2GF0A

The crystal structure of the human diras1 gtpase in the inactive gdp bound state
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
QSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding protein Di-Ras1
total genus 55
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gf0A00
3EPJA 4Z1MD 2GDJA 2Q0HA 2G6BA 4JBXA 3KXIA 4TT3A 1W48A 4A0HA 1F5NA 4TMZA 1Z5ZA 2WIBA 1WQ1R 3AVTA 1K8RA 1KK2A 1VTKA 4LZZA 3ZLJA 3MWJA 3AQ4A 1NLFA 4HLDA 1BMFA 4LYJA 1M1YE 1W5TA 3KXKA 3CBQA 3GCGA 4QBIA 1QZXA 2O0KA 3QXSA 4CF7A 4S35A 1R2QA 4RD1A 3CUEF 4DUGA 4D80A 2IYUA 3ZVMA 1PJRA 2VLIA 4WAUA 4EKDA 2WJJA 1Z47A 4MRVA 2QPTA 5CK5A 3MWLA 4V0KA 1AIPA 2P5TB 2IYTA 1UKYA 4M1SA 5L3SB 5SZHB 4QBGB 1Z6GA 1AS2A 3AF0A 4DXAA 4KAXA 1KJWA 4WZBE 1KSHA 3L82B 2RKOA 1NF3A 3IGFA 1ESMA 3FVQA 4I1UA 5CM8B 4EPYA 2AL7A 4M53A 3LWNA 1OXTA 2GVDC 3A58B 1U8YA 3UXMA 4ZDIA 4N0DA 2ZITA 4PZLA 1Z0IA 3SHFA 3X1WA 1XPUA 1U8ZA 1XNJA 2FFQA 5EQTA 3C16C 1U99A 3PEYA 3B1YA 2W6JA 4TTRA 4DDWA 1YZKA 3PUXA 3I61A 2BCJQ 1TPZA 2CHVA 3MLEA 4TQUS 1R0XA 1NVVR 2MSDB 3TSWA 3Q5EA 5F9FA 1DO2A 1XTKA 2ZUCA 3THWB 4HAUA 4TL7A 5TARA 3SJCA 1Z6XA 2K5UA 2I4IA 3U2QA 2NTYC 2OESA 4A6PA 1OKKD 1CJMA 2YOFA 3K0CC 3HDTA 2PMDA 4W7SA 2KSQA 2ZU0C 1NLYA 1Q20A 1V5WA 5DH9A 3RRYA 3PR1A 4AKHA 1YR9A 4BFXA 2XAUA 1XU4A 2HF8A 1V43A 4KCGA 5HE9A 3QG1A 1DTSA 3KKQA 1LW7A 4QKQA 1ZM2A 1AK2A 3T5GA 2ZRJA 1EWRA 4OHXA 4CZ2A 3A1TA 3AKYA 1Z07A 3A1WA 2GILA 4LOAA 1M74A 2ZE7A 5EE5B 3V4FA 1PUJA 1E9BA 4ESVA 1Q22A 4NCHA 2H5EA 1VG9B 2NQ2C 3T12A 1K5DA 2WTUA 2OEPA 4CT5A 1JR3D 4A0RA 1IY0A 4Q1CA 4PHGA 1DAHA 2OFOA 2AK2A 2ECKA 4LPKA 4A82A 4OKSA 3QI2A 3WP1B 2FFBA 3B60A 3CZPA 4FI3C 4CEJA 1IN6A 2J46A 1VG1A 5E4FA 2RH5A 3QKUA 4BPBA 4DCVA 2FV8A 3NTUA 4LWZA 1OB5A 2EFHB 2OE2A 4L9SA 5EE0A 2MSCB 4NYJQ 2JJ2A 4B48A 2OCAA 1Z0DA 2IXEA 4GZMA 2CJWB 4YDHB 3W5IA 4M1OA 5FOSA 3EWAA 2IS4A 4NE2A 4LJ9A 4FW9A 4PANA 1MOZA 4JVSB 3GLHE 5KYKA 5IDVA 3ZJYA 2ZYTX 4HLCA 2OZEA 3RLFA 2XB2A 1W0JA 3BH0A 1TMKA 1NBMA 5AUNB 3SFZA 1E79A 4GRAA 2XJ4A 3BERA 3U5ZB 3REFA 1JJ7A 3B2EA 1JR6A 5DGXA 1XMSA 2FE4A 4GP7A 3Q72A 4RD6A 3ICQB 4FWTA 1A7JA 3H84A 4QGAA 4OI0A 4AD8A 1JBKA 1W0KA 1GRQA 2HUPA 1KI6A 1EG7A 3EZ2A 3P1JA 4QJ4A 1HQCA 3QY0A 2R8RA 4B3FX 1O87A 2C98A 3FMOB 2J0SA 3LRPA 2IYXA 5SZKB 4TQ9A 4I4LA 1OH6A 4N1AA 1LB1B 1WMSA 1YR8A 1U9IC 2ATXA 4NCKA 2FSFA 2IWHA 2PZGA 3X1DA 2FEMA 4OHYA 1HE1C 2QM8A 4JLDA 1JR3E 5AUOB 1WP9A 1FX0B 1PLLA 2ASEA 1OHHD 1WCV1 4IHQA 3W6NA 2JLUA 3SNHA 2XEXA 2ZR9A 1VG8A 4RZUA 3VHLB 3VR5A 3BBPA 2C96A 4I81A 1T5IA 4IRUB 4PQFA 1IN4A 2YC2C 5DN6A 4RVCA 3B78A 2ZJ2A 1PZNA 3Q8XB 3CKLA 4QL3A 2TMKA 3QF4A 5AJWA 3VFDA 1AZTA 1E79D 1OT3A 1J8YF 1MKYA 2BMDA 3Q85A 5G3YA 4KFSA 4AK9A 5G3ZA 1HT1E 1QHGA 2P6UA 2ZS7A 4NTZA 1KO7A 5L3VA 3D6TB 3OE7D 1Q1BA 4MGZR 1NN1A 3CH5A 3AKDA 2B92A 2FOLA 2AXPA 1JEEA 3RS0A 1X8LA 1KI1A 4U5XA 5FTKA 1QHIA 1AKEA 4C7OA 5DSZA 2QN6A 4G5OA 2A30A 2P6RA 1RRPA 1XTQA 5JI2E 3K9HA 2XSZD 4Q9JA 3UWKA 5JI3E 5LPNA 3KQKA 2PLRA 3DHWC 4B74A 4DLUA 2PBRA 3PVSA 3CF6R 3AH8A 3LNCA 3B85A 4HEJA 5LB4A 1KKMA 3C15C 3CRRA 1MRSA 3TLXA 3THYA 2VQSA 3MWKA 1CLUA 2WPDD 4LJYA 2W00A 4Z51A 2GEDA 4V0OA 1JR3A 2AHOA 3HU1A 1I4TD 1KY2A 2VTKA 2O8DB 2D2FA 4PC2A 3TUZC 1I2MA 4M0LA 2QMUA 2GJAA 3KKPA 5DISB 3QXXA 4IEIA 3MJHA 2YC4C 2VH5R 3I8SA 1KDRA 1IJFA 4Q4AB 2WAXA 1QHHB 1W49A 2YYZA 5CYPA 1SKQA 4XTCS 4PAQA 4CW7A 2NO7A 2ZI3A 4PPQA 1G4AE 4IFEA 1S1CA 2O8BB 3PITA 4U7DA 5FBLB 4C0KA 3VU9A 5JWRA 4WZAE 4BLTA 4XH9B 1S4QA 2YOGA 3I72A 3ZZ0A 3FKSD 2WKQA 2V7QD 4B34A 1RIFA 1TF2A 5EUQB 3ADBA 3THYB 3SJAA 5FPSA 4ZDWA 4IJMA 2ZSFA 5F9HA 3A1SA 2PX0A 2F1JA 4RCZA 5FOTA 4DCNA 5B58C 1N5LA 2A5DA 4KJZA 4US2R 4RZ3A 4UNRA 4D25A 4ERNA 5M04A 3BXZA 5FFMA 3L0SA 2IW3A 1LVGA 3RS4A 3MRSA 2X77A 3K09C 1KSGA 3IQWA 2EYUA 1NY6A 3EC2A 1QHHA 1HTWA 5KSYA 4ZKDA 3JZMA 4QHSA 4QHYA 1U2RA 2XSZA 3GEIA 3QF4B 1SHZA 1W36C 1UF9A 2GJKA 3C41J 3MSXA 4DLYA 2IUSA 2OBNA 3WNCA 3EW9A 1EWQA 2QMOA 5JS7A 2ZJAA 4PQRA 2ZXUA 1KSFX 2WMNB 1E69A 2XNDD 4Q21A 4DC9A 4XWOA 4MH0R 3PCRB 2EWWA 3E1SA 3EARA 2R6CA 2CHQA 4LYHA 2VF7A 3RYTC 2PLFA 2ZYVX 3WY9A 3VR6A 3A1VA 4CEJB 1FUKA 3TAHA 5KTYA 2IEYA 1P60A 3KQNA 4HZIA 2D06A 4G5GA 1AA9A 4EDHA 4BRWA 2YOHA 1LY1A 1XX6A 2E9SA 1NI3A 4Z1MA 2CNWA 4RSGA 4EFMA 1II9A 5GJBA 2R9VA 2QUZA 4FMDB 1IY2A 2C8VA 1W1WA 3TMKA 1IY1A 2KWIA 2Z5FA 1KI2A 1OHHA 3AVXA 1T91A 5JMTA 2BJWA 3K0AA 3OIWA 1EX7A 2DFKB 1TX4B 2BJVA 2A78A 3H0KA 3IO5A 4M9XA 4NCNA 4LUCA 3DPUA 1Q1EA 3X2SA 1VYTA 2RCNA 3A4NA 1DE0A 1XTSA 1NIPA 2GHIA 5KOYA 4XVQA 1UADA 4JJZA 4BLRA 4R2HA 2J0UB 4W9MC 1COWD 5LB2A 3AP2A 4UXIA 3HPQA 3AVPA 1OF1A 4TMVA 2JLQA 1D2EA 5H70A 3EZ9A 4TSFA 4HB3A 4TYWA 1KI4A 2FNAA 1IHUA 1CF4A 4Q4HB 1G3RA 2GF0A 4JBWA 1ESNA 3CF2A 5FI1B 4QC2A 2R6FA 1HE8B 1D9ZA 1T3SA 4XOIA 4IEEA 5DIFA 4LYFA 2CLSA 4OI2A 4Q7JB 5KSZA 1NJGA 1ZINA 5BXQC 1U98A 4UQOA 2UVQA 2X2EA 5HZHA 3LBIA 5EXPA 2EYQA 4QM6A 4M4SA 1UM8A 5BYJA 4OYHA 4QRHA 4Y0VA 1KI7A 5LD2B 5C18A 3P20A 3FTQA 1UBCA 4HAWA 1GRNA 4DDUA 3AUXA 1W5SA 3G0HA 4G1UC 2RGAA 4F4CA 1IQPA 1JALA 4G5SA 3AB3A 1KIMA 2ZE6A 3GPLA 5K8LA 1D9XA 2W0MA 2ORVA 1OIWA 1YKSA 