAAA 2ZJFA 4U7FA 4X0EA 2I22A 2R97A 3Q87B 4MAAA 3V1UA 4BLQA 3B7WA 5BUCA 4CNBA 5EHQA 1ZOIA 1LPOA 1J1IA 1DRWA 4MIEA 1TPYA 3KHSA 2DHDA 2BGJA 1TW2A 4NJEB 1Y7IA 1K2WA 4NBVA 4R54A 1RZVA 4Q4DA 5FA5A 1ISHA 2BE9A 1AQIA 1XZ8A 3STTA 1ZN9A 3KLPX 3N58A 3MS2A 3AKCA 1VCHA 1VLMA 2QE7A 4GAEA 4P80A 1Q57A 2A1IA 4IIUA 4X61A 1TVKB 5K20A 4NFHA 4KLCA 1CUBA 4FXOA 3T5BA 4BGVA 3UGTA 3X1KA 3ZR4B 1L7NA 2Y1XA 5FJJA 5CVTA 2IYZA 4HUQA 2VTKA 1A72A 3MTJA 3ZCXA 2GN4A 3IT2A 3H11B 4E33A 1BKDR 4C2TA 2ABWA 3JTMA 4YTEA 4GMDA 3UN1A 4OQ4A 3HN7A 2PZJA 2X4DA 1E0KA 5EGNA 5AXBA 4MULA 2XOKD 4TQGA 1Y82A 1YZNA 3RSLA 5AW2A 4LDNA 4YMLA 2R7LA 1PGPA 1NQUA 1V8BA 2OC4A 2YQZA 4R16A 3KB2A 4FD3A 2IC5A 4K7JA 5L3RA 2HTEA 4DBVO 3KQLA 1GAJA 1IXSB 5ADUS 2FUG1 3VFDA 5CLGA 1USWA 3PWSA 2EYQA 4HX5A 5CGQB 4WY2A 3NTXA 1TLLA 1AD2A 1P2DA 4GQAA 1QORA 3NONA 1T1GA 5FNVA 3Q9LA 2Y4NA 3AYZB 1UC4B 1JDBB 1YFJA 5TNXA 2XUFA 5E1DA 1M2NA 1AK9A 1O5TA 1JJAA 1JEYA 5CJJA 3G1UA 3KOWA 1C3VA 3VR2A 3TSYA 4BFZA 3LPAA 5BQ3A 4NBWA 1WDTA 4N7BA 1GL9B 2ZAOA 1QIFA 4XLLA 1C7EA 1GGVA 1VJRA 4TX1A 3HUTA 5E8JA 1TGYA 4MA5A 3AI2A 1Y3AA 4L4XA 1LVHA 3DOEA 4ZO7A 3SBOA 3ZNNA 3N8GA 4E88A 4D4KA 2BELA 3GZNB 3OQBA 2MSDB 1YJQA 1EFLA 3IAUA 4UHJA 3UMBA 1S3SA 1LPAB 3C3EA 3MELA 2D0DA 1J8QA 1QYRA 2IHVA 4BNMA 2W42A 1EP1B 3NH9A 4WDQA 4E2XA 3HCOA 3IQDB 2ZSFA 2COKA 1A82A 3OOHA 4NAVA 3DCIA 4C2UA 3P4XA 4PWZA 1EE2A 2X13A 4RV4A 2P8JA 3VMMA 1ZD5A 3WLFA 5A5GA 1VIMA 3QBJA 5EPOA 3TDNA 3HY4A 1YGPA 2NV0A 1UBRS 1WULS 4S35A 1IY2A 4QUBA 4F3RA 1WSWA 2R8RA 4IWYA 2EGUA 3DFIA 4R2IA 1JEQA 3DEIA 4IXWA 1JQDA 3UJ3X 1I4EB 1N1MA 3W3AD 4JXKA 4Z51A 3O4JA 5KX5F 3WGQA 1Z3IX 2HPHA 1SVNA 2WG2A 4DMHA 1VDZA 2JJ8A 3CISA 4YUWA 2XXAA 3RRMA 5JFTA 1FE8A 3CLVA 1K9SA 2HXGA 4DIEA 3MMXA 1XZPA 4TTSA 1QGUB 2JFQA 1R6TA 1RRMA 2FN3A 3PXAA 1RPJA 3NANA 2W70A 4F38A 4YR7A 1JBKA 5DNYB 2JZNA 1I13A 3AHCA 3CCCA 3CEHA 1N36B 4IQ4A 3VVMA 2YXBA 4BX2A 3RHSA 1O9GA 2BFFB 1CR0A 1JX6A 3ULKA 1XXHE 4FWBA 5BQFA 1YA4A 3HY6A 1YQGA 1WG8A 2CCGA 3IDOA 3O83A 5TT1A 2X0DA 2LCQA 1T3SA 1T3GA 1ULTA 3EVBA 3IMGA 2E2WA 1SBTA 3I9LA 2WFLB 2FH5B 2BI7A 2W2XA 1XKLA 2XV1A 3PE4A 5DGDA 5LZ8A 3UHFA 1MB9A 1Q3KA 1ZD1A 1EK0A 3AETB 1ZI8A 3F6CA 3NCHA 1RQPA 1T2VA 2X5JO 1V4NA 2ZSBA 3I83A 4K6FA 3VPSA 2WD7A 3GG9A 4H7EA 3TX6A 3G2HA 1UFRA 2BW0A 3DMFA 2NQTA 3OE1A 2XKJE 3ADPA 4ENVA 3NM6B 4FXPA 2PT7A 1AKMA 1QKJA 3NIWA 3PNQA 3IP8A 3PNVA 4YJ2B 2WEKA 3THRA 1GEGA 1Z5GA 5BV7A 1N2JA 1RJ9B 5ICCA 3V2GA 1H3FA 1MB2A 3RTEA 1S9HA 2FUEA 2QQ0A 2Z3WA 4AKSA 2G08A 5LQRA 2PA0A 1V35A 3VDMA 2GA9A 4M7PA 3BGVA 2Y0DA 5A62A 2IQIA 2MR5A 3K20A 1IHOA 2B99A 3KKOA 3SC6A 3WYBA 2ZIUB 4DRXA 2G07A 2UZ1B 2Z8XA 3EIXA 4GS5A 2BEUB 3AXSA 1N7IA 2Q2QA 4L51A 5CPFA 5DNAA 1H0HA 3PC6A 2FJ0A 2ZCJA 3N8IA 4UMVA 5EXDA 2Q1TA 3KWFA 1FTYA 3QPVA 4MUXA 4M7RA 3WLTA 2CF5A 3W9YA 4Q3DA 3BC1A 3RIYA 3DEAA 3KZNA 4M49A 1N7HA 4BMOB 5T4FA 4LJRA 1Y8RB 4YMGA 4JC5A 1D6JA 3F5MA 1VKHA 2CUZA 1O6FA 1DEAA 1GSHA 2ADFA 1E0JA 3PDJA 1THGA 4IRXA 3VKWA 3I2HA 1OLUA 1JJIA 1R9JA 3GUZA 1FDVA 4IDPA 1BCSB 1J99A 2VCYA 2C0CA 2QVXX 3ZVMA 1DFIA 2FMHA 4M46A 1N2GA 3D81A 4JS0A 5TSDA 5TQ2B 1OREA 2A88A 2ISSD 2NG1A 1U3CA 3PXGA 3VNAA 3PFGA 3H86A 1K8ZB 1OU4A 2C2OA 2ZAGA 3M1IA 3WNVA 3EFHA 4TS1A 1C0IA 5DHRA 4J94A 1EA5A 1KPGA 3OQIB 4JA0A 1KDYA 4JJZA 3A6KA 3SEAA 1OFGA 2GYWA 1DCTA 4D26A 1MX3A 5J59A 1WB4A 2BTQB 1LQ2A 3RT9A 3LDGA 2DR3A 1JHYA 2ZZKA 3FAKA 5HR5A 1KP3A 3A7DA 4HEJA 3TL2A 4EQZA 3BWBA 3RARA 3CMCO 5JO0A 4M0LA 3BVPA 1ICEA 3S28A 2P11A 2B8WA 3LRPA 2GEDA 1FRVA 3EY4A 4J07A 4XCQA 3WYEA 3A6EA 3DMNA 5HM8A 5ERYA 4BRSA 1ONPA 3HQ4O 1G59A 1GTRA 1NQAO 5EMLA 1Y1RA 2FW8A 1XC7A 2XWBF 5BR7A 1D8TA 1ANKA 3VQTA 4JI0B 3COPA 4KREA 4A3SA 1E7RA 1T91A 2L2QA 1HL3A 2HA2A 3B1JA 4JUFA 3H8WA 4NE2A 3DKRA 3AERB 4R83A 2HK9A 4ZAGA 2GAFA 3NJ8A 3GDOA 1SOWA 3D5TA 4OH7A 5AKIA 1KR5A 3JZMA 3ICEA 2O2EA 2VWGA 3TW8B 1N4AA 2PGXA 4X91A 2G09A 