2GF0A

The crystal structure of the human diras1 gtpase in the inactive gdp bound state
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
b'QSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein Di-Ras1
publication title The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 55
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gf0A00
2GJSA 4BASA 4LBYA 3I5XA 5C2JB 1SGWA 1G8PA 2IYQA 2YZ2A 2GNOA 3ZYCA 4AG5A 3OIUA 1RRPA 4WZBE 1KY3A 3SI7A 3U4QB 3ZS8A 2OCBA 4LJ7A 3NBFA 2WWGA 3CIOA 2DWPA 4GPTA 2ZRMA 4HLUA 3OIWA 3GLFA 4JLNA 1YE8A 1W4RA 1KI1A 1EWRA 2NPIA 3AGPA 5EXTA 1DAFA 4JT2A 4ARZA 5DGXA 4DB4A 4IFBA 421PA 1XFAA 4I1SA 3WBKA 3FWYA 5EJEA 1TEXA 4NCJA 3B7GA 4CRWB 1MRNA 2RGXA 3P32A 2WSSA 3W8RA 1ZM9A 1G9XA 1JJVA 3DOFA 4WIAA 4B32A 1N6LA 1XU4A 3I73A 5AJXA 1KO8A 2V8OA 3K09C 4M21A 3GJXC 2XNDD 3DEFA 4TLEA 1IXZA 4JIMA 4D82A 2OE2A 2F1IA 2WWHA 3WNBA 4Z54A 1G20E 5JMTA 2CHGA 1A82A 4IDOA 4DLZA 5BWMA 2VEDA 4NCHA 4BFZA 221PA 4I1VA 4Q1BA 1YR6A 3OIYA 4M1YA 4A0HA 5M04A 1P2VA 1XPRA 1N5KA 2DY1A 2IYWA 2N42A 2QROA 4X8HA 5K8TA 1JPNA 5FPYA 1BS1A 1RRCA 3CF2A 4HLDA 4B3CA 1TPZA 2JJ2D 4C2UA 1NVVR 4P4TA 4D4MA 1A1VA 1WA5A 4IRUB 521PA 2C9YA 2W0SA 2ZM5A 2FSHA 2D2EA 3WMFA 1SXJD 2F1HA 3SJCA 3BORA 2P3SA 4GOKA 4M1TA 2WOOA 3GJ4A 4MRVA 4DSOA 3EPJA 2UZ3A 4QGFA 5FL7D 4G5RA 3ECCA 3QIAA 2NIPA 3RS7A 2D2FA 3CZPA 1XXHB 3K8YA 1TX4B 1R5OA 5HE8A 2G3YA 5SZHB 4G1UC 3SJBA 2J87A 2W6JA 2GEDA 1E0AA 4OI0A 1CR0A 2P5SA 1NKSA 5EE9A 2MMGA 2ZRHA 5JWOA 2VHTA 2OAQ1 2GJKA 2JLQA 2GBLC 3MMPA 3NHBA 2F43B 4Y0AA 4S35A 2D62A 5KPJA 4HLCA 3KFVA 1YZNA 4PANA 1EWQA 2CCJA 3O8DA 1S8FA 3A8TA 2IWHA 4Q9LA 4URWR 3RWOA 1ZNZA 2BJVA 3A37A 1G5RA 2HYIC 3QI2A 4FWIB 3OE7D 5DYIA 4M9SA 1U98A 3R9XA 4KXFB 3B1YA 3N2EA 4CYMA 4LHYA 5H70A 4BECA 4D4KA 2QY9A 2ZAOA 1ZVQA 1COWD 2ZUBA 2FPLA 4D80A 1NKTA 1XCPA 4JJKA 1KIMA 3K70C 1G7SA 1GNRA 3EWSA 2VSFA 4HAZA 4LYFA 2YWEA 2JLWA 2JJ8A 2CL6X 1XTSA 3GLIB 4LV5B 4D0NA 3A6PC 1FTNA 3RC8A 5G3YA 4GOXA 2GKSA 3MGCA 3EIEA 3N2IA 4PPFA 4BFXA 4QHSA 4OI1A 1II8B 3TLXA 4UXIA 1L7VC 4H9GA 2BBTA 3ONWA 4CVNA 1E79D 2H8KA 3ZIAA 5JZVA 1JEEA 3EZ7A 2HEIA 2HV8A 2OBLA 3B9QA 2JJ1A 3CLVA 3K9GA 3QVUA 3VTKA 4B6FA 4D4JA 2J1LA 1N6PA 1XD2B 1E2QA 2WZQA 1CJVC 2EFEB 2G1KA 4Z51A 3FOZA 2FFAA 5KNCA 1G5PA 4TQAA 1M7BA 4WVFA 1U8AA 2Q3MA 5DI3B 3U3JA 1I4TD 4Q18A 2OV2A 2E1RA 5AJWA 4Q01A 2QPTA 3A1UA 4Q5IA 3KKQA 3S1AB 1NNEA 2VHCA 4HZUA 3WMEA 4MYHA 1EG7A 5JLJA 1ZC3A 1ZINA 1SVWA 4PR0A 4C0SA 4JYBA 3SFVA 4LRWA 3AKEA 3THYB 1IY0A 1T0HB 5B2ZA 1NSTA 2NO6A 4C9BA 2WWXA 1FOEB 1GITA 4KSBA 3OAAD 1R0ZA 1VG8A 4PO1A 4RVCA 5K8LA 3WRYC 5JWRA 4PZYA 3KJHA 1NRJB 1W48A 5DHAA 2FEMA 3QENA 1KAOA 4B76A 5FUYA 2ZI9A 2PZGA 3ASZA 1DO0A 2XSZA 2ZJ5A 2GA8A 1Z2CA 1BYUA 2Q3HA 3CX6A 4NDZA 2Z6VA 3NIBA 3PUVA 1US8A 2NOAA 3CF6R 4TSFA 1YZGA 3U3KA 5CK5A 4CIDA 4E09A 1OHHA 1SZPA 3FDIA 4Q4JB 3TNFA 1X1RA 2RGCA 3F5FA 3LAWA 4C30A 2ANCA 1VTKA 1MABA 2RGNA 1I4DD 1WDTA 3A1WA 3VHXA 4QBHA 4EFLA 4PAQA 4NCIA 2A78A 1T3SA 1ZIOA 2BIFA 4KSCA 1XRJA 2ZI7A 3EWAA 2Z5FA 2ZREA 1Q12A 5FPKA 1Q20A 1WXQA 3DDCA 5AJYA 5IF9A 1JECA 2XZPA 1Z0KA 3TQFA 3PUXA 3AVVA 2WPDA 3CR8A 5E4FA 5GADl 2WKRA 2R6CA 4MRSA 3K0AA 4LJAA 5KO2A 2CVFA 4TMKA 4D6PA 1E9EA 2GEUA 1GOTA 1U0JA 1ZJ6A 3AF1A 4HAXA 1ZUNB 4BLSA 3AVPA 3KB1A 1BIFA 4OQLA 3V4FA 1FUUA 4M22A 121PA 2ZJOA 4KO8A 3GJ7A 1AK2A 3QXJA 4U5XA 1OXVA 2IHYA 1GG2A 2D7DA 2ZRJA 4PAOA 4M1WA 1Q1QA 4XVUA 4M9ZA 3FTQA 1HH4A 3BFXA 4A6PA 5HPYB 1GNPA 3N70A 1KSJA 1X8KA 1M6NA 3EZFA 4RD1A 4WBSA 2AL7A 2J45A 4WZAE 5FPHA 4W5JA 3TGPA 4DXAA 2QGNA 3QXXA 3W9YA 1EGAA 4JT4A 1A2BA 1FZQA 4Q4HA 2BEKA 3TIFA 1DS6A 2XB4A 3C8UA 4A8JA 4MGZR 5CIQA 3K70B 2CK3A 5LD2B 3VFDA 1VCIA 3FKQA 1XZPA 2WTUA 3KTAA 1Z6XA 2R6AA 3DKPA 4B33A 4BRUA 4RSGA 2WJHA 3LDAA 1M1YE 3D8BA 4XWKA 1NBMD 4DIEA 3LVQE 4Q4LA 4ZPXA 5UKDA 1DAKA 4JLMA 1MO6A 4DBLC 4NE2A 5B30A 1O87A 3REGA 2DFTA 1CLUA 1RRFA 1W0KA 2WJGA 1CIPA 3RRZA 4DSNA 2P6NA 4MA4A 2PJRA 4CZ2A 5JI2E 1KMHB 3TVDA 1EXMA 1W1WA 5EUMA 2V3CC 5IK2D 2V7QD 1D2EA 1P72A 3GLHB 1LF0A 1KSFX 2AN9A 2EFHB 2WAYA 3X1ZA 3PEYA 1G7CA 1IAQA 2WWFA 2GDJA 3CH5A 4Q66C 4S2EA 4TQUS 3FHOA 4EJSC 4YMTA 3DM5A 4DWJA 1P3JA 2V6JA 4PC2A 3X1WA 4JKIA 4PC3A 1SXJE 4GSYA 3SYNA 3PIRA 4QKQA 1KMQA 4W5WA 2GAAA 2GCOB 3U7EB 1X8LA 4HB3A 4B73A 2OXCA 1E94E 2QE7D 2UVQA 4KU4A 3SS8A 3CRVA 1H8HD 1G3QA 3IO3A 3VR2A 1XB2A 2P6UA 4RD6A 2OFWA 2IYZA 3MLEA 1YRBA 1WBDA 2YYZA 3R9WA 1KO1A 1N6HA 4W5HA 1BOFA 3B60A 3O8RA 2IYLD 4HEJA 3NTUA 1AS2A 5JJLA 1R0WA 4YQFA 5JS7A 3DO6A 4B6EA 1CP2A 1CJUC 3T1QA 4BEJA 3PQCA 5DH9A 5DO9A 3HR7A 5IDVA 1IQPA 1ANKA 2QRNA 1LFDB 3OEED 4UJ3A 1E2KA 3G5UA 3TRFA 3QXCA 2C04A 4EPYA 1VYUA 1G16A 2VPPA 3K70D 3AF0A 2ZE8A 821PA 1K8RA 2XXAB 2NTYC 1UBCA 2FFBA 5EXPA 5JEDA 2KI5A 2ZRGA 4FD2A 5HKKD 1IN7A 1F48A 1OYWA 5FL3A 1OH5A 1GZSA 2F9MA 4TMWA 5GJCA 3THWA 1GP2A 1OIWA 3SHWA 4B75A 1GWNA 3FGNA 3I5YA 5CB6A 1XTKA 4TTPA 1I2MA 1JXOA 3SBDA 1DTSA 2XB2A 2IUSA 4URUR 4K8OA 3ZVNA 2QM8A 1KI4A 2QMEA 4JSYA 1WB9A 4IEEA 2MSEB 3SU8A 1W36C 1J2JA 2CLSA 8OHMA 4OQNA 4O2RA 4POAA 4H1VA 2A3RA 2AX4A 2IT1A 1D2MA 3IBYA 3H86A 3W3AA 1QHIA 4EPVA 