2GF5A

Structure of intact fadd (mort1)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
191
structure length
191
Chain Sequence
SDPFLVLLHSVSSSLSSSELTELKYLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of FADD and Its Mode of Interaction with Procaspase-8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords FADD protein
total genus 66
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
A PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2gf5A02
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2gf5A01
2OF5A 2N83A 3QF2A 2KM6A 2L6AA 4E9MA 2BBZA 1CY5A 1UCPA 2VGQA 4RHWA 4DWNA 2BBRA 2N7ZA 2LS7A 4N1KA 1NGRA 1A1WA 3LQRA 4A2WA 3YGSP 2M5VA 4O7QA 4M9XA 2YU0A 4QOBA 1YGOA 2HM2Q 4I16A 2LWDA 4RHWE 4N1JA 2D96A 4N1LA 4F42A 1C15A 1N3KA 4NQKA 4P4HI 3J6JA 2G7RA 2GF5A 1A1ZA 2OF5H 2L9MA 2N97A 2YGSA 2YQFA 1DDFA 1E3YA 2N80A 3MOPK 3EZQA 4IZ5E 1Z6TA 2YVIA 1ICHA 2DO9A 4JUPA 4M9ZA 1WXPA 4D8OA 2O71A 1WMGA 2DBGA 2DBFA 1D2ZA 4UZ0A 2F1SA 4IZ7B 2N1FA 2B1WA 4M9SA 4JQWA 2NSNA 3MOPA 4ZBWA 2MB9A 4O6XA 2IB1A 2LWEA 2NAQA 1D2ZB 2N00A 4P4HA 3MOPG 3YGSC 1E41A 3LQQA 2A5YB 4O9FA 4FH0A 3EZQB 2DBDA 3KATA 3T6PA 4EWIA 2MN4A 3J63A 2MS7A 3CRDA 2MPCA 1FADA 3CL3A 4IZAB 2NZ7A 2DBHA 2MS8A 4A2QA 1WH4A 4LWDA 2A9IA 1CWWA 2P1HA 4O9LA 2KN6A 1DGNA 1PN5A 4F44A
chains in the Genus database with same CATH superfamily
2OF5A 2N83A 3QF2A 2KM6A 2L6AA 4E9MA 2BBZA 1CY5A 1UCPA 2VGQA 4RHWA 4DWNA 2BBRA 2N7ZA 2LS7A 4N1KA 1NGRA 1A1WA 3LQRA 4A2WA 3YGSP 2M5VA 4O7QA 4M9XA 2YU0A 4QOBA 1YGOA 2HM2Q 4I16A 2LWDA 4RHWE 4N1JA 2D96A 4N1LA 4F42A 1C15A 1N3KA 4NQKA 4P4HI 3J6JA 2G7RA 2GF5A 1A1ZA 2OF5H 2L9MA 2N97A 2YGSA 2YQFA 1DDFA 1E3YA 2N80A 3MOPK 3EZQA 4IZ5E 1Z6TA 2YVIA 1ICHA 2DO9A 4JUPA 4M9ZA 1WXPA 4D8OA 2O71A 1WMGA 2DBGA 2DBFA 1D2ZA 4UZ0A 2F1SA 4IZ7B 2N1FA 2B1WA 4M9SA 4JQWA 2NSNA 3MOPA 4ZBWA 2MB9A 4O6XA 2IB1A 2LWEA 2NAQA 1D2ZB 2N00A 4P4HA 3MOPG 3YGSC 1E41A 3LQQA 2A5YB 4O9FA 4FH0A 3EZQB 2DBDA 3KATA 3T6PA 4EWIA 2MN4A 3J63A 2MS7A 2MJMA 2MPCA 3CRDA 1FADA 3CL3A 4IZAB 2NZ7A 2DBHA 2MS8A 4A2QA 1WH4A 4LWDA 2A9IA 2XV9A 1CWWA 2P1HA 4O9LA 2KN6A 1DGNA 1PN5A 4F44A
chains in the Genus database with same CATH topology
