2GFBB

Crystal structure of a catalytic fab having esterase-like activity
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
b'DVKLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARGDYYGSRGAYWGQGTLVTVSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A CNJ206 FAB (LIGHT CHAIN)
publication title Crystal structure of a catalytic antibody Fab with esterase-like activity.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 41
structure length 219
sequence length 219
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 1994-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gfbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gfbB01
2HJKB 5FDYA 3WS3B 4KC3B 2DDQL 1TQBB 3J7HA 2BVOA 4NSKA 2CLRA 3L3GB 1U8KB 1YNLL 5I1EH 5B21A 2QSCH 3TNNB 3B2UD 3H3PL 1MF2H 3T4YB 3GNMH 2DQIH 3P9LB 1OSPH 1JK8A 4EUPH 3SBWC 1TQBC 1T83A 3CUPA 3P4OB 1MCKA 4NN5B 4OTXL 3V0AC 3MGTA 3L7EA 4HD9A 2XFXA 1MCSA 3N06B 3UTQB 3QPXL 2A6KA 3BKMH 2DQUH 4GRLB 1ZGLP 3MROA 1WISA 2E9JA 3D3VB 1ZLSL 2VDOH 2CKBH 2P4AB 4DW2L 2AEQH 5E70A 1GVIA 4NN5C 4OLWL 1FFPB 1X5GA 2BRQA 1EZVY 5EOTA 2YPKA 1AXIB 3Q5TA 3BEWB 3ZSSA 3CXHK 4XNYL 1HKFA 4GRLC 4KJQC 3BIKB 3TNMB 5ITBH 4JZJB 1NC4D 1BGXH 1PAMA 1UC6A 5T1LB 4HT1L 1P4BH 2P5WB 3T0ED 1DEEB 4C55A 4NQEB 5JHDD 2W59A 4NZRH 4RAHA 1UEYA 3QIBA 1IGTA 3LD8B 4IHOA 4K3JH 5JQHC 5BCAA 4GRWF 2YPLB 4K7PH 2BMKB 3MODL 1BFTA 3T1FB 4JZJC 3TYFB 2Z92A 5JLZA 3OAYK 1QBML 3MPCA 5IEHB 1A6WH 3CX5J 2ITDA 3LD8C 5IVNA 3M1BB 3JWNC 3F58H 4HUKB 4M8QA 5LWYH 5TDNA 2BC4A 2WWKO 3J8F7 1UJ3B 4F37F 2DAVA 4TRPH 3PWVA 3WFDH 4ODTL 1N0XL 1XGTA 1JYWA 3V6ZA 3ZDYF 2CDFA 1R0AH 1WAAE 3RZWA 4KV5F 2HMID 3G08B 1I7TA 2HRPH 4WU5A 2GK0B 1DLHA 4ZQKB 2DQFB 3EDKA 4PJFB 2DWDB 3QIUA 2B1AL 4DFHA 3ARTA 5FYLE 5C0FB 1UJ3C 3CFJB 4JY6A 4OLXL 5DJZB 3UPAA 4BYHA 4EDXB 1ETZB 2F53B 1GIGL 2DLGA 5K9KA 4D0CB 2FIKA 4L1HA 3LSOB 5EU6E 3V6OA 3TIEA 3JV4A 3KGRA 3VXTB 3DX7A 3A67L 2CJUH 4LCCA 5JW5A 1NSNL 5EC2B 3UAJD 3K7UA 3G6JF 3NIGE 5JO5A 5B39A 2O5XL 4UV7H 1HDMA 1U8PA 4HV8A 2OMNA 4QRRE 2H3NB 4WTWA 4DQOL 2E6JA 1AP2A 4K8RH 2BNRA 4NHCL 3SGEI 4Y5YB 2DB8A 4YHIB 5D7KD 5BV7L 1V3KA 3VFRB 2Q76B 1FG2A 2OTWB 3NCMA 1JL8A 3PP4H 2P8MA 5IK3B 2HKHH 3CSGA 3I6KA 1AIFB 5CFHA 4WU7A 1YEKL 2YEZB 2IG2L 3ULVC 4PJAE 3FQRB 5CGYC 1AGEB 1VENA 1NFDE 1G6RH 1PG7H 1QLEH 5DYOB 1H15B 1HSAB 4Y5YC 3QEQA 4MCZB 3X12A 4LU5L 2F5AL 4KDTA 2W60A 2MCPL 3DSNA 4HCRL 1ZMYA 4XAWH 2CRIA 4D9QE 1D9KB 5GGTH 1R24A 2ICWB 2C1OA 1LEKB 1WBYA 2CGRL 1FJ1A 5CZKA 3LS4L 5I1HL 1ZHKA 4PREB 1XCTB 4LF3A 1OHQA 3SDCB 1JWMB 3FB7B 5KVEL 1D9KC 4BFIB 3MNZA 5DEFA 4P46B 1YEEL 2AJXH 1EAPB 3RKPA 1F2QA 3MV7E 3RVWD 2AERT 4HC1L 3QXDA 5F7NC 3UTZB 4UB0H 3SDCC 2VSCA 4JO1H 1R5WA 1BM3L 2X9WA 3I3DA 3V5KA 2UY6A 1T0NB 4P46C 1A8JH 5I18H 3QWOB 4RAUA 2XACC 5EZJB 1RZGA 4XPBL 4OCXH 1CTNA 2OSLA 3NABL 1FVCA 1INDL 4M5YH 1MQKH 1DUYB 4OZHA 4LHQB 4H25B 3MLWL 4P4KA 4HFUH 1SJHB 4RGNE 