4FD2A 3UATA 4MKHA 2R6DA 4IDQA 5KNDA 3TGPA 4D0NA 4YMTA 4HAVA 5FOVA 4RKEA 4URUR 4BECA 5B64A 3AF4A 3LBHA 2BIFA 2J7PA 4DCTA 5DI3A 1DAFA 2QMHA 1EESA 2QL6A 2C9OA 2W2TA 4XD7A 4OBEA 4PHTA 1R5BA 2D2EA 4HAZA 4L8GA 3RC3A 4ZCLA 1Z0FA 2ZI7A 2C2HA 5FUYA 3RAPR 1M2OB 1Z6TA 3ETLA 4IDNA 2O8FB 4TYNA 3NVAA 3H1TA 1UFQA 3GLGA 1Z6AA 2IYZA 1S3GA 3U3KA 221PA 3V9PA 2IHYA 3Q9LA 3SU8A 2GJSA 5JJLA 5IT5A 4UJ3A 2DHRA 1FZQA 2WKRA 1E9CA 3AM1A 4PO8A 4M9ZA 5TDHA 5H8WA 2GCOB 2QPOA 3MWYW 4M1WA 4ASUD 2XTMA 4MKGA 1ZIOA 4HB2A 2CL0X 4ZO4A 4Q7KA 5ELXA 1CEEA 4KSCA 3U6BA 1IXSB 2JEOA 2VHQA 2ZR7A 1X1SA 2CLDX 1E2IA 1QVAA 1G5RA 4RCYA 3BIFA 1KZ7B 4Q1DA 1G7RA 2VO1A 1TEXA 4NZYA 2QAGB 3HWSA 4LCBA 4A8JB 3GJ6A 3OIYA 3R9XA 2DWOA 4KHZA 3RHFA 2KBFA 5TMPA 3GLHB 3PUWA 2H1LA 1J7KA 4XWKA 1XJQA 1TUIA 2JLRA 2CL6X 1PV4A 2JATA 3RDPA 5E7JA 3TQCA 3WYGA 1CXZA 2ZRKA 3WXMA 3ASZA 1AJEA 4HUQA 3U7EB 1LNZA 1UEJA 2QGZA 3OFND 4JLBA 4Q02A 1GUAA 2J87A 4IXNA 3THXB 2XZLA 2EVWX 3B1ZA 1QBKC 1XD2A 5EXTA 3Q3JB 4JKYA 2HEIA 4V03A 3K09A 4EAQA 3WYAA 1N5KA 4DRZA 3CRW1 2GA8A 3LO5A 2WM9B 3CPJB 3AGPA 4QGGA 1HEIA 2IHBA 4NONA 1AM4D 1OSNA 3F3YA 1Z3IX 4NYJR 5FR2A 2CDNA 4XD7D 4JKIA 3TUJC 3NIBA 1Y3AA 4HSEA 1GITA 2EQBA 1TU3A 3W6PA 4BFYA 4CEHA 2DWQA 2J7PD 2OAP1 4TMKA 5SZIA 1A4RA 4DHEA 1BIFA 121PA 2LCFA 2ZJ8A 3B8HA 1XEXB 4N0EA 1FMJA 3CR8A 4B33A 1QHYA 4TSFD 2ZROA 1GDDA 4NPHA 4M22A 3KJHA 5FL7A 2VPPA 1E2EA 3ZQJA 3UG7A 4ZIRA 1COWA 2P3SA 4NYMQ 4JYBA 3P4XA 4KFUA 2WWIA 3EPHA 4AKEA 5B30A 3CRMA 3SJBA 3SJZA 4URZR 5KU1A 4OK5A 3WRXC 1SZPA 3EG5A 1P6XA 2XNSA 1FFHA 1G17A 4LPSA 1OLOA 4GFDA 4I1OA 4PSVA 3KKNA 3MGCA 4TLAA 4UNSA 3KFXA 3Q7QA 1XCGB 4B6EA 1G16A 1NBME 5C4MA 4WW0A 1LV7A 1GAJA 3CH4B 2PT5A 4DWJA 2JLYA 4ACBA 1ZMXA 3QQ5A 3VR4A 4AYXA 1VECA 2RHDA 2ZSAA 3GLIB 1E2GA 1ZCBA 4EFNA 1QHNA 4JLMA 1R8SA 3ZDQA 4BLOA 3GJ0A 4A2QA 3PFIA 2ZM5A 3OIVA 1NL3A 2ONJA 1VYVA 2KE5A 3KJGA 1U0HC 3FFAA 3OZXA 5CJ2A 1R6BX 1UBEA 3NH6A 1M7GA 4P4SA 2BEKA 3BH7A 4ESHA 1A2BA 2JIZD 4ZPXA 3OHMA 5E3HA 1Q3HA 2I1VB 1XD8A 1XMVA 2BHRA 3T35A 2R6GA 4TZ0A 1W44A 1XB2A 3B6EA 3D8BA 2HDNB 4DIDA 4LJ4A 3TBKA 3BORA 1F2TA 1KOFA 3H4MA 2OT3B 3GEHA 1Q0UA 1UKVY 2J3EA 4CEIB 4EPRA 1GVNB 2EW1A 2F7SA 3FWYA 5EE9A 2O0JA 1DEKA 4J0QA 3FYHA 2OCPA 2P2LA 4RKFA 3NHAA 2VBCA 5FR1A 4WA7A 4EPWA 5KNBA 3NDBB 1QDEA 2Q6TA 1GSIA 1FNMA 1KI3A 1SKYE 3I1FA 1Z83A 3W5JA 5ANRB 2ZRIA 1N6NA 2V8OA 3DDCA 3NC0C 4C7OB 2VHJA 821PA 2ZI6A 2EU8A 4NYIR 3LLUA 1KNQA 3B82A 2ZS8A 2OBLA 3HR7A 3MJRA 2WPDA 4CIDA 4URWR 1N6LA 1U9IA 1NN0A 4X8LA 3FB4A 2LKCA 5L3RA 2GAOA 2WOOA 2GZAA 2QAGC 4A8JC 1C4OA 3K0AB 2V54A 2V7QA 2WBLC 5GVSA 1Z2AA 1X8KA 1X86B 2XTNA 1E0JA 1J99A 3D3QA 3TKLA 4UKDA 4BZXA 5L3QA 3FDIA 1ONBA 2V1XA 2ONKA 1YZNA 1ZM7A 2ZRPA 3L8YA 4A4DA 3ADDA 2EFCB 2MMCA 1QHSA 4URVR 2FZ4A 1DELA 2ZEJA 4CYMA 3FPAA 3FMIA 1X8JA 2KJQA 2BMFA 1GKYA 1Z0AA 4EPVA 3O8CA 5K8UA 4CGZA 2WVJA 1X3SA 1G20E 2O8CB 4HYYA 1WA5A 1G19A 3U61B 2W83A 3CX6A 3O8RA 1E2HA 5DN6D 4ASUA 2W6JD 1GOTA 3VNVA 2UZIR 4FINA 421PA 1W4RA 4E03A 3EX7C 5EZ6B 3SBEA 1CJUC 4EPTA 4TLDA 3IHWA 2IYWA 1E2QA 1FTSA 1YVDA 2O8BA 1JQJC 2WSSD 4YQFA 2FPKA 2XXAB 1UJ2A 1G6OA 4TN1A 1FPMA 2OLJA 1F60A 2ZRNA 3U4QA 2O8DA 2F9LA 2C77A 3LV8A 2FZLA 4OL0A 1E2KA 1GNPA 2AK3A 1P61B 2UZ3A 4HDOB 3S1AA 3I92A 2EFEB 2IYQA 1BOFA 2ODNA 2XZPA 4YMSA 2V4ZA 1S1MA 4LBZA 2IT1A 1E0KA 2BMJA 4EIWA 4N3NA 3BRWD 1FMLA 3TR5A 3VHXA 3BE4A 4C0BA 3ICEA 3RNLA 3AVVA 1GG2A 8OHMA 1X1RA 2OG2A 1JPJA 4A0FA 3VU9B 2CMKA 5F3WB 3W8RA 1II8B 1TQDA 1CIPA 1LS1A 1JXMA 4F4JA 4MQBA 4IW3B 2OO7A 5EJEA 4DEYA 1CR0A 5DHAA 2WOJA 2WWXA 3PIRA 4QXAA 2DFLA 4IFBA 4IOLA 4YLGA 5HKKA 3BB4A 3G82C 1DS6A 1CP2A 4JSYA 4BLSA 2QBYA 2F6RA 1E1RD 3CLVA 4L15A 4V0NA 3CO5A 4EJSA 2BMEA 3SQWA 4B3GA 4Q4JB 1GWNA 1FL9A 1IXZA 4C0LA 2HXYA 3GJ3A 1SVWA 1G21E 2C5LA 4O2RA 4ON9A 4P4TA 2QORA 4HZUB 5FUVA 1R5OA 3RABA 3PUVA 4ILEA 4LHXA 2QGNA 2PT7A 2ZI5A 3O8DA 3LX8A 3I5YA 3BAFA 5HR5A 3EXAA 3ZYCA 1NN5A 4FXPA 5SZJA 1NP6A 3QEJA 5DLQC 4JLNA 1S3SA 5L8VA 4F7WA 2IYLD 4NKRA 3ZIAA 1K6MA 1ZJ6A 4EQ6A 3SE0A 1RC8A 2G1JA 2WICA 2NO9A 2QG6A 2ZJBA 5JRZA 1KO8A 4OQXA 2A5YB 1W2HA 3NBZC 3ZS8A 5C1BA 3FOZA 2FG5A 1ZP6A 5BWMA 3GP8A 3PEUA 1R8QA 1BYIA 5GADl 2YV5A 4PZYA 2F55A 4D82A 2OLKA 3H2YA 1YZQA 3FHTA 2QRNA 3KQLA 2FSGA 2OCYC 1FTNA 4R71A 1TF7A 1W2GA 3ASYA 1JNYA 4F4IA 4BZQA 4TQAA 5J47A 4BFSA 1ZRHA 3OAAD 4II7A 1MO6A 4MYHA 3U3MA 2CBZA 2VHCA 1ZUIA 2OM2A 3EIEA 3QVVA 2F1RA 3U7GA 2ODBA 1T0JB 2HV8A 4KSBA 4C2TA 4LDJA 1IM2A 2GAAA 4P0TA 1ZNWA 4BGDA 5JJIA 2GK7A 4DZZA 4DLWA 3RSOA 4RY2A 4DLSA 4KO8A 4BFUA 1CULC 2BBSA 2J5XA 2F43A 1JECA 1E9FA 4C0AC 4M1TA 4JJKA 3UANA 2HLDA 4HAYA 1XDBA 2AFIE 5LDDC 3RS5A 1Z63A 4CEIA 1N0UA 3WBJA 4C3ZA 4HUQB 5JZVA 2O8FA 1IBRA 4LBVA 3IUYA 2J9RA 1E9SA 4C2UA 2IEZA 5JECA 1OFIA 1T8UA 3NEJA 2BM1A 1M6NA 2JJ2D 4QJ5A 4FN5A 4ACAA 2GRJA 2VRWA 3T1VA 3U3RA 4B2LA 3AF3A 2GEUA 3B13B 3IIKA 2VP5A 3BOSA 4FCWA 2CE2X 4TYPA 2X8AA 2IS2A 5L3SA 1UKZA 3AKCA 4OI1A 5BW8A 4HLUA 2Q3MA 2IS6A 4BUJA 2D4HA 1T6NA 3QPUA 4TTPA 5CIQA 2VA8A 2VL7A 5EP3A 3RVBA 1ODFA 5KSPA 1M8PA 4YMWA 1KMHA 4HZUA 4QBFA 5KHOC 3HR8A 3CB4A 3DM5A 3KFVA 5FPKA 