2OF5A 2N83A 3QF2A 2KM6A 2L6AA 4E9MA 2BBZA 1CY5A 1UCPA 2VGQA 4RHWA 4DWNA 2BBRA 2N7ZA 2LS7A 4N1KA 1NGRA 1A1WA 3LQRA 4A2WA 3YGSP 2M5VA 4O7QA 4M9XA 2YU0A 4QOBA 1YGOA 2HM2Q 4I16A 2LWDA 4RHWE 4N1JA 2D96A 4N1LA 4F42A 1C15A 1N3KA 4NQKA 4P4HI 3J6JA 2G7RA 2GF5A 1A1ZA 2OF5H 2L9MA 2N97A 2YGSA 2YQFA 1DDFA 1E3YA 2N80A 3MOPK 3EZQA 4IZ5E 1Z6TA 2YVIA 1ICHA 2DO9A 4JUPA 4M9ZA 1WXPA 4D8OA 2O71A 1WMGA 2DBGA 2DBFA 1D2ZA 4UZ0A 2F1SA 4IZ7B 2N1FA 2B1WA 4M9SA 4JQWA 2NSNA 3MOPA 4ZBWA 2MB9A 4O6XA 2IB1A 2LWEA 2NAQA 1D2ZB 2N00A 4P4HA 3MOPG 3YGSC 1E41A 3LQQA 2A5YB 4O9FA 4FH0A 3EZQB 2DBDA 3KATA 3T6PA 4EWIA 2MN4A 3J63A 2MS7A 2MJMA 2MPCA 3CRDA 1FADA 3CL3A 4IZAB 2NZ7A 2DBHA 2MS8A 4A2QA 1WH4A 4LWDA 2A9IA 2XV9A 1CWWA 2P1HA 4O9LA 2KN6A 1DGNA 1PN5A 4F44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF5 A;  2N83 A;  3QF2 A;  2KM6 A;  2L6A A;  4E9M A;  2BBZ A;  1CY5 A;  1UCP A;  2VGQ A;  4RHW A;  4DWN A;  2BBR A;  2N7Z A;  2LS7 A;  4N1K A;  1NGR A;  1A1W A;  3LQR A;  4A2W A;  3YGS P;  2M5V A;  4O7Q A;  4M9X A;  2YU0 A;  4QOB A;  1YGO A;  2HM2 Q;  4I16 A;  2LWD A;  4RHW E;  4N1J A;  2D96 A;  4N1L A;  4F42 A;  1C15 A;  1N3K A;  4NQK A;  4P4H I;  3J6J A;  2G7R A;  2GF5 A;  1A1Z A;  2OF5 H;  2L9M A;  2N97 A;  2YGS A;  2YQF A;  1DDF A;  1E3Y A;  2N80 A;  3MOP K;  3EZQ A;  4IZ5 E;  1Z6T A;  2YVI A;  1ICH A;  2DO9 A;  4JUP A;  4M9Z A;  1WXP A;  4D8O A;  2O71 A;  1WMG A;  2DBG A;  2DBF A;  1D2Z A;  4UZ0 A;  2F1S A;  4IZ7 B;  2N1F A;  2B1W A;  4M9S A;  4JQW A;  2NSN A;  3MOP A;  4ZBW A;  2MB9 A;  4O6X A;  2IB1 A;  2LWE A;  2NAQ A;  1D2Z B;  2N00 A;  4P4H A;  3MOP G;  3YGS C;  1E41 A;  3LQQ A;  2A5Y B;  4O9F A;  4FH0 A;  3EZQ B;  2DBD A;  3KAT A;  3T6P A;  4EWI A;  2MN4 A;  3J63 A;  2MS7 A;  3CRD A;  2MPC A;  1FAD A;  3CL3 A;  4IZA B;  2NZ7 A;  2DBH A;  2MS8 A;  4A2Q A;  1WH4 A;  4LWD A;  2A9I A;  1CWW A;  2P1H A;  4O9L A;  2KN6 A;  1DGN A;  1PN5 A;  4F44 A; 
#chains in the Genus database with same CATH topology