5BRZB 1MNUH 5C08E 1ZGLM 1SYSA 4EKXA 4NM8H 4WFGD 2AQ1A 5D7IE 5JR1L 1OTSD 3FAWA 3LEVH 2Y36L 3QCVL 2M26A 1AY1H 3SGDI 2IH3A 5ECJE 1EIBA 2IQAA 3IJYB 4G8GA 4YE4H 2VL5A 4FQXA 2J6EA 1IQDA 4GQPH 2BCKA 3SDXE 2WIIB 3F6LA 1ORSA 3BKCL 1JF1B 3QNZB 3SQOL 2HFFA 4QRSA 1E4XH 1H0DB 2DQDL 1ZA6A 2WQRA 5C6WH 2O61A 4LK4A 4R4FH 3ROOA 2FX8L 2VDKH 1CFSB 3BI9X 1KENH 4O9HH 4LHUG 2VLJB 3FRUA 2V6HA 5DEZA 5I2IA 5KG9A 4FFWD 5JOEA 3U0TA 1T2XA 3HNVH 4Z95H 4GG6B 4LSQH 4KVNH 5E1AA 3IJHA 4OD1H 1KLUA 1UM6L 4XMPH 2PXYB 4CADA 5ACZA 1NCDL 4OD2B 1T66D 4G6MH 1OT2A 4ZFGH 2DBLH 2VC2H 1MFNA 1U6AL 3O6FB 4ZUSA 5GGSY 3MOBL 1FZMA 1UFUA 2I60H 2PXYC 4H88H 3IXAA 1OOAA 4LIQE 3VFOA 2EDLA 3GJEA 2FX7H 4YXLH 4X9HA 3LH2L 2QHLA 3O6FC 1TZHB 1XGYL 1OSPL 3KR3H 5M7QA 4ZDHB 4HQQH 4NKOA 4QRUA 1UVQB 3ZMRA 1I7RA 1N6UA 4X9IA 1QFOA 3LPWA 2FZ3A 2KQMA 1PY4A 5I8EB 2ZCHH 2D4DA 3DUSA 1ITCA 3PGFL 3RHWF 4M7KL 1OAXH 4AIZB 1QLRB 3B6SB 1L7TL 1RZKH 3QG7L 3FMGH 1MHEA 3IDGB 4OIIH 5E5UB 4PRDA 3VXUB 4M6OH 3QDJA 3AC0A 1YECH 5D1QB 3CFKA 4X6DA 1AI1L 5FUCE 3RQ3A 1UWXK 3MREB 3Q1SL 4KH2A 1JPTL 4BQCA 1T0MA 4QOKA 2OJEA 2PR4H 4NQVB 3SO3B 3VJ6B 3B5TA 1AXTH 4XCCL 1ZT7A 1YYLL 4HULB 1SY6H 4UV4L 5CGTA 1LE5A 5EU7E 5D1QC 5IP4A 4YBHA 5J11B 5T5FL 4U0QB 1OD7A 5F96L 4C83A 5GS1A 4P9HL 1C16B 4WW1A 2WNGA 3SO3C 1U91A 5I71B 1A6WL 2FHBA 1XAUA 1A5FH 4HX1A 5DHVH 1Q0XH 1EX0A 5J11C 3HPJA 2X6MA 4I3SL 5JNYA 4X8JA 5L2KA 3IXTA 4XBGB 3VD9A 5I71C 4LSPH 4FMFA 2APBA 1S7WA 4UBDC 1R3IH 1Q9KB 1EHLH 3B9KB 1A6AB 1RURL 1D6VL 4XPGH 1AE6L 2HLFC 1REIA 1K8DB 5CCKL 1Z3GL 3B9KC 4UINL 1KFAH 3D6GA 1WZKA 3T8XA 2UWEB 2AK4B 1OAQH 5CSZA 3U9PH 1CU4L 3D87B 5IB4A 4WW2B 4MNQB 1YUHB 2UUDH 2VLKB 3ALPA 4NJ9L 5D7LE 2XA3A 4MDJB 4MWFA 5E9DA 1KCUH 2P44B 1RZJL 5IQ9A 2C4FT 2F54B 2IANA 1KTDA 4E42B 3T2NL 1FG9C 4WW2C 1N59B 2DD8L 4M7JL 4L4TB 4FXGA 1L0QA 5T3ZE 3MLRL 4OD3H 1KULA 1V05A 4FQIH 3DO3A 4XVSL 3D48R 3KPSD 5MHSE 1BFOB 1TFHA 2ESVB 4PJ9D 4XBEH 4OZIE 3V79C 1MUJA 2EH7L 4N9GA 2XYCA 4JN1H 4HS3A 1SEBB 3T0DA 5J6HA 2V2TB 1IC7H 4XC1H 2KQNA 5FO8B 3VD3A 2ADGA 3VXSE 4X6EB 4QF1A 1K4DA 2JF1A 2EDTA 1U36A 1OAKH 5EZIH 1BOYA 3IB4A 1U8JA 3D85D 4KK9C 1FAIL 2HT3C 5L2JB 3EO1A 1CVSC 3WNLA 5E0QA 3NFNA 4KROD 5I1GH 5TDOA 4OUUB 1N7ML 2XN9B 3WHXB 1RJZA 3OTTA 3BAEH 1KN4L 5IM7B 2OI9B 5EUOE 2AJXL 2GJ6A 1JHKL 5LGKA 3FQXA 4JGUA 1CDJA 3EO9H 12E8L 4ZFZA 3FT4A 1OL0A 2DLTA 2PTUA 4N0UE 4JO1L 3G5VB 3TO4A 5JXAH 2OI9C 1E6OH 3ECBB 4K7FA 5EBMB 4LCUA 3DO7A 1ZWIB 4LSUH 1SM3H 2I9LA 1BZ9B 1MI5E 1FNEB 4F3FA 4AH2A 2BP3A 2XXCB 1QFUH 5HGBB 1CFQB 1RIVL 2A1WH 4PP1C 1LNUA 2Y9RT 2OZ4H 4KKBC 3FHQA 3BP7B 3L5XH 1A7RL 1MLCB 3KWWB 4KGJA 4RA0C 1PKQA 5DMIH 1QR1B 1JNLL 1YA5A 2VZOA 4R0LA 2YWYA 4OLZL 3UTTD 2VKWA 1UYWH 1Z6JT 1L0XA 4NQCA 5D5MB 4QRPD 5AZEH 4HC1A 3MYJA 4GT7A 2I07B 3NIFE 1NGXB 1KIPA 1FRGH 4NC0B 4NUJB 1IGFL 1AGFA 3KXFA 5C0ND 4XH2B 3KHQA 4I77H 4NZTH 2W0LA 3LN9A 1YPZA 3I75B 4FFYL 3IGAB 5JMOC 4OLUL 2VISB 3C09B 