2GF0A

The crystal structure of the human diras1 gtpase in the inactive gdp bound state
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
QSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein Di-Ras1
publication title The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 55
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gf0A00
3EARA 4BWYA 4LHZA 3LNCA 3AF0A 1TEVA 3PUVA 1JR3A 2Q3MA 2BHRA 3K0FB 1Q57A 1ESNA 1MR3F 2NZJA 1ELOA 3QXSA 4DEYA 1OSNA 2BBSA 1W48A 3UK6A 4OI2A 1VYTA 5KU1A 4A92A 3V4RA 4JLNA 3KJGA 2CK3D 3N70A 5A4JA 1J70A 1K5GA 1T6NA 4HB3A 4UNNA 4J0QA 4KFSA 3SNHA 1ZRHA 5HZHA 1OFTA 1S8FA 2PEYA 3DVLA 2HEIA 1QHYA 3LLUA 4C0HA 5SZIA 2P6NA 5BN4A 2X1VA 2PT7A 3TUJC 1N6PA 4I1VA 1IY2A 4GI7A 1E0JA 3GJXC 5EUQB 3SYKA 4F4IA 1R4AA 3C16C 1HTWA 1SQ5A 1U8YA 3CH5A 4US1R 1AQYA 1II0A 3FDIA 2J0SA 3WRYC 2WPDD 1COWA 3GJ6A 5FH9A 1DVRA 2BMEA 4D0NA 2WJVA 3WYFA 1OFHA 2NO9A 2R9VA 2WKRA 3NC1C 2ZROA 1G6OA 4PHHA 4XVRA 1NN0A 3MFYA 4PC7A 3ICEA 5AK0A 3GMTA 1HQCA 4KSCA 2CLDX 4KJZA 4B48A 4FWIB 2FU5C 4QJ3A 3LW7A 3OF5A 1OKKD 3THWA 1ZBDA 4GBMA 2QMOA 3AF4A 4W7SA 2AR7A 4LJ5A 2UVQA 4PQRA 1FNMA 1NL3A 2IX3A 3U3JA 1N5KA 1GKUB 3CNLA 4V0ME 2FH5B 2OXCA 1II8A 1IN8A 4A8JA 2F55A 3I62A 4WZAE 2IK8A 2ZRGA 4RKFA 3O8CA 4B43A 1QVAA 1LS1A 2DWOA 2A7QA 1NKTA 4UNPA 3OZXA 2H1LA 3CF6R 1EFRD 4PTLA 4BUJA 2XB4A 4L16A 4LJ6A 4TL8A 1M74A 1Z08A 1N0WA 2IBMA 3UMFA 2Z43A 4ILEA 2HLDA 2GAAA 1RYHA 4AYWA 1QHNA 1W36C 1KK2A 2C96A 4QBIA 4PFSA 4B44A 4JYCA 2D74A 3JZAA 1KI4A 4L5BA 3T35A 4Q4AB 4EJSA 2HCJB 1NG9A 3WBJA 1RE0A 1QHHA 2PH1A 4HB2A 2JLUA 2GTPA 4O2RA 1R0WA 3I8SA 3KZ1E 4A0HA 1M6NA 1ZNWA 1ZNZA 4B35A 2JJ2D 4CEJB 1BH2A 3AVTA 2ZYVX 5TVKA 4POAA 2Q6TA 2GCNA 4PAQA 3DKVA 5JZVA 1F6BA 1NBMD 1LB1B 1YZLA 1OF1A 1E3MA 2JASA 3W3AA 4DUGD 3CX7A 1KZ7B 4ARZA 4Q47A 1OHHD 4N0EA 2N42A 1FUUA 1UKVY 3HP1A 3OE7A 3EPLA 1Y3AA 1NVXQ 1IHUA 3AUXA 3A1VA 4YXWA 1KMHA 1KSFX 3LAWA 3BAFA 4HEJA 3TE6A 2AK2A 4BLTA 4BZPA 5KOYA 3L0OA 5F3WB 4JL6A 1XRJA 2KJQA 2F6RA 3BS4A 3EZ7A 1AQUA 2CXXA 3H1TA 1IN7A 4B2PA 3KQHA 3IUYA 3CLVA 1KDRA 3AVYA 4OJQA 1XWIA 3VTKA 1W0JA 4AWXA 4OQMA 3EC1A 4C0AC 1EFCA 4TT3D 4KVAA 2JLSA 2IUSA 1YZUA 5AUNB 4ASUA 1FQJA 121PA 1YKSA 2CMKA 3RDPA 2GK6A 1T3LA 4GOXA 3NDBB 4BLRA 4MRRA 3K0EA 4TYQA 4G1UC 3DMNA 2WWYA 4QGFA 3BGWA 5FUYA 3B7GA 2VP6A 2WZQA 4V0OA 1A82A 4DEXA 4B3XA 2O8BB 4ZDKA 3T1OA 2VTKA 3PFIA 1ZU4A 4NE2A 2XAUA 4KFTA 4R9UC 4AURA 1UAAA 3K9NA 2Q3HA 2OE2A 3GLGA 4DBLC 3QXCA 1SKQA 4GZLA 4AIIA 4DCNA 5L3QB 3UWKA 3K09A 3AKDA 2ZS7A 4IXNA 3VAAA 2RGDA 2P0EA 1FQKA 1E79A 1P2UA 3ND9A 3W34A 2W0MA 4JLVA 3WMEA 3AQ4A 2H8KA 5M04A 3FHCB 5JBQA 1LTQA 1TPZA 1EWRA 1XEFA 2NQ2C 3T1VA 4EDHA 3GLFB 1LY1A 3QVVA 3Q9LA 3AKYA 4ZDJA 1G3QA 5GJWC 2I3BA 4B2LA 1CR0A 4KLNA 1US8A 1VG1A 4LJ9A 1I2DA 2IYVA 4LX0A 1XCMA 2XOKD 4H1VA 1Z6TA 3U3KA 4CF7A 1E98A 2GJAA 1U9IA 2WWWA 3L43A 2CCKA 3KFVA 5EZ6B 2QUZA 3S1AB 4DLSA 4RFSA 1OFUX 4PC6A 1YHNA 3DMDA 3LVQE 2AXPA 4JT2A 5ANRB 5JECA 1GOTA 1BKDR 1JEEA 1ZUHA 3VHXA 3QENA 5CLLA 2ZI4A 3KQLA 1E99A 2ZRBA 2IUUA 4B3FX 4URYR 4HUQB 2WMOB 5GJCA 3D6TB 4BEBA 4EPTA 1GRNA 2VQSA 4MDEA 2VHCA 2YWGA 3AF1A 4HZIA 3W5IA 4C0SA 4OI4A 4DSUA 4JVLA 1OT3A 5JCPA 5HCIA 2J5XA 3T12A 3KKPA 2YZ2A 2JDID 1G7RA 1KAOA 1NMZA 4JLKA 3TMKA 3I5YA 4U02A 4Q9KA 3I92A 1Q1BA 2P2LA 3BBPA 4D81A 4D4KA 4BZXA 4D0LB 2VH5R 3AVQA 4KHZA 2E1RA 2IWRA 4BGDA 3BJIC 3G0HA 1XMSA 2QU8A 3GLHE 1GG2A 1T8UA 4LBZA 3WNBA 1NN5A 3DKPA 3EXAA 1VG9B 4A8JC 3ZIAA 3BH6A 5FBRB 1KAGA 4Q1AA 1LW7A 2W6JA 2OAP1 5F9FA 3E1SA 4TMVA 3GLHA 1G7TA 2PLFA 1KI1A 1XJ0A 1YRBA 2V6JA 3R9IA 2VEDA 3GEHA 3X1YA 4KSBA 1QHXA 4Q02A 4IDOA 3ETLA 2GXSA 2GBLA 4B6FA 1P5ZB 4PXAA 1HT2E 3PEUA 2EWVA 2QRZA 1AJEA 4GMDA 5C4MA 4HI0E 4JZKA 1P7CA 2RGNC 4NYIR 4EJSC 2GF0A 1N6NA 1SVIA 2R6AA 2D2EA 2FV8A 1FMLA 4QNMA 1FMJA 4F4CA 2IW3A 3LRPA 5EP4A 5KDLA 2ZSAA 4HB4A 4C2UA 1CIPA 5TY0A 2OFOA 3FMPB 3AP3A 1Z47A 1OJLA 2P65A 5LB4A 1T0HB 3RANA 4A36A 4C3ZA 1GTVA 2UKDA 1KY3A 4BQSA 4EUNA 3ADBA 1RRPA 2JJ1A 5KDDA 3CNNA 4KYUA 3IIMA 2O8EA 4ZKDA 2L0XA 3BK7A 2QAGC 4MUAA 3TH5A 3TK1A 2XGJA 1ZC3A 1NG1A 4PPQA 2A78A 1R7RA 3IKJA 3QKUA 1FX0B 3G5UA 3ZD6A 4M1KA 1VG0B 1DPFA 3TR0A 1UBGA 3BD9A 4G01B 1XPRA 1GSIA 3M6AA 2ZSEA 1SHKA 1VTKA 2WHXA 1DARA 3DEFA 5FOSA 3AVXA 1UBCA 3FKSD 4DLTA 3BWDD 4DSTA 1ZM7A 3B1YA 2EW1A 4NBSA 1G6HA 3BE4A 2ZRDA 3RRZA 3SE0A 1JPNA 4JMPA 2GVZC 2HXSA 2O8CB 3UMRA 2LWIA 4FN5A 2OESA 4A6PA 1P9RA 4BFSA 1FTSA 1KZGB 2FSGA 2XSZD 4PC1A 2F3RA 2ZAOA 2WIBA 4D82A 2C98A 5J40A 1TUIA 3MLEA 4Q9LA 4AK9A 4O2LA 2PZFA 3AF3A 3F0TA 1U94A 2GRJA 1KSGA 1T9HA 1DS6A 2A30A 2ZYWX 1P2VA 5JHGB 1G8GA 2WJYA 3CR8A 3SJCA 3EG5A 2R2AA 1YRAA 3B13B 4G5OA 1XMVA 4OK6A 1H8ED 1S3SA 3W8RA 2H17A 2J0UB 2BMFA 3V9PA 3PITA 4OHVA 1G9XA 2I1VB 4XD7A 5H70A 3TGPA 1W5TA 3IIJA 4IOMA 3SFVA 1XJQA 4XWAA 3ZGXA 1OH7A 5UKDA 1XFAA 2XTMA 3HWSA 4B3BA 4NHOA 3AVOA 4ZI2A 2GA8A 2HDNB 1IXZA 2CNWA 4IJMA 4NCHA 4O0MA 2RB4A 4G5SA 2H18A 4TN1A 4PZLA 3I72A 3C5HA 3IIKA 2FF7A 1XZQA 1RFLA 1J2JA 2W2TA 2KSQA 4X8LA 3QEJA 4PX9A 4HYYA 3CX8A 4DZZA 1Q22A 1XU4A 3EZFA 3I1FA 4LYJA 4R71A 1G16A 5JS8A 4P4TA 1E94E 3K70D 