2JDIA 2RGEA 2IS2A 5FR1A 3TJZA 5BN4A 1XCGB 2QTHA 2WWWA 4MUAA 4KBFA 1OFUX 3TE6A 3PEUA 4CDGA 1EFRD 1UM8A 4ITRC 4Q02A 1KAGA 3GLGB 3FHTA 2DFLA 3IEVA 2BMDA 4GP6A 1MKYA 4C7OB 4MGIR 4QM7A 2QGZA 3W6PA 1G8FA 1AZTA 1DARA 2CJWB 2FG5A 1XXHE 4GFDA 3T34A 4B2IA 2ZUCA 3QKTA 5CYOA 1ZM4A 1OB2A 721PA 1KNQA 2CHQA 4FI3C 3U60B 3KJIA 4ZDKA 4BUJA 2VP5A 3BK7A 1UPTA 4NYMR 4RZUA 3L8YA 2KWIA 1VG0B 1GKIA 3EIQA 3MWLA 4NL4H 2ZE5A 1VYVA 3HPQA 1HTWA 3KQKA 1HQYE 4JLPA 2GK7A 4HZIA 4PPGA 4JVLA 5B58C 3E2IA 3FKSD 1EFUA 1GRNA 4KI0A 1LS1A 4PHFA 4BFTA 1J70A 2GRJA 2G9NA 3HPRA 1PVOA 3I92A 2RGAA 3HP1A 3UXMA 4BLPA 1F2TB 4WAUA 1Z6YA 2V9PA 2RGNC 4M2LA 3BWDD 4NTZA 4QJ4A 2H18A 3KX2A 1E9CA 4KHZA 4DCUA 3LBHA 4RFSB 3WXMA 2C9CA 3WMGA 4PSAA 3IUYA 4N1AA 1NG9A 1S1CA 3HYRA 1CULC 1EFCA 4YONB 3GLIE 2FNAA 5FTMA 4CW7A 1Q57A 5B64A 1VIYA 4XSGA 3VKHA 1DAIA 4EJSB 3UIEA 2F1JA 4DKXA 3AF4A 4NMMA 1GL6A 1Z29A 4EAQA 1OJLA 1R6BX 1K6MA 2CNWA 2ZSFA 1E2LA 3GFPA 3L0OA 2C96A 3FMIA 1W5SA 5JEEA 4M9QA 2PL3A 4C4PA 2QTFA 3BERA 2ZYVX 2IS4A 2RGDA 5DE3A 3T12A 3SYKA 2ZRFA 4PX9A 1VYTA 2BJWA 3LBIA 1S9HA 4NYJR 1WCV1 1CU1A 4P33A 3U44A 4PXAA 4IDNA 1P4SA 2EWWA 1VPLA 5BN5A 4M9XA 1U81A 5DNYB 4JS0A 2AFHE 2AWOA 2J0QA 4M4SA 3KZ1E 1KI2A 5J4KA 2JLZA 2EFCB 4H1UA 5L3SA 2L0XA 4ASUD 4IVQA 1S3GA 2FJUA 2IUTA 5GVSA 2DHRA 4MYTA 1RE0A 2CE2X 2CDNA 3CZQA 5G53C 3ICEA 1ETUA 2BM1A 1CEEA 1G8HA 4IKEA 1TUIA 4MYUA 2YJTD 2YOHA 2WKPA 5IHPA 5KPDA 5ELXA 2DR3A 1CR4A 3BOSA 3C5CA 3NEJA 4B47A 1D8TA 2GZAA 4C0BA 5B57C 4MQBA 3DMDA 1RYHA 3SEAA 5E7MA 1FNNA 2HF8A 3RHFA 4KODA 1NBME 1SVOA 2OXRA 5FFMA 2ZR0A 3THXB 1D9ZA 2WWIA 1ZC4A 2QMOA 4LWZA 1OPXA 4ZIRA 2OEPA 3QBVA 1L4UA 1TQ4A 4LI0A 1NJGA 4TMTA 1UAAA 4CF7A 1FFHA 2A7QA 1T6NA 4OHXA 4TYWA 1HV8A 1SHKA 1W36B 1KTVA 4KYIB 4BLTA 4MUBA 3EAQA 3GJ3A 3OIVA 3MUFA 4JL5A 5CIWA 2QN6A 2OBNA 4Q03A 2R9VA 2C03A 2J46A 2QP4A 1KSGA 2O8DB 2HT6A 1T3HA 5D3MB 3X1XA 1VKJA 2YC4C 2REOA 1MV5A 1DELA 2UZIR 5DN6D 3I32A 1JR3D 1XTRA 3AEZA 2B92A 2VP0A 1L4YA 4YMUA 1G6HA 4DCNA 1SVLA 2AD5A 1NN5A 4FINA 2QM7A 1RYFA 2NZ8A 2AR7A 2QPAA 3AGQA 3BB3A 5JI3E 2H17A 4JBWA 4F4CA 2PMDA 4F92B 2GWHA 1S3SA 3A1VA 4OQFA 2WVJA 1UF9A 2EU8A 5SZIA 3T35A 4OK6A 3GMTA 2QSYA 5FBWB 1IJEA 4GBMA 3QXSA 4DLYA 3P4XA 1P2SA 3Q9LA 1KOFA 2XOKA 4A15A 2ZROA 4JYCA 3EPKA 5AWFC 1GL7A 3PG5A 3MJHA 3CO5A 4CEJB 4M53A 2QQEA 4LX0A 5P21A 4NCKA 2ATVA 4B3XA 3AP2A 4DZZA 1C1YA 2CL0X 4B74A 1P61B 2JIZD 3RS3A 3P27A 2Q21A 2QSZA 3O8CA 4BZXA 1KKMA 5EP4A 1C9KA 1U8ZA 1NIJA 2BBOA 1E6CA 1ZNYA 1W5TA 4PC6A 3V00A 3MD0A 3IDQA 2IEYA 5L3QB 1SXJB 3PR1A 4LHVA 5EP1A 4FMDB 1OFHA 3BGWA 3G82C 1H8ED 1NP6A 1T8TA 2D7CA 4RD4A 2BV3A 3CM0A 3EX7C 1CR2A 3VKGA 2G0NA 4TZ0A 2J7PD 2AK2A 2EFDB 4LHZA 3BC1A 2JJ1D 3PCRB 3SE0A 1K5GA 3BE4A 1W36D 3K0FB 1L8QA 1UEIA 4AIIA 1G18A 3MRSA 3VR1A 1IXRC 1P7CA 1XDBA 1LY1A 3GLHE 4NONA 3LO5A 1XX6A 3GJ0A 4GL2A 1N0UA 1XNJA 3QNUA 4LSGA 4PAMA 4AYTA 3ZVMA 1X3SA 4B2LA 2Z4SA 2BCGY 1XJCA 4M8NE 1ZM2A 1W7AA 3JZMA 3CRRA 4TMVA 2R62A 1UKEA 4FMDF 1YVDA 3KUCA 1G6OA 4L16A 1P2UA 3QKRB 2XTMA 1W4BA 2IYVA 2ZE6A 3UANA 4WXRA 1AM4D 2IBMA 3EARA 5JCPA 4XJXA 1R8QA 3SZRA 3H1TA 1KJWA 2Z43A 3L0PA 1PV4A 1RRGA 2O8BB 4IDHA 2O8CB 2R6GA 4DRZA 3WP1B 1BMFA 3LX8A 5BYKA 4XTCS 2CXXA 1KKLA 2NG1A 3TSWA 1P9RA 4L8GA 2PMKA 1GRRA 4LJYA 1F2UB 1E2GA 4TYNA 1IN8A 4TLAA 3UMRA 4GZMA 1G3UA 4LGMA 5FOUA 3QUSA 2ZS9A 4LDJA 4DLUA 3QKSA 4TQ9A 5EP3A 3V4RA 5A5GA 2X77A 4NZYA 3SN6A 2OFOA 4DEXA 4U02A 1E2PA 3CWZA 2D06A 5HZHA 1XWIA 5IT5A 3KXLA 1T0JB 3IGFA 4IW3B 3LW8A 1NVXQ 2XGJA 4M1KA 5IRCD 1NVUQ 1UFQA 2Q9CA 3I8XA 2C2HA 4BFYA 2RGGA 2QNRA 4A2WA 2IW3A 4JSTA 5E95A 1J8YF 5J4HA 1YRAA 4Q1CA 3I3SR 4G5SA 1X8JA 1UKZA 2YHSA 2A5DA 1JPJA 4GT1A 1S96A 1TF7A 4NBSA 2W2VA 1XBTA 4KFUA 4DDTA 1QHGA 3BXZA 4OHZA 3WYGA 4OHWA 5GJVC 1GTVA 1TQ2A 2BDTA 3NBZC 4LBVA 4A2PA 3GFOA 4BFSA 4LCBA 3NVAA 3CWQA 3A1TA 3THOA 2D74A 3UMSA 4OHYA 3PFIA 4G5GA 2D3WA 1Q3HA 1U2RA 4IFEA 2OLKA 4W7SA 1E1QD 4BGDA 1RJ9A 3KXKA 1HEIA 5H1YA 1Z63A 1E2IA 1E4YA 2GILA 2Z83A 3O47A 4FMCF 3OZXA 4CEIA 3VNVA 2AHOA 2AXNA 3LLMA 2ZVPX 3ZQJA 4M1SA 2ZANA 3PENA 4XVRA 5FBVB 1AIPA 3GLGE 1G8YA 1FMJA 4IVPA 1DG3A 2FH5B 4EPRA 2GJ8A 3LD9A 4BLOA 4HUQB 4IXMA 1K5DA 4G5QA 2QAGA 5GJWC 3R8CA 1HY3A 3CNOA 1KI9A 1E0KA 2P5TB 1QHSA 2ORVA 1G3IA 2ZIAA 1OKKA 2VH5R 3M0EA 3DMNA 4YDSA 4F4IA 2IYUA 2FV8A 3C15C 4O0MA 2ZR9A 3AKYA 4EPTA 1DAMA 1P73A 1YQTA 2KB0A 5FPSA 4ZCMA 3NDBB 5A0FA 1SQ5A 1RIFA 4JLKA 1XEXA 4MRRA 1E9SA 1OF1A 4PC1A 4TTRA 2VHJA 3EW9A 3K0CA 1S9DA 2XITA 1KI6B 1P9NA 2AXPA 5JHGB 4Q7KA 1HYQA 1KDOA 4EQ6A 2DPXA 1NSFA 3ZD7A 2J0UB 4OI4A 1JNYA 1G3MA 1Z28A 2C95A 2ORIA 3D3QA 3VNUA 4AKGA 5FUWA 2ZRKA 5E3HA 4JVSB 2ZVQX 2BOVA 4ACBA 4AWXA 3DZ8A 3C16C 2QL6A 2IYTA 2XAUA 4P4UA 2VQSA 4BQSA 4A0FA 4XTRA 3WYFA 2BMEA 2QTVB 1UKYA 3F0TA 3QG5A 4P3YA 2Q0HA 5JJKA 3P20A 4KVAA 1F5NA 2PH1A 2VP2A 1ZBDA 2Y8EA 3A4LA 1ZIPA 1J99A 1ZD8A 1D2NA 1KNXA 1RZ3A 2QBYB 2OSBA 1W0JD 4B3BA 2WHXA 2O5VA 2B8TA 1JR3E 3ZDQA 4EIWA 4CEHB 4FW9A 2HLDD 2DWQA 2ZR7A 1E1RD 1LVGA 3RYTC 3Q85A 3AVYA 1GKYA 2VYFA 3MWJA 4M0LA 5G41A 4DLXA 1WE2A 4HDCA 2ODBA 3PUZA 4TYQA 1U0HC 2W6ID 3R7WB 2GZHA 4EFNA 