2CRMA 2X9XA 1ZANH 4W6WB 3GSXB 4H5SB 4L8SB 4JFZH 1OW0C 2XZZA 1DQLL 1DZBA 2QADB 1UXSB 1HQRB 3VI4E 1SBBA 2Q8AH 3WUWB 4JKKA 2CSPA 5F88B 5HGAA 3VG0H 3C09C 2CLVA 4QYOB 1A3QA 3B8SA 4B50A 3BQUA 3QDHA 4L8SC 3RTQB 4LGRB 5FYKD 2QADC 3ZO0A 3EYVB 1JGVH 2EDXA 1X4ZA 5F9OL 3Q6GL 4AMKL 4YBQD 3ARBB 2I26N 5J6GA 3CJJA 4CBPA 4RBPH 3MFFA 5JDSA 3SKMB 1A1OA 1DN0B 3RTQC 4N0YH 4ODHH 5FYJH 1GGTA 3CZJA 3OR7B 4S1QL 5T3XL 1OP3H 2AKRA 3MLXH 1VFAA 5T1DH 3FB5A 2XTJB 4Y1AB 2A0LC 3NCJH 3TJHC 3ARBC 1X5KA 2G75B 5TE7H 2ZCHL 3W9DA 3F7VB 3V6BR 5EU5A 1T1YA 1WJ3A 3P0VL 4WI7A 5JW4N 4Y19E 1GZQB 2XTJC 1G7PA 5C6PB 5GSRB 5K9QG 5JPMB 5C0AB 1GGUA 1HHHA 3HC0A 1OM3L 1YEGH 3MV8A 1TDQA 3MRNA 3UPRA 4JKLA 4CW1A 3D39A 1IAKB 2HH0L 4OFDA 1GGCH 2BX5A 2EDFA 2P5EB 4KJYB 4K55A 5H8DA 2Q87A 4LPVA 3S37H 5KW9H 1RK1B 3PWNA 2BY1A 4Q6IB 4UILL 1ND0B 2W92A 4XGZA 4P2RB 5KSAB 3VFMA 5D70L 1WF5A 4HIEB 4WNQB 4Y4FB 4NO0B 5H37H 2ICWJ 1J88A 3HR5A 1S7XA 4JHAL 3MRQB 4PRIA 5AEAA 3TWCH 3VE0B 2PCPA 4FA8A 3F12B 4Q6IC 4Z76B 5KSAC 4PS4L 5EOCJ 2X1PA 4FTVD 1IKNC 4J3VA 3HUJB 4ZO6A 4FQ2L 1FNGA 1CL7H 4Y4FC 3ULSA 3IFOA 2VKXA 4LOUD 1DP0A 5DUPL 3MV9A 2DL9A 3LY6A 2ZUQB 1RJCA 3FQUA 4JFHE 4QWWC 2P7TA 1XIWB 1KELL 5GGRA 2VDLL 1Q9LA 3BPCA 1ES0B 1KXTB 3PWLA 5CMAA 1DVFB 4G6AC 4XP1L 1KJ2H 1HHIA 1QO3B 3GUTB 4XPAH 4YLQT 1XIWC 3PV7A 3TZVB 3D0LB 5CEZL 3Q5OA 2FEDD 1DEDA 5H2BB 4WIQA 5CJBA 4ODVH 3QJHB 4YGAB 3OKKA 2XZCL 3QRGL 1KB9K 3QUXA 4YNYA 5J3HD 5CEXA 2CDEB 4Q0XH 1Q1JL 1DVFC 4HLZG 4PG9A 3TZVC 3I6LE 3OKOA 1DLFL 3SPVB 5F8RC 4OFIA 4UUJA 4J4PC 3ZE2F 1JF6A 4OM0H 4JFED 3S36L 4IDJL 3RDTA 2BNQD 2O5ZL 4KK5D 5E8PA 1LHZA 1EVUA 4IRJB 3T08A 3FOMA 2OTUB 4OGYL 5DR5H 3ARVA 4PRPB 1FGNH 3O8XB 4GW5B 2ZSVB 1B6UA 4G6KH 5ERWA 3RGHA 1NMAH 4GXUM 3UZQA 2AXHA 4IRJC 3SDDB 5GHWH 1CLYL 3L95B 1LGVA 5EC1A 1KIQB 2KUTA 2X4PB 4POUB 1XEDA 3A0OA 2A6JA 5GGUB 3V95A 4ELMF 4G9FD 2X44D 2HFEB 3VXOB 3O8XC 1FLRH 1MOEA 5E99L 2L0DA 1Z9SA 1I1AA 3F6IA 3X3FH 3SDDC 3QYCA 2N7AA 4PJIE 5I16A 4QGYA 3WMSA 5DA4A 1G7JA 4OZGE 1T1WB 4XPFL 3OHXA 4WTZA 3BGMA 5AUMA 3T3PF 5J1TC 5HHNB 3UTSA 4HAGA 4YX2L 2NR6D 5TQ0L 3P0YH 2W9DL 3WN5A 1HK6A 3IFNH 1U3ZA 2VDQH 3IJSB 1Q9OA 4TNVF 1RI8A 3RY6C 4X80H 3FO2B 3GKWL 3Q48A 2V5MA 3BESR 2ARJB 5HGDB 2NXZB 1UA6H 3KYKH 4HWNA 5FO9A 3ROLA 1DBAL 3O2VH 3S97C 2NZ9C 5T5NF 1FC2D 5I8OH 2LQRA 3OB8A 3QDGA 3LKQA 4LSVL 4WUUB 2MWCA 3DECA 2WV3A 5DK0B 4HGWB 4K94H 1FYTA 4U6YB 2NXZC 5AWNL 1YNTB 2J8HA 4PRHA 2F9BT 2V17H 1OGTA 3L3IA 5IF0B 3RI5F 3MACH 1F58L 1F97A 4NN6B 1IM9B 5IB3B 3QCUL 2QQLH 1I9JH 3GIZL 2DKUA 1IBGH 3HAEG 1YQVH 3GSVA 3OPZL 3PWJB 2NW3A 2VITA 5F70A 2DQGH 3MLUL 4BA8A 4NN6C 2OR9H 1PY9A 4GRLD 3MCLL 5C7XH 3GI8H 1S9WA 3D3VD 1M7IA 5E03A 4XZUB 1VFBB 1QRND 4UOJA 1F4HA 2PYEA 4OKVA 1EO8L 1B88A 4D9RD 3S9DB 4XNMA 2OTPA 4JGJA 1B2WH 4PGEB 3IS1X 4NUGL 4G6FB 3FQNA 3I2CH 3V52L 3E6FA 4UNTA 3VWKB 2DQJH 3QXAB 3BZFA 4BK4A 1ZEAH 5T1LD 2P5WD 5KSBB 4NQED 1BAFL 4YHPB 4U6HA 