2AXNA 1Q12A 3Q72A 1TU3A 4IDHA 4PC3A 1OLOA 3HDTA 4CRWB 3P1JA 4M22A 2C8VA 3U5ZB 1S9HA 4W5JA 3FKQA 4PANA 1KOFA 2RGCA 3SJZA 1OYYA 3WMFA 4YDHB 4D4MA 4L15A 4GZMA 2ZUCA 1G64A 3EZ9A 4UXIA 1B0UA 1A2BA 2DPXA 2CBZA 1CLUA 4PZYA 2ZI9A 4DLRA 1ZU5A 4GFDA 5FPTA 4BEJA 2AKYA 2AWNA 1YVDA 1WBBA 3A58B 3UATA 221PA 1F5NA 2R44A 4Z1MA 2P3SA 1S96A 2XXAB 3O8DA 4GP7A 2XEXA 5GJVC 3L82B 4V02A 2A5FA 1W0KA 5DE3A 3TAUA 1SHZA 2GZAA 2DCUA 2O8FB 1OXTA 4DLXA 5TXGA 2ZRIA 3QOFA 4YMTA 1XEWX 1GNRA 4EPRA 2AFHE 4LRWA 2UZIR 3GPLA 2DR3A 2I1QA 1QHIA 3NEYA 2J59A 3SS8A 5CB6A 2O8BA 4B3CA 2VSOA 2VRWA 3AF2A 1IAQA 2ZR0A 1EK0A 2OT3B 2ORIA 2W00A 2C5LA 4Q5IA 3Q8XB 1J99A 4YMWA 5L3QA 521PA 4V0LA 5F98A 4RZXA 2ONJA 2WSSD 1AKEA 3W6OA 3LBNA 4B6EA 4WXPA 3IGFA 3TIFA 2E87A 2H16A 2PT5A 3CO5A 4LJAA 2IS1A 3KXKA 3K9LA 3EA0A 1CKEA 1ZD8A 2QGZA 1NVVR 1IM2A 5IK2D 2JLVA 2BOVA 5K8LA 1KYIA 5BXQC 1M2OB 3GLFA 3GJ4A 3CPEA 1W44A 4DB4A 4IDQA 1G3MA 5JI3E 1FW6A 3L2OB 2R6DA 5EE9A 1CBUA 1Y63A 1MRSA 1G4UR 2REOA 2O52A 3S1AA 2N1BA 3PEVA 3TQFA 4LBWA 4TWZA 4LBYA 2CK3A 1GKYA 3P26A 1DAEA 5AJWA 4ZCIA 1TF5A 5TB5A 1XJCA 2F43B 2R6FA 1ZM2A 4HLUA 5DN6D 3BFVA 1N0UA 4HUTA 1MO5A 4HAWA 4PHTA 4HUQA 1BYUA 2YOHA 4UJ5A 2HCBA 1VYVA 1S3GA 1EX6A 2GCOB 4HDCA 4JL8A 5BN3A 5CYPA 5DNYB 4F93B 3QF4A 3MSXA 2ZIAA 2OFWA 4RKEA 3QBVA 1KK0A 1E2KA 3QG1A 4ZKEA 5KPJA 3U6BA 3U4QB 2Q21A 3BOSA 1TL7C 4HLCA 3JVVA 4TLBA 3M0EA 2G88A 1Q0UA 3IQXA 3K8YA 4N0DA 3SZRA 1SXJD 1NLFA 2ONKA 5L3SA 1IY0A 1NN3A 1YR6A 2ZRPA 3QY0A 3GFOA 5C4GB 1JR6A 1AK2A 4BFUA 2GXAA 1G291 2CCGA 2NZ8A 4Q7KA 5H1YA 4DLZA 5FFMA 3BH7A 4EQ6B 2RMKA 4UNRA 1OKKA 3THOA 3PUXA 1W7AA 4CW7A 3TJZA 2EFCB 1J7KA 2BJVA 5FUWA 1W49A 2CE7A 3Q7PA 1KGDA 4L9WA 4P31A 5KUTA 3VNUA 2JLQA 2YWHA 2AX4A 1QG2A 4A2QA 4X8MA 4AC9A 2ZRAA 4NCIA 3SBEA 3NXSA 3WP0A 1BMFD 3DHWC 4E07A 1Z29A 3MD0A 3W6PA 1N5LA 2FFQA 2ZYUX 4XSGA 1JJVA 1OXUA 4X8OA 4Q4HB 2IXGA 4A82A 2BEJA 4CDGA 1G17A 2QRNA 3L8YA 4L4UA 2VLIA 5KSPA 4S35A 4NONA 1V43A 4ZIRB 4B33A 5CK4A 3ZZTA 4JBYA 4DCVA 3MWJA 1F3OA 4Q66C 4L9SA 1AGPA 3Q5EA 5JI2E 4TMTA 1PVOA 2DWQA 2WWGA 2IYSA 3DPUA 5DI9A 3PVSA 1RJ9B 4QC2A 1G41A 2W58A 1L2TA 2JJ2A 3LBIA 4PAOA 1FX0A 1JB1A 1W2HA 1NBME 2J87A 4PHGA 4MYUA 3DOEA 1U2RA 1GZSA 4DSOA 4MGZR 2V54A 2WJJA 2D2FA 5CYOA 1U8ZA 3DDCA 3E5HA 3KXLA 2F9LA 3LY5A 4GOKA 1ZIOA 1ZM4A 5B58C 3K70B 1OHHA 8OHMA 2ANBA 5HTKA 3TR5A 4CEIB 2KB0A 2O8CA 1VCNA 5EP3A 2ZI6A 4B34A 5DI3A 1H8HD 1UF9A 1GL9B 5AUQA 4ZDWA 1ODFA 2NPFA 3ZVRA 1TAGA 4B74A 3QEOA 4CEHB 4C4PA 2EFEB 3BERA 3FHOA 5G3ZA 3RC8A 1E0AA 2JA1A 3PUZA 3RWOA 3OEHD 3K9GA 4DWJA 1C9KA 3A4LA 3IBYA 4WOPA 1DO0A 3TLXA 4AKGA 2ODWA 2XTNA 3T5GA 5EE3A 3ZZUA 2GDJA 2J7PD 5HKKA 1VECA 5JJIA 1UM8A 2V7QD 1AM4D 2D62A 4TT3A 2B8WA 4TLAA 1Z0FA 2ZRMA 3UXMA 2TMKA 2J0VA 2FWRA 3L0IB 4Y0VA 5JRJA 2EFDB 2IEZA 3KUDA 1P73A 4B3DA 2FGJA 1G5PA 2QY9A 2XX3A 1GITA 1SVSA 4IKEA 4OK5A 5CIWA 2OCBA 4NYMR 3ASYA 4OQXA 4URZR 1GWNA 1JBKA 1KJYA 3VR4A 3WNCA 3N2EA 3P20A 2VF7A 3IQWA 4FMDB 2WVJA 2ZE6A 3ZS9A 4XWOA 1QHGA 2ZEJA 3A4MA 2ODNA 4QGGA 2ZU6A 2FJUA 1UPTA 3U61B 5EXSA 2IEYA 2F3TA 1O3YA 2ZAMA 1CJUC 2JIZA 3MAAC 1IONA 1VDZA 1I4TD 1I2MA 3CKLA 4P33A 4PSAA 2ZJ8A 2JGNA 5K8UA 1WF3A 4HDOB 1AS0A 1C4OA 3P4XA 3LXXA 1NVUQ 1S0UA 1G8PA 3LQRA 1HE8B 2XOKA 1GAJA 5AUPB 4EFMA 1ZMXA 3EIQA 3K1JA 5F2EA 1KO7A 2DY1A 2W6ID 4LDJA 4JSTA 2QBYA 2KE5A 3NHBA 3A1WA 3CB4A 3U44B 5EE1A 3KJIA 2XNDD 1NIPA 4W9MC 4BFXA 3FFAA 2XXAA 1FP6A 1AS3A 3WYAA 3EW9A 1M7GA 1IJEA 2FEOA 2O5VA 4V0MA 1YZKA 4IOLA 2OEPA 1W36D 3U3RA 2GESA 3U7HB 3LX5A 1LNZA 4BLOA 1ZP6A 4NYIQ 5CIQA 2O8FA 1OV4A 3QQ5A 3K0CA 2LKDA 4F92B 5AR1A 1KI9A 2AD5A 1Z07A 4Q7MB 4AKEA 2VYFA 4JJKA 3GJ0A 2OG2A 2OLJA 3NDPA 4TMXA 2D3WA 1XBTA 3B1XA 1GRQA 2FSHA 1HH4A 1KI8A 1PLJA 4NCKA 3CR7A 2JDIA 4JYBA 4X8HA 5F9HA 1ZD1A 1N2CE 3HU1A 3T5DA 1A2KC 1UJ2A 1SXJB 1WE2A 2QP3A 2QSYA 3E2IA 5JFGA 1CR1A 4Q19A 1ZM3A 2QROA 4TLEA 3OAAD 5GVSA 4YMVA 4QJ4A 1HA3A 4RSGA 1WBDA 1VCOA 2XNSA 5IF9A 3CUEF 1NRJB 3QPWA 4E22A 1EGAA 4ACAA 3CRQA 1TQ4A 2BCJQ 3RS2A 3H0KA 3ONWA 4A9AA 5DH9A 3TBKA 5KO2A 3LXRA 1Z3IX 4RD0A 1E2LA 1P60A 4BRUA 4NKRA 1XEXB 5DYIA 5FTMA 3UG7A 1JAHA 4RD2A 4C7OB 5D3MA 1EXMA 3MJHA 3OESA 5P21A 4Q7JB 4WA7A 5D3QA 1BS1A 3UPUA 1NJGA 4W5HA 1H65A 2ZJ2A 3CIOA 1XCPA 5FI1B 5DISB 5TDHA 3FGNA 4O3MA 2OSBA 1ZUNB 4M1OA 2ORWA 4JSYA 1XD2B 4OK3A 1EFUA 3CRRA 1S9DA 1I4LD 3DM9B 3I73A 4TL7A 4JS0A 1KJZA 1CJKC 4TQ9A 3A1UA 4IDNA 2F43A 4PSVA 2VP9A 4U7DA 2IHBA 4ACBA 5FBVB 3L0PA 4I1SA 3X1WA 1R8SA 2OCAA 5LD2C 4Q48A 2HJVA 2GCOA 3NG1A 1DG1G 4MUBA 1P62B 3A1TA 4XOIA 1E4YA 2IYZA 4NPHA 3W5JA 3W6NA 2GXUA 4U5XA 2F1IA 1E4VA 4D6PA 4CT5A 2VL7A 3OFNA 2YKGA 2Q9AA 4MKGA 3AVWA 1IXSB 1KSJA 1MO6A 3I32A 1F2UB 1FNNA 1L7VC 2VPPA 1WXQA 2IHYA 4PPNA 3ADCA 4JLJA 5EQTA 4B73A 4PSKA 3B5JA 4LJ7A 2PMKA 4TMKA 1E9DA 2HUPA 2J46A 3RLFA 3T1QA 3FWYA 3VR5A 4FMCF 1NSFA 2FX3A 1KI3A 3FKSA 4EQ6A 4ZO4A 4M1SA 1E2JA 2QTHA 2FNAA 3HR8A 4Q4JB 2O8DA 3SBDA 4QM7A 1WQ1R 3OIUA 5FOTA 3LLMA 4PPFA 2XSZA 4WXRA 1UBEA 3RNLA 2QP9X 3B2EA 3BRWD 5CJPA 4JT4A 3T61A 1KKLA 1TNDA 3CWZA 3MG9A 2PL3A 2WWHA 2OBLA 4ZCLA 3IPXA 3THYB 2OO7A 1XD9A 2GZHA 4HAZA 4L8GA 1C1YA 