3AUXA 1KI8A 1W49A 2JGNA 1NMXA 3EA0A 2H7VA 5FBRB 1PLJA 3RWMB 1GILA 1ESNA 1ZRHA 5L8VA 3ADBA 3UG7A 5JSZB 4LUCA 2V6IA 2CHVA 3F3YA 4HAUA 2O8EB 2LKDA 3D31A 4ERNA 1FTSA 2O0KA 4P4SA 1P6XA 5FBLB 4B3DA 3QF4B 5JHHB 3VU9B 4TT3D 1M7HA 2XNDA 2A5YB 1JR6A 1LF5A 2IC5A 3K53A 3NXSA 5A4JA 1XCMA 5FH9A 3K0SA 5JWHA 1KSHA 3LX5A 3ADDA 4DDWA 5F9FA 4LPSA 1G4AE 3AVXA 5C1BA 3RANA 2RHMA 3RRMA 2C9OA 5KSYA 1E9DA 3KXIA 3QG1A 4ZDJA 4DB2A 3PUWA 1KK2A 3TW8B 4HUTA 3OEHD 3EC1A 3RAPR 2OCPA 4A4DA 2VIIA 4TWZA 2WMOB 3I61A 3LBNA 1Z6GA 5EE3A 2JJ2A 2IHBA 4QGHA 4AC9A 1DBSA 2QQ0A 4QL3A 3TBKA 4I81A 1W44A 4PHTA 2HCJB 4HATA 4ZKDA 1Z83A 2FGJA 4F91B 5L3VA 1V5WA 3LV8A 1KDRA 1LB1B 1IY1A 4B43A 2KE5A 1HURA 5FL7A 3MAAC 3U7GA 2UKDA 1QHHB 4HLUC 4V0MA 4DVGA 1GM5A 3RABA 3C14C 3L0SA 5HR5A 4MYCA 3SQXA 1IOZA 3NDPA 2ZRPA 3SJZA 5CITA 1PJRA 3NH9A 1KZ7B 3SFZA 1SVKA 3KB2A 4IDPA 5KSZA 3CONA 4A36A 2HF9A 1TNDA 1G7TA 2BC9A 3U4QA 1M34E 2FE4A 4JLJA 5L3RA 4QC2A 3ZQ6A 1QVRA 4Q00A 5DLQC 2FSIA 1ZM7A 3A58B 3NH6A 4PPNA 1ZD9A 4YMSA 4A2QA 3VKWA 1AKYA 2AK3A 1SKYB 3HJNA 3WP0A 5DHFA 4PHGA 3DL0A 4Q19A 3OE7A 1G3RA 1W4AA 1OH7A 1FX0B 1ZNWA 4US1R 4DC9A 4KFTA 5JRJA 1COWA 1J7KA 2ZRNA 1Z3IX 5EUQB 1OXSC 1OH8A 2XZLA 4JZKA 1E0JA 4V0KA 5F3WB 4LYAA 2OBMA 3T1VA 1HA3A 3KQUA 1KK0A 5AUQA 3U2QA 4V0NA 4FCVA 4Z1MD 2KBEA 2GTPA 4NYIQ 1G7RA 4NP6A 4LJ4A 5J4YA 3ICQB 2E87A 2CCKA 2IWRA 2HXYA 1FP7A 3R8FA 1QZXA 2OT3B 4D4LA 4HI0E 3QE0A 2IXGA 2ZI6A 4HB0A 1S0UA 4FIDA 2K5UA 1EK0A 3NWJA 4KFSA 4HAVA 2C5LA 1SVMA 1S4QA 3B5JA 4LV8B 4RD0A 3BBPA 3TH5A 4QM6A 1QG4A 2ZRDA 2E9SA 4C0AC 4RKEA 1KK1A 2CNWD 2OO7A 1M7GA 3CH4B 3IEUA 1CJKC 3GEIA 1E69A 4MRPA 1J90A 1QRAA 5G3ZA 1DPFA 3NC1C 2ZJ2A 2IEZA 3MWKA 1KI3A 1JBKA 1T8UA 1NY5A 2PEZA 4MH0R 4PHHA 3U6BA 2PBRA 1XXHA 3EIHA 2PT5A 2G1JA 3PV0A 1G21E 3Q5DA 3OFND 2EWVA 3CNLA 3H84A 3I4LA 5HZKA 3TUZC 1Z6TA 2YKGA 1WQ1R 3B1WA 1CTQA 2XTZA 2ZYTX 3DKVA 5FI1B 2VP4A 3OAAA 2ZI4A 4C0LA 2V54A 2F43A 4DUGD 4XWAA 3WBJA 4RJLA 3U7HB 1KI7A 2REBA 3VR4A 4K81B 4B35A 3SR0A 1E9AA 1E98A 2C98A 2JLSA 4URXR 2VRWA 4KFRA 4PQRA 3QPWA 2QMHA 1P62B 3TUIC 1Y3AA 4BEBA 4RZXA 3B9PA 1XEWX 2BKEA 3IKJA 2BMFA 4Q9IA 2X2EA 4IDQA 2O8FB 1N3BA 4KLNA 3K9HA 3K0CC 2J5XA 3UWOA 2X2FA 3UK6A 4DSTA 3GLIA 4GMXA 2PX3A 2R44A 2FPKA 2JAQA 2GF9A 3TVTA 5BW8A 1Q1ZA 2ZU6A 3RRNA 2JASA 2C77A 2WJVA 2ZETA 1II8A 2WJJA 1JQLB 3GEEA 1U8YA 2ZTSA 1RC8A 3GD7A 3ZGXA 4AY2A 1D6JA 1QF9A 2I3BA 1N0WA 3CR7A 1WP9A 3U5ZB 2ZRLA 3H0KA 3QF7A 4LC0A 4EPXA 3GLFB 3RNLA 3KKOA 1XD2A 4Q4AB 2ATXA 3E1SA 4KBGA 2IXEA 3ZD6A 1NI3A 1OV4A 4ARZB 4FCWA 4ZI2A 5DYGA 2XNSA 3EXAA 1U94A 5DI3A 3ASYA 5AJVB 2V1UA 3W6OA 4XD7D 3LRPA 4DCTA 2C8VA 2EYQA 3S1AA 4F4JA 4YXWD 1CRQA 1ELOA 5HTKA 1FP6A 3CB4A 1MRSA 3THYA 1U9IA 3BFVA 4RCYA 5CM8B 3SQWA 4C2TA 3L2OB 2OHFA 1MO3A 1DEKA 2DYKA 1RW4A 3AF2A 1XEWY 3FVQA 1TL7C 4DEYA 1KDTA 3OF5A 4DLRA 2G77B 4DCVA 3K09A 2N46A 3KJGA 3LY5A 5FBQB 2R6FA 4XVQA 4NH0A 3Q7QA 5TY0A 5F98A 2H16A 2OILA 4LZZA 4UJ5A 4Q4JA 2I1VB 3LXRA 2JLUA 3BH0A 3CX8A 2PCLA 5FTLA 1H65A 4UXJA 3GJ8A 4QRHA 2G0TA 4KCGA 3AV0B 3UPUA 2RH5A 1N6IA 3H4MA 4TZ6A 2A5JA 3GPLA 2AFIE 2KSQA 2EYUA 5JRZA 5F9HA 4NKRA 1RVDA 3T1TA 3NBYC 5TB5A 3BH7A 2OESA 1NN3A 2NGRA 5E7JA 4Q9HA 5AR1A 1CJMA 1DE0A 5IK2A 2DFKB 3ND9A 3HYTA 1EFHA 2B7BA 2FA9A 3GP8A 2VSXA 3OESA 4M1MA 1P2TA 2VF7A 4V0LA 3F8TA 2CL7X 1N5JA 3DVLA 3NEYA 3A1SA 3TUJC 1YR9A 3B85A 2O0JA 2WAXA 4HAYA 2YWFA 4TL6A 4AKHA 2IK8A 2FDCA 1E3MA 3WNDA 1HUQA 1ONBA 1Z22A 3ND8A 3J81k 5GVRA 5HE9A 3A4NA 2QE7A 2ANBA 1H8HA 2GESA 1VDZA 2RAPA 4C0KA 2RKOA 1ZCBA 3RS5A 5KOYA 4URYR 3AUYA 1Z0DA 4U00A 1F3OA 1Y63A 2BKUA 2GBLA 1FW6A 2WKQA 4A6XA 3AH8A 2MMCA 5JCZA 4OHVA 1QHYA 4YMWA 3PEWA 3W5IA 5HCNA 4A8JC 3NKVA 4LBWA 4BLQA 2WSSD 1JEDA 1N25A 2PJZA 1SHZA 2YOGA 4LYJA 1N5LA 3EZ9A 1LTQA 4G0NA 3NG1A 1TMKA 1XF9A 2HDNB 4AK9A 3JVUA 4HYYA 5TDHA 2A30A 3OEEA 4LYHA 4PO8A 2ZI3A 4FMBB 4AYXA 1E2NA 5CB8A 2PX0A 4JJZA 2ZE7A 4IOKA 4MKGA 4A9AA 3Q5EA 3T5DA 5GJBA 4MRNA 4DCSA 2QORA 3CRQA 1VMAA 5HKKA 1MOZA 3RRYA 4Q48A 3TQCA 2IX3A 4C0JA 1YKSA 1IXSB 1YJ5A 4QBGB 4Q7JB 4ZV4A 1TAGA 2WOJA 1OYYA 3DHWC 3MFYA 1R5BA 4PC7A 2OM2A 5CLQA 3Q8XB 2V4ZA 3FMOB 1EX6A 2WIBA 1XEFA 4DSUA 1OH6A 1TTTA 4V0OA 1HE8B 3AVTA 2B8WA 2PZEA 2WWYA 5AK0A 3B1ZA 2X8AA 3KQHA 1KMHA 3B2EA 1G4UR 3JVVA 2OAP1 3IBGA 4J0QA 3MJRA 4HZUB 1OFIA 3U6KA 1CKEA 1TU3A 1I2DA 4BFVA 1FMLA 1UBEA 4LJ5A 4NCNA 4XSHA 1TU4A 1N6OA 1Q44A 3GLHA 3IPYA 2W6JD 1LW7A 3QEJA 2LKCA 4I99A 5F2EA 1E96A 2VP6A 5G40A 1VHLA 2P6RA 3K1JA 2EVWX 2VSOA 4D25A 1Z5ZA 4URVR 2QP9X 1EFRA 1DVRA 1XMIA 5C18A 5KNDA 5CDFE 2XJ9A 4KVGA 3P26A 2GCOA 3T1OA 1DADA 1FNMA 1QG2A 1E0SA 3IHWA 4NU0A 4PFSA 4Q7MB 2ZJAA 4GOJA 2ONKA 5AJZA 1TUEA 2JA1A 1US8B 5C4GB 1CS4C 3TK1A 4R2HA 2ZPTX 2DB3A 2ZYWX 1ZUHA 4Z8XA 3ZZUA 4KV9A 1BKDR 3MCAA 1MABB 4IOLA 3LA6A 3ZZ0A 1R4AA 1JJ7A 3AVQA 2ZJ8A 3FKSA 2ZRAA 2BMJA 1SKYE 1L2TA 1A4RA 4X8OA 1W46A 3W3ZB 2VO1A 5FR2A 4JLDA 5KDOA 4B71A 4W9MC 4P32A 5J4LA 3RC3A 3QOFA 3K0AB 4ZI3A 1T4GA 2ZSAA 3A36A 3SBEA 1KO7A 2XXAA 3GJ6A 2W0MA 3ZIAD 6Q21A 1M2OB 3TAUA 2QEQA 2H92A 5CJ2A 5FOXA 2JLYA 3BB4A 2V55B 1XD8A 2ODEA 1E4VA 2NO9A 4M1OA 3WHKA 1XTIA 2V1XA 