5HJ3B 2P8PA 1QQDA 3DX8A 1N3NB 3W2DL 2MPAL 4WEBL 3WSQL 1LO3H 3L6FB 5C0CA 1JV5A 1QSEB 2YPLD 3BDYH 4X5XB 3V2AR 4CMHB 1QLFB 5D8JL 3VWKC 5D1ZB 1G1YA 1A6TB 1P7QB 1N8ZA 2Y4SA 3DUUA 3LEXA 4ONOA 3HG1E 1BEYL 1U8MA 1XGRB 4KY1H 4JFXA 1HYRC 1FL3A 2EYTB 3QXVA 4MAYA 2NY0B 3KPRA 1FC1A 1RJYA 3MLTB 1JWSB 4LLQA 4CMHC 4GG8A 1EEYB 5D1ZC 1I75A 2YPVH 1NGZA 5CILL 4JANB 4NRZA 1HXMA 4PY7A 2A74B 2NY0C 3LQAL 2VXUL 5GXBB 3JTTA 4N0FA 1A02N 3GHEH 5K59E 2AJ3B 5FHBL 5DWUH 2F53D 1J1PL 3P30H 3MRJB 4PJEB 4E41A 4BSJA 2WLYA 3LCYA 1EBPA 4WO4B 1NUFA 4PY8J 1KGCD 4KKNA 5FGCE 4QT5A 3DIFB 3UBXI 4G3YL 4MXWL 1F45A 3DI3B 3OJVC 3MNVB 5INCB 4P3CH 4ZXBB 1E28A 5C8JB 2R56L 1AKJA 4LEXH 4WO4C 1J12A 3O81A 3MJ9H 1K8IB 1HKLH 4JLRA 1A1NB 3V6OE 5CGYD 3ULVD 2VIRA 2QKIA 2OYPA 3LKNA 5CJOH 2WUCL 3SDAB 1T7WA 1WIUA 4ZXBC 2OQJB 4MLIA 4DKAA 1CBVL 4J3UA 8FABB 1RMFL 2YXFA 5HSFA 3MRHB 5GS0H 4W6YB 5BVPH 1KPUB 3EFFA 4MNGE 4U1NA 4MAUH 3EDDA 3NN8A 4LCYB 3IKKA 4XWGH 2HP4A 3NZ8A 3SDAC 1Y0LB 1RZ7H 3M17B 4C4KO 5C0IB 2HJFB 1JRHH 2VAAA 4HS6A 3VW3H 4D9LH 3B3IA 3O3AA 3BP4A 4RIRA 4W68A 3JBG7 5INDA 4U1HB 4C59B 3FRPG 5HYJA 1D9KD 3TIDB 3L7FA 2ICEB 3SQBA 2NX5B 3VFVA 5LXGH 3QEQE 2Q1EA 4PG2A 4ELKB 1HXYA 2QR0B 1G7QB 3MRBA 4Y0GA 5DJAB 3QHFL 3SDCD 2B7DT 4MD5B 1F3JB 3UYPA 1WFOA 3FN0L 4P46D 1RUKL 3ARDB 2R69H 5FA3B 1ZTXH 3LEYL 5FUZL 1LEGB 4RWHA 3DX9B 1P4IL 5SWZA 5EORL 5IVXB 2JELH 5DR5L 5E2TL 5AYQA 2XA8L 5BQ7B 4OT1L 1I1YA 4LLUB 5DJYB 3ARDC 1TIUA 1HHGB 5CP7B 3TBSA 3ULUE 1TNNA 4F7MA 5EU3B 4GKSA 4MJ5B 5BRZD 4WFFD 1KPVA 2MOVA 5FKAA 1F4YL 2EICA 4PB9H 2YSSB 2WBKA 5LJYH 3OV6A 3B5GA 1FYHB 1U3HB 3GMOB 2GY7B 1PZ5A 5GPRA 5JIKA 1IGYA 2ZOKB 4OIAA 4OZHE 1G7IA 5DQ9A 5D2NB 1JIBA 5EIVA 5D2LB 3KYNB 4GXUN 5DQJA 1SBSH 5EU4A 5AZ2L 3TO2A 5C1MB 2CK0L 4WEUD 3VXPB 1OPGH 1MCEA 1U3HC 4PJCF 4WY7L 4HWEH 4JFDA 1HEZA 2Y7QA 2ADJA 4UAOB 4G8GE 2VLJD 5JOFA 5D2NC 2IMNA 3GBMH 1NCWL 3MRIA 5EA0L 4JJ5B 5E6ZA 5JUEL 1LDPH 4F33B 2C1PB 2XNAA 3LDBB 4Q9QL 5TDPB 3VXMB 3BUTA 4GMSH 1A0QH 3FAXA 1JNNH 1ED3B 4UAOC 3DXAB 2PXYD 5TFSL 2P49B 2ZCKL 2R2BB 4MCYB 1U8OB 1DN2A 1EEZA 3HC4H 2BHZA 2R9HC 3G5ZB 4P5TA 3WEXA 3LDBC 3C8KA 2FDBP 2V2WB 3G6JA 1MCNA 1WTLA 1VSCA 4JRWA 4MMZC 4FQLH 3P4NB 2XZQH 4MA8H 4ZFFB 4ZS6C 4FFVC 4XP6L 3WLWC 5BOPA 2AABH 4F7PA 2EKSB 4NGHL 1MCJA 1PGRB 3I3BA 3L3KB 3PG2A 4YXHL 3VFGL 1NDGB 2LU4A 4ZS7H 4W4OC 4JKWA 3T4AA 4WHTB 1YMHA 5FB8B 4G9DB 5C0JA 1BX2A 1DJSA 1MVUB 2ZOLA 3BP5B 5GISL 2R0ZL 4JFYB 4Y16B 3ZKNC 1TJHL 4U3CA 3SN6N 1A4JA 4TSCL 5T1MB 3SGJC 3P4LA 4G43B 4HPOH 4M7ZB 4UDTA 4P2OA 5EIIA 4U1LA 1GH7A 3VXUD 4M6MH 3V0VB 4PYGA 4XHJC 1O5DT 2WSKA 4Y16C 5D1QD 4UOW0 1IT9L 2DQCL 4A6YB 4RISH 5A16B 2B4CC 1JYXA 4U3XA 4M7ZC 2X70A 2C3WA 1TZGH 1LO3L 5EO9B 1H3VA 3DRQB 1J1OL 2VLLA 5F1IA 1A6VL 3QDJE 3GSRB 3INUL 4JFFE 7FABH 4OI7A 4X6DE 1LP9B 3BD4A 3SE3C 2RFXA 1WC7B 4QOKE 1GPOH 3BE1H 2FWOB 3GMMA 1IGMH 4UBDD 1K2DB 3VD4A 1JZ8A 2KL6A 4GW4A 5EO1B 3GZKA 1JNHA 3E8UH 