2E21A 5A05A 1ID8A 3D1VA 2UYOA 1ECBA 3GEGA 4K9PA 4C7MA 3NKVA 1LS6A 4DW8A 5LZ2A 1X9HA 2ETVA 3RUHA 3EWIA 3G5UA 3OICA 3ETNA 1SCUA 5KSZA 1KVQA 2FP4B 3H99A 2CDBA 4QTUB 2TSYB 4KRXA 3W6UA 3S8YA 3GELA 4IUYA 1JRLA 1ZY2A 4ZDKA 2FW6A 3QOWA 4L5BA 4LYYA 5DOZA 5JHGB 1F3OA 4AUKA 3QFHA 3EXAA 4J1QA 2QLBA 1YKSA 2RK3A 2AI2A 5DRTA 3CZMA 2J9XB 2FRXA 1N2CA 2Q5QA 2FK7A 4BNTA 3OWOA 2VJQA 3DBLA 1L7PA 1NJ1A 5CGZA 1PGJA 5ITZA 3THWA 3IIEA 3K9FC 1N5RA 4DAEA 2YCBA 4IG9A 4YRMA 4F96A 5E1OA 1GYRA 4PTYA 3TBHA 1EJ6A 5FULA 5JCPA 4EO9A 1Z4JA 3IRUA 1TTHA 2HJRA 3OEED 1THTA 3U5TA 2R5WA 2XGOA 2CXQA 4HZGA 3GH1A 3PGJA 3OZXA 1MR3F 4LRQA 3TG8A 2YWBA 3PL1A 5FI1B 4OXRA 5GONF 3VZDA 5GOTA 4BO6A 1A9PA 4INOA 1Z2PX 3C6ZA 1AY0A 3JQAA 1H4VB 1DOZA 1FNBA 5AVZA 1MX1A 3D1JA 4YMUA 3GLIE 4ZI5A 5MN4A 4Q3NA 1AZLA 4I9NA 5CW2A 3SQMA 2R2AA 4E09A 1K7YA 1VSTA 2ZR8A 1F6BA 1SG9A 4I4TF 4TZTA 4MS4B 2FQYA 2C97A 3SEQA 4B80A 1FTWA 4LDAA 2YIMA 2PQMA 4WXYB 2E5WA 2G9UA 1SAYA 3HFGA 5F3RA 5DBFA 2WJ4A 1U3UA 3CWQA 3CZ4A 4KOEC 2QM3A 2VK2A 5A02A 4RSGA 5CIYA 2PLAA 3TLAA 3I64A 4MDEA 4LOLA 4PN7A 2AKEA 4KAJA 3I05A 1WB9A 2ET6A 1I2DA 3E9DA 3FPJA 2HJSA 4IIXA 5FOWA 2Q5FA 2R7KA 1LJLA 4QRDA 1TZJA 2W2OA 4UUNA 1EFPB 5AKHA 3U44B 1TFRA 1QWSA 4X8LA 4ONEA 2YDXA 2CL0X 5LP1A 5CHEA 4JJ8A 4O4IB 1W93A 3I32A 4D6XA 2WT4A 2BGWA 2G7ZA 2ONYA 4OQZA 3NASA 4Q3AA 4GP7A 5F64A 4C29A 1RZUA 1GHTA 1XB2A 2CN1A 3GDWA 1KZYC 3I1YA 5FXMA 2FQWA 1HMPA 2SCUB 1E9VA 2JVKA 3VKFA 2EL7A 1LPSA 4RD3A 1JIQA 5CNIA 5E6RB 5C4MA 4WXMA 3GJ3A 3TGLA 5CLLA 4CEHA 5TMPA 1ZS9A 1RKVA 2OBMA 1II0A 5KTTA 1J7KA 4BUJA 3BL8A 4MOWA 4KLAA 4ENTA 2C4WA 3I3SR 3K9BA 4P2BA 1P4JA 1Q15A 2EEZA 5CDUA 3NBUA 1Y80A 2FZKA 4HQNA 4PN3A 3ZGOA 1YUNA 1I9GA 2EFEB 1K8QA 4DJTA 3GVCA 1XWIA 2FV8A 5LYJB 1CQJA 1TVMA 4KVZA 1EFRA 5F4ZA 3HBAA 3ER9A 4HRAA 1JA1A 4D4IA 3PPYA 1X38A 2CXXA 2L42A 3O6VA 3C16C 1LS1A 3WGGA 2RKOA 4E3ZA 4EPWA 3GL9A 3TNDA 2FJPA 1FYDA 4X1KA 2I62A 2WD9A 4KTVE 4UW9A 1SWWA 3KUCA 4H0NA 4RK4A 2ZRKA 3IA2A 3P1JA 4PLCA 3WDLA 1DBSA 2GBFA 1KRWA 3EZ2A 1ZR4A 2F1JA 3BCRA 2WILA 4Q6BA 3EULA 1VB5A 3DE7X 4GGOA 4OL0A 5A9RA 4HAIA 2VAPA 2DF8A 3B9PA 1N6RA 2RSLA 3BAFA 3EVCA 3M3HA 3HJAA 2D0IA 2ZVDA 3D3KA 3GC6A 3HGMA 2Q46A 2QIOA 3DZJA 1JFLA 3FKSA 2QY9A 2QVBA 1L3IA 5AFSA 3CNLA 4LBYA 4ZC8A 3ONNA 3BFKA 1J1UA 1VSQA 1K7SN 3QE0A 1FZTA 3ZBUA 1F8XA 4AS1A 1FSGA 2GS9A 4IRMA 4KXWA 4BS9A 3OF5A 2QD5A 3DHEA 1FL9A 3LZDA 3PYXA 3AL2A 4M4SA 3WG9A 2QP9X 3ZD8A 3LOPA 4Q7JB 5JYBA 2PZ8A 3ZQJA 2O0KA 2XT0A 4TGLA 8GPBA 1K6MA 3W7VA 3CY6A 1IULA 3GD5A 1OWPA 4ETMA 1L5MA 2CMKA 2H51A 3ABIA 1DAOA 3RU3A 4EW3A 3U6KA 2WF6A 3EWNA 3MWEA 3VZQA 3TSAA 5A5EA 2BEVA 2WAAA 3AUSA 2BGGA 1L8OA 3LAWA 1JXQA 3ZNQA 5EIBD 1QS0B 2W5UA 1Z0AA 3LF1A 3SIRA 1ISMA 1E64A 3B53X 2HWUA 4AZ0B 5LUBA 4Y1EA 3LO5A 1VKOA 3MGGA 4MVJH 3TL3A 4IDFA 5JANA 3GB9A 3QHPA 4ZYWA 4RS4A 5AM2A 3I9V1 2V6GA 2OILA 3MNFA 3ZOKA 4KR6A 4BLPA 2QBYA 2I2AA 5DX8A 2HHHB 5CAEA 1SBNE 3QNMA 3VJMA 2IE0A 4CM1A 5L7WA 1UJ4A 3ZWYA 4DIOA 4D9BA 1Z56C 3OPXA 3GPLA 2ZBUA 4BMZA 1WSAA 4G5YA 4KX5A 4QTYA 2DTDA 2ZRNA 3LT5A 4FQ7A 1KEUA 3UXEA 4E31A 1M66A 5DTQA 1DZ3A 4D3FA 3EEYA 3UNXA 1QRSA 4MITA 4YQFA 2HW8A 1NV9A 4Y0AA 4AJ2A 1AKNA 2HSEA 3NU1A 1MAHA 4YP5A 4IINA 4GZ6A 1JT2A 2OHOA 1A4RA 4NZOA 4DZRA 3AO0B 3UMYA 1VPDA 3I0MA 1NX6A 1FIUA 2AMFA 4NYIR 3SU8A 3RSSA 1SCNE 2E82A 1KEWA 2Q07A 2XTJA 1E8MA 2OE2A 1V11B 2JAHA 2KX7A 4IM7A 1JQKA 2AOUA 1N92A 3H2KA 3JATA 4TXJA 2ZXEA 4KWIA 5K0NA 5LYJA 4DIFA 4V0ME 3LT1A 4JYMA 1LFAA 3D4NA 4OCZA 2QK4A 1K5HA 2SNIE 5J4YA 2IX9A 1H4SA 2A59A 1NU6A 1QOPB 3DDUA 3EGEA 4TS4A 1KQFA 3EWSA 1XKQA 3CXUA 3EZ9A 3LF2A 3S2UA 3SC2A 3T5PA 2ZT5A 5DHQA 4G1EB 2YW2A 4UJ5A 4JITA 3LVBA 4IIJF 1NAHA 5B7GA 3L8DA 3PBKA 1FQJA 3G0GA 4PYKA 1HNXB 1BZYA 1W29A 3AONB 3WZLA 4LF5B 2VSQA 4GL4A 3RBXA 2JLAA 5BYBA 1VE3A 2J6BA 2QDKA 4DSNA 2QGZA 3EXG2 1RYEA 2ENWA 2JHAA 4Q0MA 1ZX1A 3K92A 2W2NA 2VTBB 