 2OF5 A;  2N83 A;  3QF2 A;  2KM6 A;  2L6A A;  4E9M A;  2BBZ A;  1CY5 A;  1UCP A;  2VGQ A;  4RHW A;  4DWN A;  2BBR A;  2N7Z A;  2LS7 A;  4N1K A;  1NGR A;  1A1W A;  3LQR A;  4A2W A;  3YGS P;  2M5V A;  4O7Q A;  4M9X A;  2YU0 A;  4QOB A;  1YGO A;  2HM2 Q;  4I16 A;  2LWD A;  4RHW E;  4N1J A;  2D96 A;  4N1L A;  4F42 A;  1C15 A;  1N3K A;  4NQK A;  4P4H I;  3J6J A;  2G7R A;  2GF5 A;  1A1Z A;  2OF5 H;  2L9M A;  2N97 A;  2YGS A;  2YQF A;  1DDF A;  1E3Y A;  2N80 A;  3MOP K;  3EZQ A;  4IZ5 E;  1Z6T A;  2YVI A;  1ICH A;  2DO9 A;  4JUP A;  4M9Z A;  1WXP A;  4D8O A;  2O71 A;  1WMG A;  2DBG A;  2DBF A;  1D2Z A;  4UZ0 A;  2F1S A;  4IZ7 B;  2N1F A;  2B1W A;  4M9S A;  4JQW A;  2NSN A;  3MOP A;  4ZBW A;  2MB9 A;  4O6X A;  2IB1 A;  2LWE A;  2NAQ A;  1D2Z B;  2N00 A;  4P4H A;  3MOP G;  3YGS C;  1E41 A;  3LQQ A;  2A5Y B;  4O9F A;  4FH0 A;  3EZQ B;  2DBD A;  3KAT A;  3T6P A;  4EWI A;  2MN4 A;  3J63 A;  2MS7 A;  2MJM A;  2MPC A;  3CRD A;  1FAD A;  3CL3 A;  4IZA B;  2NZ7 A;  2DBH A;  2MS8 A;  4A2Q A;  1WH4 A;  4LWD A;  2A9I A;  2XV9 A;  1CWW A;  2P1H A;  4O9L A;  2KN6 A;  1DGN A;  1PN5 A;  4F44 A; 
#chains in the Genus database with same CATH homology
 2OF5 A;  2N83 A;  3QF2 A;  2KM6 A;  2L6A A;  4E9M A;  2BBZ A;  1CY5 A;  1UCP A;  2VGQ A;  4RHW A;  4DWN A;  2BBR A;  2N7Z A;  2LS7 A;  4N1K A;  1NGR A;  1A1W A;  3LQR A;  4A2W A;  3YGS P;  2M5V A;  4O7Q A;  4M9X A;  2YU0 A;  4QOB A;  1YGO A;  2HM2 Q;  4I16 A;  2LWD A;  4RHW E;  4N1J A;  2D96 A;  4N1L A;  4F42 A;  1C15 A;  1N3K A;  4NQK A;  4P4H I;  3J6J A;  2G7R A;  2GF5 A;  1A1Z A;  2OF5 H;  2L9M A;  2N97 A;  2YGS A;  2YQF A;  1DDF A;  1E3Y A;  2N80 A;  3MOP K;  3EZQ A;  4IZ5 E;  1Z6T A;  2YVI A;  1ICH A;  2DO9 A;  4JUP A;  4M9Z A;  1WXP A;  4D8O A;  2O71 A;  1WMG A;  2DBG A;  2DBF A;  1D2Z A;  4UZ0 A;  2F1S A;  4IZ7 B;  2N1F A;  2B1W A;  4M9S A;  4JQW A;  2NSN A;  3MOP A;  4ZBW A;  2MB9 A;  4O6X A;  2IB1 A;  2LWE A;  2NAQ A;  1D2Z B;  2N00 A;  4P4H A;  3MOP G;  3YGS C;  1E41 A;  3LQQ A;  2A5Y B;  4O9F A;  4FH0 A;  3EZQ B;  2DBD A;  3KAT A;  3T6P A;  4EWI A;  2MN4 A;  3J63 A;  2MS7 A;  2MJM A;  2MPC A;  3CRD A;  1FAD A;  3CL3 A;  4IZA B;  2NZ7 A;  2DBH A;  2MS8 A;  4A2Q A;  1WH4 A;  4LWD A;  2A9I A;  2XV9 A;  1CWW A;  2P1H A;  4O9L A;  2KN6 A;  1DGN A;  1PN5 A;  4F44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...