5HDQL 4Z8FH 1IM3B 4P99A 1T89C 3C60A 2YBRA 1PLGL 2HLFD 4GQ9L 4BUGA 4EN3A 4HWBL 4U6TA 4IS6B 1MIML 4IMLA 4CU8A 5EU6B 3U4BL 5HYSB 3B9KD 2HJLA 2X4OA 5IB2B 3CFDA 3H8NA 4PJFF 3SKUD 5EPMA 2VN7A 3X17A 2FBJH 3L3JA 4Q2ZB 5CZXC 2QHRL 4X6BA 3MBXL 3KYMA 2H26A 4FXLA 1DSFH 5L2KE 4H20L 5C9KA 5CIPA 4FXKB 3RL2B 1MCWM 4KGLA 4KTEH 5LKNA 1X5AA 3S4SA 2JCCE 4L8DA 3RGVA 3ALXA 3NFPB 2G9HB 2BOCB 1SYVA 1TXKA 4U1GB 1KJVB 5C9JA 1VEOA 4MNQD 2R2EA 2VLKD 4P3CL 4X4YB 2GAZB 1PG7X 5DHXB 4KPHH 5ETUA 2F54D 2LAGB 5DD6A 4U1GC 4R26L 4LKXA 3ULVF 3O9WA 1IC4L 5DC0A 4L4TD 4RNRA 4BZ1L 5FECB 4ERSH 4ZAKA 3JUZA 3FTGA 2AV7A 1KCSH 4JVPA 5FKPA 3SKJL 2IPUG 5EWIH 4S1DC 4U6VL 4ZPTB 2ESVD 5IFHL 5BJTB 1WGOA 2IANE 1GRWA 3G9AB 3DYMA 2Z31B 4KK9D 2ICCA 2HT3D 3VW3L 1UZ6E 3O2WH 1Z5LB 2NY2B 1FPTL 3RJQB 4WHYG 1PDKA 1IL1A 3NIDF 3IDNA 5J13B 4L8CA 2ZZUT 5T33H 4H26A 2Z31C 4PGCA 2VLMD 4XVUC 4YDJA 1CFVL 4M00A 2NY2C 5C09B 4JO3L 1EGJL 1TMCB 2XN9D 3F7YB 1WIPA 1RU9H 3FFCB 2LAAA 2FCBA 5IW6A 5J13C 2ZG2A 2BNUA 3NAAH 4LQFL 4OV5B 3QSKB 3PQYE 1SEQL 3VH8G 1P1ZA 3BKJH 3EFDL 4O5LH 1XF3A 2OJZL 4ESKA 2RCSH 2W65A 4O2FB 2R29L 2H6PA 5DJ6A 1CXKA 1OF2B 3PUCA 1OARL 4NQXA 4PP1D 2MFNA 2GJ6E 3SE4A 1JGDA 4KKBD 1RIHH 1NC4A 4PJHE 3T0EA 4GKZB 2Y5TB 5JHDA 3IVKB 1J05A 2O5YH 3CVIL 1QBLL 4H8WL 2EC8A 3P9MB 1CWVA 3ZLQC 3JV6A 3CCHA 4P57A 4I4WA 1MJ7H 5MI0B 4AT6A 4H0GA 1T1XA 3O4LE 1GGIH 2IBGA 1XGQA 2R2HB 3OJDB 3NH7H 15C8H 1HCVA 1XGUA 3LN4A 4ZUVA 4OLYH 3U0PB 4PJXB 1C08B 4M4RA 2YS4A 5ICZB 5MI0C 4X7TA 5F21B 1F11A 1I85C 2EECA 2Y25A 5KVGL 5LCVH 1PKQE 4MA3A 1FNSH 3DI2B 1QACA 3VGDA 4FFZH 1PJ9A 2J88L 4NQCE 4HH9A 2QADD 3FCTB 4GG6F 4GMSL 5C0BA 3KXFE 5LGHH 1KG0A 4JM4L 4UTBL 1YPZE 5HDBE 1KJMB 3HZYB 4EIZC 4UIKH 5SWSA 2J4WH 3H42H 5BZWA 3RTQD 4S1RH 5EBLB 4K07A 4M02A 4G8FB 1DBML 3CXDH 5CHNB 1B4RA 1FNLA 3RBGA 2VR4A 4ETQA 4DGYH 3MCKA 2FR4A 2A0LD 3BGAA 25C8H 5C0GB 2I27N 3TJHD 5I66B 4YHYB 3ARBD 2UZIL 3BOVA 3T2QA 3C9NB 1DFBH 5CD5C 5L8JB 3U0WL 1MWAB 3DV4A 1FL5A 3ESUF 3LHPH 4R97B 4WJ5A 5ALCL 3HLAB 5E00B 5DFTA 4Y1AD 2XTJD 5MERA 9CGTA 4YHYC 3RUGB 2GY5A 4ZD3L 3B5HA 5CJXA 1AQDA 2VQTA 4J3XA 5EUKA 2LV4A 2A77L 2PF6A 1F4WH 3K2UL 4R97C 3CZFB 4PUBL 1EFXA 1FVEB 2ED9A 1B4JL 4HMCA 3JV0A 3WJJA 1XZ0B 2P8LB 2IGFH 5D6DA 1RUAL 5C0AD 5JQ6L 1DQJA 4HDIB 4WGVB 3RA7H 1ZHBA 2D7MA 4CU7A 5MENE 2A83A 2X9YA 3S3SA 2HG5A 3OQ3B 2R0WL 1D7FA 1JZ5A 1I9IL 1ZLVK 1EO7A 3HPLA 4LCIH 2HT2C 5MEQB 3HNSL 4JFPB 4NQDB 3FQWB 3GJFA 2H1PH 2P5ED 3HI1B 2CR3A 1F6AB 3GMLB 5CGMA 4KHTL 3BW9A 4P2RD 5KSAD 4Q97A 1BJ8A 3GMRB 3I50H 5K93A 1G9NL 1MCHA 2QBWA 3NGBB 4Y4FD 2GITA 4NO0D 2BY0A 5GS3A 3HC3L 4AG4L 2CKNA 4QWWD 1FDLL 2C26A 1MCPL 2LVEA 1GAFL 4BFGA 1M7DA 3NGBC 4NT6A 1M71A 3GSNH 2CIIB 1OB1B 4G6AD 3BH8A 2V5YA 3OKEA 1DBBH 4PRIE 1XIWD 2FO4B 2H41A 4NC2B 1IJ9A 2GUOB 4EXPX 1CLOH 1UWXH 5KJRL 1LK2A 1QSVA 1YN7A 1DVFD 3FN9A 1Q0YH 1QSFA 5D72L 5FYKL 4NWUH 1IARB 3CC5A 3MV9E 5FYLH 3GEWB 1OAZL 3TZVD 1NKOA 