4BVAA 4R6WA 2WG0A 3MTQA 3RS0A 1WPQA 2HBZA 1V5WA 2IZZA 2WVGA 3A32A 4KYVA 1G1AA 4NONA 1BX0A 2O7QA 1C1DA 4TLLB 1KI6A 5AUNB 1GADO 4HB2A 1UAYA 1E1QD 3VHLB 4CDGA 4TYNA 5CX4A 3RWBA 4A6XA 2Q0HA 5ALNA 3OQMA 2GNOA 4KK3A 3K5HA 2RAPA 1HLDA 3HXLA 4M0EA 5CYOA 2H1VA 2AOVA 2OQRA 4GR5A 1V1JA 4KDFA 5DHTA 1J70A 1SIWA 3CB2A 2O7VA 1N5IA 3EF3A 3IMKA 3MCTA 1KIFA 5J5AA 3SYNA 4MPRA 2QYTA 1SBCA 3HYCA 2X2PA 3PYLA 4I14A 1OFTA 3JQGA 3D02A 3L7JA 4OFWA 4RH0A 2E3JA 4BWGA 3L7NA 1XEXB 3C5HA 2NO0A 4JCCA 4L85A 2AGVA 4AJ9A 4ZI3A 5BW5A 3DFUA 1NPTO 2O8BA 1H8ED 5E7IA 2SECE 1JVNA 1E2DA 5LQDA 4DDUA 1H22A 3CO5A 2ID9A 3Q3EA 2JASA 1Z2EA 1XDGA 5BXQC 1MOQA 3HXOA 2GXSA 1M2OB 3PNLA 3HG7A 4PGGA 4UMFA 4BL5A 1GQQA 3FPKA 2YKGA 1ZITA 2JAWA 3MHPA 5A9TA 3DA8A 1RQ2A 3DV0B 3IBFA 2QG9A 5SZHB 5JH7A 1F6DA 1V9CA 3EQ7A 3URMA 4BVHA 2Q7XA 1KO1A 2HF9A 3HU5A 3GEHA 3LUAA 3OOYA 5K3CA 3T61A 1WX1A 3EISA 3U31A 3OY2A 2IHZA 4LOKA 4Q9IA 5KWSA 1G20B 5AM5A 3ECSA 3SHQA 3WB9A 5FQNA 3HCDA 4KWHA 1MC8A 3PSHA 5KMGA 3OA2A 1A2KC 4R4JA 1PR2A 4W7HA 1ENOA 3S81A 5EINA 3RKUA 5F9FA 2H7VA 4N0PA 1YE5A 2JBWA 4WKNA 3P4UA 2G88A 4ZT3A 5FWDA 5G0TA 5KAMA 3ZIAA 2WTUA 1AGPA 2B5VA 4PGAA 4K9LA 4R1SA 4R5MA 3ROGA 3UHOA 3VSAA 3O3CA 4NXMB 4B6GA 1KEVA 1LW7A 5JSHA 4IEIA 1USGA 3JWEA 3KZCA 4MQ4A 1PJLA 3C85A 4IPTA 2VSXA 3F3SA 4UBKA 1RZRA 4YAJA 2RHCA 4PLZA 4RSHA 3I28A 2QS9A 2X2OA 3AM5A 3IP9A 3K6KA 1QHHB 4KP7A 4QDKA 3JYOA 1TUBB 1MDBA 3RASA 5BWCA 3QUCA 1VECA 2NTYC 2HA0A 2PXXA 3VC2A 2C1EA 5B4VA 3CUWA 1BTOA 4X20A 4R8VA 5JJCA 2GPSA 2XRZA 1OJLA 4ACAA 2ZR7A 1ZJYA 2HADA 4WFQA 2GJAA 1I2BA 5I7AA 1WW2A 1DJOA 4FCCA 2L18A 4XZ3A 2IY9A 3AEXA 3R74A 4DNXA 3NHJA 2J0UB 4M98A 1EFVA 2Y6VA 2CSUA 4ZN6A 4P3YA 4UFNA 1W88A 2PL5A 1Y6FA 3BG5A 4XJVA 3EXIA 3EA4A 5FAXA 4LHZA 1WMBA 3WL3A 2VL7A 1E3TA 3EMDA 1T2AA 1UPCA 4ZT4A 2GHQA 4YCJA 4EL0A 3QBTA 1M0TA 3ZVNA 2DUMA 2O0LA 4UAUA 5JAOA 3NHAA 5DHUA 1YB6A 1JW9B 2FU5C 2QN7A 3GWGA 4I4IA 2D7JA 4M8IA 1RTTA 1YR6A 3PEUA 3UGQA 2JFHA 3ZLVA 3AP3A 5ARDA 5B1SA 2EEPA 3Q40A 4U4AA 2P9GA 3CPSA 5BN3A 5K0BA 2QROA 3DF9A 2JI7A 1DSSG 1O95C 2DLDA 4HTFB 2QSUA 3DC2A 3V8VA 1FPQA 2FK8A 3OKCA 4IOMA 2FWNA 2QZZA 5ADWA 3BDAA 4MYUA 1EUZA 2HMUA 5I4BA 1GDHA 5ALRA 4EHJA 2G83A 4ZGWA 3L7LA 1COWD 4REOA 3V4ZA 4D44A 4FC6A 4O1HA 1UBNA 2HNKA 2D59A 4PR0A 3SMQA 9LDBA 4C4PA 4B3CA 2FFAA 3H9UA 3M6IA 1HT1E 1OBCA 5CIWA 5LQMA 5EQDA 2J3DA 1EM8B 3G1WA 1O95A 2B6HA 4EGJA 4WXEA 1A9YA 5DM1A 1W581 4PYNA 2EFYA 4YLGA 4MICA 2IYYA 3LUFA 4QPPA 4UUQA 1E6LA 5FPTA 1T9GS 3UWKA 5JY1A 2HCRA 2RAUA 5AK4A 3CVYA 4XVRA 3OJLA 4U2GA 4XLTA 2PS3A 1QZXA 4ENSA 2G82A 1JLLA 3MA0A 3QRWA 2C3PA 5ECGC 1XRNA 3GBPA 3T5DA 5BUSA 3B36A 2PL9A 5H7XA 3RYTC 2E6KA 1U65A 4WNCA 2QORA 3UV6A 3ZQUA 2RGRA 2JAQA 1BAPA 4CR7A 1TEHA 3LQQA 2ZJ1A 4RIFA 1KERA 2NXEA 3I1JA 1DRUA 4G85A 4JD5A 4A8HA 5F35A 3PE3A 5HM6A 5I4KA 1JFFB 4WNYA 3J81A 5ELMA 1XROA 2QD3A 4L5CA 3V2IA 3M8KA 5GADl 2R8XA 2H6EA 1D9ZA 1TUIA 3ZQKA 4KPGA 4K9DA 1NPYA 3KYIB 4LQLA 3QSGA 4H31A 3F7MA 4CCAA 4B3XA 2JA2A 4KN9S 1K92A 4LMPA 16PKA 5BWOA 1FUKA 1VCMA 2WSSD 2FSVC 4YHHB 1QIGA 1SHKA 4FR5A 1QF7A 5AUQA 3IBSA 2C5FA 2G5PA 3CONA 3BMNB 4K9NA 1LBTA 4B7ZA 3DLBA 2BJWA 3B1FA 4LRXA 3UK1A 3WIEA 3WXMA 1HDYA 3NHLA 3NYIA 2XSZD 1LA2A 1Q16A 1CUVA 2LXNA 3OM0A 4W5RA 2ZI5A 4IHJA 1E0SA 2FTKE 4FMDB 1N9GB 2YDYA 4NCNA 3AUUA 2VT7A 2ZSJA 4UQOA 2FSVA 2JJYA 1EVJA 2JIQA 4AP9A 4E3WA 4FOPA 1I2AA 3BREA 1RWXA 5A06A 1WIWA 4MV6A 3SJAA 4D3YA 3ZZUA 1U8XX 1IZ9A 2XJ4A 3ENVA 3JQEA 3L0CA 4ROSA 3ZJVA 2OCAA 3W04A 2H1CA 4XQCA 4A2CA 1YE3A 4FN4A 1NQVA 2IEAA 3QYAA 1YJCA 2A9VA 2FFRA 1EFDN 4HWOA 1K2VN 3M6AA 3HSSA 2QZ9A 3G6KA 1ISIA 1V1RB 2FMXA 2QQGA 1M75A 3GP3A 2NSYA 1QFSA 2JCYA 3SVZA 2VAVA 2BN4A 1CPYA 2DM6A 2VKTA 3CUVA 4I1OA 5JSYA 4DJDC 3FWKA 2ZVQX 4QUIA 4ZDIA 4AJKA 4MQFB 1PZGA 2QVZX 1MC1A 4M1WA 1PWYE 1S02A 1Z36A 4M0MA 5IKXA 5FF9A 5JVDF 4MUJA 2Q9AA 1DWUA 2YJTD 1N2OA 3OX4A 4WOKA 