3PV0A 1G3UA 4Q4HA 2YYZA 4KXFB 4OHZA 1GILA 4ZI3A 1YJ5A 2RCNA 2A5YB 2JLRA 3B78A 1QZXA 1U98A 3HYRA 1H8EA 4TYPA 4AYXA 1ZM9A 1E69A 421PA 4QNRA 4ZIRA 1OE0A 3KKNA 2P5TB 3EIEA 1COWD 3TKLA 1JXMA 3ADDA 4CT4B 4M9XA 2F1JA 1IXRC 1WB9A 3X2SA 1FFHA 2AK3A 5G3YA 5LDDC 1XCGB 1XF9A 3ADKA 1Z83A 2YJTD 1DBSA 3JVUA 1II9A 2CVFA 1KI6B 4ZCMA 4OL0A 2ZJBA 1EESA 1KDPA 4PC2A 4Q01A 2OM2A 3K53A 2ZE5A 5CM9C 2ODEA 1M7BA 1DAHA 1Q3TA 2MMCA 1CS4C 4S2EA 3QE0A 1FUKA 2WV9A 3NWJA 1KY2A 4M9SA 3F8TA 1NY5A 2NIPA 3V4FA 2G0NA 3RVBA 1D8TA 1ETUA 3NTUA 2MSCB 4BASA 4CEIA 2PLRA 1XMIA 4M53A 4MRNA 3A1SA 3NVAA 4AI6A 3B8HA 4I99A 3AV0B 4QBFA 1TU4A 2KBFA 5KNCA 2FZ4A 2J1LA 2C9OA 2FPMA 5G40A 1NVVQ 2CCJA 4NL4H 1R0YA 2HYIC 4URUR 2GNOA 2AFIE 2IS6A 1AKYA 4UXJA 4JL5A 1L8QA 4OQLA 4KCGA 4LBVA 1S1CA 1R0XA 3QKTA 3U7FB 3L8ZA 3ZQ6A 4ESVA 3PJRA 1P9NA 1CU1A 1UEIA 4II7A 5JLJA 4V03A 3V00A 4A15A 3K0FA 2G9NA 1UKYA 2OFXA 1G4AE 2Z4RA 4RD1A 1Z0KA 4RJLA 4DXAA 4B76A 2B8TA 4F38A 1W36B 5LBIA 3AGQA 3F3YA 3H2YA 2FFHA 2QN6A 2QQEA 2ZITA 2EU8A 2WWIA 1G3RA 3WBKA 2RKOA 4M21A 2ZPTX 1Q1EA 4RVCA 5JEDA 2ANCA 1E96A 4AKIA 3D3QA 2AD1A 2J7KA 1MH1A 2A5JA 2ZJYA 2G6BA 3EASA 4OHYA 1U81A 2OLKA 3BB4A 3KQUA 2WSSA 1MABB 2IYLD 3PUWA 2IC5A 3WMGA 4YONB 1P2SA 5E7JA 5HE9A 3UIEA 2CHQA 2YVUA 1KO4A 4ZDIA 1W5SA 4HAVA 2J45A 1JI0A 2DBYA 5CK5A 4DDVA 2FFAA 1ZIPA 3HPQA 1XTRA 2ZTSA 1HQYE 1PZNA 2ZJAA 4NCNA 2A2ZA 3NBXX 5EUMA 3AP1A 4IOJA 1D6JA 2ZRHA 1AA9A 2FPLA 2ATVA 1YZQA 3B60A 4PHFA 1X8LA 1XX6A 3E70C 3VR3A 4Q9IA 4DJTA 2VIIA 5KSZA 2ZSBA 4C0KA 1Z0AA 4GDFA 4ASUD 2NTYC 5EE0A 3U44A 4KI0A 3GP8A 1CRQA 5JEEA 3D8BA 4BZQA 1M1YE 2A5GA 3QKRB 4R2HA 3PQCA 1U8AA 4PZZA 1E2QA 5DN6A 4GSYA 4Q1CA 4WZ6A 1P4SA 3THXB 3RS0A 3KKMA 3C14C 2QI9C 2QT1A 2ZANA 3QKSB 3VMFA 5AJYA 1RRFA 4LC1A 1JNYA 1A4RA 2PMDA 3KKOA 4BECA 1ZUIA 2GK7A 4Z8YA 2SHKA 2ZVPX 1SXJE 2GJSA 3UKDA 1MV5A 2G0TA 4RZ2A 5FPKA 2V55B 4WIAA 4OKSA 4EPVA 1VCMA 5FL7A 4Q4AA 3VHLB 5GADl 4M9ZA 2FMXA 2GZDA 2QQ0A 1E0SA 1XTJA 2XJ9A 3K09C 3NH9A 3X1DA 2FZLA 2HJGA 3HYTA 3RRMA 2V4ZA 4Q03A 4IRUB 2ZSFA 4CEJA 4LJ4A 1Z63A 2RGEA 1ZW6A 1UDXA 2OBMA 5FPYA 1GVNB 3EAQA 1XEXA 4I1UA 3X1XA 4KU4A 3R8CA 3B9PA 3VX4A 1NLZA 1LF0A 1X3SA 4IVPA 2VSFA 3BFKA 2D4HA 4TQUS 4M1WA 1WDTA 1BMFA 1U9IC 3CBQA 4PAMA 4HZUB 1BO6A 3DZDA 3PENA 1B23P 1XD2A 2D7DA 2PCJA 2UZ3A 5SZJA 2OHFA 4Q4LA 1Z0JA 1UFQA 4BFWA 2ZUDA 4YMUA 1G5TA 2QTVB 3TSZA 4QGAA 4B3GA 3FB4A 2WOOA 3HPRA 2QENA 2VHJA 2IXFA 1IN6A 1RVDA 1JPJA 3RYTC 1R5OA 1XPUA 5CB8A 4PO8A 621PA 3CPJB 4F91B 1O87A 3KUCA 2ZU0C 2ZRJA 5BYJA 1R6BX 1Z22A 4BLSA 1R2QA 2YOGA 4LV6A 1RW4A 4IVRA 3J81k 1VKJA 3F5FA 4O25A 4D4JA 2PJZA 2BWJA 3R9XA 4NYMQ 1KMQA 1OW3B 4DDUA 3WXMA 3LV8A 2JAQA 3OIYA 4NCJA 1W46A 1XTIA 3RS7A 2QZ4A 4TSFD 3WY9A 2ZETA 4TL9A 2O0JA 3HJNA 4D0GA 821PA 2FSIA 3ICQB 1JAIA 1RRGA 3GJ5A 5IHPA 4QKQA 5K8TA 3T1TA 4AG6A 4OYHA 2ZREA 1II8B 4A8JB 2YWEA 2ZRKA 3ZVNA 1KSHA 4MRSA 2W2VA 1TMKA 5J47A 5DHAA 1SVWA 3O8BA 3EPKA 2ZRCA 3QNUA 3KTAB 3P32A 1DOAA 1JXOA 2EQBA 3RSOA 4ITRC 3ZH9B 3KFXA 2IS4A 3TUZC 5KDOA 2GBLC 5DO9A 4MQBA 1YZGA 3OEHA 2PX3A 5EJEA 5L8VA 2QM7A 1X1RA 2KI5A 3THYA 3GLIB 5G41A 2J41A 3IHLA 2OCYC 2ERXA 3P4YA 1MOZA 2J7PA 1J8MF 2DFKB 2QM8A 2ERYA 2V7QA 3TRFA 2GHIA 2B21A 4TQAA 5HZKA 2IS2A 1CJMA 1AGRA 1M8PA 2MMGA 4DVGA 1DADA 1GL6A 1N0VC 4MITA 4GMXA 2G1JA 4G3XA 2GVDC 2VP4A 2XTZA 4JLAA 5B57C 2H5EA 4DCTA 1EWQA 2ORVA 3EA5A 2WM9B 1OIWA 4JLPA 4RZUA 1D2NA 2NO6A 1QHSA 4K8OA 4OHWA 1KI6A 2HF9A 5EP1A 2QAGB 2VP2A 1W2GA 2FEMA 3GJ8A 2ZVQX 3SYNA 3DO6A 3VKWA 1E2GA 1G8HA 3RWMB 1T0JB 4V0KA 2REXB 1YR8A 4A0RA 1ANKA 3MMPA 2X8AA 5FI0B 1KMHB 4A2PA 5JS7A 1WMSA 1KK1A 4IHQA 3VR1A 2JLWA 4A4DA 3KX2A 5B64A 4TYYA 2WPDA 5AJZA 2OV2A 2PEZA 4P4SB 2BV3A 4URWR 1KKMA 3VR2A 3CZQA 2GEVA 3LX8A 3HU3A 3GFTA 3RABA 2CJWB 3UANA 2WTUA 2V6IA 5FTLA 1NMYA 1SZPA 3K9HA 1KO5A 2AN9A 4M1MA 3C4JA 2C04A 2IT1A 1E9RA 3M1IA 3AUYA 1PUIA 1X6VA 4URXR 2V3CC 4B32A 1P61B 2WKQA 4TMWA 4QBHA 4AD8A 4TZ0A 4LJ8A 2W6IA 2XJ4A 4LZZA 4LK2A 2BMJA 2PBRA 2W2XA 1SKYE 1Z0DA 3Q3JB 4EIWA 4YQFA 4G5GA 2G3YA 2D06A 3CONA 1E2NA 2BEKA 2GWHA 4M2LA 5FPSA 4Q1FA 1XB2A 3RC3A 3NH6A 3KL4A 1Z2CA 3CM0A 2CNWD 4LC0A 1A5TA 4KVGA 1Q1QA 1EFRA 3SJBA 4Q9JA 5JWHA 2Z6VA 2C9YA 2YINC 3GLGB 5SZHB 4BE7B 4TMZA 2AHOA 3KJHA 4LSGA 2VP0A 4QFMA 3RRYA 1G19A 4P3YA 3PEYA 1W4CA 4JKIA 4PO9A 1E0KA 4LHYA 3BFXA 1TADA 3IEUA 1E9BA 1N5JA 1KNXA 2ZXUA 1AIPA 4IXMA 4D4LA 5AJXA 2E9SA 3OAAA 5H68A 5EXPA 1YZNA 2QE7D 3LQQA 1DO2A 1T91A 3B9QA 4Q18A 3AH8A 1CF4A 1SVKA 4XH9B 5C1BA 2Z4SA 2QP4A 4V0NA 2VO1A 1F2TB 1XXHB 2FSFA 3A36A 4ON9A 3CX6A 1A1VA 1XZPA 3FE2A 4LI0A 5IT5A 1NBMA 2QORA 3CW2A 4JIMA 4DUGA 3ZVMA 3OHMA 5JSZB 2ZR7A 4ESHA 4LPSA 2BC9A 4QHSA 1D5CA 2CL0X 1E9SA 4GP6A 4MRVA 3EIHA 4Q21A 2A5DA 4IFBA 4RZ3A 2QGNA 2ZRLA 2ODBA 4LGMA 2HT6A 2BKEA 2C78A 2DFLA 3C8UA 3FFBA 5L3RA 5CJ2A 3QKRA 4FIDA 5LPNA 4NDZA 1Q20A 5J4YA 3LWNA 1FOEB 4PO1A 1R5NA 2XZPA 4QHTA 4AG5A 3CH4B 4MKFA 5HCNA 2GKSA 4XWKA 1Z06A 1X86B 3RS4A 1LV7A 2CE2X 2VHQA 5GVRA 3QKSA 3TUIC 3QIAA 1NJFA 4BPBA 1MO3A 1WA5A 2J0UA 4C0LA 2WAYA 2VA8A 1SGWA 4W5WA 2B6HA 4MYTA 2GJ9A 2BM1A 4ZPXA 1OXVA 4BFZA 2R62A 3A6PC 