4B48A 2Q3FA 2TMKA 3EZ2A 4LPKA 2FZLA 2SHKA 2REXB 4GP7A 4DDUA 4UNPA 2VP9A 3CF0A 2JEOA 4EKDA 1LV7A 3C4JA 3Q72A 2HT1A 1VCOA 5SZJA 5KSOA 3AVUA 4O25A 4Y0VA 2ZQ5A 1B23P 1OE0A 3I8SA 3SHFA 3G0HA 3CX7A 3HWSA 1OSNA 4DJTA 3E70C 2CLCX 4IEIA 4RD2A 4Q4HB 1R2QA 2IYXA 1NF3A 3DM9B 4L15A 3SNHA 4EFMA 4A8JB 2MSDB 2XX3A 1AGPA 4A0RA 2PLFA 5BYJA 3GLGA 1T5IA 2F55A 3KTAB 1OXTA 3FYHA 4C7OA 5TMPA 4Q4AA 2ORWA 2QI9C 2DBYA 3KL4A 1OW3B 3M1IA 4ASUA 3FE2A 2CJWA 1GFIA 4E03A 3IHLA 1U0LA 2XSZD 1Z2AA 1U9IC 2LCFA 4XH9B 1II0A 1SULA 4KYUA 4PZZA 1CF4A 1UBFA 2QU8A 4TSFD 3ZVRA 2OZEA 2PT7A 2XEXA 3W90A 1OHHD 3P1JA 2IYSA 3U7FB 4AI6A 2HJVA 1N6KA 3VAAA 2QT1A 4FN5A 4DDVA 4PO9A 1AKEA 1GUAA 2P0EA 1ODFA 2DCUA 2CBZA 1SVIA 1S1MA 2PZFA 3AP1A 3L0IB 1Z08A 1XJQA 3UG6A 1FUKA 4E07A 1Q22A 3P4YA 4Q21A 4FMCB 1MR3F 1NL3A 3I1FA 3L82B 1DG1G 3LVRE 4TMZA 4BFWA 1N2CE 3B1XA 5KDDA 2WPDD 4JBXA 3BIFA 2J59A 3KQLA 1PUIA 2HXSA 1F2TA 4QJ5A 4HAWA 5FOWA 3RS2A 3B8HA 4CT5A 5DISB 4DLVA 1UBGA 1Q21A 1NMYA 3T5GA 2XTNA 1UEJA 4QHYA 4RFSA 1VG9B 2J41A 3GFTA 3VR6A 4GI7A 3B82A 4I1OA 4ILEA 4JLVA 1ZCAA 4HB2A 4ZDWA 3CUEF 3W5JA 1G1MA 1U90A 2A9KA 2WM9B 4EJSA 1Q1EA 1WMSA 3RVBA 4N0DA 5KSPA 4Q7LA 3QQ5A 5DN6A 5FTKA 2NQ2C 1JR3A 1XTJA 2ZUDA 3DZDA 3H2YA 4G5OA 4PTLA 1E2EA 1F6BA 2GF0A 3QVVA 1Z06A 4O2LA 4BZQA 1NN1A 4DLTA 3UWKA 2EW1A 1NLZA 2WJIA 3QBTA 3QXHA 1OIXA 2BCJQ 4IOMA 5CLLA 1OIVA 3D6TB 4QHTA 3GLFE 1VIAA 3WYAA 3U3MA 2QUZA 2ODNA 3N5CA 5EXXA 2CLDX 2OG2A 5AUNB 1OXUA 3GJ5A 2FN4A 2OCAA 2ZEJA 2CK3D 1W47A 5KTYA 2BWJA 2ZRBA 5FOTA 3C7KA 2AKYA 5C46F 3LFUA 3FPAA 2G6BA 1GIAA 1VECA 1JALA 1C4OA 1VG1A 5EE0A 1IHUA 3THWB 2IYYA 4QJ3A 4TTQA 1II9A 4ZO4A 4V02A 4R9UC 3ZVLA 4BLRA 2JIZA 1NJFA 1QDEA 1U99A 4QOSA 3RS0A 1OB5A 4G3XA 1T3LA 3SYLA 5LD2C 2GK6A 1W0KD 4C0QC 2VA8A 2F9LA 3I72A 3B6EA 1WF3A 4HSEA 2ERYA 1T5LA 1FQKA 3D7MA 3IILA 4B34A 1MO5A 1P5ZB 2O52A 1XZQA 1E9RA 4GNKA 3THXA 1H8EA 5HCIA 4BRWA 4A82A 4CGZA 2CCGA 2A5FA 2J7PA 4KITB 1QVAA 3JZAA 4URZR 1G291 2FGKA 4OL0A 3QPUA 3HDTA 1NVVQ 4YLGA 3TR5A 1XMSA 1E9BA 2P67A 1WRBA 1NLFA 3TKLA 3FFBA 1YZKA 3B78A 5EXSA 2FWRA 2IF2A 4PZLA 3QSYA 4TLCA 3WRXC 1YHNA 5KYKA 3EC2A 2O8DA 1V43A 5D3MA 1G19A 1UDWA 3KKPA 1NMZA 2GETA 4QBFA 2WMNB 1ZM3A 2FMXA 2YV5A 4JMPA 4Q1AA 1G5TA 2JLVA 1R0XA 4Q1EA 2G83A 5TVKA 2R6DA 4PQFA 4L9SA 4LK2A 1DAGA 3EPHA 5J47A 5H8WA 2B7CA 3E5HA 4JLBA 2BHRA 1KGDA 4LBZA 4R71A 3X1DA 5EQTA 4R98A 2A5GA 4BWYA 1OLOA 1ESMA 4C0HA 2ZI5A 4PSKA 2NO7A 3ADCA 1X1SA 5KUTA 3AF3A 2ZYUX 3KKMA 2JLRA 2WSMA 2IA5A 3IIKA 5JJIA 4NYIR 3X2SA 3IQWA 3VX3A 4RCZA 5FOSA 4CEJA 3QPVA 2KBFA 1M8PA 4JBYA 5FUXA 2BBWA 2AD1A 5JECA 1PUJA 2RCNA 2ZJBA 4HLQB 1TEVA 3AKDA 2F3TA 5BN3A 1R0YA 2F1RA 4DLSA 2QP3A 4ACAA 1QBKC 3IIJA 1GAJA 4AURA 2QMUA 3QKUA 3NC0C 1IN6A 3VR3A 2FOLA 3KDSE 5KNBA 1M74A 5L3QA 1SXJA 4A92A 3AM1A 1IONA 1FL9A 4KJZA 1KY2A 3ZJYA 2YWGA 5ANRB 2QRZA 3LQRA 3HR8A 2JDID 4BPBA 3NHAA 3U44B 1KJYA 1KJZA 4ESVA 1Q3TA 4DIDA 4IJMA 4HDOB 1JAHA 2MSCB 2ZRCA 3M4YA 4GZLA 3K0FA 4DLWA 1DO2A 4LHWA 5L3SB 4OQXA 3RLFA 4US0R 5J4VA 2IXFA 2ZAMA 4D81A 1E1QA 3CNNA 5FTNA 1JI0A 1FQJA 1KYIA 3UMFA 1T91A 1WBBA 3HU1A 1Z8FA 1UJ2A 4OK3A 4RKFA 1KO4A 2ZS8A 1AS3A 4MGYR 4ZCLA 2ZJZA 2ZSEA 1RPZA 1AJEA 2GCNA 3QKRA 3ADKA 3PJRA 3FMFA 4UNNA 2WIAA 3CRW1 5JFGA 3AKCA 3K9LA 4JL6A 1EESA 3K9NA 3X1YA 3ETLA 2YNMA 2HUPA 1G41A 4ZIRB 1EX7A 4JKYA 1Z0AA 5LDDC 4JLOA 3U61B 1A5TA 2HJGA 3IQXA 5LB4A 1JQJC 2P65A 4ZCIA 1XP8A 1HE1C 4YC7A 3WY9A 2ZJYA 4ZKEA 2O8BA 4LHXA 5KU1A 2O8CA 4XWOA 2F7SA 2FFQA 1Z0IA 4LJ6A 3BD9A 4WZ6A 1E79A 1F2UA 2GXQA 2NO0A 2H5EA 4QG7A 1YU9A 4D26A 2RB4A 4RFVA 3U3OA 5FTJA 1KO5A 1LNZA 1BO6A 4GMDA 1EFTA 4Q9JA 1P75A 2R8RA 1E99A 621PA 4PPQA 1BYIA 4TLBA 1TF5A 1YZLA 1ZUIA 4WA7A 4U7DA 1AGRA 2ERXA 4TL7A 5FOVA 3BS4A 1HT2E 2GJ9A 2FZ4A 1E2FA 2VTKA 2YINC 4RY2A 1ZMXA 4B44A 4Q1DA 3NBXX 1W0JA 4DHEA 4P0TA 5LBIA 3O8BA 2HLDA 1E1RA 3GQBA 3LLUA 4UKDA 3SOPA 2GVDC 4UNRA 4AD8A 3EPLA 4DT1B 4D0LB 1XPOA 4D0GA 4V0ME 4E22A 3I62A 2W6IA 2ZS7A 4GDFA 4ESHA 1N6RA 2C78A 3REFA 4CT4B 3GEHA 4KAXA 2QAGC 3PXGA 4N0EA 3LXXA 4XOIA 1I4LD 3ZZTA 1RFLA 2Q9AA 1JB1A 1HT1E 1MH1A 1YZQA 3MG9A 4UQOA 4UNSA 5J40A 1OT3A 4NHOA 5CK4A 3V9PA 4ABYA 3TR0A 2OFXA 1ZNXA 2QPOA 1PZNA 4HUQA 2QT0A 2DWOA 2W2TA 2ZRIA 4WOPA 5BXQC 3BFKA 4KLZA 4TT3A 1KZGB 4Z8YA 2R65A 2GXSA 5DIFA 1NG1A 5K8IA 1AQUA 2Q9BA 4L9WA 5FI0B 3W34A 2C99A 3B13B 2VHQA 4E5UA 3EASA 2B21A 2LWIA 2VF8A 1IM2A 1X86B 1T9HA 4R2IA 4EPWA 1S2MA 1KI6A 3FMPB 3OEHA 4O3MA 2X19A 5FPTA 4QNRA 1TQDA 4X8LA 4P31A 4RD3A 1OFTA 2B6HA 2J0UA 4RZ2A 3SDZA 3EA5A 1DAEA 4OKSA 5LPNA 2X1VA 3UKDA 2XZOA 2EQBA 1Q1BA 2WBLC 3AP3A 1J8MF 4TLDA 3IO5A 4F7WA 5AUPB 2QENA 1N5IA 2BM0A 3KUDA 2D4HA 3BH6A 4ON9A 1XMJA 2H57A 3RDPA 3TSOA 3VHLB 2GEVA 3VX4A 1HQCA 3IIMA 1YR7A 4D2IA 3VQTA 4EUNA 2JATA 3L43A 1E2JA 2ZU0C 3SC3A 1X6VA 2JLXA 2QBYA 4MDFA 1ZD1A 2ONJA 4CEHA 2WV9A 1D5CA 1NLYA 1XPUA 4N3NA 1VCMA 2FSGA 2RGBA 2XOKD 3KJEA 3QEOA 1P60A 2KJQA 3AVOA 4II7A 1E32A 5DSZA 5EE1A 3VMFA 2VL7A 1F60A 2QA5A 3UATA 3TW4A 4HDQB 2FX3A 2GVZC 2J7KA 4BZPA 1A2KC 2GCPA 4IHQA 1IBRA 5BQ5A 1ZAKA 3R7WA 2J0SA 4FCTA 2VBCA 2CVHA 1GRQA 1B0UA 3IPXA 1NBMA 