4D8UA 5AJVB 4ZI2A 1R1DA 1L9XA 1YS2X 3GLKA 5E6UA 4GOND 1U6JA 5ALZA 3JWJA 3FBGA 1WCV1 3PVCA 1AGXA 3NFYA 3Q1KA 2D1YA 4DXAA 1IVYA 3EXFB 1B16A 3B89A 3IKLA 2JIOA 1U3DA 2X9GA 4CU5A 1MENA 2H4JA 3SF8A 2BFPA 3L4SO 1G6OA 3Q8LA 1N5MA 2PRYA 2RCNA 2Z98A 3D54D 3FCCA 2WE7A 4D57A 4N9WA 3M9LA 3TX2A 2XVZA 2VOEA 2Q29A 4BNZA 4Z54A 2QR3A 4PX3A 2GWHA 5J40A 3QKRB 2F8MA 1FTNA 2NZ2A 2D7DA 3DDCA 2PBLA 2ZVPX 2VI5A 4BDTA 3RSGA 4JU9A 2DLCX 2VP4A 4UTPA 1E8DA 1E92A 2PYZA 4HYTA 3G9ZA 2X7JA 4C4AA 4OK6A 4R81A 4RFLA 1AO3A 3WKDA 5LIRA 5FWXA 5BPHA 4ZOLF 3RFUA 3RB8A 4WXHA 2YV5A 2ZW9A 3JRWA 5GAJA 2AF3C 4R9NA 1JFFA 1M1YB 1M6VA 1UOEA 1ZUNB 3K70D 2VF7A 5KSWB 2R3SA 4MGYR 4QYIA 4DEXA 1CY7A 2FN8A 2OAEA 3DZHA 5GJWC 2LP4Y 3DE2X 4LXGA 4DWWA 5LP6B 1W1WA 1BX1A 3N2KB 3PTLA 1PF7E 4TL7A 4YHBA 4ZKDA 1E9SA 2HR1A 1P33A 1G1MA 1RXIA 2D2XA 1U8CB 3BF7A 4AO8A 3K9GA 4CL2A 4GVPA 5BQXA 4IHKA 2FW1A 5IK2A 4OGFA 2FDRA 3UHPA 4YWJA 2VH1A 1GNRA 4RKFA 1YA8A 2ZEJA 1GIAA 4C89A 2FN7A 3IOEA 3JRXA 4KL8S 4RFVA 3DUWA 2PN1A 2YJZA 3ZCQA 5DX0A 1TK9A 3GLFB 4J76A 2LPMA 3DF7A 4QRHA 4EHNA 2YHIA 3IPRA 4JLSA 4QUHA 4ALJA 1UZAA 1F8YA 1AQUA 1PT8A 5K8JB 2A4MA 3EDQA 5KTSA 3JASB 3VHQA 1ZHHA 1QQ7A 3AJEA 3A37A 2IOYA 2I2WA 2YMMA 3OIUA 1RAEA 1KTVA 3INRA 4QEDA 2XDQA 1N5JA 3GJXC 4LGMA 3TD6A 2A3NA 1IU9A 1YB1A 2IZ1A 2VRCD 3K72B 1V1RA 1F6WA 1ZUIA 4NCXA 4P0TA 3HUFA 3PXUA 3MAJA 2CLEB 3MRVA 1FS5A 3U4QB 1USIA 2ESRA 1U94A 2R4TA 3N6VA 4FHGA 3UGJA 2I7VA 1G9XA 2XI4A 1TM5E 5AM3A 2H1LA 4H3VA 4M7OA 2OYCA 3DL0A 2CVZA 3R6GA 4LRWA 5ECWA 4BO0A 3DL7A 1UQUA 3QITA 2LIVA 3UJDA 4ZZIA 5ARCA 6YASA 1XHLA 4D2IA 4AWAA 2R79A 1E2LA 2GB4A 3FHLA 2J45A 4PO8A 4AS2A 3WGMA 5L9AA 1H4TA 3QOXA 1MOSA 2CFIA 4HNQA 3HKBB 4RTLA 3QXCA 5BSTA 2GPTA 4X45A 4R3WA 2RGDA 3NP9A 3KV1A 1Z7BA 1N2EA 4FZ3A 3KJNA 4ZQIA 4GBED 4IJMA 4UTVA 4FIDA 2CB9A 2PFKA 3R9XA 1XKXA 1ZN7A 3E0QA 2OKCA 5KKAA 1N1GA 4EA7A 5HKOA 1RJDA 1VE5A 5DCUA 1Y89A 2E5FA 2AFIA 2FXIA 3D0KA 3N59A 1IG3A 2HSWA 2OZVA 3L0DA 1SBQA 2J3QA 1SXJD 4P81A 2O0HA 2WKRA 2RH9B 4IRUB 4C6TB 2I78A 3HM2A 4HDCA 2DUJA 4L5AA 2Q5EA 1JUDA 1UPTA 1AB5A 2Z8YA 4DSZA 1SC1A 1TQHA 3DDNA 3ZKWB 1AK1A 4IEEA 4BEJA 5FDFA 5IF3A 3P0JA 1R0CA 1U90A 1RI1A 5BV1A 5BRAA 1PHPA 3TQQA 1CVRA 1KQOA 1Y4SA 1NLZA 1HDCA 5A0VA 2PD6A 3GR6A 2OENG 4LBVA 4RS3A 2XE7A 4EJSC 2VUUA 3IEPA 4Z7OB 1S2OA 3L18A 1QF9A 4CLOB 1BXRA 3DCJA 4YN3A 4TN5A 1LLCA 1KMIY 4HGYA 1GZSA 3D6VA 4LAFA 3R6LA 3VH2A 3VXKA 2B8JA 3H75A 1J09A 4BMYA 1UXOA 2M6SA 3TIIA 3AHEA 1R8QA 2M32A 2H08A 1PFUA 2Z1MA 4QYSA 3RS2A 4B82A 5FPQA 5KOYA 2QSJA 3CSUA 5DYYA 4G8BA 2FCAA 2A14A 1S2DA 4MVCA 3FYHA 3RJ5A 3GCWA 4EJSA 1RT9A 4R7TA 5K2OA 4U00A 2Q6LA 3QU5A 3WGHA 3O5AA 4II7A 2ZI6A 1WXIA 3RROA 1OWOA 4PO1A 3LYUA 2PVPA 2O8FA 4KXFB 3FPFA 1KMHB 1WCYA 3VTFA 5ALTA 2W98A 3KAPA 2J4CA 4NV1A 3ZJYA 3RK4A 1IL0A 1HV8A 2CNKA 3UJ6A 3PI7A 3EG9B 1VHJA 4X9XA 1BMDA 2JFBA 4ZOCA 3RHTA 1SXHA 3LQ1A 3CV3A 4CDNA 2FF7A 1TLTA 2X8BA 3MJDA 2OV1A 4F5ZA 4QAQA 2GN0A 3KOOA 1J5XA 1XO1A 2I67A 2JA1A 4JKOA 1I4DD 2HLNA 3I23A 3QBDA 4RZ3A 4YCCA 5HFNA 4RCVA 5FP0A 3U6BA 1RCTE 1Z15A 1QYDA 5FH9A 2LKDA 2FPXA 2PPLA 3AM3A 3DBHB 4BDSA 2PWZA 4G01B 4JVNA 3EVNA 4Y7CA 1JAIA 2QMUA 3I2IA 1RKQA 2NSLA 2WLTA 2WWHA 4GWLA 4MVJA 3TO5A 4BRZA 2FUCA 5LXTB 1M7HA 5GZ1A 3EW7A 1FXWA 1ZNXA 3PUJA 5I9MA 4ZEOA 2BKVA 4F11A 5LZ5A 1QBGA 3FPEA 4GOLD 3HKBA 4NJOA 4B79A 1GNVA 5B2EA 1WMDA 1R0BA 1ZGGA 1ZNYA 3C3CA 3K0BA 3X1WA 3ZWKA 4AY6A 4HAOA 4ZCMA 5AW4A 1X74A 4CL0A 2XIJA 1QUEA 3ZU4A 1TEZA 2IUEA 3HUEA 1NMQA 4UCQA 1Z26A 1FFDA 3DMYA 5KEIA 2B1GA 1V2GA 3O4IA 1YUMA 2EBFX 4RQBA 1DC7A 3S1SA 2IGTA 2IPMA 2MYNA 1DX4A 4ZCQA 3KZ1E 1X8LA 3CGGA 3IUSA 4Q47A 2D2FA 3TYXA 3GLTA 2DWOA 4MRVA 5DSTA 3UAXA 1JTVA 2A5JA 4X64B 2J0VA 1EWVA 2FPRA 3U7QB 5IPFA 3ZKWA 3AH8A 1IUKA 4BE9A 1C1XB 3VH3A 2PUTA 4QSMA 3CNNA 4FR2A 2NPIA 1JYFA 1QGOA 1CZNA 3QLUC 2HV8A 4JJ6A 2YWFA 2AG6A 3VC3A 2B78A 1BXGB 2W6ZA 