1W47A 3LD9A 2NG1A 3W8NA 3GCGA 4C30A 4G5RA 2K5UA 1E2DA 3BH0A 3RSLA 3MRSA 5C2JB 1F48A 1CULC 1E1QD 4JVMA 4I1OA 3C5CA 4Q7LA 3SJAA 4KFUA 1OH5A 4KBGA 2BM0A 4QRHA 3EZ2A 2FFBA 2NGRA 4DLWA 1IN4A 3GJ7A 1N5IA 1IY1A 2RGXA 1PUJA 2Q0HA 4BFYA 4WAUA 4D25A 2GEUA 1HYQA 1UKZA 1XP8A 4TTRA 4UXHA 5FOWA 3EC2A 2W0SA 5J4HA 4US2R 3ZQJA 1NIJA 4HZUA 4Y0AA 2QPTA 1Z6YA 2G77B 4CYMA 1GNQA 3B1WA 4DIDA 2EYUA 2ZE7A 2JLYA 3DM5A 4Z8XA 1N25A 5FUVA 4HLUC 5E95A 5KPDA 1DEKA 4XVQA 2O8EB 4LUCA 1NY6A 1AN0A 2WJHA 4C0QC 1G7CA 1PLLA 4ERNA 2QL6A 4EPXA 2AL7A 5EP2A 2PX0A 3FHTA 5C18A 3KKQA 4OBEA 1ZAKA 2ZS9A 3C15C 3OEED 4WBSA 1KDOA 4LYHA 2Q3FA 4EAQA 3MUFA 1CTQA 4P32A 3LO5A 1HURA 1DAMA 1HUQA 4LHVA 4US0R 5AUOB 4M9QA 3UMSA 4C9BA 4HATA 2XB2A 1L4YA 1VG8A 4XIGS 2IF2A 1I4DD 2JJ8A 3VU9B 5L3VA 3ZD7A 4MYCA 4QL3A 1OIVA 1AZTA 3D31A 2F7SA 3H86A 2QAJA 4YMSA 3DOFA 1KNQA 5CDFE 2OILA 3T15A 2IYUA 3GFPA 3SR0A 4EFLA 1OXXK 1SVLA 3KTAA 1S4QA 1UKEA 1V5WA 2FG5A 4KFRA 5CDFA 2YNMA 1E1RD 2QMEA 3MCAA 2IXEA 2XZOA 3GLIE 3AM1A 3EWSA 3WP1B 1OPXA 4XTCS 5GJBA 1PJRA 3K0SA 3GLIA 1A7JA 3CZPA 1DG3A 4FCWA 3U6KA 4LOAA 2BJWA 1U0JA 2RGNA 2HT1A 1T3HA 4XTRA 3PG5A 3R7WB 2ZI7A 4RFVA 3QXJA 5FUXA 2BBOA 3CRW1 4KV9A 3NEJA 4LHXA 3PCRB 1LF5A 3KB1A 2QTFA 4M0LA 3OIWA 1Z0IA 4H1UA 2BIFA 4QOSA 3LA6A 3QBTA 1CRPA 4DT1B 2X19A 2CHVA 5JRZA 1TQ2A 3FMFA 2BDTA 1P2TA 1VPLA 1OB2A 5AJVB 3QF7A 1S2MA 2QAGA 3N2IA 2C99A 2CL7X 5E7IA 2NMVA 4JVSB 1MKYA 4XVUA 1NLYA 3ND8A 2WWFA 5JCZA 2FDCA 4LYAA 4M1YA 2BMDA 2ZR9A 5H8WA 3MWLA 5HE8A 2YHSA 4G0NA 1E2MA 3CWQA 3T34A 1XDBA 5A0FA 3RS3A 3U4QA 4JLBA 2ZSDA 4K46A 4P4SA 1IOZA 1YE8A 2QT0A 4CIDA 3REFA 5KNDA 1E6CA 4QBGB 5KTYA 2CJWA 2Q9CA 4NTZA 3GJ3A 5FR2A 3VNVA 4NZYA 4TLDA 3LFUA 4B47A 1GM5A 3Q5DA 1K8RA 1Z6AA 2B7BA 1AS2A 5HKKD 3IDQA 5FOUA 1YR9A 2IA5A 1JR3D 1W4RA 2D7CA 4M4SA 1SVOA 3ZJYA 3W9YA 5EXXA 2P5SA 2OZEA 1E2IA 1KTVA 4A1FA 2GF9A 2V1XA 4BRWA 2IYRA 4TYNA 4DB2A 1HY3A 2BBTA 5HPYB 4B2IA 4OI1A 1Z6GA 1WRBA 1LS6A 2ZRFA 3WRXC 3R8FA 1G8YA 3AP2A 4OI0A 3G82C 1KJWA 1XEWY 1R0ZA 3GLGE 1P72A 1N3BA 3RAPR 4DDWA 1DAKA 2F1RA 3Q85A 1ZC4A 4P4UA 2OAQ1 5KNBA 1NKSA 3CPHA 3D7MA 3WHLA 2RGBA 2RGGA 5HR5A 1IQPA 2PZEA 3R20A 4Z54A 1RC8A 1SVMA 2F1HA 4FMBB 2LCFA 3BIFA 4EPWA 1AZSC 1E9AA 1M34E 1E2PA 2J3EA 1NMXA 3T06B 2JIZD 4BFVA 2JLZA 3AEZA 1X8KA 2V1UA 1E9EA 2WWXA 2OXRA 4MYHA 1L4UA 1LFDB 1OIXA 5B30A 1RJ9A 2GXQA 5J4LA 2IWHA 1T4GA 1XXHE 1MT0A 5J4KA 5SZKB 1KHTA 2VSXA 4UJ3A 5JJKA 1R10A 2V8OA 1XMJA 4K81B 3WNDA 1F2TA 1XXHA 1JEDA 1OH8A 2CLSA 3C7KA 3CRMA 3QUSA 3I8XA 3MJRA 4AKHA 5JSZA 1XNJA 4PPGA 4R98A 2IUTA 1N6LA 1RYFA 1JALA 5JMTA 4GL2A 5TARA 1GRRA 1D2EA 1D9ZA 3NBZC 4PQFA 3KDSE 5KHOC 3W90A 3CF0A 2WICA 1NP6A 2AKAB 4WW0A 2WKPA 3KQKA 3EPJA 4CEHA 1N6KA 1G18A 1XTQA 2RAPA 1Q1ZA 1PV4A 4GPTA 2REBA 2EFGA 4DLVA 1VCIA 3NBFA 2MSDB 2IF0A 2HLDD 3QF4B 4FINA 4JJZA 1DAFA 1Z6XA 3BORA 4QJ5A 2BKUA 3K0CC 4DC9A 1NVWQ 3W3ZB 3A4NA 3R9WA 5L3SB 1TUEA 4NYJQ 3DL0A 1SKYB 4FMDF 1Z5ZA 2ATXA 2GJ8A 5G53C 1R8QA 2HF8A 4XJXA 2QPAA 1WCV1 2MSEB 3FPAA 4JLDA 4P0TA 4A0FA 4MGKR 5BYKA 5CITA 2ZRNA 3IO5A 1FL9A 4UNSA 1W4AA 2CL6X 1CXZA 3PXGA 4RCZA 1XTSA 3K0AB 1HEIA 1QBKC 2J9RA 4TSFA 1E2EA 2OBNA 1K5DA 2ZQ5A 3SOPA 5FPHA 4NH0A 1P3JA 1DTSA 1FTNA 1U0LA 1GDDA 2FA9A 3N5CA 1TTTA 5C46F 1G21E 2NO0A 4DLYA 2YOFA 1RRCA 4TL6A 3OE7D 4HSEA 3BXZA 3KB2A 1HE1C 4AY2A 3IHWA 5J5CA 4YXWD 1KIMA 4TTPA 4G5QA 1FP7A 3SFZA 3ECCA 3HR7A 2C95A 2GILA 3NC0C 2P6RA 2ZJZA 5TMPA 4JBWA 2GETA 3FYHA 4AYTA 3M4YA 5IK2A 2R6CA 5FBQB 5FTJA 3ZDQA 4Q1DA 2CHGA 2OCPA 2NOAA 1X8JA 1ZVQA 4R7ZA 3FVQA 3SQWA 5E3HA 1W0JD 2ZJ5A 3SQXA 5A5GA 1UBFA 3SYLA 3P27A 3PEWA 2FOLA 1KO8A 2PZGA 4GT1A 3TW4A 3THXA 2NPIA 3I3SR 2P6UA 3BC1A 2C9CA 3OFND 3SI7A 5KSYA 1CP2A 2DWPA 3AB3A 1ZYUA 4RD6A 4RCYA 2JEOA 4CZ2A 2ZI5A 4FXPA 5LD2B 1QRAA 4UNQA 1Z28A 4WZBE 1W1WA 1YZTA 2IYQA 4GNKA 5JWRA 3FMIA 1U0HC 4FCTA 4XSHA 2WBLC 1N6HA 3U3MA 1CJTC 4ZV4A 2Z83A 3DZ8A 4JLOA 3TSWA 2ZM5A 1T5LA 3EX7C 2BVNA 2NO1A 1KO1A 5CLQA 6Q21A 2DB3A 4OQFA 3VQTA 3A37A 5FOVA 3TAHA 1VHTA 1M7HA 1LVGA 5FBWB 3VU9A 1E9CA 1GKIA 5DI3B 1NNEA 1E79D 1HV8A 3KXIA 4MA4A 2QEQA 3AVUA 1Z8FA 1SXJA 2YWFA 3FOZA 3RRNA 1FZQA 1N6IA 1KI7A 1UDWA 3FTQA 2FGKA 1QF9A 5EE5B 3AGPA 2CVHA 5JHHB 2AWOA 1ZNYA 2I4IA 3A8TA 3REGA 2QMHA 1P6XA 3ZS8A 4C0JA 3QJYA 1VIYA 2JCSA 1FPMA 1RKBA 4A2WA 2N46A 3IILA 2JATA 3QPUA 1N6RA 4C7OA 1P9WA 1UEJA 4GRAA 2XZLA 4N3NA 5DLQC 1VIAA 5EZ5A 3R7WA 5DIFA 3B82A 2DFNA 2QA5A 2X77A 2WSMA 3QSYA 4OJKA 1RZ3A 1XD8A 4FD2A 2B92A 1Q21A 3U60B 3PUYA 4DRZA 4DDTA 4LYFA 1VYUA 3AVPA 5IRCD 1P75A 1YQTA 4QGHA 2XITA 1ZINA 2FPKA 3B85A 4IEIA 4PQYA 3GEIA 2WJGA 5DGXA 1TF2A 4DT1A 1G7SA 3QPVA 3AVVA 2RHMA 4ABYA 4C0BA 4N1AA 4U00A 2NO7A 4YC7A 5KYKA 3NKVA 5EXTA 3B1VA 3IO3A 3VR6A 2V9PA 3SDZA 3EZ6A 4TLCA 2F9MA 2JLXA 1KI2A 3TQCA 3MWYW 1IJFA 1DE0A 4RD4A 1D2MA 1EFHA 4I81A 2RHDA 2QE7A 4KITB 3CNOA 4Z51A 3Q7QA 3K70C 4URVR 2Z5FA 4FI3C 1F2UA 4LCBA 1S1MA 1GL7A 3I61A 4DCUA 2EWWA 1ZCBA 2IYTA 3ZIAD 3TSOA 3THWB 2W6JD 1CR2A 3TVTA 2QBYB 1TEXA 2X2FA 4HAUA 4HLDA 4YLGA 4FCVA 1QVRA 3WHKA 4BLPA 3BB1A 2Q9BA 1E2HA 2BBWA 1Z2AA 4I4LA 1BIFA 4IEEA 3QVUA 2IL1A 4Q4JA 