1UADA 1YR8A 3QKSB 4Q9KA 5D3QA 3KKNA 5JSZA 1GNQA 5TXGA 2RMKA 3AB3A 2W2XA 2BEJA 2YWHA 2O8EA 1LS6A 1KDPA 1MO4A 4TL8A 2H1LA 4TYPA 1QHXA 4B3FX 3QF4A 1W2HA 3VU9A 1R8SA 3CKLA 2J0VA 1G64A 1YZUA 4Z1MA 4EDHA 1Z0JA 2ZXUA 1AQYA 3CBQA 4MKIA 1XD9A 1QHNA 2V7QA 3CW2A 4OK5A 3OHMA 4YMVA 1N0VC 3ZLJA 2CMKA 1G17A 2XJ4A 4LJ8A 4WW0A 1GSIA 1SXJC 3C5HA 4Q47A 3LQQA 2QG6A 4G01B 5KDLA 4OBEA 4ZDIA 1Z6AA 2P2LA 4OQMA 3DPUA 3LH5A 5CM9C 4AYWA 3PVSA 4FXPA 4F93B 1RJ9B 4XIGS 1AN0A 4AKEA 3T61A 4V03A 4CEIB 1AZSC 2YVUA 1A7JA 1O3YA 2FEOA 2NMVA 1DAHA 4QBIA 4BFUA 4TL9A 3BJIC 4UXHA 1Q0UA 1RKBA 3HU2A 4LV6A 5CDFA 2EFGA 2CE7A 4MITA 2NO1A 4HB4A 4X8MA 4JVMA 3T15A 1QHHA 2HYDA 2QAGB 1NN0A 1BH2A 3OFNA 5DI9A 2Z4RA 1XTQA 3LNCA 3BB1A 4IXNA 1CJTC 2BBSA 2G88A 4C3ZA 2W83A 4JLAA 4PSVA 4B3GA 3L8ZA 4OYHA 4A0GA 5K8UA 4DUGA 2FPMA 2OUKA 1XEXB 4GRAA 1VCNA 4BE7B 1BMFD 3FB4A 4A1FA 3FFAA 3CPEA 4NYMQ 2IL1A 3SJAA 4B2PA 4EQ6B 5CYPA 5C4MA 1IN4A 1YZTA 1FX0A 2PEYA 2IF0A 3CPHA 2ASEA 4LY6A 4OJKA 4QGGA 4QXAA 1GKUB 1CXZA 2GAOA 2J9RA 4Q1FA 2W58A 5TV2A 1SKQA 2YOFA 3TMKA 1GL9B 2DFNA 1NIPA 2WJYA 3R20A 3C41J 4AKIA 3WNCA 5FUVA 2PLRA 2GZDA 4IOJA 2IUUA 4I4LA 3EZ6A 4TN1A 1Z07A 1W2GA 2HCBA 3FHCB 1AS0A 4MGKR 1PLLA 2O0HA 4YDHB 3T06B 1UDXA 2NZJA 4JVNA 1CRPA 3AQ4A 4TMXA 2IYRA 2ECKA 4K46A 1R7RA 3ZH9B 2J3EA 1W4CA 1R10A 3LW7A 1UKVY 1E2DA 5CJPA 5E7IA 4MDEA 4RZ3A 2W00A 3HU3A 1IJFA 1GVNB 4OI2A 1TF2A 1XMVA 4MKFA 5EE5B 3VR5A 4US2R 1GDDA 2I4IA 3Q3JB 4WXPA 2RHDA 2IS6A 1Z47A 4IVRA 2ZSDA 2FU5C 4QNMA 5JBQA 2QZ4A 2YC2C 3BRWD 3TSZA 4QFMA 3BAFA 1TADA 1PLKA 1NVWQ 1E9FA 1D9XA 3CPJB 5KHOC 3RSLA 1E2HA 2IS1A 1E2MA 2AKAB 4XD7A 5J5CA 4NYJQ 3PITA 2ODWA 3W8NA 4F38A 4P4SB 5H68A 4YXWA 4OJQA 2GXAA 3ZS9A 3PEVA 2F3RA 5EZ6B 3RS4A 1IY2A 1VHTA 4JL8A 3AVWA 1IN5A 2FSFA 1OKKD 4L5BA 1DOAA 3M6AA 2WICA 1MT0A 2ZITA 4NPHA 2GHIA 4DT1A 3Q7PA 1AA9A 2GXUA 1JAIA 4I1UA 4PQYA 3U3RA 3WHLA 3MSXA 4MKHA 4UNQA 3LWNA 2ZSBA 5EP2A 2NPFA 3TAHA 3B1VA 2QAJA 3GCGA 4FWTA 3KFXA 2Z0MA 2A2ZA 4LJ9A 1ZU4A 1CBUA 5EZ5A 4TYYA 3R9IA 1NY6A 2N1BA 1FPMA 3MWYW 2PCJA 1XJ0A 3PUYA 4LC1A 4AG6A 2BVNA 1ZW6A 2CEAA 2OLJA 4LOAA 1CR1A 1SVSA 3EG5A 2FFHA 2F6RA 1R5NA 3A4MA 3KQNA 2O8FA 1TQ6A 3K0EA 5SZKB 5TARA 5LB2A 1N6NA 3DOEA 4R7ZA 1P9WA 2Q6TA 1ZU5A 1OXXK 1ZP6A 4L4UA 2OCYC 2AWNA 5JS8A 1KK3A 1Z0FA 2VHUA 3CRMA 3QJYA 3W6NA 3RSOA 2FF7A 2GJAA 1G8GA 1JXMA 3QY0A 1KHTA 2VLIA 2I1QA 2R2AA 2JCSA 5AUOB 1ZYUA 4QGAA
chains in the Genus database with same CATH superfamily
1P91A 4BASA 2QM0A 4KIUA 5C2JB 4C76A 4ER7A 2BFNA 2C5FA 1V16B 2YZ2A 2QW0X 2GNOA 3HLYA 5EN4A 2MJLA 1RRPA 2JKYA 4WZBE 4AG5A 2OCBA 2HA3A 2WWGA 4KWHA 3ILYA 1NUHA 2VHXA 2DWPA 4ZVSA 1KBQA 3ZQKA 3GLFA 1BSVA 1KI1A 5TMBA 1LK5A 4BCDA 4OG2A 4V1CB 3AGPA 5NULA 3DEYX 5EXTA 1DAFA 2LVBA 3A4TA 3MF4A 1HE4A 4H7HA 4OGGA 5HF8A 4ARZA 3UJNA 5DGXA 4AVYA 4IFBA 2BD0A 1XFAA 3U0VA 1ODSA 1U5BA 3FWYA 5EJEA 4P7JA 5KJ1A 3M49A 2BHLA 4YHBA 3INRA 1H1DA 1NC1A 1ADYA 3ZDZB 4UFNA 3W8RA 3GEMA 2G40A 1PG0A 1E9VA 1MAAA 1CY4A 1XU4A 2FPGA 3ONNA 4PM4A 5AJXA 3S3TA 3WYCA 1KO8A 2F9FA 4LW8A 4BGVA 1XVAA 3ESZA 1C8LA 2F1IA 1EGMB 1ZXLA 4CETA 1G20E 4EKEA 1UZNA 2CHGA 4RPGA 3LGAA 4K2HA 2VEDA 4NCHA 3WZ2A 2JZNA 4H4DA 2I4TA 1PNOA 4I1VA 4BFZA 1YR6A 3OIYA 3NATA 1W29A 4A0HA 3OQNA 2RI0A 3DT6A 1WMFA 2AEFA 2WSLA 3WKAA 1Y34E 3SQLA 3SVZA 3ZHRA 4E51A 2JB9A 2N42A 5CA1F 1YL7A 2NNWB 3RTCA 2W6PA 4X7BA 3FHLA 4JJGA 4B3CA 4D9BA 1NVVR 4D4MA 3GU3A 1A1VA 1WA5A 3LF2A 2PUGA 1YJAA 4PGAA 3EH1A 4RJKA 4BAZA 1UUFA 3STXA 5A1TA 4JCOA 2CFIA 4QLAA 3BORA 3CT4A 1JMYA 4GOKA 3UXEA 3KPUA 2VJLA 3CZCA 2KM1A 4MAFA 2UZ3A 1IVSA 1MIOA 1MVNA 3P9NA 2C4NA 3KQWA 3K9WA 2JIBA 3CZPA 4GG1A 5B7GA 3IBFA 1TX4B 1UC9A 2A58A 4JLSA 3FFXA 3JQGA 4QJBA 5SZHB 5H7XA 3SVTA 5CG2A 2GEDA 2W2LA 4IDEA 1E0AA 3GPCA 4I5EA 2XT9A 3OUZA 3NV9A 2VR1A 2RG1A 2P9ZA 3LTNC 3ABOB 2VHTA 2FMFA 2ADFA 1LPNA 2D62A 1EVZA 1NQAO 2UV8A 4HLCA 3KFVA 4PANA 4AJNA 1JEOA 3BHJA 2CCJA 4RA9B 3B38A 1BCSB 2QRHA 3OPYA 3O8DA 2ORYA 2YBEA 3BJEA 5CCXA 1QPBA 1SWWA 4RS3A 2XCTB 1RHMA 1ZNZA 4HFRA 4RQBA 4ETWA 1JEJA 4LQDA 3QI2A 4IKPA 1X92A 5DYIA 3MMNA 1U98A 5EY5B 1P3Y1 1EVKA 4KXFB 5F21A 3N2EA 3TQIA 3R9XA 3D5EA 6GPBA 3EEYA 4OUDB 1JZTA 5JH7B 1QB8A 1COWD 2WPNA 1M1UA 3DDUA 2C3YA 3UUFA 3T1YB 1XCPA 1IU9A 2IPOA 1RZVA 2ZKLA 4HWPA 4JJKA 1GNRA 4MP8A 1HL3A 4R1UA 5IVDA 5IVIA 5EIEA 2GDZA 2YWEA 2JLWA 2JJ8A 4JOBA 3P9IA 4MS3A 1OLSA 3GLIB 2NVUA 1O96A 2DQSA 4LV5B 2PY6A 3TTSA 5G3YA 2WSBA 1V9LA 2CYAA 2C4MA 2XWJI 4RHEA 4WNYA 3RC8A 2BFBA 3O03A 2UUCB 3FRJA 2X8WA 3QNWA 2XE4A 3N2IA 2GPNA 3I9MA 1JZSA 5KTMA 1WHSA 4G0QA 5AFSA 3GFGA 4MQFA 2VDJA 4KQIA 3KEGA 3TLXA 4B79A 2FVYA 2DQKA 1IUKA 1NF2A 3OOEA 3ZKWA 3BIWA 2V6MA 1WQ4A 1E79D 5T6BA 1B6SA 1Q2XA 1TLLA 5JZVA 1PEDA 3AUTA 4XWWA 3IX7A 5IKOA 5GZ3A 1O4WA 2OBLA 2Q5QA 3B9QA 2ZB3A 1Q0TA 4RQTA 4BWVA 3H99A 4ALJA 4X65B 1XD2B 3OM9A 2PKQP 4IWYA 4ZQIA 4BNIA 3GJQA 4WNAB 5DK4A 3T41A 1RTTA 1BDIA 5BW4A 2FPRA 1PJ3A 1W88B 2C4UA 2YIJA 4MLZA 2L19A 4P84A 1ZD4A 4TQAA 4ZOEA 5DI3B 1OAAA 4WK4B 1TRKA 1E58A 2OV2A 5J2UF 2FCAA 3PQ3A 4JBHA 4MVJM 4YCDA 5AJWA 4Y1EA 3U9TA 5BR7A 4Q5IA 5I4BA 3S1AB 4HZUA 3TLAA 2AB0A 