4RTJA 4B46A 2B30A 2XCOA 3AOEC 4O4LF 4AXBA 3QV2A 3UIEA 5GZ3A 3WLMA 4UDNA 2OFFA 5LYYA 5CFMA 2G5GX 5AXDA 4B33A 5BNWA 4RADA 3EGDB 2BLNA 1DAEA 4JKIA 1HPLA 1NMYA 3V1LA 5HRUA 3NNSA 3KLOA 3QLUA 2VF2A 3T5MA 2IXTA 1DCFA 4U7GA 2V58A 4G26A 1Y5NA 5EJAA 3VYSB 2BZSA 4JWTA 2PGOA 3AOEA 3UK6A 2CBXA 3BHIA 4D25A 1QC5B 5JMTA 1KMHA 1EP3B 5HUJA 4QNMA 5FBHA 3FI0A 4XIGS 5F5XA 1WSBA 2GUGA 3EG9A 3X0DA 5JRJA 9GPBA 5ESDA 3PKJA 5JXWA 1M2FA 2VLIA 1R18A 4ME6A 1J00A 2RKBA 3UT0A 4C07A 4QWMA 4YT4A 3H2ZA 1IHDA 2PBZA 5KBYA 1NMZA 1YACA 1JFTA 1U0EA 4UE2A 4XVQA 2C54A 4FMBB 3KE9A 4LJKA 1I7PA 1U3WA 2YWGA 2RHGB 2VPIA 1F48A 2OAQ1 3AW8A 2HU7A 3I52A 3OF3A 4OF4A 4ZOEA 3DL2A 5B5SA 3GY0A 3HO8A 1R0SA 2BR3A 2HHAA 3QJGA 4GYJA 2DQYA 3KKQA 5FTKA 4HP8A 1SRQA 2YWDA 3H1PA 1NN0A 5IAEA 1DXQA 3V8RA 2XMRA 3U13A 3D3WA 2YXPX 1CD5A 1Z5WA 1ZVJA 3ONDA 1E1CB 1H5NA 3ZGVA 4C2BA 3ODGA 3JVIA 3VX4A 2QR5A 3D2LA 1N9KA 4ER7A 4LCEA 3L6BA 4EG0A 4FKBA 1NR7A 1KVRA 4HNTA 3GPDG 1VPEA 4H6VA 4CG1A 3T3OA 1BCRA 4DNOA 4IIYA 3ZCPA 5T3UA 1O96B 5BWBA 5BQ5A 3LQ4A 3DT9A 3IBCA 1O54A 2V4ZA 3LP8A 1J07A 2Y3IA 1GPH1 3H17A 2PNJA 2O8CB 4JMPA 1UBHS 1JSXA 5DYIA 3VBCA 1V7PC 2DJIA 1N2SA 3BIOA 4QYWA 5E2BA 2AEJA 1H1LA 4JHLA 3O8OB 4OLAA 3ROQA 4BRUA 1EP2B 2IUTA 2OGTA 2POCA 3HPRA 3IP6A 1GFWA 3EIHA 4RORA 4YWHA 4C87A 3V5NA 1GAEO 5BPFA 3B6KA 3A9CA 1DKLA 4KRFA 2RG7A 4GLBA 1GU0A 2NVBA 5E9QA 3U4CA 2KS6A 3WK9A 4AJ1A 1RAGA 1A88A 2ZIZA 4JKYA 1EM6A 2RBEA 3U3MA 4BNDB 3WGUA 2JS7A 4N65A 3BIWA 3ILVA 4X7PA 4ITUA 4KR2A 1KQ3A 2EBHX 3OIWA 1LC0A 2BL4A 4ESEA 4KPYA 2BMFA 1J0EA 5ANRB 4CMJA 2XITA 4YREA 5KNCD 1EFKA 4BLWA 4GM0A 1PWXA 3IX7A 2IU4A 2Q1XA 3TDKA 5IP5A 2Y1EA 3G8CA 1RXWA 3F96A 4EO4A 2DBRA 1U0SY 2V5AA 3K6JA 3VPGA 1HDIA 2XMGA 3OT1B 2IKQA 1DO2A 4RA6B 6ABPA 4NPHA 5A7HA 3PGA1 2H9IA 3MWJA 4AM8A 3NRCA 4QU5A 3RD5A 2D2EA 4XR4A 3MK31 4BO7A 4L08A 1EE1A 3JSAA 1T9AA 3FNBA 3H1BA 4KWCA 2OT3B 3H7IA 5JXHA 3L5KA 3NDIA 1AHNA 4DSOA 4NQZA 2QI9C 4ZALA 4OHZA 1AF4A 1ZG3A 3SMVA 1H2HA 1F0PA 3OOEA 1QRTA 5DLYA 2X6QA 2H0QA 3C8ZA 2QAJA 1I7QB 1A9RA 2KMLA 2O1SA 3A9VA 3UA3A 4FFNA 1KPHA 3NVKI 1BC5A 2WJYA 4EENA 3ZDAA 1LQUA 2PXHA 4FOSA 2BVNA 3KC2A 1P1BA 1PGQA 3GRFA 1ADJA 4A2WA 3ILSA 1G3RA 2FN9A 4W9NA 3QYPA 1ABFA 3I01M 3RSHA 3CCBA 3G8BA 2PEYA 1N32B 4GBGA 5KTYA 4F72A 3EVAA 1KF0A 3GJ5A 4NBUA 1OH5A 3VR4H 3F7NA 4IIHA 4Q48A 5C4GB 1JQEA 3A04A 3BD6A 1DRJA 1LBSA 3JYQA 4FYWA 4GMXA 4NOKA 4Z4HA 5JR3A 2VJMA 3I4FA 3MBKA 5D2CA 1KBOA 3HB5X 5AJZA 3MGCA 1FS6A 2R6CA 3HZOA 3V4OA 4C78A 3H19A 4QDTA 3VC1A 2AQ8A 2ETXA 3TIXB 2R5FA 1E1CA 5AW6A 3VYVA 5CT6A 2SICE 3IEKA 4LJ4A 1IHYA 3RFFA 3WL8A 1WQ4A 3M4XA 2QN3A 5JHHB 2VDJA 3DTVA 1T25A 3A4YA 3WO1A 2PUBA 5AVYA 4KOAA 4LOJA 2REOA 2H1FA 3FUTA 1NPDA 3P0EA 4DIMA 5JCOC 1CR6A 3U7RA 4ZODA 3T9EA 1AQJA 4GKBA 2HLDD 4AW9A 1HT2E 5EIWA 3RYCA 2WPDD 4V0KA 1CQZA 5TB5A 2P41A 2WICA 1T4GA 2A0UA 4PHCA 4BV3A 3ML1A 4WXPA 1FQKA 2YRFA 2FSGA 3EODA 1E1RD 4GICA 2FPIB 4HXYA 1PZXA 3EAQA 4Y6PA 3RRNA 4Q9HA 4M7WA 1T5LA 5EESA 2VBFA 2IHNA 1XRQA 4XA8A 5JCOA 3D7RA 3R5JA 2H92A 1XMOB 4Q15A 1J33A 1PRYA 4JOCA 2QPOA 3PR2B 3SIWA 4U5QA 3C1TA 1W0KA 3MQ2A 2BJVA 5HFAA 2WG1A 9ABPA 1SXJE 2RHBA 1YIDA 4D3ZA 3UANA 1RPNA 1AM4D 1T13A 3S2YA 2V6FA 3RC7A 3SHWA 4D4HA 5C8ZA 3KWJA 5J1SB 2O2JA 4P4GA 5F1OA 2PJUA 3LUDA 3EGVA 3I62A 1Z7EA 4J29A 2GUWA 4LK2A 4LXXA 5AVJA 5IVKA 3K73O 3B13B 4BCDA 5H4GA 1W5TA 2OWEA 2P6PA 2BHNA 1HFJA 2ZUWA 3GT0A 3G2NA 4FZVA 4RBNA 5EWLA 3GI1A 2EF1A 3EJ6A 3ZDXB 1YCGA 3KYBA 4MR7B 4DLUA 2V3CC 5B57C 3K96A 2DETA 5B7NA 4P82A 3ZE2B 4O4HA 4CMGA 3JWHA 1YZLA 1IBMB 5E7JA 3FTNA 3L7KA 3MINB 5ALJA 3TPFA 1ACLA 2P4UA 2H2HA 3IXLA 1XSEA 2ON6A 5FUBA 3FOFC 1EK2A 3QX9A 5TS3A 2Q5LA 3B52X 3BSWA 3LS2A 1FSFA 3FE2A 4G4SO 5GM2A 1YC2A 4RGQA 3AINA 5DE3A 1CS0B 3GJRA 5CJPA 4XASA 5MN5A 1Z5VA 1VYUA 4IW3B 1TTQB 3VYRB 2YBEA 3QX8A 1LJ8A 4RY8A 4CQMB 1YBAA 3Q7QA 3IQXA 3OTQA 4MVYA 4Q82A 2XECA 1B4DA 