4IW3B 1G8FA 3HU2A 4UQOA 4QM6A 5ELXA 4F4JA 4A6XA 1QG4A 3ASZA 3TVDA 3U3OA 1H8HA 3QXHA 5FL3A 2ZJOA 3SC3A 1OH6A 2ECKA 4M1TA 4EFNA 4LWZA 3H84A 4BFTA 2HV8A 4HAYA 1K6MA 4DCSA 2ZE8A 3PR1A 3NHAA 3LW8A 3B1ZA 1EX7A 3LDAA 3AKCA 4IOKA 5DSZA 4JLMA 5FTKA 4EJSB 1ZJ6A 2DHRA 2KBEA 2VF8A 2QMUA 1QHHB 1X1SA 2JJ1D 2H7VA 3AKEA 1TQ6A 2A9KA 2G1KA 4NYJR 1NN1A 4B75A 1IBRA 2DYKA 5BWMA 2LKCA 2Y8EA 1XTKA 1KDTA 1E2FA 1GNPA 2BCGY 3GLFE 1XPOA 1CJVC 3EWAA 1JQJC 4QXAA 1G3IA 2QPOA 4QHYA 3QG5A 3NIBA 1E9FA 1WP9A 1ESMA 1GUAA 1UADA 4LV5B 5AWFC 5LB2A 2YC2C 2O0HA 3GEEA 4Q1EA 2C77A 5D3MB 5K8IA 2X2EA 1NF3A 1E1QA 1TF7A 1U90A 4E5UA 4ARZB 1E32A 1EG7A 4IVQA 5J4VA 3MGCA 4D26A 2GEDA 1DAIA 2WIAA 4QG7A 5BN5A 4KO8A 4OQNA 4NU0A 3CF2A 3O47A 4TZ6A 1KK3A 3IPYA 2DFTA 1G5RA 2P67A 3KJEA 1N6OA 4MGIR 3SN6A 2C03A 4LY6A 5E7MA 1EFTA 4C2TA 1VHLA 4CVNA 4HDQB 2FN4A 2GAOA 4HAXA 3I5XA 4LV8B 4TTQA 2HXYA 1F60A 4KLZA 3TNFA 2WAXA 3RHFA 2VBCA 3O8RA 1DELA 2H92A 1RPZA 3VKGA 4MKIA 2IYWA 4DSNA 4LPKA 2R6GA 3QXXA 3U7GA 1SULA 1BOFA 3PIRA 3UWOA 2GJKA 2O0KA 5CM8B 2ZI3A 5FL7D 2CDNA 2G83A 3OIVA 4KYIB 2XNDA 4XD7D 2B7CA 3IBGA 3OEEA 4FWTA 1PLKA 1IN5A 3GD7A 1QDEA 1ZD9A 2WMNB 4OHXA 4E09A 5JWOA 4JVNA 2CEAA 5FBLB 4UKDA 3SEAA 2ZUBA 3IEVA 4Q9HA 2A3RA 3RS5A 1SXJC 4RD3A 4CGZA 2YC4C 2PCLA 4HB0A 4BLQA 4IFEA 3K0AA 2QSZA 2O8DB 1BYIA 3U2QA 1NSTA 4Q00A 1OXSC 1Q3HA 2GCPA 4M8NE 3GQBA 5BW8A 3LVRE 3QI2A 2IYXA 5IDVA 1U99A 5DYGA 4KAXA 1CR4A 4D2IA 3CRVA 5FTNA 4DLUA 3SHFA 2VP5A 4JKYA 5BQ5A 4FMCB 1ONBA 1MABA 1MO4A 2H57A 4NP6A 3VX3A 2ZS8A 4MKHA 1R5BA 4EKDA 2W83A 1E1RA 1JJ7A 1US8B 1T3SA 4LJYA 4D80A 3BB3A 2Z0MA 3VKHA 2R8RA 3B6EA 4PR0A 3KQNA 3NBYC 3U7EB 2VHUA 2C2HA 2R65A 4HLQB 5FR1A 1HT1E 5TV2A 1VMAA 1OYWA 5E4FA 3TW8B 4E03A 3SHWA 4RFSB 2WOJA 4IDPA 3WYGA 2EFHB 2IYYA 1G20E 1JQLB 1T8TA 3FMOB 3EPHA 4MRPA 1ZNXA 4A0GA 3ZLJA 5JJLA 1YR7A 4GOJA 4Z1MD 1ZCAA 2J0QA 3VFDA 1Q44A 1J90A 4NMMA 2HYDA 2YV5A 5DHFA 4B71A 3MWKA 2FE4A 5FOXA 1W0KD 2QNRA 1GP2A 4KODA 4LHWA 2VHTA 4H9GA 1G1MA 4DKXA 2KWIA 3JZMA 4RY2A 2PJRA 1YU9A 4DHEA 1TX4B 2EYQA 1TQDA 1D9XA 1DAGA 1GIAA 1NI3A 1RIFA 2OUKA 1J8YF 2QG6A 2WJIA 3C41J 4MGYR 1GFIA 3SU8A 3LBHA 3ZVLA 5B2ZA 721PA 1CEEA 3ZZ0A 2EVWX 4EPYA 3ZYCA 5KSOA 3H4MA 4F7WA 2RH5A 3L0SA 4KBFA 1W4BA 3LH5A 3X1ZA 1OFIA 3UG6A 4MDFA 4FW9A 4Q1BA 1MRNA 1T5IA 4WVFA 3I4LA 4JBXA 4MH0R 2CLCX 4YDSA 4R2IA 2ZYTX 3GLHB 1JECA 2RGAA 1OB5A 4DIEA 1JR3E 2ASEA 4TYWA
chains in the Genus database with same CATH superfamily
2C7BA 3EARA 3IT1A 4N0PA 4BWYA 1G5FA 4JUFA 3L8EA 4R8MA 1ZK4A 2VJMB 1TEVA 2NLOA 1NE7A 3ZHZA 5JROA 1JR3A 2Q3MA 1XRNA 3JQAB 1LZLA 3K0FB 3IX7A 3ISTA 2W2QA 3MJCA 1TM4E 2NZJA 1ELOA 3QXSA 4ZCSA 1CUXA 1UXHA 2JANA 4HY3A 4Q9AA 5GOTA 3FPGA 2Q8QA 1AUQA 1Q1AA 3EXEA 2E89A 3M9WA 3MCZA 4OI2A 3F46A 2CNBA 3R23A 5PNTA 3UK6A 1ARZA 2J3JA 2P3LA 3CLRD 3ZHSA 2IU0A 4BGEA 2Q3CA 4F7DA 1K5GA 3CSSA 2PG3A 2QHXA 1BA3A 2A1UB 1AZWA 4UNNA 5E1MA 1QK3A 4JUIA 4KFSA 2J07A 1QE0A 3KOUA 1KJIA 3VKUA 3DVLA 1JFFA 1SFRA 2GM5A 4BATA 3LLUA 4C0HA 3KSDO 1ABFA 5BRAA 3F73A 1VHQA 2X1VA 2PT7A 1NW8A 4DA9A 2AX3A 3P45A 1E0JA 1AXGA 3HN7A 3PPIA 2YJZA 1U8YA 1CEYA 3K6SB 1AQYA 3H3FA 1II0A 2B2NA 4Q0MA 4QTYA 5T8KA 4AS1A 4PXYA 3S44A 2J0SA 5IXSA 3WRYC 3N39C 5FF9A 4DJEC 4Z4IA 2YJGA 3GJ6A 2ZJ4A 1DVRA 1P6UA 2PMBA 4G1MB 5DKFA 1SUWA 2XVZA 2GN0A 4KRYA 4QUDA 4D0NA 1HFWA 1NWHA 2NO9A 3NC1C 4G0QA 1G6OA 3O0DA 1NN0A 1IH8A 2PH5A 4A6EA 1Y7HA 2H2AA 4S0ZA 1VQ1A 2H5JA 1YMVA 3OQ1A 2CLDX 3RTGA 4FWIB 2HJ9A 2FU5C 2FW6A 2RJOA 4G5XA 3K2QA 2CB9A 3SIPA 3VSAA 1RACA 3UAZA 4BV3A 3ESDA 4G0VA 2IDZA 4GI5A 4GI3A 1LGYA 4KO1S 2UVQA 3ACBA 4G8BA 2D5CA 4YHBA 2FRDC 5TPZD 4WKCA 2O1SA 1I32A 2BRUC 4ZU6X 2IX3A 1N5KA 3T41A 1RM5A 3IQZA 2UZ0A 4V0ME 4Z7NB 2HFJA 4KV7A 2C3YA 5BSGA 3TQIA 3CMMA 3FCUB 3G49A 1IN8A 1PVDA 1NXPA 1RM3A 2F55A 5HBRA 1SC4A 1F0YA 2OB1A 1U8XX 4ZQFA 1AX9A 4KIWA 5INTA 2W90A 3NTOA 4UNPA 2AGVA 3DDHA 4LNUA 1EFRD 2R5FA 3GJSA 4BEWA 4I5DA 3NTVA 1DMRA 1Z08A 4EI8A 4NABA 5HK8A 1MC4A 3EIFA 4D02A 2BR4A 1W36C 2HPHA 4XA8A 3ZDFA 5B12A 1WMBA 1QVVA 1FUYB 3NWBA 2H65A 3SZGA 3ILYA 1KYZA 2COKA 3BKXA 3AB7A 1PYDA 2CC2A 3ND5A 2HRBA 4LSWA 3WBJA 4CR6A 2OZVA 4ZI5A 4EKIA 2JLUA 4P80A 2GTPA 3ZHYA 3AL0C 1MPXA 3DZBA 5CNJA 3UMBA 1R0WA 3TW6A 1E5VA 2P4EA 2HADA 1FFAA 4A0HA 2JFPA 1M6NA 4IUDS 4WCDA 3SZLA 4CEJB 4OXRA 3AVTA 2C00A 2QYHA 1HFKA 1PR2A 3TZCA 3IXQA 3JRXA 3QLJA 3JY6A 5AM0A 2ZUEA 2GCNA 4B6OA 4DLBA 1ZZEA 1G98A 3HSKA 1Y3FE 3JATB 4EUHA 2BHLA 4IJKA 1RKVA 3KZVA 4OFWA 3ZDXB 5JZVA 3TTVA 1IVSA 1RQ2A 2DUMA 5J23A 2CV0A 2HW8A 1E3MA 1WUJS 1KZ7B 4V3CA 3AEUA 1GTG1 2F59A 3FFWA 3MMSA 3QUCA 3WKDA 4ER7A 4G24A 3RU7A 3HP1A 1MMFB 1Y3AA 2Q4EA 3PRYA 3AUXA 3GEGA 2FKNA 2PGNA 5DM4A 3H9JA 4YXWA 3KJFA 5DSTA 1KMHA 2AJBA 4D9GA 2VTBB 1NVTA 2B4AA 4BLTA 1OC4A 4MJ7A 1KEVA 5AK3A 3K9BA 3TLMA 2C8KA 3STHA 4U2BA 4Y2PA 4JL6A 2ID8A 2KJQA 1A3CA 2Q5JA 2DH6A 3EZ7A 4O4JF 3U4GA 3OURA 4KXVA 2OZLA 2Q0QA 4EYQA 2ZCJA 1X38A 2H85A 4MARA 1VPWA 4I6JA 1IN7A 1W1IA 4B2PA 1KDRA 2FMHA 4OJQA 4R16A 1U2ZA 1XWIA 4HXEB 3F47A 3W8DA 2CVZA 3ZV6A 5K0GA 3ANTA 4DRXB 1MXFA 3R3HA 1RLIA 3K31A 2VYND 4L76A 2PA3A 4NV0A 1SQ6A 