5BQ5A 3U6KA 4YC7A 1VYUA 4IDOA 3THXA 1H8ED 2JAQA 2QU8A 2JIZA 3AGQA 4BFVA 1Z22A 1SVKA 2D74A 2QM7A 1SQ5A 3UWOA 5DNYB 1OW3B 3SZRA 2JJ1D 1M7BA 1KI6B 4UNQA 5FPYA 3BK7A 3CPHA 3U60B 4BLQA 2PJRA 5D3MB 3L8ZA 1R10A 4MGYR 5E7MA 1D2NA 2QSYA 3GFOA 4DUGD 4LI0A 2NIPA 4NCJA 1T5LA 1BKDR 2ZI4A 2A9KA 2FFHA 3B1XA 1NN3A 2PZEA 1A5TA 5CLLA 1IN5A 1RYHA 1U94A 1P3JA 3DO6A 4ZDKA 2DYKA 3K0EA 4AKGA 1GILA 2ZANA 1KHTA 1E94E 2E1RA 2QMEA 1E1RA 4DJTA 4IDPA 1JQLB 3ND9A 1LFDB 1C1YA 1R5NA 1N2CE 1NBMD 4Q1FA 1TU4A 1D6JA 5AUQA 1KK0A 2JLVA 4KODA 1G7TA 3W3ZB 3IO3A 3IIMA 5AWFC 2LWIA 5L3QB 5FL3A 1DO0A 3IQXA 1SVSA 3U4QB 4FCTA 1CBUA 2FF7A 1OH8A 3WBKA 1EXMA 4LK2A 3NC1C 3NDPA 1ZW6A 2ZJOA 4LJ8A 4PO1A 3AF2A 3WNBA 4EJSB 1OFUX 5TY0A 4D0LB 1Z06A 3F5FA 4M9QA 2IA5A 4Q18A 4MGKR 3MD0A 2AX4A 2ZE5A 1P2VA 2D7CA 2H92A 2ZJZA 3PUZA 4HDQB 3TAUA 1EFRA 2NO1A 1G3MA 3C7KA 3DM9B 5G40A 1ZU4A 3IBGA 1ZYUA 2XJ9A 4Q7MB 3KKMA 4JLKA 4DCUA 2C95A 1BO6A 1CR1A 3NH9A 2NG1A 1R7RA 4AWXA 3LQRA 3SYNA 2EFDB 3WMFA 2G83A 1ZM9A 3UG6A 4TMWA 1Q57A 1E4YA 2SHKA 1LF0A 3EZFA 1KO4A 2AD1A 2IK8A 1CU1A 2QEQA 5E7IA 3VAAA 3KL4A 1XJ0A 3ADCA 4KBFA 4V0LA 4OQLA 4HB4A 2VP9A 1VPLA 2J41A 2B8TA 2ZQ5A 3KQHA 2ODEA 1R0YA 2GZHA 2KI5A 4US0R 4RD2A 3R7WA 2QNRA 4LJAA 4MKIA 4WVFA 2HYDA 4DLTA 1VCOA 4JSTA 3MCAA 1J90A 5CB8A 721PA 3BB1A 3QBVA 4DSTA 1E9DA 3PV0A 3ZD7A 4JL6A 3EASA 4TMXA 1RPZA 1CR4A 4URXR 1JAIA 2V9PA 3OF5A 4L9WA 2GXAA 3HP1A 3K9LA 3LW7A 5C2JB 1XCMA 2ZIAA 2NZ8A 4GT1A 5CM9C 3R9IA 1XMJA 5DO9A 1OFHA 1MR3F 3U3JA 1P2UA 4DB4A 1E32A 1I4LD 5FI0B 1IONA 4B71A 3AVYA 1JPNA 2V1UA 3OEED 2RGBA 3PENA 1U0LA 1KSJA 1P7CA 2PL3A 1WXQA 2ZRAA 1DARA 2O5VA 2WWHA 1OPXA 1BS1A 3ND8A 3KZ1E 1L4UA 2ZVPX 1XRJA 3DKPA 2NGRA 3QSYA 1UDXA 2NO6A 4FIDA 3VNUA 2GKSA 3BS4A 4A15A 4JLPA 4L16A 3CONA 5H68A 1E2DA 4TYQA 3QUSA 4JIMA 5DYGA 3TQFA 5JHHB 1TNDA 4GMDA 3P32A 2AWOA 2OUKA 1RRFA 3QPVA 3NEYA 1E2FA 1G291 5DYIA 1ZUHA 1HY3A 2JA1A 3AVUA 2Z0MA 1VIYA 2AKAB 5JFGA 2HJGA 2DCUA 3I8XA 4KVAA 1BH2A 2QQEA 2WZQA 3LAWA 2P0EA 4QNRA 5CJPA 2OHFA 2VSOA 4BWYA 1BMFD 1XEFA 1KK3A 4EPXA 1CKEA 4Q47A 1E4VA 1ZM4A 2QI9C 1PLJA 3F0TA 3GLGE 1WDTA 2YZ2A 3LW8A 1LF5A 3N5CA 1SXJD 2WIAA 4IDHA 4Q9KA 1CTQA 5CB6A 5KNCA 4NH0A 2P65A 3RANA 3W6OA 1US8B 2W58A 3EA0A 3LDAA 3DOEA 1KMQA 4LRWA 5HCNA 2HF9A 4PC7A 2O8CA 4MUBA 2G3YA 2BEJA 3GLFA 2NPFA 4JZKA 1G9XA 1GFIA 4XSGA 2OFWA 3OFNA 3OEHA 2BKEA 1G8HA 1E2PA 4AI6A 1NLZA 1U8AA 2PZFA 2ZYWX 4WBSA 1XXHA 3TUIC 4AYTA 3FHOA 4AIIA 3PUYA 2FSIA 3EZ6A 4MYTA 4UNPA 1E2MA 4TWZA 4NP6A 3LFUA 5UKDA 4NCIA 5DE3A 1KI8A 2WJIA 1H8HA 2Q9BA 4YDSA 4LSGA 4Q4AA 2WJHA 3RWMB 2Q3FA 1RYFA 4PO9A 3GLIE 5CLQA 2F3RA 1YU9A 3EIQA 4KI0A 4M1KA 1R0ZA 3GEEA 2OSBA 1PLKA 1XZPA 1VG0B 1II0A 3R7WB 4HB0A 4DKXA 4ZV4A 2FPMA 2REBA 3F8TA 1SKYB 3GLIA 2FX3A 4RFVA 1CJVC 2CLCX 4M8NE 4C0HA 3CM0A 1IAQA 3K1JA 3NXSA 4X8HA 4PAMA 1UBFA 1VHTA 2XB4A 3AP3A 4JLVA 4KLNA 5F2EA 2OILA 4LY6A 1DOAA 4BFZA 1VMAA 4GBMA 1AZSC 2CCGA 2VHTA 4DEXA 1HYQA 2FA9A 4LGMA 2AKYA 3ZQ6A 4BE7B 3QENA 2DFNA 1G41A 3C5HA 2AD5A 3LY5A 4CRWB 3DL0A 3AVWA 1T4GA 1NMXA 3MG9A 2G9NA 2CK3A 1HUQA 2B6HA 3SEAA 3T1TA 3IPYA 3TK1A 3TH5A 4JS0A 2AXNA 3M4YA 1NVVQ 2FH5B 1E99A 2WWGA 1N5JA 1XEXA 2GCPA 2ZS9A 3GLHA 3PEVA 4HATA 2C78A 3QE0A 1YJ5A 5KDDA 3ZD6A 4RZ2A 4E07A 2BCGY 1YZLA 2WAYA 4GZLA 2V3CC 4RFSB 1W4CA 4OK3A 5FBRB 5CYOA 2XNDA 2ZRDA 3CRQA 4PC6A 4ZCMA 3VKHA 2REXB 2ZRGA 3QOFA 5FL7D 2P67A 3IKJA 3SN6A 2IXFA 2QP9X 3UK6A 2IUTA 1J8MF 2PMKA 2RGXA 3L0IB 3RS7A 3HJNA 2OFXA 4O3MA 3K9NA 3T1OA 4F38A 4ZI2A 1G7SA 3EA5A 4LC0A 4RZXA 5EP4A 1YZTA 4FMBB 1NKSA 4MKFA 3BFXA 4D81A 1GKIA 4GOKA 2GK6A 4C0SA 2ZSDA 1QG2A 2N1BA 5LD2C 3K53A 1F3OA 3R20A 521PA 1AS0A 2YJTD 1FNNA 4DB2A 4C4PA 1ANKA 4JL8A 4P4UA 1NNEA 4Q01A 3A8TA 1PVOA 1FQKA 4GOJA 1JJVA 4QFMA 2H57A 4XSHA 2Z43A 3AKEA 3WNDA 3QKRB 3JZAA 4RJLA 2C03A 2WWWA 3VX4A 5KPDA 4TL6A 4JT2A 1S9HA 3N2EA 3CR7A 4Q9HA 4BLPA 1E1QA 3JVVA 5IK2A 1OB2A 3PQCA 2PEYA 3AP1A 1SULA 3NKVA 4M1MA 2F3TA 1T9HA 2Q9AA 4M9SA 1FX0A 4G5RA 4AG5A 2GEVA 4PPNA 5CK4A 1S9DA 1W4AA 5J5CA 2J0UA 2IX3A 3QKSA 5JRJA 4IKEA 3GLFB 3QEOA 2H7VA 2JJ1A 2FN4A 5FBWB 1US8A 4C0JA 3M1IA 1ZD1A 4JLJA 5FTJA 1P9RA 1ZD8A 4I99A 4U02A 4Z54A 1JXOA 1P73A 2A3RA 1N3BA 1XD2B 4Q1AA 2RGCA 4LHWA 2W0SA 3NBYC 3KUCA 4XWAA 4C30A 1HV8A 4LJ6A 4A0GA 1B0UA 2A5JA 3SOPA 2DPXA 1VDZA 1SXJA 4Q9IA 3CW2A 2GZDA 3FFBA 1SXJB 1JAHA 1KI9A 4A2PA 1GNQA 1SXJC 2RAPA 4B73A 4KYIB 1MO4A 4HAXA 3BD9A 3BJIC 2OCBA 4JL5A 1F48A 4B2IA 2GWHA 2WV9A 4EFLA 1ETUA 2QRZA 4YMUA 2FPLA 1GM5A 1DAGA 4IVPA 2O8EA 5J4VA 4URYR 3KUDA 3EWSA 1YZUA 1NKTA 4DDTA 3UMFA 3UIEA 1XPOA 3RS2A 1NVUQ 1IN7A 3WRYC 5J4YA 1VKJA 4E09A 1G8PA 4Q19A 2ZU6A 5AR1A 3W3AA 4PFSA 2IUUA 3L43A 1ZM3A 3U7FB 4JT4A 2E87A 4HDCA 1NG1A 2IF0A 2KBEA 4NL4H 5K8IA 1E96A 4PSAA 4KBGA 2QZ4A 1FOEB 1YQTA 4HI0E 5J40A 2IYRA 3IBYA 2R6AA 2L0XA 3OEEA 3NHBA 3TJZA 3SBDA 3A36A 1G3IA 1XJCA 2DWPA 3VR2A 1RE0A 3C14C 1TQ4A 5FPTA 4KFTA 2XTZA 3KQUA 3HU2A 1WE2A 4PZZA 4ITRC 1SXJE 5B57C 4PXAA 1Z29A 5JLJA 2CCJA 3L0PA 4DLXA 1XCPA 5GJCA 4JYCA 2BM0A 1GKUB 4TZ6A 1NVWQ 2Z4SA 4K46A 2P5SA 2H16A 3EPLA 4OQFA 2J45A 2DR3A 2OXRA 2IYVA 2I3BA 4QG7A 