4FZVA 3VZSA 1JLMA 4W9NA 1ZINA 4OCZA 4ZFNA 4L4RA 4H60A 3SFVA 4Y2YA 3S1LA 5B2ZA 5K3AA 3UHOA 5HTOA 1NSTA 1ZQ9A 4ND6A 4O2BB 3RU9A 2NO6A 2CFSA 4C9BA 4HGOA 4NJMB 3OAAD 2HQBA 2WINI 4PX3A 1IUNA 5BSUA 3VYUB 1IEQA 1DXOA 1J4AA 5K8LA 4PZYA 5FLEX 1NRJB 1W48A 3RYHA 7GPBA 3H2ZA 1WZ2A 2WD9A 2JK1A 5A03A 4KWEA 3W5DA 3RFTA 4PNPA 1Y1SA 2ZI9A 4I46A 4E1VA 5KZMB 2HBRA 1DO0A 3IP8A 4PRYA 2O5EA 5BT9A 3TI7A 3ENKA 1PQYA 1US8A 3CF6R 4Q12A 1YZGA 4E09A 4Y2QA 1ZHFA 4F85A 1OHHA 2R48A 3RSFA 1O9BA 4RYLA 3TQHA 1ODCA 3PNYA 3CUUA 1FYEA 4TM8A 1NFQA 1WUKS 1UMKA 2ANCA 4C30A 4D45A 1VTKA 4RTRA 4MQEA 3R7SA 1QG0A 4H0NA 4KR9A 1O94C 2LDXA 2PRZA 5IC4A 1NF8A 2HF2A 2D0PB 4M60A 3AFOA 1ZIOA 1DJPA 2C83A 3C3BA 3DLAA 2EIXA 3I2FA 1YQXA 4O4IB 1HL7A 2Z5FA 2ZREA 4ABTA 1SM4A 2C0CA 5D5PA 2Q7DA 5JE8A 3DDCA 5AJYA 2NUBA 1VKOA 2D1SA 2JIRA 1JECA 3IFSA 4N0QA 3TQFA 3ND6A 4LGYA 5GADl 2AJLI 4F3TA 2WKRA 4OJNA 5EIAA 5B1IA 4XIJA 4I4IA 3N74A 2ZIFA 2JI4A 3C8MA 4TMKA 4D56A 2NLOA 1E9EA 1BE6A 3QTBA 3D2AA 3KB8A 1U0JA 4GKKB 2A0XA 1FEZA 3AF1A 3H4VA 4HAXA 1ZUNB 4BLSA 3DWIA 2OECA 3NGMA 5T57A 1BIFA 3RT7A 4OQLA 4X66B 1FUUA 1UODA 4MKXA 2JNWA 3GPIA 4M55A 4KO8A 1WX1A 3RVLA 3P8ZA 1WU8A 1SQSA 3HDHA 5ER9A 4U5XA 1XVUA 1RJWA 2IHYA 5F78A 1Q92A 4LRTB 4DV4B 2BGMA 3KZCA 1Q1QA 4FGSA 2YMQA 4X71A 1G59A 1NA5A 2TMGA 3EXFA 4PNHA 3HP4A 2XGMA 4P81A 2QDKA 5ALJA 1GNPA 3N70A 1KSJA 2GPBA 3EZFA 5DTEA 3B9BA 1LRLA 3NCHA 3P9CA 2ZUVA 3WKDA 1ZI8A 4IFIA 3UGTA 3KU4A 3FSGA 4KXXA 5AKHA 4W5JA 1GO2A 3S55A 4NE7A 1KJ8A 3RNOA 1KOGA 4HTFA 1EUQA 4JJAA 4TWJA 3BMCB 4R0NA 4R1TA 3IB3A 3HGTA 3ZI4A 2WKWA 1V0JA 3RSSA 1DS6A 1XA0A 1NZDA 2CK3A 2IU6A 1KYVA 1A50B 1I30A 4X6LA 1VCIA 1M6VA 5KNDH 1XZPA 3KTAA 4UTNA 4B33A 1KP2A 4XUEA 1K66A 3D3WB 3GP5A 5IM5A 4DIEA 4ND7A 3UAVA 3F5SA 4Q4LA 1NUAA 4ZPXA 3OD5A 2X9GA 2P7IA 1E8MA 1NLMA 1MO6A 1T8PA 1FFAA 1T1GA 2PS0A 3HB5X 1V1MB 3ZU2A 3ZY3A 2K4MA 4ZMBA 3NC4A 1JTFA 3PEFA 2DFTA 1CLUA 1SU4A 2Z5LA 1XAIA 2WJGA 3BIXA 3RRZA 4MA4A 4WERA 1ZISA 1X9IA 3GF4A 5JI2E 3H11B 3BIOA 4R81A 3TVDA 1D2CA 1EXMA 1LTKA 3PWZA 4WOJA 3HZOA 3FSRA 4WZBB 3V8EA 2PYDA 2R5NA 4II3A 5T5QA 1S2NA 3ITNA 4YXFA 1E3SA 1UQRA 4C07A 1D2EA 3IAAA 3NOQA 3R3HA 4L3WA 3R6GA 4XPZA 3T9DA 4B6OA 2XKKA 1QZ3A 5HP4A 3V6MA 1ECCA 1G7CA 3CH5A 3RFUA 3WFIA 1ZD3A 3CLSC 4TXMA 3T3GA 5LDGA 3DM5A 3ROEA 1RLOA 3QLJA 4DWJA 2ZDGA 1OC4A 1X19A 4PC2A 3C8ZA 1LZLA 4MR8A 3UWDA 2ZPAA 4JKIA 4PC3A 3C5VA 4GSYA 4UBNA 3SZMA 3PIRA 2A9OA 1KMQA 1ZJ5A 3QBJA 3KJQA 1Y7HA 2EGHA 2GCOB 3F71A 1X8LA 2I2DA 1DQRA 1LX7A 1YZYA 2TS1A 2PRYA 3PIIA 2QE7D 2UVQA 1P5JA 1DU4A 1XMPA 1O8CA 1G3QA 2HH9A 2Q6VA 3GRCA 3U4QA 3JTEA 1JYFA 1RDFA 1TO2E 2BGLA 3EVDA 4LDNA 5EMMA 1DAPA 2OFWA 1ZK4A 3NKLA 5JANA 1WBDA 3QEKA 2QN1A 3RGGA 1KO1A 1WBJB 4A6EA 4EYOA 4C7JA 3ZLVA 2BYTA 1BOFA 4Z4EA 2ET6A 3TBFA 4EGQA 3KO8A 1KBZA 4MPRA 4YQFA 5C3MA 3DO6A 2VJKA 5DTQA 4MICA 3T99A 3UPTA 1CP2A 2CMDA 4BEJA 5JAOA 3F6PA 5JTTA 4YV1A 3F67A 3FCAA 4QTZA 4R3NA 1LFDB 4UJ3A 4YJFB 4EPYA 4YI3A 1L5RA 2UUOA 2VPPA 1X8XA 1P29A 4BP8A 3A9WA 2WJWA 1O95C 4TV8B 2FRXA 1Z2PX 2V7GA 3NONA 2JH9A 1K8RA 3SSNA 4AECA 1DC6A 1M0SA 1USVA 2FFBA 3DGEC 2I3AA 4LMBA 5EXPA 5T41A 2BMWA 2HW8A 1KWGA 2A4KA 1QMGA 2OQ2A 1IN7A 1XL1A 4KGZA 2IODA 3DOUA 4OJMX 5DTJA 5ICMA 5LQJA 4R1LA 4MGEA 2GT1A 1ZMRA 1GZSA 3BG5A 3NHRA 3W7VA 1OH5A 1KMNA 1Z37A 2PUAA 1IQRA 3T7TA 1PSDA 3QEMA 5ILQA 2CXPA 4UDXX 2OENG 1VFNA 3R4VA 3TDKA 821PA 5JNWA 3ZWAA 4ARBA 3I5YA 1INLA 3ACBA 4YJ3F 2NP7A 1XTKA 3Q4GA 4TTPA 5D2CA 5SY6A 1I2MA 1JXOA 4A91A 3R5FA 4WACA 4RZIA 4QUKA 5EHIA 3SBDA 2XB2A 3VDXA 4URUR 3EDYA 4GX5A 1NVTA 2QMEA 4JSYA 2W8BB 1WB9A 4P5EA 1HR0B 4CLEA 2MSEB 2ZBFA 1XJWA 1J2JA 4YCMA 2I9KA 3EGVA 2OBXA 5IT5A 3IULA 2YDYA 4AB1A 3HBFA 1I2AA 3EXHC 3KAPA 5THXA 1MEOA 4I50F 4EPVA 2VUSA 2RGEA 3M5DA 4QTUB 2ES4A 2OZKA 1VSTA 2Q46A 5DP1A 5F1OA 4GPEA 4AX8A 2H4YA 4L50A 2QRGA 1QB7A 4HAOA 3UMGA 1E5DA 3GLGB 1XQ6A 1MAWA 3D4PA 3DLPX 3MIZA 3GH1A 3W2TA 3WMWA 5KNDD 1UKBA 1MKYA 5AD1A 3AK4A 3IKVA 3CLUC 3STTA 2CB9A 3OZIA 1J56A 4Q4CA 1DARA 2FG5A 1XXHE 2PR2A 5CVJA 1NVMB 5AIBA 1LLQA 3BSSA 2OO3A 2ID4A 1PF7E 1SQ6A 3O83A 4RMIA 5DOZA 5GIPE 2YZ7A 4KR3A 1K3TA 3D7RA 3L4JA 4MIEA 4FI3C 7ADHA 3KJIA 4U2KA 3MCTA 1J7JA 4JI7B 1ID8A 5ALQA 4BL5A 4O4LF 2FFRA 1GR0A 2HJRA 5EGSA 3HI6A 1GKIA 3EIQA 4NL4H 4BZWA 1ZG3A 3HA3A 5KYWB 1HDEA 4JLPA 1VI6A 3GLQA 3G2HA 4HZIA 1TEHA 4GM1A 4RK4A 3DDHA 3GR6A 3SE7A 1EFUA 4KI0A 2FUEA 4RH1A 1ORRA 3G5MA 1J70A 3R41A 2G9NA 2ADMA 1FQWA 3H0CA 3RF7A 3P2MA 3WL3A 4BJHB 2I8AA 2XB8A 3HP1A 3UXMA 4AULA 1F2TB 2RGNC 2JBHA 4K9MA 1O94D 3BWDD 4NTZA 1Z8HA 4BB6A 3G9UA 4BNGA 3AL3A 1E9CA 2AYYA 2ZBVA 4KHZA 1UT5A 1V8PA 3AR7A 4N7JA 2IHZA 3TEJA 4ZVNA 4RPHA 3KELA 4MCIA 4D8XA 1S1CA 2EBFX 3CCFA 3HVKA 2ZSJA 4AJOA 5ICGA 2WQ6A 4IH9A 4H6WA 1YGYA 3F6RA 1R8XA 3AESB 4JJ6A 2BFEB 3VKHA 1X7XA 2OWEA 3EGCA 2XADA 2XDQA 5E1BA 1C9MA 3IXQA 3AXTA 3SLKA 1CG6A 4DKXA 3N28A 1ZNQO 3MRTA 4EPTA 1GL6A 4KVFA 2WYHA 3BDAA 5E6UB 4OLHA 1K6MA 3R6TA 4B40A 1E2LA 3MBKA 4O4JF 2C96A 1DXHA 5AW9A 3S29A 1IYZA 2COEA 3QLVA 5JEEA 1IBMB 1Q74A 5K51A 2ZIWB 1KAMA 2W9XA 3EGIA 3RSCA 3EPPA 3ZD9A 1V45E 4FGZA 1M72A 1PJLA 