1FP2A 4XQEA 1JHVA 1EFCA 1X7WB 1C2TA 4MVWA 5I8PA 1YZUA 5HRCA 5AUNB 4ASUA 1NVBA 1FQJA 2OECA 4REQA 121PA 3AHEA 1WNFA 2ORED 1TLFA 1RHUA 1YD7A 4GOXA 4RVOA 5JAIA 3R9XB 2G71A 3K0EA 1DXYA 4DA7A 4GZ5A 2WWYA 3BGWA 1P1BA 3V48A 5AJTA 1J0AA 2ADFA 4D8VA 5HA5A 4NULA 3FOFC 4XIFA 3FZEA 1UAAA 1UMCB 3CE6A 1YI8A 2VZEA 1VLQA 2Q3HA 4RMIA 4MR8A 3QXCA 2H1HA 5FDFA 2PKYX 4DCNA 3WIEA 3IBSA 3RK1A 3AKDA 3NBAA 3LPDA 2ZS7A 3QEKA 2GRUA 4YAIA 2RGDA 2BFEB 2P0EA 1UMBA 3F6RA 2CNDA 3D2CA 5KNDH 2W0MA 3AQ4A 2XD9A 1JIUA 2X5KO 4HADA 2AC7A 3ENVA 4R84A 1TPZA 1XEFA 3E2PA 4EDHA 4CG3A 5AVYA 3TIGA 1LY1A 4BVAA 3Q9LA 3V33A 4PM4A 4YRNA 3M33A 4B2LA 4KLNA 1MQAA 3ML1A 1AUVA 2L19A 2EKDA 4NMWA 4LVNA 3B3QA 1WDLA 4H1VA 1ECFA 1J24A 4CKZA 1CJSA 1XAIA 2V7BA 3BK2A 4AM8A 4R8VA 1U9IA 3L43A 1JUDA 2AQKA 1IXYA 3KFVA 5EZ6B 4KMOA 4DLSA 4RFSA 3L93A 1U80A 1YHNA 2YHBA 1O6ZA 3GCDA 3BDAA 3LVQE 2AXPA 4JT2A 4PR3A 4NEGA 2UYCA 3BXOA 3W2HA 2NP6A 1JEEA 1UP6A 4PNZA 4QNNA 3VHXA 4Z7OB 3LOUA 1PX0A 2W9XA 3W5BA 4DMKA 1A69A 4FQ7A 3D4PA 3H1GA 4B3JA 1KVUA 3E7DA 4EEKA 2SKCA 4FFMA 2IUUA 2I6UA 1TUGA 4JB2A 4OPMA 1C4XA 4WNCA 1ULUA 1K08A 1NYQA 1M6VA 2AEEA 2DHCA 2DX7A 4D99A 5BN3B 3KEOA 2IPXA 5KTOA 1NQOA 1GRNA 2MWMA 1FNDA 1SG9A 2BFFA 4WCFA 4MDEA 4AJEA 2P11A 4U6NA 1XGKA 2VPYA 4MV3A 2C1EA 1DKUA 4G6ZA 1P80A 2I55A 2QJWA 3T12A 1JDBB 2YZ2A 5E9JA 1KAOA 1NMZA 3ZU5A 3ZWPA 3I5YA 5CT4A 4FEGA 2P8SA 4Q9KA 5AHRA 5GPBA 5A7FA 2XA2A 2IV7A 2VH5R 3I9LA 3ODGA 4BP9A 1PFVA 1XMXA 1UJ6A 3ZLVA 4HKTA 1V11B 1UBUS 3MWEA 2QU8A 4KPUA 4N0QA 1RQRA 1T8UA 2QN7A 2J9YB 1JH8A 2Y71A 3PR3A 3MS4A 4MI9A 1VBNA 3EXAA 1VG9B 4A8JC 3H18A 4IZHA 4J1TA 4FHEA 2A86A 3HB9A 4Q1AA 2OAP1 1Y1SA 5BW4A 4XYLA 2BFMA 3A9WA 3D8UA 4JJIA 1RWMA 2CDBA 5I4IA 1KI1A 3DXXA 3IAAA 5FNZA 2PE5A 2V6JA 3UQZA 3NLLA 5BMVA 1QHXA 3HU5A 1A4XA 3PEFA 3PI6A 1ZUWA 3GVXA 2VCEA 1DKPA 2GXSA 4G56A 3GBSA 1YS7A 4FP9A 4XPIA 2Q28A 2QRZA 3CW8X 1AJEA 4RIEA 4KBYA 3QPAA 1YB4A 3JQ6A 1L7PA 4HI0E 4NJMA 5JD6A 1ZMBA 1XQWA 1SVIA 2RGWA 1JEAA 3CHYA 4MUFA 1FMJA 2IZ7A 4OLJA 2H11A 4LQ4A 3BE8A 4KJXA 2H9IA 3BGDA 2P30A 1IUKA 3ILVA 2WF7A 3KOXA 2ZAIA 4HC4A 4G9BA 4C2UA 5TY0A 5AKYA 2OFOA 3HCWA 3LY9A 1S2IA 5G0VA 1H2FA 1OJLA 1BOOA 1QO0D 1TK9A 3BKWA 1WCIA 1BX3A 1N1GA 1TMOA 2OO3A 2QJRA 5LB4A 2UKDA 1JKFA 3JD0A 3HJHA 4RSMA 5KDDA 3PEEA 4R40A 3ADBA 2NX2A 3CY6A 2RKBA 3CN9A 5IDXA 3SS7X 3QYAA 4UM9B 4RVDA 1VA4A 3LP5A 3HSSA 3TH5A 4CTOA 2XGJA 1NG1A 4TRNA 4MDYA 3WDKA 2HUNA 4ITVA 3QKUA 3G5UA 3OOWA 1E20A 3LCCA 4PAWA 3KCQA 3TR0A 1UBGA 4G01B 3TOVA 3M6AA 4RH1A 1G66A 3E3MA 1C0PA 1PEAA 1SKAA 2REQA 2WHXA 3L1UA 1DARA 3DEFA 3VR5D 3USZA 3AFHA 3EXHB 3FKSD 2GWRA 1G8SA 3BWDD 4DBLC 3OP1A 2P4HX 4KXNA 1T34A 1G6HA 3BE4A 1Y8RA 3JYNA 2ZRDA 2JCBA 2BD0A 1N36B 4IF4A 4P84A 4H59A 2AG1A 1ZA1A 1RHRA 1SG6A 3P9ZA 4I46A 4H1WA 5LQAA 3AY3A 3RFXA 3JQ9C 4YCBA 4A6PA 1JQEA 3HCDA 5TJHA 3GNTA 2O2SA 1JQDA 2XSZD 3WLJA 2C1ZA 2WIBA 2EARA 4KOAA 3HFRA 4L8VA 1TUIA 5HKOA 4BNKA 2Y93A 4O2LA 3OC0A 3W0LB 3NOOA 5JQWA 3U0VA 1QJ4A 3HCAA 2JHGA 5J2UA 1DIOB 2VUSA 1U94A 2GRJA 4CL8A 3G02A 1I2AA 1BFUA 2O05A 1YS2X 1XZ8A 2WJYA 2B8EA 2R2AA 2CLIB 3E7PA 3KPWA 1IWOA 1VMKA 4K9RA 4BB9A 3ZVKA 1S3SA 2J0UB 2BMFA 2ILVA 3LM8A 3KWLA 4OHVA 4GXRA 1EPUA 1YAJA 1GQOA 5A71A 5BNIA 2I4TA 1QONA 3IIJA 5L4SA 5FQOA 3EDCA 3MGBA 5DTIA 3ZGXA 3DDWA 1XFAA 5EJ9A 2R1ZA 3GARA 2RK6A 5ICEA 1Q0LA 1XK6A 3EUWA 4JC5A 2HDNB 1REQB 1LQTA 1NMSA 2Z2KA 1Z6PA 4BNDA 5JJBA 4O0MA 4BVJA 4YAGA 1NURA 2PFGA 3DAPA 1SBHA 2GBCA 2B9VA 3C5HA 3E82A 4FZ5A 3H99A 4A1OA 5B1EA 2VHYA 4GE3A 3ER6A 2RD2A 5DOVA 3QEJA 1QOPB 3QU5A 1L7MA 3TQQA 2H5IA 3CX8A 1GNTA 2Y27A 3I1FA 4R71A 4Z6KA 5JS8A 4I7EA 1CUGA 1E94E 4RJTA 5IHXA 2AXNA 4D6XA 1Q12A 1RWVA 2W2KB 1OFGA 3AEYA 4IDHA 4EUSA 1OLOA 1KY4A 3GRKA 4O2BF 3LDFA 1L8XA 3U5ZB 2C8VA 1F06A 4W5JA 2RGCA 3M6WA 5AYVA 4BEVA 4BDTA 1HDIA 1I01A 1TD9A 3R4VA 4UXIA 4EARA 3V55A 2UYQA 3JWHA 2H4FA 5EMHA 1WZNA 3H5WA 5T6BA 1CVRA 1Q6YA 1K3TA 5E4TA 2D13A 2Q3LA 2ZI9A 2C8JA 1ZU5A 2PXAA 2NUTB 5JAHA 1IWBB 4BEJA 2AKYA 2V4MA 5CTAA 5BN1A 5EMJA 2AWNA 1WVGA 1YVDA 2GUGA 3K1AA 3A58B 4RF4A 3QFCA 3S2IA 16PKA 1MZVA 2XUOA 4FYIA 1E1KA 4HQKA 1T2EA 3A26A 4Z1MA 2P3SA 3GJYA 2XXAB 2EHJA 4MZXA 1QP7A 3RV4A 4NWIA 4TRJA 1F0PA 5EL0A 2IH5A 2A5FA 1WU8A 4Y6QA 1DQYA 4EJFA 4B6RA 4EJMA 4K9KA 1A76A 2DCUA 4OQEA 1K4KA 4NZOA 5KC9A 2DSNA 3GG9A 1EB8A 4OAOA 4MK4A 3F7MA 3RB8A 3QOFA 2DPLA 3TIIA 3ZPXA 4YMTA 3E22B 2AFHE 2BKVA 3G85A 3O94A 1RI5A 2AHRA 2GFIA 2UZIR 2PMWB 1W25A 3D7RA 3IKLA 1L8OA 4L2IB 2DKFA 1ILEA 2VOJA 3KAJA 2J59A 3RPEA 2PKXA 1XKTA 2O8BA 4PGAA 2VSOA 2C4NA 2VRWA 2AFHA 3AF2A 3WXBA 1BTOA 1EK0A 2Q6IA 1C3LA 2Z8YM 2W6OA 1NHWA 5KYVA 2W00A 4Q5IA 3TEFA 3PTAA 5L3QA 5F98A 4V0LA 2ONJA 3MWDB 3W6OA 4YCCA 1M2NA 1P3DA 3LBNA 1M6EX 5J58A 4WXPA 3TIFA 1MW9X 2YV4A 4E08A 3CVVA 3PPXA 2PT5A 4Y8VA 3V4LA 2IH4A 2ZXFA 3KXKA 2NVWA 4ZVMA 1IUOA 4YXFA 2Y1FA 3WLRA 5C7YA 2QGZA 1IM2A 2JLVA 5LMCA 4RUKA 1M2OB 3GJ4A 2ID4A 3ER9A 1GTL1 5E1OA 3CPEA 4DB4A 1Y9EA 4LDZA 3KM0A 4R9VA 4CLOB 4ID9A 1KQ3A 1Q7CA 1KFEB 1W59A 1CF9A 5KVCA 3MJDA 4N5NA 2R6DA 4HF7A 3IDSA 1Z34A 1CBUA 4MVJD 1A8SA 4PQEA 4S0XA 3UAYA 4BLUA 1XUOA 