2XITA 1U81A 4LJ7A 1QF9A 5TB5A 1W4BA 4NDZA 3CWZA 1Z08A 4Q1BA 1G6HA 1XZQA 4W5JA 5FTMA 1Z6YA 3Q7PA 3GFPA 4Q4JA 3T06B 5KDLA 2DY1A 1D8TA 1EFCA 1I2DA 3THOA 3TE6A 4QGFA 1X6VA 4V0MA 4GPTA 2HJVA 2FWRA 1F6BA 3ZS9A 1DAMA 4CVNA 4DIEA 1OH7A 4YXWA 3KJIA 1E9RA 1G4UR 1G8GA 1KDPA 3IDQA 3KB2A 4IOKA 3H86A 3PJRA 1DG3A 3U3OA 1K5GA 1KJYA 2JGNA 3QVUA 3SC3A 2Z6VA 1N6RA 1J70A 3T1QA 4TLEA 1N6OA 2QAJA 3QNUA 3ZGXA 3DEFA 1II8A 2VYFA 3ZZTA 4DCSA 2ZJYA 1E6CA 5C4GB 4B6FA 4D4JA 5JWOA 1N6KA 4OI4A 1T0HB 2JLZA 3OESA 2HT6A 1G5PA 2AWNA 5JJKA 1XTIA 3VMFA 2CVHA 2UKDA 4AYWA 4AKIA 4UXHA 2ZJ5A 4B3XA 2X19A 2YWEA 3C4JA 1TF5A 4WXPA 3S1AB 1G5TA 4AY2A 3DOFA 1Q44A 1Z2CA 1NRJB 2CNWD 2ODWA 4LHZA 1P62B 4K8OA 4D4KA 3N2IA 2GXSA 2YWHA 5CDFA 3KTAA 5TVKA 2ATVA 5FH9A 4FCVA 1UKEA 2VP4A 1TEVA 4PSKA 2B8WA 4LC1A 5G41A 1TAGA 5CDFE 5JSZA 3PEWA 3I73A 5GJWC 1MV5A 4AURA 4CDGA 2RHMA 3WP0A 1OIVA 3QPWA 1TUEA 3QKTA 1ZAKA 4QBHA 2CEAA 2W2XA 4BZPA 1P72A 2V55B 3EAQA 2F1HA 4FMCB 1G8FA 3UMSA 4LHYA 5IF9A 3V4RA 3M6AA 2Q9CA 2X1VA 4LHVA 1KMHB 2JCSA 2J59A 4MITA 4Q7LA 1E2LA 1DG1G 5JCPA 3GJ4A 5EXXA 4A2WA 4G3XA 4O0MA 2WSSA 2ANCA 1WRBA 1GNRA 1UPTA 3CRVA 4DBLC 2JDIA 5J4KA 4RFSA 2FSHA 4L5BA 3T5DA 1VIAA 3A6PC 2G77B 3IILA 1EX6A 2KB0A 1KO5A 2JDID 1MH1A 3LVQE 1S8FA 1KKLA 2VIIA 1RKBA 3QF7A 1Z0JA 2WSMA 3W34A 2RB4A 1XXHE 1NSFA 4MGIR 1W0JD 2O0HA 4OJKA 1FUUA 2ZRHA 4Y0AA 4GMXA 4C9BA 2ZUDA 3T15A 1A82A 1VCIA 1L8QA 2VEDA 2XZOA 4XVUA 1KJZA 3CX8A 4Q5IA 1GP2A 2RGGA 3P4YA 4OQMA 3LVRE 1KDTA 2HCJB 4P33A 1MABB 3LXRA 1KGDA 4UXJA 4DLVA 2GXQA 2FMXA 1ELOA 3ZVNA 3TVTA 3HU3A 2ZRBA 4MYCA 2F9MA 4X8OA 5AJYA 5FTNA 4TTQA 3RWOA 1H65A 4Q66C 5FPHA 4Z8XA 3MFYA 1GRRA 3FKQA 4HLQB 4JVMA 3E5HA 3R8FA 3Q5DA 1W7AA 3K0FB 3WMEA 4BASA 1KNXA 3LD9A 1EK0A 2PX3A 1JEDA 1Z28A 1M34E 3N70A 2BC9A 3BFVA 3WHLA 4JVNA 2GESA 2BDTA 4GSYA 2HLDD 4ZKEA 5HPYB 4B47A 1NIJA 3D7MA 5GVRA 3CX7A 1ZUNB 2R2AA 1F2UB 1VCNA 4BEJA 2REOA 3O47A 2CXXA 4E22A 3K70D 3B5JA 2BV3A 4LBYA 3NWJA 2VP0A 2AFHE 3KJEA 4DSUA 2VSXA 1ZVQA 1D2MA 4O2LA 3RRNA 3CNOA 4MDFA 4NU0A 4KYUA 2D3WA 5FBVB 2YINC 2G88A 2JLWA 4US1R 1S96A 3HPRA 3QG5A 4UJ5A 2OBMA 4OHWA 3EIHA 3ZZUA 3ZVLA 3A37A 1KK1A 3DMDA 2XOKA 1DAIA 2IF2A 1NVXQ 4A6XA 2H8KA 1OFTA 4D2IA 5CITA 1E0AA 4BFTA 2IS1A 4P3YA 4MDEA 2QA5A 2ZETA 2D62A 2ORWA 2EWVA 1NG9A 4LV8B 3EC1A 1SGWA 2QTVB 4H1VA 4NBSA 4NYIQ 1P2SA 1GL6A 1ZU5A 2G0TA 2NOAA 5EZ5A 3WHKA 5J4LA 4V02A 3SYLA 3B9PA 1VCMA 2VF8A 1Z8FA 3GD7A 3CZQA 1Q1QA 2BWJA 4DLRA 1GL7A 1AQYA 3B9QA 2QAGA 4KLZA 2ZREA 4A8JA 4QJ3A 3SR0A 5KUTA 4D6PA 3CWQA 4DT1A 2CVFA 3AF1A 4TMTA 5HKKD 2Z83A 4DVGA 4ZCIA 4TLBA 4CEHB 1W0KD 4W5HA 1Z0KA 2IYSA 4LYAA 1N0WA 5BN5A 3U44A 2NO0A 1L4YA 3C5CA 4MA4A 2B7CA 3RC8A 1RFLA 2BBOA 1QVRA 3I3SR 3C8UA 5D3QA 2JJ8A 4YXWD 3I5XA 3EPKA 5EXSA 1OYYA 5JCZA 1Q12A 4FWIB 4F93B 2XGJA 2DB3A 2VSFA 4G5QA 3KX2A 4KVGA 2YVUA 4MRRA 1N5IA 2MMGA 1XMIA 4YONB 4ARZB 2B21A 3TSOA 3PG5A 2OV2A 1MO5A 1N6IA 1A1VA 2W6IA 1XEWY 2RGNA 1OYWA 3FGNA 2B7BA 1ZD9A 2J1LA 3E70C 5JEDA 2PH1A 2ZI9A 2CCKA 3X1YA 1KDOA 2CK3D 4Q48A 1W46A 2WJYA 3V00A 4PC3A 4B76A 3SHWA 4Q4LA 5A4JA 4ZI3A 5G53C 2A5GA 2ZRLA 4XVRA 2FJUA 2YHSA 3DKVA 5EE3A 5EP2A 1UEIA 1A2KC 3PXGA 1TL7C 1XBTA 3HYRA 1C9KA 3NBXX 1WF3A 4I1VA 2R65A 4G0NA 4M21A 3QKSB 1XD9A 1FQJA 4S2EA 1KYIA 3BC1A 3LLMA 2V6IA 4AC9A 2YWGA 4M2LA 2LKDA 2GTPA 1YR6A 1AGPA 1RJ9B 2RGNC 3CNNA 5AUPB 3QXHA 5JWHA 1CR2A 3THWA 1XPRA 1G7CA 3GQBA 4OQNA 4R2IA 3D31A 1GTVA 1KTVA 1IOZA 2BBTA 3AEZA 3FE2A 3OIUA 4JVLA 5H1YA 1P4SA 4OJQA 1OIXA 1TQ2A 5AJZA 4ZDJA 1NMZA 4CT4B 4GL2A 5HE8A 1SVOA 2BVNA 4WXRA 1U0JA 1OJLA 1AN0A 1DPFA 3HYTA 1T8TA 2IL1A 1QG4A 4GI7A 4IVRA 1AGRA 3TW4A 2BBWA 1L2TA 1YR7A 1ZC4A 2IYYA 3BH6A 4KFRA 4PHHA 3LX5A 3W9YA 3LXXA 2V6JA 1G8YA 2R44A 1G3UA 1NMYA 2CHGA 4GP6A 2ZSEA 1MT0A 1VHLA 3KTAB 4M1YA 4GNKA 5FOXA 4ABYA 3LQQA 4FMDF 4Z8YA 3SFVA 4E5UA 1YRBA 1J2JA 3TRFA 1WBDA 1SVMA 4KU4A 2JLXA 1UBGA 4L4UA 3RS3A 1IXRC 2ZVQX 3QBTA 2N46A 2QP3A 5EUMA 5JEEA 1WBBA 4A9AA 4Q00A 2JASA 3ECCA 3A4LA 4JMPA 4BEBA 3A4MA 4R7ZA 4B32A 4Q9LA 4GDFA 2A5FA 2C9YA 3CIOA 4Q1EA 1FW6A 3KKOA 3AV0B 1IN8A 1Y63A 1R4AA 5DI9A 5KPJA 4TYYA 3IPXA 2OAQ1 4JBYA 2ANBA 4B2PA 1QHXA 3I62A 1P2TA 1YE8A 1KAGA 5AJVB 2FDCA 2GBLC 1OKKA 2YNMA 2QSZA 4AG6A 3X1XA 4JLAA 3I32A 4MUAA 2J0QA 1CRPA 3E2IA 3CNLA 3OAAA 1SHKA 4WIAA 1OV4A 1LTQA 4F92B 3K0SA 3GJ8A 2P6NA 2GF9A 2F43B 2HXSA 3DZ8A 1RVDA 2H18A 5E95A 3TNFA 2A2ZA 1JB1A 1KO1A 4R9UC 2OXCA 4D0GA 2PCJA 5HZKA 4TT3D 4FMCF 2GBLA 3NBFA 3AVOA 2QENA 5GJVC 2WHXA 5J4HA 2AR7A 1MABA 3U44B 2GXUA 3UPUA 4K81B 3QXCA 3FHCB 1YRAA 3GFTA 4W5WA 3SYKA 1DBSA 4QNMA 4A36A 2ZRMA 2GJ8A 2A7QA 5B2ZA 1G1MA 2YKGA 4NHOA 2O8EB 2GCOA 3ADKA 1AS3A 1WB9A 3QKRA 5FTLA 2Q21A 2GNOA 1U90A 1ZCAA 3RRZA 4PHFA 3ZIAD 2CL7X 1AQUA 1QRAA 1CJTC 1F2UA 4MRPA 5A0FA 2JLSA 2XXAA 4LV6A 2QT1A 4Q03A 1ZBDA 3MMPA 1G64A 4EJSC 3LA6A 1KY3A 4I1SA 1XTRA 2GETA 3L0OA 3BB3A 4D4MA 3B1WA 5FOWA 4O25A 5DHFA 4H9GA 1I4DD 1NJFA 3A1UA 2NZJA 3BFKA 3SS8A 3TIFA 1B23P 1RZ3A 4POAA 2Y8EA 1G3QA 2BKUA 3K0CA 3B1VA 2QE7A 1RJ9A 3EZ7A 3T61A 5IHPA 3GJ7A 5AK0A 5EP1A 3BWDD 1E9AA 5C46F 2J0VA 1E9EA 1BYUA 4EUNA 3K70B 