4RXUA 3RU7A 4CUKA 4EA7A 4FHZA 4EBFA 5JBNA 5DE3A 1XTBA 1AQJA 1VYTA 2BJWA 4P33A 1E62A 1V8FA 3C3DA 4QRIA 3BMXA 4MQMA 2EWWA 3AEKA 3LA8A 3U09A 3SF8B 4M9XA 5TS2A 4JS0A 2QLLA 2XCRB 1NJSA 1TM5E 2OM6A 2C42A 4X1KA 3KZ1E 2ZB8A 1KI2A 1WS6A 2CFCA 2EFCB 3I76A 3PTZA 4RGYA 5DRTA 4ZEVA 4ASUD 1Q17A 1Z9BA 3NPAA 3RROA 2FJUA 4C2BA 1S2GA 3HCOA 4QXOA 2C0PA 2DHRA 1EK2A 1WXEA 4YBRA 3UICA 3F7MA 5GVSA 3WAGA 3HDJA 2HNAA 3HCNA 1CP3A 1U04A 1NXQA 2BM1A 4WPGA 1JA9A 2MR6A 2YJTD 3MAJA 2WKPA 5IHPA 5KPDA 1UJMA 3OQBA 4YRIA 3BOSA 3EDCA 1A9RA 1OWOA 3C5CA 1AHHA 1D8TA 1IBCA 1V41E 2HA6A 2AC2A 5EJ5A 2G9ZA 4MQBA 2O2YA 1RYHA 1OBVA 1V1RA 3B6IA 1FNNA 3GHHA 3NNNA 3OQIB 5E7MA 3ROMA 3WB0A 4CM4B 1NBME 5HF6A 1RD4A 3TLGA 1T13A 3IUNA 5E4YA 3UK1A 1Q16A 2XUAA 5FFMA 1F6WA 2GRUA 2WWIA 4Q7QA 2DPGA 1ZC4A 3PNMA 1EFPA 3OTHA 2Q29A 2BLLA 4QSMA 4LI0A 4OXIA 1UAAA 5CYGA 2NV2B 3FFTA 3MJDA 4HO1X 4RNCA 4CF7A 2PFGA 5DHPA 3LWDA 2VDRB 2A7QA 1T6NA 2PD4A 3IVGA 3N8KA 1HYEA 4RV4A 5F1KA 3TZ6A 1ZRMA 2FWMX 1R3UA 3WLOA 2HZ7A 2NAPA 4EMTA 2XYRA 4BLTA 4OFZA 4YYEA 1YJCA 3OIVA 4JL5A 5CIWA 5AVKA 9LDTA 3ESBA 2QN6A 2OBNA 3Q9NA 4HFJA 4Q03A 3EXHB 1PNTA 1RFGE 3LWZA 2C03A 3HB0A 2Q4BA 3CLSD 1KSGA 1SJ9A 1D0SA 3OFVA 2O8DB 1VKJA 2XYVA 2XKJE 2OYSA 2YN4A 4C4RA 2VDMB 3JQ9A 4JXKA 2DM6A 3AEZA 4XEHA 5CT4A 3VBCA 1DKRA 1G6HA 1JU4A 1SVLA 1FB5A 1Z12A 1Y42X 2X0JA 1QFSA 1M34B 3WQRA 4PLFA 1OA0A 1QMPA 1L6IA 2AR7A 5AXBA 3WRXA 3AONB 1LVUA 2BY4A 2H17A 1ZXXA 4MUFA 4MVJE 2YX1A 4D97A 2V58A 3D8RA 1K6IA 3QQPA 1ITZA 1HE3A 3KOMA 4OK6A 3GMTA 3T5TA 4BX8A 1IJEA 4GBMA 1H9AA 4DLYA 1UJCA 1A8SA 1C81A 1P2SA 5M2QA 3E9RA 1A9XA 2AZ4A 1N34B 3VH4A 2ZROA 3CH7A 4JYCA 5IP5A 2DU8A 3WSWA 1RPNA 3KT0A 2PO5A 4RF3A 4NY1A 5AWFC 3S2IA 2RHHA 3TRIA 2I03A 4ZVTA 3MJFA 1FRQA 1Z88A 4YCAA 5KWSA 1YHZA 4JYZA 1FP1D 1KY5A 1W25A 5LVAA 3CVVA 1L1RA 3AP2A 5DBHX 4WSOA 1RHJA 4MX8A 4NDNE 1IQUA 5TPZA 2PT6A 1SQFA 1P7VA 2VUTA 1P61B 2JIZD 1W9HA 3UVEA 3WOHA 3RS3A 3MINB 1O95D 3GIDA 2QSZA 3O8CA 1TMOA 2DTEA 4EVSA 4QAQA 2JFVA 1Z4MA 3PNVA 5EP4A 1AXRA 3V3TA 1Q7TA 3CGGA 1NIJA 5JNRA 1ZNYA 1A9YA 3ICOA 1WU7A 2OHJA 4PLZA 4WCFB 1K97A 4DMMA 4DHWA 4B4UA 4CG2A 4KH0A 2IEYA 2FF5A 4ZOLA 3CJQA 3PR1A 3DJYA 5AI8A 2YDXA 4G0UA 3JYLA 3G82C 1OR8A 3RVKA 1H8ED 5K0JA 4O2AF 4FNMA 3NPMA 4QDUA 2M6KA 3G49A 2D7CA 4ZODA 4IRXA 2W6QA 4I50A 4TZ0A 2RK3A 3V55A 1JDBC 3E22A 3OCJA 4UQPA 5EHXA 3IP6A 3PC4A 2AK2A 3AJ9A 5EG5A 5EPEA 4LHZA 5HGXA 2DOKA 3D0QA 3OCWA 3A70A 1K5GA 3SE0A 4V3CA 4CMJA 3AW8A 3K0FB 1M8KA 3RCBA 3GCWA 3VR1A 4B3HA 1RNLA 4EW1A 2R7LA 2RAUA 5A9RA 1WW2A 1BG6A 2Z09A 3DEJA 3M3DA 3VKUA 1XDBA 2WFLB 1EWTA 4CQLB 3ZCQA 4HPJB 4YCNA 1XNJA 4FGWA 3ZVMA 4K9QA 2B5VA 1X3SA 1Q19A 2BZ1A 1Z0UA 3Q5GA 3JZMA 1QV9A 1TLTA 2XE6A 1UKEA 4FNGA 5IKEA 3MAGA 3KUCA 1A8QA 1G6OA 3LK6A 3OZWA 3UBTA 3QKRB 1WCIA 2BONA 4UHDA 5GMOA 4ZHQB 1GT91 4IGFA 3KSDO 2AJCA 3KU1A 3FOFC 2IYVA 4NAUA 3WXBA 4B5LA 1JEAA 3FF1A 4WXRA 5EMNA 4I6EA 3TZCA 3VYRB 4DXDA 4F71A 4MI3A 4DWVA 1W1IA 4P3NA 5TQ0B 1WCYA 3EH2A 1G5FA 5I51A 1PS9A 1G8KA 4G9GA 4J2TA 1VKRA 1YRWA 3BDIA 1PV4A 5D3KA 1RRGA 2XWBF 4UEWA 2O8CB 3LX8A 3GN2A 2Y92A 1RI5A 5BWCA 1KKLA 1Y3FE 2GEJA 4GPBA 4L8GA 2PMKA 4AMBA 4HCJA 4TXJA 3HCBA 5DLPA 3O21A 3HJGA 1N4AA 4LGMA 4XJVA 4KK4A 5TMDA 5FTWA 2YZGA 4GU5A 5EP3A 1SUSA 1TTQB 3MELA 2IXBA 4NZYA 4D4IA 5D8DA 1JYEA 4DGQA 1JSCA 2PX6A 3G5TA 4LXXA 1E2PA 3CWZA 4U02A 5HZHA 1MC4A 3CYFA 3CUVA 3G0OA 5CD9A 1TCUA 3BILA 1YQQA 2ZJ3A 3BZWA 3GZNA 1YJQA 3E61A 4D9EA 1NVXQ 3PNLA 1KQGA 3WDSA 3CXUA 1Y4ZA 2QJRA 3E9QA 1KR2A 2OD2A 3HB1A 4M1KA 2Q9CA 5F51A 1M2WA 2C2HA 3FCUB 2VC2B 5SYMA 3T9CA 4A2WA 1YOVA 3F98A 1YRAA 1BQ4A 4Q1CA 2I7VA 1EBBA 3I3SR 4X1YB 2YHSA 3SR3A 1V4VA 2A5DA 1GSAA 1FXUA 3AB8A 3A04A 5KQGA 5GJVC 1GG8A 5KOIA 3HKCB 2H0RA 4A2PA 2FSVC 2DMRA 3EFBA 4LCBA 4LRQA 4TMFA 3RVNA 4OB6A 4W4TA 1KFCB 4ZT7A 3THOA 1LBHA 3GUVA 3KAKA 3UMSA 2QTMA 1U2RA 4K9PA 2K7FA 4KC0A 2BTEA 2RBEA 3EGXA 3AY0A 1MFZA 2RKWA 3UT5A 4Q9AA 1E4YA 2Z83A 4M0CA 5B55A 1FU4A 3ZQJA 4AAYA 3H83A 5FBVB 5CUQA 1TJ4A 3KQQA 4JX9A 4LOHA 2YBDA 4RK1A 2D0OB 2G09A 1YAJA 2TYSB 2X1HA 5D87A 3W6ZA 2HY7A 4HUQB 2RH8A 4PN3A 3R8CA 5GAJA 3MHPA 5AKXA 5KKNB 3KR2A 1V5IA 1J2RA 3A9CA 3DL2A 3DMNA 1A69A 4IQ0A 4C2AA 4F4IA 3OZSA 1YQGA 3P96A 1CE8A 3LP6A 4O0MA 2ZR9A 3WGIA 3FSJX 1DAMA 1P73A 2KB0A 5FPSA 1XRLA 1D2HA 4BOYA 2CKDA 3INGA 5C31A 4C78A 1ODKA 1RIFA 1VHWA 4TTRA 5EWLA 4DYHA 3VJLA 2OCGA 2VHJA 1N78A 1S9DA 3ZWOA 4RDXA 1KI6B 3MPOA 5AW7A 2QJTA 3EODA 4B4VA 4EQ6A 4DBLE 1E1MA 2L82A 4DN6A 3ZD7A 5AW5A 3PQDA 1JG7A 1G3MA 1TUGA 4Y1RA 2XUFA 5FUWA 3ABRB 3FBGA 2BFMA 4FFOA 3Q7SA 5HILA 4B83A 3QLUC 4B81A 2I6XA 3PGA1 3AWDA 1ODJA 3E03A 1N2GA 4JQOA 2XAUA 3H5OA 4RSMA 4EY6A 1FTGA 3DUFA 4N9QA 3ER9A 2BMEA 2JFOA 3LNTA 1UKYA 4P3YA 5JADA 2ZZNA 2LNDA 1JEQA 1ZBDA 3ZI7A 5L9AA 3A4LA 3L9WA 4AJLA 4F6RB 3C7DB 1ZD8A 2EJBA 2OSBA 4B3BA 2WHXA 3K6RA 4XIIA 2COUA 1TJ5A 2UYQA 3Q3GE 4RHFA 4ZEOA 4CEHB 3I58A 4FW9A 2EAUA 2VK8A 3ZXXA 3RYTC 1IK4A 2GBCA 3IP9A 3Q85A 3QKWA 5JXGA 5F52A 3STUA 1E18A 5HIKA 1DX6A 5IARA 5ALEA 3DAHA 1C3EA 3C6YA 3DFMA 1USIA 4GR4A 3VR2D 1W96A 1MENA 3G6WA 4GWKA 4TYQA 3LGSA 4BRZA 4R1PA 2E4VA 