3OJEA 3FD8A 3B7WA 4PYLA 4MWOA 1JTFA 3ZHRA 1MRSA 1U8UA 2EJWA 5EOVA 4Z4QA 3BHIA 1ID1A 3AKZA 2EJBA 1EP3B 2HBQA 4Q37A 2VZ9A 3BA1A 4TWZA 3IP3A 2YUIA 1K89A 1PD0A 1J0BA 1DIRA 2VJKA 3KQSA 3LUAA 2WZCA 2CK3A 5JRDS 5AJWA 1K9VF 4KUHA 5ALNA 1MHPA 4RA6A 4ZC1A 5K6AA 3IQFA 5HOEA 3WGZA 1PJZA 1N0UA 3INGA 4MV0A 2EG9A 1TJ4A 1Z5GA 3E3AA 2BGJA 2O50A 5TQJA 1PTJA 1H6DA 2R1VA 2YOHA 1XZMA 4JGGA 2HCBA 4UFNA 2WG0A 1S3GA 4UJ5A 2CD7A 3UJCA 5CYPA 5DNYB 3UGTA 4F93B 1SQFA 3EWIA 1T5HX 3ZV5A 5EJGA 2AIRA 1KZHA 4AKTA 3L0ZA 3QBVA 4P54A 5F1PA 1KK0A 3JQFA 2GZMA 4IJQA 3U6BA 3BOSA 3WWCA 3JVVA 3G2NA 3L1VA 1Q0UA 4LOKA 3K4QA 4ENVA 3STTA 2G76A 5L3SA 2B3TA 2J5BA 5AHWA 4V38A 1QH1B 2H31A 4YJFA 3U9LA 2YY6A 4MPTA 3ZGNA 1AK2A 1CZUA 2IY9A 1BXZA 3EGWA 2JCYA 3MOIA 5COBA 2CCGA 1YL7A 1U5BB 5H1YA 4PS1A 5LDGA 3BH7A 1RCFA 3HUFA 5G0SA 4DLZA 5I7WA 2OCDA 2N3ZA 2AQ8A 2YFQA 3R77A 4Z0PA 1OKKA 3PUXA 3L7JA 4CW7A 4UHHA 1Z36A 2BHNA 2GLUA 2J4FA 3I9KA 3K9WA 1A9RA 4C4TA 5H81A 5F73A 2GT1A 4FDMA 3V7UA 1LFAA 2OVBA 4JVOA 3FGZA 2UUAB 4P31A 1KGDA 4WLOA 2AX4A 3ZE2B 3UJHA 4BNLA 1Y1RA 1T6BY 5LBTA 1BX1A 4OA8A 4KQFA 1A8IA 3I76A 5H5JA 5DASA 3NXSA 2NQTA 3WP0A 1IZYA 2Q2NA 3D4LA 4D44A 1Z75A 3DHWC 3KWMA 4QASA 3T1YB 1J9GA 3LP6A 1MUUA 1WO8A 4MW9A 5M34A 1CY4A 4XSGA 1RBZA 1HR0B 4OG2A 3VU8A 1PNQA 1KQFA 2W8BB 1PK7A 1OXUA 3TKAA 4YUZA 2EFJA 3QNMA 4QQFA 3EGIA 1HPLA 2J6CA 4B4OA 3TTXA 1DAOA 1V43A 4ZIRB 4KWIA 5K0SA 3VR6D 4KH0A 3AHDA 4HFMA 1TEHA 4Y6GB 5EKUA 5CVVA 3ZDBA 3INTA 4L9SA 5DYNA 1PO7A 1V1RA 2FN9A 3PT5A 4BVFA 3TZEA 1XALA 4CCYB 4X1YA 5LQUA 1L1QA 4CM1A 3WZ2A 2ZJ6A 5DI9A 4XJTA 1RJ9B 3VPFA 4QC2A 4AX8A 1G41A 3ITKA 3UENA 5JU6A 4PAOA 1TC1A 1JB1A 2R2GA 3P2IA 3TQRA 4J94A 5CH8A 3CLUC 3LLVA 3DOEA 1GZSA 2RG1A 2YWJA 3IRUA 5CMLA 2GBIA 2M98A 4S1TA 2VPZA 2PANA 3L05A 1XTPA 1CY1A 3L92A 1MN6A 1U8ZA 2R6JA 3DEAA 3KXLA 2F9LA 4IIBA 3DB2A 4F5YA 2AZDA 5CVCA 1OHHA 1NF8A 4WUVA 4QBKA 4ZYTA 2ZDGA 2N0SA 4MWCA 1XHLA 3TGWA 1VCNA 3CRNA 3DLCA 4G2TA 2QTAA 5HF9A 5CIYA 3EEYA 1PG5A 5AUQA 3WYDA 4Z53A 1YC5A 4XM0A 4F9TA 5AIBA 3OFKA 3QEOA 4CEHB 4Z1OA 2EFEB 4TV9A 2GCGA 2AMFA 4LVUA 1MC8A 3MW8A 4WKPA 3T4PA 3NYWA 1CUVA 2VNKA 3SICE 4D43A 3OEHD 1NM5A 3K9GA 3OO1A 1ENOA 1MPTA 1FDRA 1NUAA 1Q0HA 4WOPA 4NENA 5U4QA 2XQJA 3UWPA 4BGIA 3O1LA 3IUBA 3T3HA 2IBTA 3MQ4A 1KMCA 3T5GA 1GLVA 1ORDA 1R00A 4FT4A 1Q91A 3LUHA 2YYSA 5M7EA 1B6RA 5JSQA 1Y4UA 2YASA 4QYXA 2WUEA 5IKPA 5K0CA 2J7PD 2E6UX 1VECA 4AJPA 5K9ZA 1A7KA 2DERA 2HQRA 5I3ZA 3ERCA 4Y30A 4MWTA 1AKTA 4RVFA 3UXMA 2ZRMA 2H4JA 1F1JA 1ODSA 2YICA 3L4SO 3L0IB 1Y6RA 5HG0A 4TXMA 3CKYA 1VPEA 1ACLA 2PZLA 1F8FA 2IEZA 4LY3A 1P18A 1N9ZA 3A3PA 3ROGA 1GSHA 1QIKA 1ORIA 1Y81A 1SVSA 3E7FA 4IKEA 4MICA 1H0RA 3A31A 2YCLA 3LUFA 4OK5A 4PNPA 4W99A 3X2FA 4N7BA 3T52A 3ZLUA 4H0NA 2J6BA 4GPIB 1FYEA 3M3DA 1DQZA 2Y1LA 3JALA 3V4SA 1HYEA 3GDWA 2VDJA 4WA8A 4F1KA 3P20A 4FSHA 3ORYA 3AR4A 3UAXA 4FMDB 5AW0A 3ZCXA 3ICVA 1W35A 5J1TB 1EGVB 4U1RA 3IIEA 2VJBA 5EJAA 4BNZA 3F2VA 1GG9A 4NPCA 2ODNA 4QGGA 5MN4A 2B98A 2ZU6A 2H1CA 3C3KA 3LX6A 4KXLA 4LRSB 4RZQA 4GECA 4TOIA 5TQ2B 4ZGBA 1UBNA 1OT5A 2F3TA 2ZAMA 1F6WA 5JNTA 3M5CA 1GUYA 3VR2D 3MAAC 1VDZA 5DHRA 4YCMA 4XGIA 4PSAA 4EB6B 3VZDA 2JGNA 1YRYE 3RVPA 3EFBA 2AUNA 3M5WA 1WOYA 3A6KA 3HCPA 4A6DA 1HZJA 2VAMA 2R8OA 5BSHA 1NVUQ 1S0UA 2NU7B 3ZNNA 1K68A 2FR1A 3R7AA 1T4BA 4LOHA 4JHLA 4XQ9A 1QE3A 1LA2A 3FSGD 3EIQA 3ZDYB 1TAQA 4P7FA 5TEVA 2DY1A 4JSTA 1FS5A 2CVQA 1B8VA 2KE5A 3LUCA 3NHBA 2QSJA 4WY2A 4X60A 5EE1A 1BQ4A 3JARB 3WZLA 1QGUB 4YUAA 4W9MC 4R1OA 3DL4A 3FFAA 1XRRA 4H60A 3WYAA 1P2BA 1GA6A 1JHXA 2V9ZA 2PZAA 1E7QA 3VH3A 5IUJC 1IBCA 4IIXA 4NQZA 1SZDA 2O5VA 4F6CA 4IOLA 1DRKA 2OEPA 3DXYA 3GZJA 2JRCA 4RQTA 1N7HA 1OWMA 5D5PA 1LKZA 2QRPA 4PBTA 4TPKA 4B3HA 3UJ8A 3HCCA 3IKMB 3JAWA 1I5OA 2LKDA 4F92B 5AR1A 3AETA 4Z2AA 3TXYA 4YJ2A 4TRRA 1UPXA 1YCGA 2JI4A 4BWVA 4R2XA 4CU5A 2XKKA 2QUIA 3B1XA 1GRQA 2EBUA 4LFCB 3IMCA 3VTAA 1PLJA 3S0JA 1JLLB 3DHYA 2R4QA 5TS2A 2FJ0A 4BMDA 2G04A 1RLOA 3Q9SA 1NQAO 3HUDA 1CR1A 1E58A 2BFDB 4TLEA 2G80A 2ZTVA 4ZU1X 4QJ4A 2ID9A 2XGOA 1UKBA 1RQNA 4RSGA 1N3IA 3AUJB 4E22A 1EGAA 2WG1A 4ACAA 3CRQA 2PQMA 3OMWA 5H80A 1E5LA 1YDFA 5DH9A 3LXRA 4MV5A 4ZOBA 4BNJA 1C9NA 1DP4A 2V7PA 4QDXA 5HVNA 3ZQUA 4NKRA 3UG7A 1IDN1 1GYRA 1H85A 3ZWMA 1EXMA 1TXGA 3NALA 4NNPA 1KE2A 5CXQA 1KIFA 1LVHA 3NFYA 4NK5A 4FFBB 1Q83A 1BS1A 3OQJA 4ODIA 1ZOLA 5D3QA 5FWAA 3S7ZA 4NNJA 4EYOA 2I78A 3LQ4A 4INJA 5D1HA 3PUJA 3OU2A 4G26A 4BAGA 1QV9A 2VNSA 4DJDC 1ULBA 3CTMA 4OCZA 4GZ3A 3D1VA 2HC9A 4OK3A 5G1PA 3H87A 1S9DA 1HE2A 3Q1KA 1P1JA 1QWOA 1D0SA 1DTWA 2QNIA 4RYLA 3I73A 1Q7TA 1KJZA 1SCJA 2F43A 4PSVA 3P2YA 4E5MA 5I7OA 4K6KA 5KYGA 1ZAYA 1EH5A 5LXTA 1EK1A 1NR1A 1NJ8A 1V96A 2VRCD 2YXLA 3HUUA 3KEGA 3MJVA 4HDNB 4M3NA 3VOSA 5CUQA 5ELMA 3P2EA 1P62B 3O7MA 5LFAA 1E4YA 1RS0A 5GP1A 1TJ3A 2R7KA 1QIDA 1Y0BA 3BUSA 5CD9A 3KZKA 2VNAA 5HEKA 1RPAA 2DPYA 2JFHA 2VL7A 4TS1A 4Y6SA 4CT5A 3AVWA 4MW0A 1QLWA 4CL3A 1D3AA 1IXSB 1KSJA 1SIWA 2E48A 3IYLW 1JGTA 1Q7RA 3OY7A 4QECA 3SSOA 2VPPA 1PJ3A 4PPNA 4I8IA 5JZSA 1WU7A 4JLJA 2GHTA 1LPMA 2FZ5A 2OHJA 3UCXA 5A05A 5JUWA 4LJ7A 3PDWA 1QQ5A 5DTJA 