4KYUA 3TJMA 4DDVA 3REGA 1H1TA 1NATA 1W4CA 3WC4A 1LWOA 1ORTA 1ZCBA 4JGGA 3JZAA 2IW1A 1SCJA 3LL7A 4WACA 4BJ5A 4DY4A 3DLPX 4M37A 1TO1E 1TKCA 3X1YA 1NY5A 5FD8A 1LWNA 1NNSA 2C07A 4RHCA 4YJHA 1OI7A 4Z4GA 5FFFA 4MQBA 2ZRIA 3L07A 1FTSA 1U31A 5TMDA 3DVQX 3WDKA 5KNBH 3VJRA 4B4WA 3K0AA 3C74A 1ZK1A 3RYIA 1HLFA 4TKVA 3FW1A 1HQDA 3TCNA 3BWEA 4JQYA 3TSWA 2BZ0A 1NVKA 3KQSA 2DB3A 1JBQA 1TZ2A 2DYKA 1LI7A 2XBUA 3IUQA 2K2QB 3QIVA 3K1TA 4MYSA 3KJXA 1YJ5A 3MWDB 4L2IB 3IEIA 1ISJA 3M4JA 4J90A 2C99A 2K87A 4DM7A 1CB0A 3AILA 2YJNA 4JYZA 2DHCA 4KQ1A 4C5AA 4AXXA 4FQ5A 2XRMA 5CYFA 2JLBA 3T3HA 3SJBA 1SOUA 2JLRA 2F90A 5K4AA 3LVQE 5HPYB 4OHFA 4W5TA 1E0AA 1CW2B 5DLDA 5LDGA 1N5OX 5H8WA 1ZOPA 1CFJA 2IHKA 2VNJA 2Z2YA 3JXEA 4I99A 4TWZA 4UE6A 2C2KA 5TS2A 3A1DA 2R7AA 1GO2A 1WA5A 2YCLA 1F2TA 1G5IA 4MUMA 1YI8A 3AR3A 3PHCA 2I7TA 2RGGA 3FROA 1VYHA 1U8TA 3ZHVA 1E5VA 4ZHQA 3TUZC 2PX5A 1KFJB 5DLEA 4I9UA 1M1NB 1SHUX 1PO7A 1VKRA 2DFTA 2ONKA 3DO5A 3OQPA 3LYLA 4RPLA 3UJ9A 1MA3A 3LW7A 2O5EA 3A9UA 1ZA1A 2P5UA 1TM2A 3KB6A 4GE3A 5AIAA 4TTIA 4J2HA 1I36A 2D0PB 2H1RA 5HKAA 1AXEA 3W34A 4PS0A 2KW5A 3ESBA 3GARA 1IM2A 3JYHA 4G8DA 4I36A 4EUFA 5IJZA 4F4CA 4MR7A 5EHXA 3M6XA 3MILA 4RPJA 4PSKA 1E6UA 4G4JA 4G5GA 5KU7A 4KE6A 4MXDA 2CBZA 3JD4A 3PNYA 4UD6A 4QWWA 4ZCSA 3BFXA 3I73A 5FUQA 3SS8A 1VL8A 3PUIA 4EY7A 5L6MB 2VWQA 4CCSA 4MDFA 1KH3A 1W35A 4H6WA 4Y3UA 1Q0QA 2CEAA 1C9KA 4R1UA 4PPFA 5K0EA 1BDJA 1IC6A 2G40A 2PL1A 4J7XA 1Z29A 1CRPA 4DA8A 4LJ5A 1EWQA 2RC5A 4I08A 3QFTA 2BEKA 4H3HB 3L6EA 2F3QA 5JD5A 5DULA 2HSZA 4U63A 2P9QA 2EC5A 2WU4A 1NVFA 3DL4A 3ILXA 4JEIA 2WZCA 4JP8A 3ID6C 4Q93A 4YJ3F 4DT1B 1IN5A 4FS3A 1BFUA 3QE2A 4G5FA 1YRQA 1H9CA 3H1GA 3NEAA 2C7RA 3K35A 3P9SA 5I8ZA 2PKEA 3CKMA 4IHQA 1OXMA 5KYNA 1ESDA 3OLWA 4XXHA 2HOQA 3O9ZA 3ZYZA 2I9PA 2FA9A 2MINA 4E1VA 5CDFE 1QTNA 2G63A 3ADKA 3JPYA 5H83A 1KOFA 1GNLA 1O8CA 4B71A 3LV8A 3QVMA 4GOJA 4TS3A 1DLIA 5GV8A 1U8ZA 2P2ZA 4NBLA 4D9KA 4TVSA 1NV8A 4TV9B 1F4PA 3IOBA 1O5IA 2G9RA 4EF4A 4U8GA 2OBFA 2PR7A 4X41A 4W5NA 1ZMTA 3EYAA 2BSQA 5CT5A 4HF7A 4KH1A 4L2IA 3IUBA 1Z0DA 3OZUA 4OXXA 4WESB 4MW5A 1LI4A 3I09A 4N7RA 4WJKB 5TE9A 2YMQA 1EDDA 2DWUA 5TJHA 3CG0A 4B84A 4KW7A 5LSAA 3WLJA 1SZPA 3DWGA 4LRYA 4DR1B 4QOFA 3AW9A 1I3LA 3MERA 1MFPA 3BA1A 1P1KA 2YW9A 4IVPA 4KQKA 4QQFA 5GY7A 2E4WA 3CLHA 1B3RA 4X94A 2Y2VA 3DMTC 3H4VA 2GKGA 1KU0A 1JU9A 3GFBA 1GU1A 2Z04A 4EIWA 4RKRA 1RWNA 3H9CA 2J5RA 3E7PA 2HA7A 2FRVA 5G4KA 2EX4A 4JP5A 2OAGA 1SD2A 2Y0CA 3KQPA 1HQKA 4FFBA 2OD7A 2RGBA 4UBIA 3KKKA 4YB8A 4C08A 3VR5D 3D0QA 2MJLA 2YUIA 3DMTA 4KFRA 3RJZA 2HDOA 4C05A 4JAVC 1UMDA 4XB2A 3UMMA 3B70A 1NBOA 4B3MB 4OYYA 2O2SA 1NR5A 1I4LD 2BONA 2WJGA 3GLGB 1XZHA 4J3FA 4RMJA 3DZIA 5AKKA 3RI3A 3JSXA 2E89A 3TRFA 5LDDC 2W37A 3AJRA 4BO8A 1CDZA 2VUIB 4B75A 3FNGA 1G6Q1 1DTSA 4I55F 2J5XA 4WUTA 5IDXA 2WV9A 5HW0A 4O63O 3OT4A 4QG3A 3LZCA 3WKBA 1EMDA 3MMPA 3DZ8A 4FDVA 4PX2A 4EVIA 1AA6A 1SU7A 2GCPA 4OYRA 4J9UE 2O54A 1LLFA 5K3SA 1GYQA 2P40A 1UAGA 3FSGD 3CF6R 3JQ8A 5GTDA 1X1QA 5F3WB 4LHYA 1U8AA 2PQ6A 5T3YA 3RRJA 3WGJA 5ESWA 3NS7A 2A9PA 2CK3A 2QN6A 4X24A 1RI4A 4MUKA 4HAWA 2EKZA 2H2AA 2ZI7A 3M49A 4HLQB 5D51S 5TC4A 4E14A 1H6DA 3BYZA 1N0UA 2D2IA 1KMQA 4LV5B 1HYBA 1QYXA 1TI7A 4CU2A 2XUIA 3UPDA 3OVMA 4J1TA 2G1AA 4FYMA 3QFCA 5FPKA 1PFVA 3G0CA 2C7GA 4B7CA 4HMPA 2HA6A 1DQRA 4DQUA 1JKMA 4UXIA 5CCDA 2CMHA 1KOGA 3IPXA 1VBKA 2A9FA 2O2IA 4XWAA 4ANFA 4F46A 5KB3A 4HN2A 1GUYA 1OKKA 1QIIA 2XUAA 3DZKA 3H83A 3GD7A 3LP6A 4R2JA 5FOUA 3TD2A 1PYOA 4CHGA 5BVHA 1PQUA 2DKNA 3A4IA 3PQ3A 4EGQA 5BR4A 1Q7RA 2YN0A 4TLEA 1IUNA 1MAWA 4BEVA 3H6HA 4Q66C 4DR7B 2WWVD 1E2IA 3FXAA 3KUUA 1CZHA 4JJGA 1XTZA 1LC3A 3LT2A 3QENA 3A1WA 3WYAA 5BURA 3ETCA 3A6GA 2HREA 3QYFA 4KIUA 2XUJA 3PL5A 1ODLA 1B2RA 4XJTA 1IN4A 2GZSA 3F47A 4WESA 3AIKA 4B43A 3ME5A 2DCMA 2CLMB 4NZYA 3S1AA 5J2TA 3A28A 1JJ7A 1ENZA 1EQ2A 1P31A 3LOQA 2ZE6A 