3P0IA 4YRTA 4EFNA 1FFXA 1E3TA 3AUXA 4NSNA 3HMQA 4AKIA 2B8EA 1W49A 1PVDA 2JGNA 3EPRA 3EA0A 3OM0A 3VPFA 4Z9BA 1SEPA 1WB5A 1GILA 2AZTA 2BUAA 5SV2A 4P98A 4P35A 5HMMA 4B6SA 4B0PA 2FEWB 3ZK8A 2MHCA 2TRSB 2V6IA 2CHVA 4U63A 1AA6A 3GL9A 3D31A 4XQ0A 2JAOA 2PGLA 1FTSA 1M1YA 4FUQA 1XELA 1JL3A 1O5OA 2CLMB 2QZ9A 2MSNA 2YRFA 3A7DA 2ZYSA 1D1TA 1YS7A 2B30A 5FBLB 5JHHB 2Q7OE 1QH8A 3RVMA 2OGZA 4JOQA 1W8IA 1HFEL 4ZYZA 1JR6A 2IC5A 3NXSA 1NXXA 1T36B 2PKQO 1MDBA 3TTYA 1E7MA 1KSHA 3A6EA 3ADDA 5LOVA 4ZJYA 4F2WA 3H8JA 2REQB 4MCHA 3ZKAA 2H52A 1PGOA 1PJSA 1EM8B 1V9SA 4GMGA 1XQXA 2Q3CA 4UZSA 3UMJA 3EOAI 3AU9A 1GTJ1 5C1BA 3FUUA 4LE2A 4R41A 3KXIA 3QG1A 1ENOA 2HAEA 3BD8A 3HJHA 4ZV9A 3EUFA 3OHPA 4C20A 2RJ3A 3R0VA 1UQTA 4FYIA 3RAPR 4G1EB 3O8LA 2QS9A 2YZMA 4V38A 4QGHA 3BWXA 3PJEA 3KLPX 2O8VA 2OCKA 4H7JA 4E30A 1T43A 3C5EA 5KTKA 1GU1A 4QL3A 1KS2A 1BCRA 1NE7A 3QPCA 4O1HA 1UZLA 1NW5A 1A7KA 4HATA 4IJKA 1UC4B 4GE0A 5A5EA 1V5WA 4RF4A 5IJ9B 1LB1B 3F6YA 1RZUA 3FLAA 3ICWA 2KE5A 1E1KA 3WLRA 4BVBA 3QOWA 1HLGA 3L7OA 2J5RA 3PXCX 1AMOA 3U7GA 3DV0A 4V0MA 1GM5A 2N47A 3F90A 3RV3A 3RABA 3VU0A 3C14C 4BLVA 3K3PA 3C6KA 4XGQA 1DDOA 1IOZA 3FUVA 3ZWPA 3HN6A 2WQ7A 3P9QA 4PNZA 1XU7A 2LP4Y 3IKLA 1K63A 3OJWA 3NH9A 4ZARA 3NYWA 1V16A 3KB2A 5KOHA 1I01A 1KZ1A 1ACLA 2HF9A 3IT1A 4GOOD 1GZ6A 3SICE 3JQBA 3ZQ6A 3KD3A 4QC2A 1BMQA 4YIHA 1NDUA 3KOZA 1ZM7A 1ULUA 3A58B 3N2KB 3VKFA 3GFVA 4IZIA 5DCYA 5DHFA 2GLTA 4FKZA 3UJCA 1WTCA 4QUBA 4XM0A 5BV0A 1PT6A 4V1CA 1HG1A 1G3RA 3D6JA 3F5DA 5BNIA 1OH7A 1Y1LA 3E58A 3V8RA 1FX0B 2DT8A 2P5YA 1JGTA 1O7JA 3WLLA 5JRJA 1COWA 1GRVA 1I7QB 1X13A 3RTDA 2BGUA 3B6KA 1DQYA 3MGKA 1KFEB 2L69A 1RABA 1U7ZA 1WW3A 3FETA 2QJOA 3DOHA 3FVWA 5BR4A 3T1VA 2J08A 5IG2A 4C4YA 4YAJA 3PQ7A 3U2QA 5TR9A 3FMVA 4PE5B 2HWWA 4BV8A 4CM8A 1JQEA 4NYIQ 3OQOA 1P2FA 3WLTA 1CIVA 1QOPB 2BSXA 2Y0DA 3ICQB 3SFTA 4K6KA 3IT2A 1YSCA 3OTQA 5LP6C 3R8FA 2RHGB 3VKVA 3OT4A 4HI0E 1PWXA 2WD7B 1H3EA 4TS1A 4KOEC 3KOOA 2YVLA 4BYMA 1EK0A 3IBCA 4KFSA 1EJBA 4HAVA 1JQAA 3B5JA 1C3XA 3Q8WA 3K71B 3TH5A 2PJUA 4CTJA 3D5QA 4CXMA 4DREA 2ZJ0A 1ILWA 3PRHA 1TD9A 5T6MA 3HJTA 2UAGA 2VDPB 1FFCA 1HM5A 2VCHA 5GINE 3HDVA 1MLDA 4X1IB 4HJRA 4E2FA 5FD8A 3JCZA 4L7VA 3WWYA 1OI4A 2P1DA 4MMXB 3C43A 3HEMA 1PFYA 2MTBA 1Q14A 4IQFA 4YDQA 1YS9A 3ZY4A 2FJ0A 4UFOA 3UO8B 4EG1A 4PHHA 3U6BA 4LRSB 4BVHA 1ZGZA 3H9BA 4FGJA 1CDEA 2QTNA 1G21E 4H7IA 4KQCA 1T2CA 2EWVA 1GFSA 1O6CA 4HP8A 1T5SA 1Z6TA 2W98A 3L0CA 2GPWA 3EWIA 3DKVA 2E0IA 4C06A 1WV1A 1XO1A 1U7WA 3DAFA 3OAAA 2ZI4A 3WRWA 4CI9A 1IK6A 4LOIA 3RUIA 4DUGD 3DS8A 3WBJA 3U7HB 1D8AA 1KI7A 4RA9A 1NLUA 1BCSA 3T7KA 1RP7A 1DJQA 1SVNA 2JKZA 5JSFA 4J4TA 3FPHA 1QXSA 3TF5A 2RD2A 3OPXA 4ITVA 2R4QA 4NG5A 1N2BA 3WLQA 1K7CA 3DEHA 1R27A 4PINA 2MOKA 4GDMA 4G1VA 3D0OA 4OUDA 5JH7A 1NUQA 1YBFA 2WJ6A 1CJBA 2X0KA 3EC7A 2XF2A 4AM8A 1W5FA 4EY8A 3PHIA 1L8XA 1H2EA 1DEXA 3ZCPA 2J5XA 5A3QA 2WF6A 5JBIA 4XIFA 4A2CA 1SR8A 4FYKA 3ET4A 3JQFA 3GLIA 5HQTA 2PX3A 4I9HA 4WNCA 2JAQA 3OPYI 4QFCA 4WVLA 2VT7A 4UHCA 2Z98A 4UDOA 1Q1ZA 2ZU6A 2WVHA 2KYRA 5DU2A 3FIUA 4MIKA 2ZETA 2WJJA 1RXYA 2FMTA 1GAWA 1NR7A 1RC8A 4R69A 1OZHA 1N0WA 3A3YA 1TLFA 2H2GA 2HK8A 2WMYA 3QU2A 3U5ZB 1D7OA 3FNFA 3OOSA 2HBZA 3WO0A 4Z1OA 5F23A 3ZDCA 5FLYA 2Y66A 4CM3A 5HRUA 1UMCB 2WVGA 4L78A 2XUOA 1RYBA 1XD2A 1RWXA 3R44A 2QLFA 1XXLA 3PKZA 4MULA 1ISPA 3O2NA 4Q4AB 4WNAA 4CM5A 4KPYA 2IXEA 5ENDA 3ZD6A 1EAMA 1OV4A 3GEGA 5C8DA 1G2PA 1V8DA 1W88A 5DYGA 2I29A 5HUHA 3AIIA 3GDOA 5DI3A 4S0ZA 5JO9A 6LDHA 4U7PB 2V1UA 1UWCA 1Z4PX 1NYTA 4GI2A 2YV3A 2EYQA 4V39A 3S1AA 1P8AA 2IHJA 4EF4A 4KEAA 4DQ0A 2ENWA 1ELOA 3OCXA 2B9VA 3VPCA 3M6WA 1GEGA 1YH3A 3H1PA 3IMEA 3TOCA 1M1NA 1NPYA 3F6CA 3SYMA 4DLAA 2QQGA 4O2BA 2FKNA 3DP9A 2UUAB 1WKBA 3TW0A 3T3DA 4NJMA 3FTNA 4C2TA 3TXAA 2J33A 1AMNA 1TVEA 2GD2A 4DLRA 3OF5A 4ATNA 3D4NA 1BZYA 4ENPA 2Y0CA 1H2RS 4RS4A 3P2KA 1JTEA 2V9ZA 3QU4A 2EQAA 5FBQB 5DLDA 1V2GA 1NHGA 2YVQA 1W76A 1ZSVA 4ETIA 4F5EA 2GN4A 3HBLA 1FDUA 2HADA 2PVPA 2Q2WA 4LZZA 4NK4A 5LP6B 1XHFA 1Z16A 4I1PA 4UE6A 1QNFA 2PCLA 1ECGA 5EMLA 2I87A 2G0TA 4D7AA 3AV0B 2RH5A 3QHPA 3QK7A 2A5JA 3O4GA 4O4IA 3KKEA 2EYUA 4R3UC 5ICSA 3Q2OA 3T1TA 1RVDA 1AHNA 5DYTA 5HDBB 3BH7A 3LUGA 5HKAA 1CYEA 1NN3A 1OILA 4QOIA 1PGJA 2WK1A 3A3PA 4Q9HA 2GUGA 4BNLA 3ND9A 3ZJ4A 1EZZA 1QPZA 3TCNA 2QVXX 2VF7A 4KQMA 4IIHA 2H1OA 4ZMSA 2B4TO 1B26A 2QT9A 2VNSA 3BYZA 3DVLA 2QN2A 3U3DA 5EIWA 3TUJC 4HAYA 2O0JA 4TL6A 1ZUNA 1ZCZA 2IDJA 5FBKA 1JAZA 1K7FB 4I1YA 3ND8A 3FYSA 1SU6A 4KN9S 2QE7A 4B8YA 2ANBA 2RAPA 3GIWA 3M6UA 3ON5A 3H2IA 4IJWA 4PGGA 4U2EA 2O4UX 1Z0DA 2FN3A 1NX9A 2BKUA 4YGXB 2C7PA 3VSCA 4ZREA 2C94A 5K01A 4B85A 4XCXA 3BF7A 1QHYA 1PW7A 5CT9A 3W5IA 4A8JC 1QP8A 1Q0RA 1N3LA 4LBWA 5ARDA 2WSSD 1S8AA 1JEDA 4PWYA 2B1GA 4TKUB 3ESRA 3EZ9A 3GGCA 3GGPA 3UA3A 1U0TA 3NG1A 1JH9A 2B2NA 1R74A 4FHCA 5BSHA 4HYYA 1JR2A 2XNHA 4PO8A 4FMBB 1EQ2A 2XA9A 3BMCA 3Q3IA 3H9GA 4MVWA 4ZVQA 2BGTA 3VO2A 1YWGO 4I8XA 4K9KA 3T8YA 2B4KA 4MTLA 3RIMA 6ABPA 1QV6A 3FCYA 1ZGCA 2FE1A 1LJLA 1WAMA 3BCUA 3Q5EA 2WNIA 4ZQFA 4MRNA 3OOHA 5EJMA 3MTDA 1W9MA 3VI4B 3VNAA 4UEJA 2R87A 3LT1A 2H2AA