1W47A 1LS6A 4MRNA 2I1QA 4WZ6A 4BQSA 5BN4A 1G18A 4LJ5A 3SI7A 5FUXA 3M0EA 2RGDA 1W36D 4MRSA 1SVLA 3O8BA 5FOUA 3VQTA 4DT1B 3RRMA 1M7HA 1P9WA 1S2MA 4ZIRB 3W8NA 5JSZB 2WWYA 4H1UA 5AJXA 2ZAMA 2NMVA 3QJYA 2QBYB 3IEVA 5JHGB 4C0QC 4B3DA 2IC5A 3R9WA 3KDSE 1OXVA 2ZE8A 3GJ5A 1P9NA 3IEUA 2C04A 2F1IA 3VKWA 4DSOA 2IBMA 2WWFA 5F98A 2FGKA 2VHUA 2ZYUX 3I4LA 1XXHB 4YMVA 4U00A 1RRGA 1ZNZA 1N6HA 2ERXA 5JS8A 1HA3A 3IHLA 4TL9A 4EQ6B 4B43A 3TR0A 2IXGA 2VP6A 1E2JA 1MO3A 5KO2A 1XF9A 1T3HA 2YWFA 4OK6A 1DAKA 2H17A 3KB1A 2QROA 3FMFA 1R0WA 2WMOB 1FP6A 4JLOA 4D26A 4P32A 1N25A 2R62A 5JBQA 5HTKA 2GVZC 2CE7A 1HURA 4RD0A 3VTKA 1UDWA 3TW8B 4NYMR 5HCIA 4XJXA 3U7HB 3K8YA 4OHVA 2PCLA 1DVRA 3GLGB 4IVQA 1E1QD 1XP8A 2X2FA 5IK2D 2HT1A 2FFAA 1SVIA 2RGEA 2GCNA 1H8EA 3LBNA 1OXUA 3AUYA 1NSTA 2G0NA 3LH5A 1EFUA 1AKYA 1IJEA 3FMPB 3FKSA 3JVUA 4B3BA 3J81k 1MRNA 3B7GA 5A5GA 2WJVA 4NMMA 1Q3TA 4RD3A 4A92A 1RRCA 2QQ0A 2NPIA 3RSLA 3QIAA 5DI3B 2DBYA 4KXFB 4ARZA 1YHNA 3GLFE 1DADA 2EFGA 3UKDA 2QTHA 1UAAA 1EGAA 4UNNA 4PPGA 4GOXA 1GZSA 3P27A 3R8CA 3DZDA 5IRCD 3GMTA 3TVDA 3TSZA 3P26A 4PTLA 4BRUA 1RW4A 1H8HD 4LV5B 4MYUA 5KSOA 1OE0A 3QXJA 2PJZA 3VR3A 1PUIA 4PQYA 2WKPA 2QP4A 1ZNYA 2DFTA 4IOJA 1N6PA 1L7VC 5LBIA 3AVQA 2ZUBA 4IOMA 1YZGA 3GJXC 2QT0A 4BFWA 4V0ME 2W6ID 4PX9A 3WMGA 2HYIC 3MUFA 1ZIPA 3NG1A 5CIWA 3VX3A 1KAOA 2W2VA 1EFHA 4B3CA 2IWRA 2D7DA 1HQYE 2WJGA 3IIJA 1ZNXA 5BN3A 5KDOA 2ZAOA 1CJKC 1JI0A 2C99A 2QPAA 4KITB 2QE7D 4QM7A 3ZVRA 3K0FA 2RMKA 4G01B 1OXSC 2ZTSA 4DSNA 2ZRFA 3G5UA 2AN9A 3T34A 4B35A 4Q4HA 2Z4RA 4PR0A 4TLCA 4D4LA 1EFRD 3BGWA 3ZH9B 3DMNA 3K70C 4X8MA 4QGHA 3OE7A 4WOPA 2BOVA 2C9CA 2PEZA 3KXLA 1XFAA 2HCBA 1CS4C 1E3MA 3X1ZA 2ZSBA 1OXXK 4PPFA 3REGA 1KZGB 2QY9A 3UMRA 1NY5A 1TADA 1CRQA 5K8TA 1XTJA 1GL9B 4DLZA 2J7KA 4QOSA 2FEOA 5TV2A 2VP2A 1ZC3A 4PC1A 4HLUC 1P5ZB 1N0VC 4RD4A 5D3MA 2QTFA 2N42A 621PA 2ZRCA 1O3YA 4HUTA 2XOKD 1XWIA 4P4SB 4XTRA 1D5CA 3DVLA 4B44A 2XX3A 1E0SA 4OHZA 5FBQB 1Q21A 2ERYA 2Q3HA 2FGJA 1E98A 1HT2E 1FP7A 3SDZA 1TQ6A 5BYKA 5FUWA 1Q1ZA 4LX0A 1P75A 1S0UA 4R98A 1OH5A 3SQXA 3K9GA 3VKGA 3ONWA 4A1FA 3L2OB 2G1KA 4F91B 1W36B 4QHTA 1GIAA 1EFTA 5P21A 4LBWA 3CPEA 1HH4A 6Q21A 1DAEA 3VR1A 2CJWA 5EE1A 4P31A 2ZR0A 3MAAC 5TXGA 3W90A 2FU5C 3CF0A 3OEHD 1E2NA 1XEWX 4TL8A 2ZPTX 1T3LA 2O52A 3WYFA 4B75A 4DDVA 4IXMA 1F2TB 2MSEB 4XIGS 2ORIA 1TTTA 4KV9A 4PAOA 2GJ9A
chains in the Genus database with same CATH superfamily
3DDWA 2QLBA 7ADHA 2Q6VA 2DH5A 3CQ9A 1H4QA 1CHDA 2JA2A 2JHGA 4TKVB 2NXJA 2ZYRA 3KXIA 1Y5IA 4TT3A 4A0HA 3DW1X 1V35A 3EDOA 3AVTA 4HP8A 4LDPA 1KK2A 3N75A 4LZZA 3V2IA 5CVCA 1JDBB 1M1ZA 3K72B 1NLFA 2WZBA 1KU0A 4HLDA 5AVXA 1DSSG 1M1YE 2QUAA 5A2QA 3TBHA 4D9EA 3AI7A 3BWCA 1NA5A 3ENZA 3GCGA 2O0KA 4G2NA 1P74A 4NNJA 4CF7A 2MIIA 1Z2PX 2OV8A 3DAPA 3NOVA 5ALTA 5FYQA 2N3ZA 2HMSA 2IYUA 3H3XA 3KOOA 1ABEA 1RYYA 1WPGA 4WAUA 3NTXA 3T3DA 3GNTA 1VBFA 4MRVA 1N2BA 3D4PA 1CETA 2H5IA 3ABQB 4FGKA 1HDYA 3MWLA 4V0KA 5AOCA 1AIPA 2HRBA 5L3SB 1UKYA 3D4OA 1QQ6A 3L8FA 4RPJA 1X1AA 4DXAA 5KOIA 1HGXA 1V2HE 1VP9A 4I9FA 4Q82A 2EKBA 4WZBE 3T9CA 3MHPA 1ORRA 1FQWA 2BY4A 2RAVA 5H3CA 4EPYA 2PGIA 1GO2A 4CF6A 2PUDA 4L3VA 4M53A 1RI1A 2B7LA 1XL0A 2PJDA 2GVDC 1NVAA 1XALA 2B99A 2IZZA 3OLYA 4MWCA 4L6IA 3LLCA 4N0DA 3RFTA 4BQEA 4Z7NB 3IAXA 3GXBA 3X1WA 2R8EA 3L7YA 1CQIA 2C5EA 1U8ZA 1XNJA 5FO1A 4QYMA 1E1CB 3C16C 1U99A 3Q2KA 3PEYA 1ZQ1A 1G0OA 4FT2A 1CY6A 1VHJA 1YZKA 2F3PA 2O1SA 3LYAA 1VL6A 3PX3A 4WZAB 4ZVTA 1TPZA 2GKGA 3G2OA 4M7WA 4TQUS 4ZEVA 2NVWA 5DHRA 4O8CA 1ZICA 4K6MA 1I7NA 3VVMA 1VL2A 3A6KA 1OBVA 3PSHA 3ZE2B 1RM5A 5JAZA 3PVCA 4LF4B 4KR3A 2ID9A 3CUKA 3E9DA 4HFMA 1WY7A 1MAAA 3B6MA 4A6PA 2RBEA 5E6SB 3EGOA 4W7SA 2KSQA 4F6RB 1NLYA 3JRWA 5GGYA 4B5KA 4DA4A 3PIDA 4JLSA 4D3XA 2XCLA 3RRYA 2FVXA 3IBCA 3PR1A 1FBTA 5ETJA 4ZVUA 1YR9A 5TRTA 4IUCS 1L7RA 1S2NA 3WQQA 2QJWA 4FONA 3FNHA 1DTSA 1NJ5A 1YS1X 3KKQA 3PC4A 4GQAA 4ZRMA 5KMGB 3IVAA 3KJXA 2P9CA 2ZRJA 4UU1A 1EWRA 5IU6A 4A1OA 4I3HA 1QKKA 3DDSA 2F00A 4F1JA 3DOUA 1MB0A 1EVEA 1KIFA 4XX1A 5K6TA 1A8IA 4ESVA 2WD8A 2V7TA 4QLOA 5U1PA 2IU0A 3WL7A 2EEPA 3WBFA 1Z7WA 3HVHA 3KT6A 1A9QA 1GZDA 1K5DA 2GD1O 2OEPA 4R8VA 2FN8A 4GZ3A 3NETA 4YRTA 1I5RA 4QARA 3BMNB 4YXFA 2D00A 3G89A 1LNQA 3QI2A 4OKSA 3TCNA 2FFBA 4WN9B 4NMWA 4P53A 3OO1A 4CEJA 3L1KA 2J46A 1Y48E 3L7MA 5E4FA 4BPBA 4OA8A 5A05A 3STUA 1IBCA 1D2CA 4NBUA 3K5WA 1R50A 3TE7A 5I7FA 3ZQKA 4DIOA 1BCRA 1OB5A 2EFHB 2OE2A 2A94A 2XUFA 1PV2A 1NWCA 3I6BA 4J4BA 4NYJQ 1ZXBA 2I2CA 1OU0A 4X1YB 1IQ0A 1X7HA 5DTMA 1K9VF 2QRVA 4L8LA 3S7TA 2QMQA 3EWAA 4FDLA 4LJ9A 5IDXA 4OUDB 1WXDA 4PANA 2ESRA 3BWXA 3L4JA 3GLHE 4EGJA 3R40A 1E77A 3ZDAA 3RSHA 2OZEA 2YDYA 3UVEA 1W0JA 2BZ1A 1TMKA 1NBMA 2P6PA 5IMBA 2HJWA 3VC2A 3VI4B 1ECPA 4KIUA 4KB5A 3N6XA 2PKQO 3GI1A 5C51B 4J16C 4DUYB 2ZIGA 2BDEA 3REFA 1JJ7A 4NFHA 3WL4A 1JR6A 4NPCA 4QPDA 4ZT3A 1XMSA 2FE4A 4GP7A 5D6OA 5LZ9A 5JPCA 2RG7A 1FVHA 1DV1A 2RGUA 2WUDA 3GRFA 1M5RA 2POCA 2VQEB 2DE0X 3U26A 3AWIA 1EG7A 1VMKA 3DTNA 1X19A 3QY0A 2R8RA 1ZGZA 5EJIA 2M32A 4YY3B 4YQZA 3LT2A 1GHTA 1EJBA 2VZ8A 4I50F 3NHFA 1T13A 3GVIA 1F0KA 