3W5JA 5IXSA 3UM9A 2F1IA 4NCBA 1MUUA 1SA0B 1RTKA 2ZR0A 3BXPA 4ZEMA 4XFJA 3N7AA 3S40A 5JQGA 1TAHA 3GAFA 3IV9A 3V8QA 1FK8A 2ZT6A 2ZBEA 5BYKA 3EZFA 4C76A 2VYND 4AICA 4D82A 4MINA 1TO2E 1RHJA 1ATIA 3K09C 1QK5A 4GR4A 4J49A 3HB4X 4FHZA 3VDNB 2HMTA 3GLSA 2Y67A 4JI4B 3MS7A 4O4JA 1EFCA 4RVOA 3O3MB 1QH1A 3DO6A 4B6QA 4DF3A 1NUPA 3PHJA 3T3NA 2ZGVA 1HE3A 3SYLA 1T29A 1ZM9A 2R86A 5IM4F 1ZDMA 4H1UA 4GPTA 1K0FA 2R25B 3KIPA 2F8SA 3V7FA 5AM4A 1H6CA 1XVAA 3G0DA 4K8OA 4LWOA 3A4TA 4CFSA 3K09A 3QKTA 1M6HA 2EJCA 3K0CC 2FVYA 2PSSA 2Z09A 4LSWA 2FEAA 4MQMA 2OSBA 3KUDA 2J9FB 1NN1A 4RX1A 2C9OA 4HH1A 3IXMA 3RQIA 3KQHA 3RC8A 4TSFA 2FLKA 2GRAA 1WP9A 4TTRA 4G5OA 3R7AA 2JRCA 2NADA 4P3NA 2Z5FA 3U3OA 4BE4A 2PKCA 4MKIA 4CTJA 3U7GA 4HDNA 4NK5A 4ARUA 2W4QA 4HJXA 1E2NA 2SBTA 4P0PB 3JQ9C 4C3UA 3BQMB 3K2IA 3P2MA 2I4MA 3B3GA 2RHHA 4UHKA 5DT2A 3K0CA 4DLYA 1SU8A 1ZPDA 2P1RA 3AY7A 4FK8A 3SJCA 1E3IA 1O89A 2CNLA 2PRSA 2G6TA 3MWKA 3I5XA 1RHQA 2BBOA 2VEOA 2H5IA 4K0KB 3AF2A 1A7JA 3D0OA 3KJZA 3PI6A 3V1YA 1WXDA 2HO4A 4DQXA 3HN6A 3JCZA 3BFPA 1Z0FA 2B92A 2H8KA 2LNDA 4LC9A 3JQ9A 3LRTA 4P7KA 4DLKA 1MC5A 2GPNA 1UMBB 4UC0A 1P7YA 2GSDA 2HSJA 2NO1A 2GLTA 5M29A 5KWEA 3EPLA 2PT9A 2H3EA 4XTCS 2LGJA 3EQ6A 1IZYA 1DO8A 1PFYA 1S7GA 1UBLS 1Z12A 3GLQA 1CY0A 2QRNA 4GZLA 2R6AA 4L8WB 3E8XA 3MN1A 3JX9A 2ZTHA 5G1OA 3NIFB 4L16A 2HUNA 4LJ9A 3PTZA 1J8MF 4OX9Y 2Q4RA 3LLCA 1KJZA 3E9RA 3MQFA 3FRHA 3ZHRA 5IULC 1UANA 3WWOA 4DXDA 1KO7A 4GMFA 1QE0A 1EPUA 1YO6A 4WZZA 3IL2A 3HSYA 4YBRA 1DKNA 5JNTA 5TR9A 3W4JA 5IC6A 3W9SA 3DW3X 3HLKA 4NMWA 1JG1A 3LTNC 2XJ9A 2CCKA 1WAMA 5H81A 5T5QA 2QVCA 5IXJA 2OYSA 5IDWA 3KPYA 1MG5A 1NRJB 3BZBA 2XODA 1JNYA 1K0UA 2K5UA 3G8DA 2CUTA 2WNHA 1RYDA 4LZPA 3C6BA 4DLLA 4G8CA 4F0JA 3O94A 4QO7A 4F2GA 4NHOA 4B32A 3UW3A 3ZY4A 1MEOA 1ISPA 2O8VA 2ZK7A 3CX7A 2CLKB 2Y1FA 2ZPTX 3AI7A 4WJZA 1X1SA 2XWPA 1OXUA 5WRFA 1UFKA 4BV9A 2H0RA 1XPRA 4CM4B 1QR6A 1C4KA 1NXVA 4DABA 1K06A 2ODPA 2WSMA 1RLJA 1S1CA 5DIZA 4ML3A 4GX1A 1QDEA 4N3BA 1AU9A 4WL0A 5CVJA 1A8QA 3M2TA 4W7IA 1MRNA 4DCCA 2AFHB 3EDMA 1FDRA 2NTNA 1HGXA 4J16A 4GI7A 4X60A 5B58T 1VSUA 1G21E 3UF0A 4M88A 2CXNA 1VCNA 2DPLA 4XARA 4JI5B 4AX8A 3ZWWA 4E07A 5B12A 5C34B 1GG5A 1GSAA 1QGDA 1S2IA 3DG9A 3T1OA 1CZLA 2Q6IA 1X7XB 3NTVA 2A0FA 2J9FA 3VYTB 2WVJA 2UXBB 3TVTA 2O4UX 2QRHA 2R6R1 4EWLA 3T3IA 2QQ5A 2OV8A 3NHYA 4WI1A 3RBAA 3FDXA 3M34A 4KNVA 2VS1A 3ZXSA 1I3NA 1TIKA 4RD6A 4HAYA 3PGVA 2EJBA 4ALNA 5JCZA 4LRUA 2FGKA 4W7SA 2J08A 2H4XA 3WFJA 4EG4A 3KKEA 1BW9B 1KHHA 3OLXA 4JJ7A 5DM2A 1NW4A 3PFFA 4ZV9A 4PLFA 2DFVA 5EXTA 1MD9A 3CVJA 1GGNA 5HCIA 3G0OA 4MTLA 4LQCA 4DV6B 3ZNOA 2CNWA 3KXKA 5EFZA 1UXHA 1W36D 1FYFA 3HZHA 1PVVA 2JH8A 2VJYA 1I32A 5IWAB 4WQMA 3ROEA 1P7ZA 5DJ5A 4YRPA 1WHSB 2GX6A 2OCIA 5ALQA 4E4YA 1F38A 1HEIA 1X0XA 2SKDA 4M9XA 1VA5A 5EOVA 4I81A 3V9AA 4RO0A 5K6TA 3F9IA 3MFYA 3T38A 2VPQA 3VR4A 5EJMA 5KJ1A 2AZXA 3UAGA 3GVXA 3DVSX 4YQEA 2HC9A 3RT7A 2CVOA 4WKGA 4CKZA 1DKUA 1K08A 1G66A 2GI4A 2Q3BA 2SKCA 1SCBA 4YAGA 4B6EA 4X85A 4E4TA 5HE8A 3L2OB 3OKFA 5HDBB 4C5CA 4WY8A 5K3EA 2W8ZA 3DV9A 2OVFA 3DTTA 4C7BA 2OXTA 2F4VB 4CQJA 4WZAE 3ZE9A 3L02A 4TUYB 1FX0B 5KYVA 3X3HA 4IFBA 1KK1A 4J4HA 5I8PA 3FRIA 3S2IA 3AQIA 1W48A 4O59O 1I5RA 3IH5A 1E3WA 4P7JA 2O7NA 2AOTA 4WINA 5DH9A 5CG2A 2UYCA 2NVOA 4LN1A 3M81A 4X93A 3T7AA 4BMXA 2WZBA 2GFQA 4K9KA 4KODA 5L3QB 4YP1A 2PANA 1SC3A 2P3SA 5IWCA 1I5OA 2JGFA 3KTDA 1OHHA 3I39X 4YDRA 1TD9A 5IJ9B 1CC1S 4P4SB 4RHXA 2P2YA 2IXDA 2CLSA 1OVMA 3DNFA 1ZONA 2IYXA 1QHSA 1H2FA 2W48A 1OXVA 4JFRA 4G0PA 4ZO4A 1PZNA 5C1OA 4Y1RA 5CDHA 2JI6A 3HKCB 5GM1A 3NV7A 3AV0B 2UU9B 1WDLA 2VG8A 4MVWA 3LDAA 1G3UA 1GKYA 1ULSA 5EJ8A 3CXRA 1NW7A 1PL0A 1QRUA 4BZWA 4YJKA 3PV0A 2Z6VA 1O3YA 1DBRA 1T8UA 2BFDB 4Y18A 2NYUA 1MFZA 1J2TA 1ATZA 4HQFA 3L8FA 1L7EA 3RS4A 1X80B 3PXXA 2EJTA 2PUEA 1D1TA 1DJQA 2BCGY 2F3TA 4FI3F 3CKLA 2E4XA 1FFAA 1Q7GA 3KEFA 