1CLCA 4FN0A 5FAAA 5CD3B 2UWEF 2ZUWA 4J4PD 4F9LA 1A3RL 1RVFH 3CFCL 4GXVL 1WBXB 5I19H 4WW2F 4YDVA 3ARFB 2IH1B 5TE4L 2HYMA 3MZGB 1B9ZA 5ELIA 4YXKL 2XG4A 5DUMH 5BVJA 4JG1H 4HWBA 4LLWB 4CUCA 4F80A 3ARFC 4G8EB 1T3FB 5DT1H 2AXGB 5F1SA 3OB0H 4IRJD 3BZEA 2DQEL 1AC6A 4J2XA 1ZHLB 1XFPA 1UM4H 3DVNA 3H0TB 2DYPB 3C08L 5D1XA 3LN5B 4PRPD 4IBLT 2E7BA 3O8XD 3I3EA 4I3RH 4LBEB 4K9EC 4LARH 3SDDD 4OLVL 3STZA 1PEZA 1YEIL 2EEAA 1UB5A 2DIBA 2NW2B 4LCWB 3NVQA 4JG0H 1RUML 5EUOB 1JHLL 5I1CL 5KS9A 4JREB 3RVVC 1U2CA 1ORQA 3TLRA 3F7RA 1GOGA 1GOHA 3OAZK 1UH2A 4Z0XB 4Y4KB 3VMNA 3RWGB 4PJ5E 3N0PB 1LD9B 2ATKB 2VERN 4JREC 4RFEB 3UTPD 4KHXH 3DHMA 1H8SA 3BJ91 4H0HB 4QRQA 3UBXA 2B2XH 1S9VA 3MLYH 4XBPA 3AS0A 1UQSA 3JWOL 1UM5L 2VXQL 4IRZH 2NZ9D 5DGRA 3V5DB 1FO0H 3HZKB 3AAZB 4NWTH 4OGXL 1QKZH 1T1ZA 2F74A 2NXZD 2V7NB 2ICWI 3WNNA 2O26U 4RFOL 5I76B 3UTSE 1U92B 4KU1A 1TJIL 4FP8L 4XP9H 3WIIL 1CICA 3HE6B 4XVTH 1JTPA 5HD8C 4TPRL 3ESVF 1M6OA 2I25N 4WUUD 3EDFA 5ID1B 1J5OL 5GQBA 1EMTH 4BZ2H 1A7NH 1XT5A 4I48A 3CPLA 1UEMA 1Y6NR 2F19L 1NANI 2FYYA 4RMRA 4DJMA 1EJOH 4DOHE 1MQ8A 4MDIB 2APXA 3HE6C 5F9AC 4JY5L 2W0FA 1IM9D 2YKLL 5KVDL 3QDGE 3DMMA 4LVOB 5D5MF 1ZS8B 2CLZA 3SY0B 5MEOA 1FYTE 5C6TH 5E2WH 5DC4B 4G6JH 4PRHE 4RDQF 1RZ8B 1ACYL 2AJUH 1FH5L 2VDMH 3ZE1E 4LVOC 4KMLB 3PF2A 1JYNA 4XP5H 4F7EA 3R06B 5IJVB 5FM8A 3EJJX 3KPPB 4OZ4A 1QNZL 2D7TL 2HKFL 4Z7UE 1ULVA 3AB0B 1EPFA 1CQYA 1NBQA 1KNOB 3ZHKA 4UIKL 4JQXC 1OP5K 4L3EA 4G6FD 2H2PD 4DVRH 3VWKD 3UJJH 2D31B 4U3HA 3MLZH 1WWWX 2R1YA 4KVCH 1RIUH 3AB0C 4RQQB 1ZKAA 25C8L 2PYEE 1JN6A 1QSED 4HKZB 4X99A 4MJIA 5GGVH 3I9GH 3MRDA 3O3EB 4U1KB 4ZOCA 5D1ZD 4HKXA 5J1AB 1P7QD 1I8IB 3U7YL 4QXGL 1NCCH 4LKCB 2X4SB 5EZLB 4LIQH 4JDZA 5EZOL 1Z2KA 3HRZB 5C0CE 3KPSA 1VGKA 4JCLA 5ANME 5IROC 2H32A 4PJ9A 5JXEC 1OAUL 3WNKA 1U58B 3RNQA 5B3JF 4JDVB 2JJSA 5EB9A 2OK0H 1VEMA 4RA3A 4LPCA 3S37X 1BQSA 2I9TB 4R4BA 1NMBH 1D5ZB 2HA1A 2ENSA 4YGVB 5HY9A 4L9LA 2Z4QB 4JQIH 4QHNA 4NO5B 4NPYA 1MWAH 1WEJL 4BH7B 3RWEB 4ELMA 5JOPD 4R3SB 3VFSB 4JZOA 1UKSA 2MMXA 4WWKA 3SKOB 1F4AA 3ZYJA 3WIFB 4WO4D 2BHUA 1A6UH 3WLBB 4JPIA 3BWAA 3QDMA 4K3EH 4GAYB 2AW2A 2GSIB 4I5BB 4ZXBD 2HVKB 4NJAH 2EYRA 2F5BL 4E41E 1KXVC 3WD5L 5CBEA 3WKML 3WXVH 1NL0H 3F65A 3TBVA 1ZLUK 5CKGA 1NCBH 2AXFA 3PHOB 3QIWA 5DZOA 1Q72L 3HUJF 1XF4A 3SDAD 2Q7YB 2OL3B 2K1MA 4N90E 4MMXC 3D9AL 1MLBA 4KI1A 2X09A 1BFVL 1WWBX 2QEJA 1EHNA 2W38A 4JPWH 4YHML 4QHKI 2YD1A 2XY1A 5C0RH 2UVEA 1NLDH 5J1SC 4JDTH 4OCLC 4HXBH 2Q7NA 4KJWC 3PP3H 4LDEB 4UIMA 4K23H 3BEVB 5K9OB 2Z91B 1ODAA 1NH6A 1P9MC 2NX5D 3C5JA 4YAQB 1TCMA 2Y5EA 2JK5B 1UWEH 4GKNA 4QTHB 3EO0A 2MQ3A 4U1JB 3CLFH 3DGCR 3FO1A 3MLSH 3MJ6A 3REWA 1RV6X 1IQWL 1A7PH 2NNAA 1BJMA 4R7NA 4RMQA 4XC3H 3H7LA 3QULA 5CINH 3HMWH 2KZ1B 2MQ0A 5HYJE 1NFIA 1Q9WA 3TN0B 1JZ2A 2PO6B 1C5BH 1K9TA 2X4TA 3ARDD 3LZFH 3OKYA 3H9SE 5DT1L 4LHJB 4IOFC 3IDMB 5E08L 1OLLA 3QEUA 2Z35B 5DTFA 2DLHA 1A1MB 5L88L 