3W3AH 2HUPA 4C14A 4GGOA 4P6VF 1H5NA 1BU5A 3FWYA 3H5AA 1IUPA 1JTEA 5HMMA 2FX3A 2Y0EA 1KI3A 3QV2A 2CHFA 3X0DA 3P0FA 2IFTA 4WVLA 3TD6A 1OTXA 1YB5A 4ZOLA 3WRWA 1V9LA 2PRZA 2XUQA 3I9MA 1L5NA 1E2JA 5AK6A 2X86A 5DTEA 2PKCA 1K6EA 3IP9A 2FFJA 3RKRA 3Q2OA 3U4DA 1U7WA 4CKYA 4ER5A 2WYVA 3OT4A 1RE1A 3IAEA 1IEVA 1RLTA 3RNLA 3LWBA 1O6CA 2HJRA 2LIPA 3GA0A 3BRWD 4PGGA 3SHOA 3STVA 5I7SA 4D98A 5K4HA 4JT4A 4H27A 2XMBA 5REQB 3T61A 4BVLA 1KKLA 3D3JA 2FQ1A 3J7TA 2PL3A 4BVBA 4ZCLA 4KUEA 3RU2A 2F17A 1LK5A 1JDVA 1C1YA 5KTRA 4MVJI 1KH1A 2G06A 3JASA 3W5AA 2YYZA 3ZWKA 1HKUA 1YJ5A 2W4IA 4XVCA 1QAMA 1WKCA 2A5YB 2RCNA 1XXLA 3CZRA 3DFZA 4CMEA 4TYPA 1E69A 3OQBA 1MCZA 5EWMB 4QNRA 3TW8A 4CU2A 4DAEA 1BE0A 5JCXA 2C1XA 5ALFA 2BYTA 3PL1A 3MT8A 1HYGA 3AUTA 2QE6A 3SQLA 1IXRC 2H6EA 3JQBC 1FFHA 3ABIA 5G3YA 3ADKA 5T8KC 8GPBA 5HIKA 4HDAA 4MO2A 3BGIA 1NOIA 4JWKA 2KW5A 5IAGA 4ZCMA 1QHFA 1YGYA 2ZJBA 2ZE5A 3DZJA 4IX1A 3HCBA 5EIFA 4KNWA 4N03A 3EGDA 3L7MA 3WB1A 1X7XA 3NWJA 1S3IA 4ETWA 3GEDA 1XVUA 2X3UA 1NY5A 1XYGA 1U2SA 1YBVA 2RSLA 3B2QA 3PF9A 1X42A 4MLCA 5IARA 2R6R1 2ZIWB 5AVRA 1PK9A 3UJ9A 4NV1A 2Z5LA 1IC6A 5HJEA 2PLRA 3TMAA 1XMIA 1XN1A 1CUYA 2G70A 2BTQB 2V65A 2XKJE 2HXGA 3B8HA 4I99A 3AV0B 4NESA 2KBFA 2DWUA 4CGYA 2C9OA 1VC2A 3UAOA 5E9WA 1FYDA 1BDHA 1R0YA 4RV4A 1GA4A 4MV9A 4CFYA 4URUR 4KB5A 1QDUA 4KCGA 4Y1RA 5JBIA 2AG5A 1BFDA 3QKTA 1C8KA 1KHHA 2HPVA 1NW9B 2PIDA 3EULA 3L8ZA 4ZAGA 1CY7A 4P35A 5A6SB 4ESVA 1UEIA 5FWNA 4P7BA 1NVDA 1MB4A 3BRQA 1Z8DA 1DCMA 2Y4OA 3JXEA 4UMEA 1O94C 2OY0A 4A15A 1Y1TA 1W5BA 1GU0A 1JQAA 1UKYA 1G4AE 2OFXA 2Z4RA 4G4SO 4HO1X 1A9SA 2B8TA 3IQEA 5LC1A 3F6CA 3AGQA 4F38A 1W36B 2FFHA 2ZITA 3PDUA 4ALJA 2WWIA 4TKVB 3WBKA 2IU6A 3VTZA 1I94B 1KWGA 1QANA 2AQIA 2IDKA 5FJIA 1N32B 3FNHA 2ZPTX 2C57A 3I53A 3BZWA 3WGOA 3AF6A 4RVCA 3U80A 5JEDA 3H2BA 2I2WA 4WOJA 2OBBA 1XYVA 2C07A 2QZZA 2ZJYA 1WQ3A 1T0IA 3MTDA 2L69A 2O07A 1ZOPA 1MNAA 2OLKA 2VJQA 3UV3A 2YY7A 1VJ5A 2ZKIA 3MIZA 4OHCA 3T1QA 4OUDA 3X44A 4QG3A 1ODCA 5JATA 4EOGA 2IYLD 2PGIA 3PUWA 2FEKA 2IC5A 5HE9A 1P2SA 4JY7A 3E2MA 1JLRA 1NUPA 3EXG2 4FFLA 1HK7A 1KO4A 2MCFA 5LOVB 1PGPA 1PS0A 2J45A 2HQ1A 5I7UA 2ZBQA 4LXHA 4EHJA 1A1SA 5E38A 2P27A 3EUFA 1V4NA 3HJBA 1XTRA 1VMDA 1YDWA 5CW2A 3VSCA 5B7PA 1DZIA 3HGTA 3I2HA 3MM4A 4S1OA 4BU0A 4KNYA 4MS4B 3WGLA 4HDMA 4LSMA 3K9CA 4YMGA 2QD4A 1O6FA 2FPLA 3ZNQA 3ZWVA 1YZQA 3IT2A 5TC4A 4ND7A 2D2XA 4PHFA 1WR8A 3CUSA 2X4GA 3SNKA 2QRVA 3VR3A 4Q9IA 4JI0B 5KSZA 4Z4CA 2ZSBA 3KOWA 2JGAA 3HA5A 3NV9A 1G0OA 4UHJA 1QQBA 4ASUD 4FC7A 4C7VA 4QIHA 4FBMA 3P0RA 4DBZA 2UVPA 5IJZA 1OQAA 3TZBA 4EB0A 4LE1A 1Z4MA 4BZQA 2CZQA 1UWKA 4ITUA 1N2HA 4B4KA 1YCFA 3ESXA 3R44A 4QYIA 1ZI8A 3DOJA 3PQCA 4PZZA 3OCVA 4B4VA 1RXSA 4BX3A 4ZYZA 4KRXA 5IN4A 2PMEA 5H83A 3C14C 1EJ2A 4IV0A 1P1FA 1VLVA 1E2UA 2QI9C 5KNBD 3QKSB 4OB6A 4QATA 3W06A 2V9CA 2PAFA 2C0PA 4DS3A 2X0DA 3TS1A 4HNQA 1E3EA 5JASA 1JQKA 3BEOA 1ZUIA 2GK7A 2MYPA 2YX1A 4M46A 3CVXA 1ACMA 1SXJE 1I4OA 1MV5A 4BTLA 2G0TA 5FPKA 4EPVA 4OKSA 1L4KA 2V03A 4EKNB 3NPMA 4HGPA 3VHLB 1FFXB 3LHKA 3NBMA 4KQEA 3ROMA 4FPXA 2FMXA 2Z6QA 3FLEA 2QQ0A 2VT3A 4QODA 3OIDA 2XB9A 2XJ9A 2HD4A 2FZLA 1XCOA 3SZ3A 2I7VA 4OHUA 1I6MA 3CKMA 5NULA 3FNEA 4B7ZA 4K6OA 2ATCA 4DIMA 3H9EO 3ONEA 1FP1D 1XWFA 3CF4G 3U56A 1VP9A 4D8WA 4EY5A 2G7MC 3AOEA 1PU2A 2RGEA 4TM7A 1P45A 1UDXA 2PSEA 1N75A 2OBMA 4IQFA 2BGNA 4XKJA 5FFNA 2EZ4A 2O7SA 3L1KA 5K3BA 3QVLA 3EAQA 1XEXA 2CMGA 2H2GA 4I1UA 4X84A 2BGKA 3EH1A 4TWJA 3R8CA 1V16B 1ZD4A 4FFDA 1K27A 2Q4BA 3B9PA 4NE7A 4ZEVA 3W5CA 2GM4A 4ARIA 2W2OA 4IVPA 3AMVA 2D4HA 1PIWA 3ZV4A 1FXSA 4NAUA 1GARA 2P9TA 1CK4A 1QIFA 1C50A 3THRA 5HJ7A 3BGSA 1BMFA 1U9IC 4N5HX 4RZSA 3HXTA 5FWXA 4LOJA 1D2HA 3DZDA 1SUFA 4HK4A 1PG2A 2D7DA 2PCJA 5H59A 4Y2UA 1QO7A 4Q4LA 4W1QA 3S29A 2ZUDA 3TGLA 1G5TA 3AL2A 5E6UB 1Z5VA 4G41A 4MV1A 3E27A 3VU1A 1I5EA 1IN6A 1BFKA 3ZHCA 3HYLA 1O8CA 5AI4A 1BCSB 1ZITA 3RYTC 4B7UA 2CUKA 3ACDA 3SC6A 3BL5A 1GA1A 4K9OA 1NFRA 3E5RA 3N58A 4D74A 1NXOA 4PO8A 1SVNA 1W6UA 2AOXA 5CT5A 2JFUA 3CPJB 4HEQA 2NVUA 3WGJA 4F91B 3I5MA 4WCFC 3SXUB 3SIWA 4YT5A 1OYOA 2JH3A 2VWPA 1RW4A 3QX7A 5LP6C 1FDSA 2NT4A 3E8XA 3HUTA 3OZTA 4KQ9A 4TSKA 1VKJA 5FAXA 3F5FA 2O5RA 3JYLA 1O77A 3UMMA 3ZBQA 2PJZA 2BWJA 3FPKA 3AEQB 3HZRA 5HJ2A 5IBRA 1FU4A 3HJUA 4O8CA 4XGQA 5D3ZA 4Q3LA 1Z39A 2JAQA 2YHAA 3VVBA 1WUKS 3LKBA 5G0UA 4ZCRA 5EZYA 2QZ4A 4TSFD 4NS4A 4MX8A 3GRRA 1TKBA 2O0JA 3U5TA 5ALGA 4ZV9A 5B1HA 2I6QA 8ATCA 2CXUA 2FXVA 4K1XA 5KOJB 5CFRA 3DPIA 4MI3A 5IHPA 5KMGA 5K8TA 1JFRA 1UWCA 2XDAA 3EGEA 1ITZA 3F1LA 1A4IA 2ZREA 4GKBA 4IIGA 4Y1FA 2YWEA 4A8JB 5CDSA 3S1AA 4QUKA 4OGWA 4ZHQA 1TMKA 1VSBA 2D0DA 3BIOA 1X7GA 1BVUA 4FWBA 4JLSA 4YUXA 1B2RA 3JQ8A 3QNUA 3KTAB 1TYZA 2D2VA 3BD6A 2RC6A 3LSTA 2H0QA 1YONA 1K7EB 2EQBA 1Q74A 4RHTA 1FP4A 3IP7A 3ZH9B 1HORA 4E2YA 3D02A 3MBIA 3OLYA 1D0VA 5D5QA 2IS4A 1O95A 5CBPA 3NIGB 1XVTA 5EJEA 3S28A 3VYWA 3VRHA 3GLIB 3O5AA 5GAJA 3IOBA 5G41A 8MHTA 3WGUA 1ZCFA 4GXNA 1YDHA 1B42A 3P4YA 2DFKB 3KYIB 2ERYA 2V7QA 1SQ0A 2GHIA 4WTOA 1L1FA 3WHPA 1AGRA 4WNIA 2ZAYA 2WM2A 3FVRA 4MS3A 1DADA 1GL6A 1Z8NA 3DZFA 5EG5A 2PZMA