3UMCA 3LO8A 4X1IB 4L22A 2Z95A 1XL0A 4LTDA 4N6OA 5CBPB 4IJUA 3RVKA 2QW1A 2VQEB 4RU1A 2IS2A 4DEVA 1Z16A 3NDPA 3GAZA 2WC1A 4ZEXA 1OC2A 1W46A 3PLRA 3PR3A 3TEJA 3GXOA 4CUZA 4AJ4A 1UEIA 1DWQA 3OF2A 1QVAA 2PCLA 4KVAA 4KZPA 3GDHA 5P21A 1KXJA 1T9CA 2ORIA 1Y1KE 3GRVA 3WLRA 1JE1A 3L6UA 1ISRA 4Z7JA 1EUQA 2HA4A 2XE4A 1J6UA 2Q3MA 4DN6A 4EKGA 3HI6A 4LTNA 4JNCA 3PJEA 4FEGA 4H7IA 4R1TA 3TBFA 4U9UA 1XKTA 2IYPA 4OJKA 4DLRA 3SFZA 1OZHA 1C9YA 4U2EA 1ZEMA 3D2CA 2BRUC 2IPXA 4XJXA 1GA6A 2WFZA 4ETWA 5FWYB 5C0OE 1P74A 2Q3JA 2C7BA 3BFVA 5HILA 1UDBA 4PGMA 4Q1FA 5I7UA 2G1UA 4KFUA 4PBTA 1M83A 5KNBA 4PY2A 3DDZX 5DYTA 5EXSA 1HZZC 1U7WA 4LXTA 3LUGA 2W22A 2FPPA 1ZHOA 3NHPA 4NOJA 4M0KA 1ISGA 3GUYA 3U5ZB 1H5QA 1NVVR 2AT1A 4JT2A 5D01A 5HVNA 1DAHA 4AF6A 1H85A 2IYVA 2OBXA 5CFQA 4AB1A 1RU3A 3ZG6A 5AMXA 3CPJB 3R6TA 1H65A 1IUPA 2GLUA 4YV0A 1JB1A 3AUAA 4U3JB 3SWWA 1R5JA 3CZAA 3DOOA 2FEOA 4R7ZA 4Z7QB 4KLRA 4RF3A 5CB0A 3HCWA 3IHKA 5AKLA 4R1PA 1QNLA 2A5YB 5DBOA 4F1JA 3UHJA 5EE5B 4DVJA 2DVMA 1YQXA 3Q8XB 1NQTA 4EB6B 4IMRA 1GN8A 5LIPA 1UL1X 5LOVA 3NPAA 4I6JA 4HXEB 1P3Y1 4TWBA 5EUBA 5HKLA 2QQFA 1EX6A 4EPRA 5CA1A 4ND8A 2XNCA 4B2LA 2IBTA 2Z6AA 1QH8B 2X1MA 3OURA 4FBMA 1P2FA 1U2QA 3EAGA 3NHRA 4X7BA 4A27A 4HGZA 1OAKA 4R0NA 2C7QA 4BX0A 1L5LA 1FJGB 4W4TA 2R9VA 3K9LA 2GHIA 3TXAA 4DARA 5LMCA 2W6NA 2OMEA 5DEOA 4YCLA 2MYUA 2VZLA 4TWRA 2ZB2A 5HKKA 3K30A 3FOEC 2X8LA 2WYUA 4I1VA 1CUUA 3LY8A 7GPBA 3HLTA 4RF5A 3ELUA 3SZMA 1SQ0A 3VA7A 1K6XA 1P0IA 2D1SA 3DE4X 3RV4A 1OJ7A 3HUUA 1Z4PX 3PUHA 4HPJB 3TEMA 3NGMA 3K0KA 4GX2A 2REQB 1ODSA 1TIBA 4X1IA 5EUQB 2O5VA 1BN6A 2P75A 4XQGA 1VI5A 4MAMA 1AQNA 1T5DX 3FNFA 2YWRA 1G5TA 3CF4G 4X3CA 3NT2A 4GU5A 5E1BA 5EJ5A 3VTKA 4F3TA 1T9GR 3ITKA 2WP8J 2ZIGA 6Q21A 4YC7A 3RO7A 2HGSA 3MJVA 2AC4A 5JASA 1XEAA 5CCXA 1ZVVA 2RGNC 4R3UC 1RRPA 4LDZA 1F20A 3UAWA 4J3JA 5BN4A 2OD9A 4C6RA 1JDSA 2GD1O 3PDCA 4K6OA 2VAMA 1UK7A 2ACKA 3EOAI 2I6FA 4LZNA 5LKAA 5F2NA 3DVAB 1ZN8A 1R9MA 3PX7A 7MDHA 3P5SA 4JA2A 3U0VA 4AFNA 4G63A 2WMOB 1W6UA 4PAQA 3I8SA 5LM3A 2LDXA 3L0YA 1LX7A 1X3SA 3L1VA 3WRYC 3C7TA 3T6KA 3CLSC 1QX4A 4OP2A 1MN6A 5G4LA 2RAFA 1G8AA 2O3QA 1NKVA 3QA3E 4ZVLA 1NG1A 3ZJTA 3VAAA 3AXTA 3T9DA 4GR9A 3I37X 1Z83A 3LLMA 4KGXA 5A0TA 1H2AS 4RA9B 2PM8A 1M6YA 4FFMA 2ROQA 3LMKA 5DXJA 3DMDA 4KRGA 4Z5XA 5AESA 3ANLA 2Z08A 4JYAB 3GFRA 1NVMB 3AR2A 2ISCA 4G56A 3HZZA 3MS4A 4N49A 3WRYA 2ZSEA 3KTAB 1J20A 1YR9A 5K0CA 1M76A 4FPXA 3DM5A 4DA6A 3QLJA 3S7ZA 4CXMA 3M6VA 3OHSX 1JIXA 2QVGA 3GUUA 4Z2YA 1NP3A 3KWMA 4GYYA 4OA5A 1P60A 1OD6A 4JYCA 5BN5B 1J42A 1FXUA 1P0QA 2QMHA 4XSVA 5JO9A 4EYKA 5H4HA 3VPHA 4HDKB 2IU6A 4KVFA 3ENKA 4G84A 4AMUA 3FVQA 4Q19A 1PFWA 1XEWY 6REQB 5K1ZA 1HYGA 4RCZA 4R2HA 2EIHA 1SCAA 3TIVA 1ENPA 2GCEA 1RM3A 3KXDA 1NR1A 4FKMA 2J6IA 2VYQA 4NYIQ 4MMXB 3ZJUA 1YOVB 3T0IA 5CW1A 1N25A 1TF2A 1XYYA 3GEIA 5HZHA 1FJXA 4IS3A 4D4GA 4D02A 1ABEA 1E6WA 3Q3CA 4ND6A 4OMCA 2DJ5A 2HGZA 5CK5A 5ICSA 4EY5A 2K4MA 5ICGA 4A4DA 5L7TA 1SFRA 2M1XA 2VHZA 1PJRA 3AVPA 1IZ7A 2JAUA 4G1VA 1HWYA 2P79A 4OGLA 5FFNA 4RTSA 4FSDA 2WYVA 4BNLA 1P61B 1F9EA 3NP7A 5KJEA 3W3AH 3ORRA 4OQEA 4EHDA 4HB0A 4MRSA 1RE0A 3UCFA 5KCMA 1PZHA 3JVEA 3L8CA 2OCLA 2DH6A 1U7TA 2ZI9A 4MKZA 3UYKA 5I9NA 4BO3A 4R71A 1E60A 3IVXA 2G5CA 1KMMA 4MVJG 2IUFA 3PU6A 4D9JA 2WM9B 2WKPA 1YZTA 4OAQA 5I7SA 2W6IA 2WJPA 3D3EA 4YPOA 1QU2A 2N1MA 2R84A 1VCIA 2GILA 4WOBA 4ER3A 4ZK6A 1Z2AA 4I4LA 2G7MC 4IH9A 4NG4A 4ZVVA 1JGTA 4UFOA 1H66A 3BHNA 1SRRA 2A94A 1XF1A 4E4RA 1IY8A 4HDSA 3MOIA 1MABB 2XNHA 1FDOA 1KK2A 3CR8A 2VJLA 2QN8A 2WU1A 3NC4A 3R6DA 1W4LA 2QF7A 2XYVA 4I5EA 4IDNA 4DGQA 5HRCA 3ADDA 4I5IA 3IILA 1KZGB 3UATA 4F9EA 1GFSA 1M6WA 1QHFA 1M8KA 1Y9EA 4V3BA 5HCNA 4ZTUB 1Q0LA 1E20A 3ABZA 4X44A 2NUTB 5DLPA 1SVMA 5C46F 4QGGA 2VDWA 3S7TA 3NHKA 5H82A 4TRMA 1XCPA 5ITSA 2QHXA 5MDHA 2C5BA 3HMKA 3K16A 3QF4B 4TLAA 2NU9B 2VAWA 3BRWA 1LDGA 4E2ZA 3F73A 2FSIA