1ONPA 4BVAA 3QE2A 1YR8A 2PZGA 2FEMA 2VDJA 4HGOA 3HM9A 4KK4A 5K0LA 1MFPA 3EULA 3SP1A 1UQRA 1DRJA 1FX0B 4NI5A 1JKXA 2ASEA 3MTQA 4N3AA 2AMYA 1FFXB 4U7HA 3K9FC 4IHQA 3W6NA 5K6AA 3BL5A 1JLRA 2FOIA 1GKKA 1RQNA 4YROA 3DFMA 1ESEA 1P77A 5I9BA 5BWNA 3VHLB 2ZR9A 5J58A 4RZUA 2JLUA 3QUBA 3E8SA 4FYHA 5TMDA 3ORQA 2ID4A 2VDMB 2QW1A 2C96A 3BBPA 4I81A 2I2WA 1T5IA 4YP7A 4D3SA 3ZXUB 2MDTA 2G76A 3HUEA 4UEWA 1YZYA 3W8DA 1PZNA 5A06A 2TMKA 3E5RA 1GZVA 1U0SY 3M5CA 4ZT4A 4BY9E 1IZZA 3OTQA 1OT3A 1ORDA 3GZJA 2EXXA 3N87A 3SZGA 5JFOA 1R0CA 4KFSA 4XQGA 4AK9A 4FB5A 1J00A 1HT1E 2BTQA 2JFNA 3KB6A 4FFOA 1KO7A 5L3VA 2HA6A 1LBTA 3A6DA 3BKXA 5AK6A 4G9EA 1QV7A 1NI5A 3OE5A 4P0PB 1Y3DE 4O4LF 4ZTUB 2FG7C 4XKJA 5EMMA 5HIIA 1TFUA 4U5XA 4E7PA 1AKEA 1BNCA 3I6YA 4C7OA 4PHCA 2OORA 1FDWA 1NMQA 3I1IA 3MIIA 2P6RA 1GNLA 5JI2E 1YQQA 1RM0A 3CXUA 1B1CA 4Q9JA 4QULA 1USGA 4RGVA 5GIOE 2PLRA 1JAZA 4B74A 4DLUA 5IC4A 3KLOA 2ODQA 4ARSA 1SU8A 2FVYA 2H7XA 3CF6R 3LNCA 5AKHA 4W9NC 5LB4A 4OFXA 2G5GX 1H0KA 2E4AA 3A4IA 3C15C 4R0NA 1YZVA 4AXBA 4AKTA 4BJ1A 2ZDGA 2VQSA 2W00A 4Z51A 4C5CA 3NAMA 1QIHA 2CFTA 2EFYA 2YW9A 2AG0A 1I4TD 4HNSA 4Q7MB 3T3OA 3GIDA 4ZVOA 1L7MA 1RLJA 3EXEB 3I1JA 5IH7A 2JVJA 2IIVA 1DJOA 4OXYA 4AS1A 4YDRA 4AXXA 2CSXA 4M89A 1F20A 2P79A 4QXRA 4IEIA 2J9XB 4R7TA 4Z7OB 3WV5A 1F38A 4BVHA 4YJ2B 2C54A 2VH5R 1KDRA 3I8SA 3MYYA 3UY4A 3PNYA 4XUEA 1MV8A 1V6SA 3U5TA 3A27A 3UN1A 1P39A 2BGNA 1IULA 2FUEA 3ANLA 4GQBA 4BGIA 1WU8A 1L7BA 4L2IB 5DSTA 4Z53A 4EEXA 1USWA 3H2ZA 4PPQA 4UU8A 3PYXA 5JD6A 1EI9A 1UPCA 4FTWA 3O4FA 5C7YA 1UEXC 1WDMA 2CZQA 2I54A 1IJKA 3LY7A 2V7UA 3DLTA 2PKWA 3VU9A 3IE2A 3UC5A 1HDZA 4LGVA 4LXTA 2YOGA 1L8AA 3PPWA 1OA1A 1CRLA 2WKQA 2V7QD 3EXIA 1F2DA 5EUQB 2DXIA 4R41A 3SJAA 3FRHA 4YASA 2Q7XA 3CRZA 2ZSFA 1GYPA 5AK5A 4BBPA 4G81A 2A5DA 1NQTA 4F11A 1F4PA 1HMPA 1P0QA 2C4KA 3WYDA 1R9GA 1IK4A 1JKMA 3PXXA 1YMVA 4K40A 3JAKB 3W0LB 1YBHA 4NZOA 4BHTA 3WNZA 4YFYA 3M34A 4FYVA 4V24A 1NKVA 2OORC 5DRYA 3L0SA 2IW3A 2WYVA 4NAVA 2A9VA 4NZNA 5ICMA 4WUTA 2X77A 1Z3CA 3K09C 4MWBA 4RW0A 5EL0A 4DR7B 1F9AA 2WFZA 3DTVA 1V3UA 2ZBPA 3JZMA 4N8SA 4QHSA 1A5ZA 1DZ3A 3N3AC 2YV3A 4IH1A 1PTJC 3OCYA 3P9CA 1WMFA 2XSZA 3L1VA 4NR0A 5D84A 2WQ6A 1YA8A 3EVEA 1VGVA 4H7JA 1SHZA 2HCRA 4XYGA 1UF9A 3OFJA 5ARDA 1W36C 5EVJA 3MSXA 3UGTA 1ZN2A 1ZWLA 3WNCA 3MCTA 5EG5A 3NBUA 1QGUA 4F21A 4Z4QA 2GX6A 4Z49A 4CKZA 2D13A 3H5NA 5LP6C 2GD6A 1URPA 2G09A 1VMEA 2WLTA 1W4LA 3ER6A 1M8KA 1LSOA 1A3CA 3BULA 4MH0R 4DV4B 5ED4A 1ODTC 1TVMA 2WUVA 1WDKA 3CE6A 1JR2A 1RKXA 3EARA 4TSKA 3SGLA 2R6CA 4ECEA 4D0RA 2PG3A 1XNQB 3M6WA 3TF5A 3OZEA 2ZYVX 3WY9A 2Z04A 1RWVA 3VR6A 5L6LB 5GZ6A 3TAHA 1JQBA 1C7ZA 1P60A 2LNDA 4S3MA 5C34B 4CM9D 3KQNA 4NENA 1L1RA 4RDXA 4EDHA 3MS2A 1LY1A 4HDSA 4OOFA 4RMGA 4EFMA 1LNSA 2CVPA 5LQRA 2R9VA 2QUZA 4FMDB 2O0MA 1IY2A 2C8VA 4MUXA 3TMKA 3KQWA 2KWIA 2Z5FA 4U7JA 5FA8A 1N4DA 1YWGO 1OHHA 1ZG3A 4OJTA 5EHXA 4WESA 1KDVA 1QU3A 4JXJA 1X80B 3K0AA 3CF4A 3OIWA 1UXJA 4UOQA 5DM2A 4OV6B 2WA1A 2XLCA 2BJVA 3IO5A 4O02B 3H0KA 3UMCA 2ILTA 4DCGA 2JFQA 1NBIA 4R1TA 3FNFA 2WIGA 5C37A 4KQMA 3I9V1 5HZMA 3PXBA 1DE0A 1U2SA 1NIPA 4FHGA 3IOYA 2GHIA 4BN5A 5TF4A 4XVQA 2BGTA 1UADA 4ZGWA 3C3AA 1EFPB 4FGUA 4ZOQI 4UULA 5ALQA 5BPHA 3QELA 4BLRA 4DTCA 4MW2A 3HBNA 1T3TA 2IYPA 5JIBA 4LMBA 3MRTA 2IPOA 3AP2A 4X9XA 2R60A 5ULLA 4GI1A 3BMCB 1OF1A 3NTLA 2YWCA 4BMCA 4ZJZA 1H4SA 5F1KA 3DAFA 3EZ9A 2DLCX 1E6EA 2HREA 5CFOA 2VJPA 1WZCA 4LYYA 3PI6A 5DYTA 1TEZA 4BBJA 5A5VA 2ODPA 1T5HX 2GF2A 3LM8A 4AJOA 4EX7A 5LP1A 1GZ3A 2MSKA 4QTYA 3UB2A 2C3UA 4JBWA 4OYYA 3CF2A 3MTDA 4MVJG 5FI1B 4KXLA 4MVJI 3FY4A 3PP8A 1J5EB 4IUYA 4BNGA 1SIWA 1V47A 4LYFA 3T0FA 2XKKA 4ZGGA 5KSZA 5CW2A 5A3SA 3QOXA 5HZHA 5EXPA 3VDNB 3JQ7B 1MIOB 1UM8A 2YIMA 1DC7A 5FA6A 4KXQA 1BJKA 5BYJA 4FJ1A 3INGA 4D43A 4IXTA 4FGJA 1Y9AA 1KI7A 3ACBA 5K3FB 1UBCA 2IIBA 1SCNE 1W5SA 3W3AH 1QFJA 2DBVO 4CCAA 4G1UC 2RGAA 4F4CA 1L7PA 2HK9A 1TCVA 1XHFA 4G5SA 1G1AA 1X7DA 3ZDCA 2ZE6A 1Q1AA 4WFJA 1Y8QA 1C8BA 1R0KA 2NZWA 1A71A 4JQCA 5EHNA 2W0MA 5B3KA 4ZYYA 2AFIA 3U0BA 4OHFA 1YKSA 1RQRA 4ROTA 5CVDA 1J25A 4MKHA 4CLOA 1PW5A 3IJ5A 4IDQA 1DUIA 4RABA 4PVCA 3JYPA 5D3ZA 3USCS 3OCCA 4HAVA 2HC9A 4OVKA 5FOVA 1PJTA 1O94A 4Y6LA 4DCTA 3RV4A 4DWWA 4MPJA 1J2UA 1P2GA 2WHPA 3E22A 3EZNA 4ZI7F 1OBOA 1DCKA 1DIRA 4FC7A 4L8GA 4CN9A 1O9BA 3BBLA 4PIVA 1L4NA 2C2HA 4L9AA 3AXSA 1SXIA 3GMDA 1MDBA 2ASVA 1D1TA 1FXUA 3P2YA 1FTYA 1YVEI 3OUTA 1Z6TA 2O8FB 3WIUA 1A2OA 2B5OA 1FFAA 3NVAA 1UFQA 4HMOA 4TYNA 1Z6AA 4BQQA 1YFKA 3I9KA 1C41A 1L7OA 2X4DA 3U3KA 3DAOA 3GFQA 3NQ41 3TLEA 2IHYA 4Y1RA 3IAHA 5JAPA 4I66A 4ND6A 1I1NA 4I5IA 2WKRA 2H9IA 4CETA 1H69A 1Z7YA 1T4BA 3AL0C 4OREX 1ZA2A 3PGLA 3MGKA 3ANMA 2HQRA 2GCOB 3MOSA 4CR6A 2JH8A 2QXUA 2C1EA 4MKXA 3CZMA 2CL0X 3R24A 4ZO4A 4IDEA 3LHKA 2J07A 1HMYA 3JVEA 4Y9TA 3TLCA 2Q1WA 3VGJA 3NPMA 1JHQA 3E9QA 4HL6A 4RTSA 1KWGA 1OR8A 5ITSA 1JEQA 3BIFA 5C4IA 4DV6B 1KZ7B 4Q1DA 5EUCA 1WXWA 1G7RA 2I29A 3Q4GA 2CNDA 4NZYA 4LCBA 3OIYA 3R9XA 3H3JA 3TKAA 2QAIA 3ELWA 1K27A 3ZR4B 2C7QA 2KBFA 5TMPA 3GLHB 4HMPA 2H1LA 9MHTA 4XWKA 1XJQA 3WHPA 1JSCA 1JWLA 4W6QA 2DQYA 