3DSFH 1U9KA 4FQHA 1K3IA 4XRCA 4IRSB 3TN0C 2GTWA 2PO6C 1H5BA 2A6DB 3IKCB 3QWRD 5E7FA 1HH9A 1S3KH 2Q3AA 4QXUH 4BKLB 5MEPA 5TPWH 5E6IB 4MD0A 3A6CL 4N8VA 3SE8H 3NOIA 1G7LB 3PABB 5SWZE 1VB9A 4IRSC 4YHKL 4PGDB 1CR9H 4X8XA 4CVZB 1U3HD 2XICA 5F8QC 2CXGA 3ILQC 5E6IC 3HAEB 4MD4A 4PV8A 4I0PB 3ZTJG 5IMOB 2CDGA 2R23B 1K5NA 5CEZE 3MLPA 3QQ3B 5B38A 3NCFB 4BFBD 1G0YR 4M1GH 1B3JA 3WIHH 2FHCA 1JZ7A 3EOTL 3OX8B 3HE7B 3ULVL 3AU1A 4O4YH 4NP4H 4I0PC 3QFJB 5DVNA 3WFHA 2VZSA 5FA4A 2R9HD 1OCWH 3STLB 3WFBL 4EBQH 5HHMB 3HE7C 5E8NB 1L7IH 3VXMD 4TVPD 4X4XA 3DXAD 3L3HA 1KIUA 3BKYL 4XP9L 3ZDYE 43CAB 3MRFB 4LPWA 4BZYA 1A4KB 4ZS6D 4FFVD 3WLWD 5KN5B 4YDIH 4G7YH 4H1LG 2FSEA 4U6XB 2PW2B 2Z8SA 4HMEA 4M5ZH 5EFIA 4DN4L 4HBCL 2G60H 2GKIA 2DLIA 4K3DH 2BVOB 2VQUA 2Z93A 4NSKB 3MRMA 4OZFA 5F6HI 3WFCH 2CLRB 2D7QA 3THML 3CU1A 4G80B 4KKCC 5DLML 5EOCL 1QFWH 5D7SH 3ZKND 3CVHB 1G9EA 2YK1L 4FTVA 1X5YA 1BBJB 3G6JE 2J2ZA 2OX5A 3BDBA 4CKVX 2BJMH 1R3JA 1SQ2N 2Z0BA 4ZNEA 3L7EB 2XFXB 4XHJD 4Y16D 2A6KB 2AEIT 2W1NA 5JHLH 2BY3A 5DQDL 4CMMA 4OLEA 3NFSH 4BJLA 1T83C 4HIIA 1NGPH 5HHXL 1J8HE 1PQZB 5F7MC 3FHAA 3QPQC 3SDYH 5GGQH 4DKEL 1MRCH 2LABA 3O3UN 4PJGB 4YC2B 3UJJL 2X10A 3REVA 3U36A 3U30B 5KSBF 2G2RA 4V1DB 3KNBB 4PP2B 1QVOA 4JB9H 1AGCA 4WCYL 4M48L 1IGTB 4IHOB 4J1UA 4LDOB 4HJGA 1NBVL 4OQTL 4YC2C 3HZMB 3P77A 1N4XH 1SMOA 2Z92B 4YO0A 2VXTL 4U1MA 3U30C 5L8KB 4JFEA 4X7EC 3RY5A 4Q9RL 2DJUA 1JHTA 3QIBC 2BNQA 3IRZA 3MNWB 1I7ZA 5FYLD 3BSZL 1YY8A 1WQVT 5TDNB 1IAII 1F42A 1A14L 3FKUS 4OM1H 5CZXD 4PLKC 1NEZB 4OSUL 5BO1H 1KC5H 4TUJA 3V6ZB 2CDFB 2VABA 1LMKA 1IC5H 4PRNA 5EU6D 5LVEA 4WU5B 5IB5B 4KTDH 1DLHB 5L9DL 1CIUA 3QIUB 5I9QB 4JY6B 2LVCA 1XR8A 4CAGA 4YHLH 5F1KC 2JTDA 4YPGA 4PJEF 4M7LL 2FIKB 4OF8A 1TPXB 4I0CC 1FL6B 3QIUC 1JGLH 4C56B 3DRTA 5I9QC 2IFFL 3JV4B 5D96B 3DX7B 3S34H 3T2OA 4LCCB 5JW5B 1QYGL 4F7CA 3DURB 5IV2B 1JZ6A 5JO5B 3QO0A 3B2VL 5B39B 5LQBL 4PJCA 4ZTPH 4KMTH 2E9WA 5BS0B 2OP4H 3KS0J 1TPXC 3GGWA 4S1DD 5CEYA 1GGYA 4WTXA 3WXVL 3LRSA 5D96C 4HV8B 4Y88A 3ILPA 4LCCC 5IT2L 1IGIH 2BNRB 3ARXA 3W0WE 2EDQA 7CGTA 2A9ML 1BOGA 1FG2B 5JW4Q 3RU8H 2P8MB 1FFRA 3I6KB 2C7UA 4FABL 4HLZH 4BQ8A 4WU7B 4OAWA 1Z9MA 2FATH 1NCAH 2IBZX 1Y18A 4NNPH 3V6FA 2HJKA 3GRWL 3QEQB 2VDNH 3WS3A 3T1WA 3S5LB 1BIIA 2Z31D 4MB4A 4XVUD 1RJLA 2VB5A 2NY2D 4HUVA 3H3KA 4KK6C 5CP3H 5CZVL 5I8KH 3UDWA 3L3GA 4U49A 1U8KA 5IHLB 1YZZA 3M8OH 3O4OB 3TNNA 5C0DA 2AXJA 2C1OB 2XZAH 2EYSB 1BWMA 2OL3H 3QQ4B 4Q9BA 1FJ1B 2BSED 1ZHKB 1HNFA 4HFWA 5C09D 1INEL 4LF3B 3S4SG 1F8TL 3HRPA 2XRAL 3P4OA 4HK3N 4LFHG 1XGPB 4KAQH 3FFCD 1JGEB 3O4OC 5C3LD 2Q86A 3MUZ1 4P23A 3UYRH 2BRRL 3MNZB 5KSVA 1GCFA 3D3VA 3QXDB 1C5CH 2XOTA 3PIQB 3S3PA 3TYGL 4EVNB 1MFBL 1QRNA 1A7QH 1R5WB 2UUDK 4M1DL 5IVXF 1WAAA 3BEWA 3NA9H 4RAUB 3PE9A 5T3ZL 3TNMA 1FNFA 1B0GB 1RZGB 2OSLB 3TCXA 1BF2A 5T1LA 2P5WA 1DEEA 3V4VL 4NQEA 4P4KB 4Z78A 3TBTB 1JMXA 2Q8BH 5FHAL 2NY5C 1SYSB 4O2CB 5HGGS 