2CL6X 2ZBVA 3TB6A 4EKEA 1B2RA 3SQNA 2V58A 3ZDDA 2IEBA 3WYGA 2ZRKA 3ZY2A 1SD1A 1AJEA 1H2ZA 4HUQA 1J5PA 2VAWA 3EVGA 4JLBA 1L8OA 4Q02A 1P1JA 2J87A 2Z3ZA 3PEFA 4M60A 5F2NA 4PCVA 2NV0A 2I4LA 4YAUA 2DERA 5ALMA 3FPSA 2AF3C 4HPXB 5FNVA 3SM3A 4BGEA 1C30A 3QH4A 4OBXA 1QPZA 2GA8A 1J1IA 1WDLA 4XR9A 5I8PA 4XCQA 3RG8A 2WM9B 4RZIA 3CPJB 4AQ7A 3ORRA 2XMZA 5BMOA 4HH1A 1TCBA 4GR9A 2SCUB 1GZUA 3F3YA 4NONA 1Z3IX 2CDNA 4LRXA 3NIBA 4HSEA 5F78A 1MZVA 4MO2A 1Y6RA 4E70A 3W6PA 2JB9A 4CEHA 1GGFA 5CLJA 1A98A 4AL4A 3IP5A 4Q3LA 3P9QA 1THZA 3Q6MA 3TOZA 3I2KA 2ZJ8A 2NNLD 4KAJA 4FK8A 4N0EA 1FMJA 3KWMA 3CR8A 3F47A 3HY4A 4N5MA 2FTKE 3P4UA 2CDCA 3D54D 1LDMA 3HXOA 1QLWA 2WVHA 1GDDA 4QPZA 1ZONA 3KJHA 4L02A 2A6PA 4YCJA 3K96A 3ZWAA 4UM7A 2VPPA 4WZBB 4YJ3F 4P4NA 1E2EA 1FNDA 3ZQJA 2CUZA 1COWA 3TDKA 1BOOA 3P4XA 4D8TA 1KY4A 4PLFA 4KR6A 3KZOA 3OWXA 3W2EA 1VB5A 2ZFUA 4I9UA 3ISTA 2A3NA 1UZUA 1YL5A 2VDLB 3P2JA 1FFHA 2M6LA 3SWWA 4GFDA 2BI8A 4KGVA 4JB3A 3MGCA 4PYKA 1KP3A 1VHWA 2OCXA 1RVV1 3H18A 2B69A 1XCGB 1B0AA 1NBME 1TLTA 3LIPA 2RC5A 4I1YA 5C4MA 2HPVA 3FYCA 3H6HA 1CDOA 2R4UA 3BFPA 3GUCA 1GAJA 1G8MA 3CH4B 4O08A 3SZMA 3SXJA 4DR3B 3HUUA 2O2XA 5BNWA 5IAJA 1FXWA 1LX7A 2FSUA 2ARKA 4MVJE 5LDGA 2F55A 5EJ7A 2W98A 1ZRSA 2DU8A 2JZOA 4JLMA 3S29A 3ZDQA 3C3DA 4QRIA 3P9KA 5D8DA 4BLOA 1GLGA 2FK8A 3LYLA 3MCZA 2RHRA 3SKVA 1EZ1A 3R0XA 1IIBA 5I5GA 4DYDA 4L5YA 1RE1A 1UPBA 2R66A 3OZXA 4E2ZA 1R6BX 1UBEA 4NARA 1M7GA 5FLEX 2OMEA 4QPJC 3KBOA 4GKAA 3P52A 2HKIA 1PQPA 2Q2VA 5ADWA 2DMRA 5TPWA 5HCUA 1W44A 2P8JA 5AJUA 1E7QA 3B6EA 5TNXA 1U7UA 3V8PA 4HBZA 4KXXA 1R0SA 3TZEA 2HK6A 1IQUA 1XKQA 1LK5A 1EP2B 1KOFA 1NXSA 1QVZA 3BORA 1NTRA 1NOJA 3HDGA 1UKVY 3GF4A 5DIZA 4DQVA 1UZLA 1GPKA 5E2IA 1JG7A 1SOUA 3PDHA 4GX5A 1WO8A 4BO1A 5B7QA 1MW8X 1SRRA 4Q9AA 2D5CA 2F7SA 3NONA 4Q4DA 3VVLA 4J0QA 3Q40A 3AEKB 3K15A 5HFNA 2BGKA 3FLEA 3EXIB 4FQ5A 3NHAA 5JNSA 1O94D 2XXJA 3OX2A 1ZN9A 2AX3A 5FR1A 5IDWA 3MT7A 1X92A 5KNBA 2Q6TA 3U4MA 1ECFA 4BO8A 3DDCA 4LDZA 1QO7A 1ZVVA 3AY3A 5KYGA 3HNOA 2G9RA 1HFJA 1Y6JA 4ND7A 2HSDA 2CLEB 2RK3A 3H4VA 3VU3A 3RUPA 4LZLA 3V1KA 3B82A 5JSKA 2OBLA 4PX2A 9ABPA 2J4DA 3OJWA 1B4DA 1CUDA 1RQGA 1USUA 3EIUA 4INJA 4X8LA 2O2YA 3WLMA 3GBSA 3AETA 3RB8A 4MMXB 4J7UA 3IS3A 4IV5A 4IGFA 2EIHA 5GP1A 5BQ3A 3FRIA 2Q9UA 5BT8A 4YJFA 3HKBB 2OA0A 3BWEA 1ZHOA 2LRHA 4S1PA 5G0SA 4LVUA 5G02A 1E0JA 3LQYA 2OHOA 1J99A 4BZXA 4ZV4A 4UKDA 5L3QA 5ALDA 2V6BA 3HKEB 1ONBA 5KC9A 1YZNA 4QPPA 3JAWA 4LDAA 1WCYA 4URVR 5HF8A 4XDGA 2FZ4A 3T7DA 1DELA 1E8NA 4FOLA 5K3CA 3NR2A 4CYMA 4G36A 3FMIA 1KVTA 2VKQA 1E7MA 4Y2VA 3I5AA 2BMFA 2IYAA 4R2KA 4RGBA 3AR8A 3UAXA 4EPVA 4RM3A 4EG6A 2Q99A 3ISJA 2QJFA 3STHA 1N5DA 2O8CB 2QTTA 2WSBA 4PGMA 1O89A 3G88A 1AKQA 3GBVA 1P5HA 1HNXB 1HZZA 1W4ZA 2HLNA 2W37A 4RF2A 1NYRA 1GOTA 4G9BA 4PLCA 4L2IA 1W4RA 3B7PA 2VP3A 3AJAA 3HDYA 3TIIA 1VMDA 1CJUC 5LZ4A 4TLDA 1PJQA 2QTMA 1DL5A 2BPOA 1WUTA 2ACWA 2JCGA 2PBLA 3JASB 4MB0A 5ILOA 1EUYA 3TS1A 2O2JA 3R23A 2AUTA 2A4MA 2Y1FA 4WFIA 3U80A 4QRDA 3IDFA 4TN1A 1FPMA 1MC5A 2VK1A 3RSSA 4BMNA 1TD1A 5JBNA 4ZEWA 5PNTA 3HY6A 1QZTA 3NTRA 4MSUA 4IPTA 3V2HA 1DKOA 2JGJA 3KEGA 4G4SP 4Z9YA 4JUAA 4ZI5A 3L7NA 1J22A 1RWXA 4RZHA 1P61B 3SR3A 3ZUPA 1T3ZA 2VWPA 3C8HA 4L7VA 2PPVA 3P9SA 3I92A 1DEXA 3T3MB 1UXIA 4J29A 3T9EA 2XZPA 2AH5A 4WGGA 2X1MA 4LBZA 1GAWA 2EL7A 2X76A 5BQPA 2GASA 4JUBA 4N3NA 3RTCA 3K8ZA 4LKRA 2X9NA 4DQLA 2ZM6B 2PSHA 2Q5EA 4IWXA 5FORA 3RNLA 4CQMB 4Q4CA 1YQUA 3IE0A 1GG2A 3AVVA 2QYTA 2JLCA 3ABIA 8OHMA 1X1RA 4EA9A 5DCWA 3WO1A 2ZVDA 2OG2A 4A0FA 2UUCB 1WZIA 4P7FA 1KYXA 4L6CA 1DKUA 1G20B 2QR2A 3DLPX 3GOQA 3ZX5A 1NZFA 4K1XA 5F7XA 2BSXA 2FPXA 4F4JA 5A7FA 4M0KA 5I7WA 3R5HA 4MEBA 1QTRA 4PLYA 3HZRA 3IDZA 5MDHA 1EGHA 1Q84A 4ESEA 3B3FA 3QWIA 4IZHA 2QBYA 1YQDA 2NTJA 2WNHA 1H4VB 4L15A 5MF6A 4H4CA 2ZOSA 4WDQA 2UV8A 4U7TB 3TLZA 3DHYA 3K6SA 1FL9A 4P80A 1DAPA 1YDGA 3EIOA 4C0LA 5BV0A 2FUKA 1SVWA 2C5LA 4ON9A 4P4TA 3DZIA 1OWNA 1R5OA 1ZN8A 2GQ0A 4YRQA 2PPLA 4LHXA 4OQYA 2O2SA 1C0LA 1FFEA 2MR5A 2PT7A 1MVLA 3BSWA 1RDFA 3C1OA 2JD0A 3GR6A 3HLYA 3QVOA 4I0WB 1QZ3A 4G5FA 5HR5A 1TMYA 3EXAA 3UHOA 4ZU6X 3UC9A 3S2IA 5DP1A 3GFSA 3NDIA 4NK5A 5F1YA 1TUBB 3G79A 3IOBA 1S3SA 4IO0A 2DM6A 2XI4A 5CYFA 4C4ZA 3BHNA 1K6MA 1KARA 1WSAA 3ENVA 3IKLA 3T5PA 2Q0XA 1X9HA 4UEQA 4Y2HA 2G1JA 2NO9A 4JGGA 3TMYA 2XB6A 2A5YB 3ZS8A 5C1BA 3DHNA 3T7AA 3JZFA 2FG5A 2OVBA 3QHPA 1ZP6A 3GP8A 5JNRA 1XGKA 2YV5A 1Z6ZA 3GJRA 4UM9B 4NG5A 1JKJB 1YZQA 4G1EB 3FHTA 4YRRA 3TXYA 3PQDA 1N1EA 3ZG6A 2H31A 1E20A 2FSGA 3LBYA 5C5EA 1U04A 3N5KA 2AQIA 4TGLA 3HO8A 5TQ0B 4BFSA 1EWTA 1A9XA 1FLVA 4UDXX 4LZAA 4PF1A 3PR3A 2VHCA 2E4ZA 3QVVA 1JQDA 4BWVA 3U7GA 1PS8A 2ODBA 3E2PA 4N01A 4X84A 1ECBA 5F33A 4CLOB 4CM4A 4Y6GB 1X1BA 5ARCA 5A5FA 5JJIA 2CGEA 2WSLA 4DZZA 4RNDB 3RSOA 3GOHA 1V26A 4RY2A 3EGDA 4DLSA 2JAWA 4MW6A 3D7RA 4F5EA 4NESA 3VPBA 1JECA 2QXTA 1HDEA 4JJKA 1EVYA 5KWJA 3DDZX 1IY8A 3EUEA 1XDBA 1K68A 3NIWA 1RHRA 3RC2A 1Y1TA 3RS5A 4CXMA 2RI0A 4YEDA 4DXDA 4CEIA 3WBJA 3DE1X 3IALA 5CPBA 8GPBA 4MTCA 2VYVD 4M8KA 3WDSA 5EYPA 3WWPA 5KNCD 2O8FA 3LCRA 3TG2A 3IUYA 3P9NA 4W99A 3ZWYA 1T2FA 3P96A 3UQYS 2MWMA 4AF6A 4M0DA 4NCXA 4P36A 1FJXA 1M6NA 4LZWA 4NBNA 4B2LA 2X9VA 4NAUA 2A0YA 3U7QA 5BOVA 5IBQA 3IIKA 2XYHA 2VP5A 4P0QB 3HJBA 3CFYA 2QD2A 4TKUB 5KWSA 2WQ7A 4FCWA 3I0MA 1O5OA 4TYPA 3UEOA 1XK7A 3HACA 2FPSA 3LGAA 1TA9A 4OQDA 5LMZA 4YAOA 2VNHA 3D6HA 5L3SA 2VPIA 2IS2A 5BW8A 3ROZA 2HRZA 4GPZA 3PFHA 3ZDYB 2NV6A 2D4HA 4EBFA 4Z4HA 2NLOA 2IV3A 4MEJA 5CIQA 2PAAA 2VA8A 4QUDA 3PJDA 3WADA 1CY8A 2H1IA 3RVBA 4URHA 3FSGA 1ZSVA 2VYVA 5AJHA 1KMHA 2OCDA 2YL2A 2PD4A 4HZUA 1I5OA 3HR8A 1Z74A 3DM5A 4OP3A 1U9ZA 5K0EA 5LNK1 5ER6A 1VB3A 1LLCA 1YF3A 1ZNQO 1H8ED 3CNHA 5EFZA 4HHEA 1C7IA 3UCEA 1KQNA 1NULA 4FKMA 4BNFA 4CU5A 1C2YA 1X1DA 3RQIA 2QM7A 3CGWA 3ESDA 3GRAA 3O95A 4KQIA 3ZS9A 5LOVB 3EVNA 4QUGA 4H1WA 2XXBA 4WCFB 2GM5A 1M7BA 1KI6B 1TCUA 5AQ1A 1MC1A 3TSYA 1Q0HA 3UXYA 5D3MB 3LC7O 4MGYR 3CMMA 1EIZA 1NQ5A 3JSXA 3H2KA 4DUGD 3NM4A 2ZTVA 1BKDR 2VK2A 2VSYA 1NN3A 3B1XA 3FPKA 1FJ2A 3CW8X 2GRAA 3AEUB 3JWJA 4L5AA 4FYPA 5CLLA 1IN5A 3RE1A 1J0BA 3K0EA 4B71A 5JYEA 1REQB 2XRZA 1NVBA 4GO1A 4MR9B 3AUAA 2CHFA 3OPMA 2YFKA 4MV5A 1OMOA 4OJNA 1EU1A 2GD2A 1ZRMA 1NBMD 3GAFA 3AR4A 3LU1A 4JC5A 4OX9B 1D6JA 2XBLA 1S3IA 4RA6B 5AUQA 4H3SA 1A72A 2JLVA 4GECA 2IVFA 5LVAA 2BZGA 2XGOA 2XIJA 4ENVA 2EHJA 5HHTA 1B6TA 2P77A 2R7NA 3BJMA 4GYKA 4RMNA 4J49A 4JEHA 1R5JA 3PBKA 2H52A 5LA6A 3KELA 4IIYA 3UBTA 1PJLA 3EIXA 3MTBA 5T57A 1RHKA 1W93A 2FF7A 4IMPA 1AUVA 2ODTX 1EXMA 4LK2A 4HTFA 4UVHA 3U16A 4MQEB 4B40A 4PO1A 3AF2A 3FNEA 3OQNA 2HQ1A 4QXQA 3A9TA 2GHTA 1NNLA 1AKWA 3LQ2A 3F7OA 4Q18A 5FO0A 1P2VA 2W2OA 2XOXA 1OI4A 3HYNA 1ZGHA 3KZKA 4AF8A 3T38A 1G3MA 3CSDA 6AT1A 5CA1F 5ALVA 3F8WA 1XLVA 3C85A 3ZTWA 3KKMA 2O4UX 4ZC1A 4DR5B 3I53A 4DCUA 3F71A 2C95A 1QH8A 1CR1A 3GEBA 4W9RA 2R8BA 5CVEA 3UQZA 4AN0A 3Q98A 3SYNA 3L18A 3WMFA 1ZM9A 3ZNOA 1UDBA 1PGQA 2X14A 1Q57A 3U31A 5LUAA 1UPXA 1X9GA 1FVFA 2P7HA 1CU1A 3KL4A 5BR1A 3ADCA 1FMFA 3B20A 1NP7A 3ML1A 1ODLA 2JKVA 3LDFA 4OQLA 4F3KA 1VPLA 3KQHA 1XCBA 6CHYA 2PM8A 2GZHA 3RC1A 2PSSA 4ARUA 2Z5VA 1ZEMA 4H2DA 3SQOA 1SKMA 4JGBA 3L5OA 3LLVA 4MKIA 5EQDA 4EEZA 1Y34E 1PAUA 1RAHA 2VCHA 3MCAA 4N0QA 2UUBB 3BB1A 3BCUA 3ANNA 3QBVA 4DSTA 5IKXA 2FETA 1UK9A 2J08A 3EASA 4CT0A 3BD8A 4OKIA 1CR4A 4URXR 1PWEA 3F3MA 2FXVA 3OF5A 2V9PA 2GXAA 1RJDA 3K9LA 4QSHA 1RM4A 1XCMA 4GT1A 4RXMA 3IYLW 4REQA 2LR0A 1MR3F 3U3JA 4OJMX 1QC5B 1W25A 2OHIA 3NT4A 3FTDA 3OEED 5E9JA 2BUBA 2NZVG 3SVZA 3HDJA 4ZQEA 3VISA 3B52X 3PENA 1KSJA 3V32A 1P7CA 5GZ3A 3B3QA 1WXQA 1DARA 5G1OA 4R9VA 5TT0A 2HN9A 1MPTA 4EY4A 5C5DA 4YVFA 4ZFNA 1J2YA 2ONYA 4XGQA 1P2BA 3M33A 3OQVA 5LXTF 3CLRC 4B80A 1L4UA 1YJXA 1XRJA 3DKPA 1SCAA 1OYVA 1AC5A 4MW9A 4AW9A 3PQ8A 3IP1A 4HYQA 3ZE0B 3BS4A 1Y98A 4FI3F 1RWPA 4R2JA 3CONA 2CNOA 1RJWA 4ZVRA 4PAWA 1T2CA 2P68A 2P11A 1VGRA 2PL5A 3L7IA 4UHJA 1TNDA 4FSXA 1JIXA 2OUKA 1NUQA 1JG3A 1R8XA 2ZSIA 3NEYA 5MN4A 3J80A 5DYIA 3GZTB 1R88A 1T5OA 1JZSA 1HY3A 2JA1A 2XYQA 3FFTA 4Y6PA 3NGMA 4JI8B 2DFVA 4JASB 2YYYA 2PDAA 3AR7A 4RA9A 2QL5A 1PEDA 2HMUA 1IQRA 3E0QA 3FAKA 2IW1A 4RA9B 2R96A 1MTOA 2OG1A 2OHFA 5HX7A 5D5HA 4C20A 4JOCA 1MXHA 4EPXA 1CKEA 1QAOA 1ZD5A 4MV1A 3HA2A 4COKA 2JZCA 4J0KA 2YXBA 4MROA 2QVXX 4RV9A 3GLGE 1PDOA 1WDTA 2GR9A 1BHQ1 3LW8A 3LUKA 2BFDA 2FX2A 3FYTA 1SXJD 2WIAA 4Q9KA 4K9DA 4NH0A 3BCHA 2Q3JA 3PUHA 4MWEA 4EK9A 4K0KB 3DOEA 2WF9A 2HF9A 2O8CA 3NHRA 4N3GA 3OFKA 3UKOA 1I9CA 2B82A 4P2GA 3GLFA 1VGQA 2HH9A 2ZYAA 3OZWA 4R1NA 3DEKA 4XSGA 3HXMA 1UMCA 4YUVA 4DRYA 3HBJA 1MRZA 2BKEA 5KAMA 1JTFA 2YJZA 4A23A 1E2PA 5EIBC 5HJEA 3ZCQA 2ZYWX 2PZFA 2DUMA 1DWQA 5HF5A 1I9GA 1IDN1 3AYXB 3TUIC 3FHOA 2BHLA 3OFSA 2IEIA 3R7LA 2B1IA 3LWZA 1I3LA 2FSIA 3EZ6A 3A6GA 1GAXA 2HMWA 2B25A 4NP6A 4C1BA 2IDKA 3LT0A 1D6SA 2YIJA 2J5KA 3EPRA 2Q9BA 4Z9XA 3IDSA 3ZXSA 1JG1A 4MUNA 3LTNC 4FZRA 4Q3CA 3MOGA 3GLIE 1D7AA 3OQPA 1QGED 4Y2XA 3I2IA 2JIPA 3GEEA 3LK7A 3IAFA 2OSBA 1WBJB 1NC3A 1KVSA 1II0A 4MGEA 1PG5A 3LL7A 2OPHA 5CFQA 4FBLA 2ACKA 4DKXA 2WDPA 3KQMA 3MMNA 4JJ6A 3VZRA 5J1SB 3GLIA 2XA1A 2O9JA 1XA3A 2PE5A 3IUBA 4QOIA 2Z1MA 4ZV7A 3JX9A 2X0JA 4Y2GA 1SN7A 4CTKA 2EOAA 3L0DA 4J3NA 2WFLA 5F2EA 2XB4A 3LVFO 1AA6A 1DBWA 1RRKA 1QLHA 3PJFA 3FTFA 3BHMA 4MV7A 4BFZA 1VSTA 2FMFA 4ZVKA 3NYQA 2CCGA 1G21B 3H9QA 4PXYA 2VQFB 1YCHA 5ALEA 2IXDA 1G41A 2B8NA 2DTXA 3HA5A 1L4HA 1P2FA 4ZHQF 1K0FA 3ME5A 2AD5A 3LY5A 2IPAB 3QKWA 4QUKA 2ZWOA 4PQEA 3MG9A 1U7OA 2RJ3A 4IIVA 5TPZD 2CK3A 1HUQA 3KPWA 2B6HA 2GFIA 3L79A 2V8BA 2DQZA 3NGLA 4WEOA 1HOXA 1LI5A 2EERA 3RO7A 3UAYA 4YP6A 1TJ3A 3H8JA 4YTEA 2E55A 2J3LA 3AHHA 1MN6A 2DJIA 5EAIA 1U7XA 1R0RE 3AJDA 2B2CA 2XZDA 5A4DA 1U7DA 3SXUB 2LBPA 4BO7A 3N6VA 1EQAA 2XWSA 3GRPA 2WKWA 4HATA 2C78A 3SXPA 4LF7B 1WM1A 1Y1PA 1ZESA 2YFQA 3JATB 3N6RA 4UE3S 4W82A 3ZD6A 3O4GA 2PIAA 4E07A 2FXIA 2A0UA 3E3AA 5AH0A 3AUUA 5JJLA 2JFUA 1NX9A 3T52A 3KYCA 1J7JA 1YIDA 1YZLA 2IOFK 2NSDA 2C7PA 3PGXA 4X6YA 1HQKA 1W4CA 4TRRA 2ZRDA 3GP5A 3DMHA 4ND4A 1SQGA 2Z8YM 4YJDA 3Q6NA 2P67A 4BNUA 4FYMA 4O4HB 3R4CA 4WPGA 2IXFA 4R1LA 3H11A 4LE1A 5SV2A 3I1YA 1WB4A 4UW9A 2YN4A 3UK6A 4D8VA 1ZUWA 3S8MA 1J8MF 3RS7A 4F04A 3HABA 1IOLA 2OHXA 4MR9A 4O3MA 2LD4A