3ZKQD 4KZDL 1F3DJ 2VWEE 2YPLA 1CD9B 4RCAA 4Z7QF 1B6DA 5HPMA 4Z7WA 3T1FA 4CU6A 3TYFA 3P2TA 4P4KC 5IEHA 2VL5B 1JPFB 4FQXB 5CJ8A 1IQDB 1T03L 3T0EE 2BCKB 5JHDE 1X6NA 3WE6A 4YIQA 1ORSB 5D2LF 2EDJA 2HFFB 4QRSB 4X5WA 5LBSH 1ZA6B 1B0RA 2O61B 4OCRH 1YDPB 4L9DA 4QRRA 4O4YL 4FQXC 3ROOB 4YHZL 2X1WL 3FQTB 3G08A 3FRUB 2JJVA 2GK0A 4HS8L 1ZVYA 4ZQKA 5DJCA 4PJFA 3U0TB 5C0FA 3CFJA 2DQHH 2YMXH 1G9ML 3QEGL 1KTLA 3QUYA 3W39A 1HZHH 4EDXA 1ETZA 3LIZH 5DRWB 5E1AB 3HAEH 4PJAA 1KLUB 4CADB 3GM0A 5ACZB 1T2QL 2JJWA 3LSOA 4EI6A 4XP4L 3B9AA 1UCBL 1FGVL 4G7YL 5CD5D 4CJ0A 2UVFA 4ZUSB 2FO1A 4AEHL 5EC2A 1AQKH 4HJJL 4B5EA 5BOZG 4UTAL 3IXAB 4MQ7A 1CZ8H 4ODWA 3S35H 3VFOB 4HUXA 3GJEB 1UT9A 4WENB 4AY0A 2DM3A 2BVPB 3KPLA 4IOIA 4ALAH 3NPSB 3MZTA 4O51A 3K3QA 4HG4J 2OXGA 4QRUB 4YHIA 1BBDH 3VGFA 2QTEA 3GK8H 3BJLA 5IK3A 2AI0H 1XH3A 1QG3A 3DUSB 2EE3A 4PB0H 3FQRA 3NPSC 3V0WL 1MHEB 3O0RH 4NHUB 1H15A 2Y07L 1HSAA 1LVEA 2HT2D 5D7KE 1IE5A 4PRDB 3QDJB 5E2VH 3OXSA 5FOBB 3KLAA 1LE9A 4R96A 4ZUWA 1D9KA 1A64A 1T0MB 2ICWA 1GHFL 2OJEB 4NQDD 5DD1L 1FNHA 5D7IA 1ZT7B 3N9GL 1XCTA 2DI8A 3SDCA 3Q6FA 1JWMA 4YJZL 5BXFB 2HAZA 3M07A 2EC9U 5J06A 4OJFH 5GS1B 4BFIA 1LP9F 1P7HL 3T65A 1I7UA 4Z7VA 5IHZB 4Y4HA 2BXYA 3PV6B 3D2UA 3VCLB 2BSRA 4HX1B 2ORBL 1JPGB 1G6VK 4UQ3A 2A2QT 2P42B 2FD6L 4QHUA 5GS1C 3BP6B 3QWOA 5FYJU 1VGEH 4D3CL 1S7WB 2Z8VC 1OP3K 4FQ1H 5FCUL 1SJHA 4JM2A 1MFCL 3ARUA 4QCIA 2CIKA 1YEJL 4P49A 2ADFL 3O6LL 1DQMH 1IAIL 4O02L 1I4FB 1VFMA 4HMDA 4CNIA 1PZUB 2A6IB 4RGOH 1BQHB 4OQTA 4EOWH 4YDKH 3BRFA 1D6EB 2WIIA 4RWYH 4W81A 5E7BA 1CLZL 1KBGL 2I5YH 3QNZA 4WFGE 5IB4B 5TF1L 1FAKT 3ARFD 1H0DA 4PJBB 2NY7H 4RZCA 2HWZH 3VG9B 4MWFB 1KV3A 1VHPA 5E9DB 5IB1A 4D0DA 5HHVL 4RGMB 4JHWH 2PTTA 5FM5M 2IANB 2EC9T 5ID0B 1J1XL 4TUKL 3QXUA 4DTGH 2DIJA 2HT4C 3VGGA 1DL7H 4ZUTB 1N6QH 1U8QA 3O41A 4L5FL 3VG9C 1KN2H 1I9RH 3EYSL 3X14A 1J0JA 4RGMC 2PXYA 2EDDA 3WFEL 1A6ZB 4OD2A 1NCAL 2DYPD 2XWBB 3QR2A 3RVVD 3WHE0 2DMKA 1MUJB 4N9GB 1LWRA 1V3JA 1A2YB 4HS3B 3MA9L 1EXUB 1KOAA 5C92A 5J6HB 1JFQL 1K6QH 1YEFH 4YHOH 2V7HA 3QHZL 3HFML 4LCWD 2ADGB 5TQ2L 1CQKA 4QF1B 3SOBH 2D7OA 4TQEL 4G8IA 5IGXH 5I17A 1T7XA 4XAKD 4ZDHA 2R4SH 3EO1B 4Y4KD 5ALBH 1UVQA 4NC1E 3NFNB 5TDOB 4ZO9A 1RJZB 1ZT4B 4LNRB 5KS9E 2HTKC 4I3GA 4JY4A 1D5BA 3GSWB 4NO2B 5HHPA 2XKUA 4W6XB 3FQXB 3B6SA 2J8UB 3IDGA 4UU9A 4ZFZB 3FT4B 1MAML 3NBNA 1AFVL 2IQ9H 3LMJL 3CX2A 4TUOA 1KCVL 3GRWA 1WITA 5D1QA 2W0PA 2OM5A 1EA9C 3DO7B 4N5EC 4DZBA 4YR6B 4F3FB 1IGCH 4NO3A 3WXWH 4AH2B 1EDQA 1ZV5A 2EDWA 3HE6D 2ZKHL 3TO4C 3BIAX 5J9PB 2ZG3A 2ID5A 3VFTA 5L7XH 2NY6B 3S88H 3C5ZB 3CH1B 3ULUH 3W82A 5DGQA 1C16A 3HMXH 4MB5A 1PKQB 2OCFD 2UYLB 4R0LB 2NY5H 5CWSB 4M3JA 2NY6C 4NQCB 4NKIL 4QO1A 3CSPA 3VXNA 3MYJB 3AY4A 4PJXF 2ZNXA 2RGSA 1C8PA 4UI2A 1AGFB 3OR6A 4XBGA 3SO5A 4HZAA 4OKDA 2Y06L 4J3WA 1YPZB 4R0LC 4LPUA 5F97E 1P7KA 3UBXG 1P4LA 4OFVA 4EEEA 2BZDA 1A6AA 1BIHA 2BK8A 5GZOC 1HIMH 1AGBB 1AC0A 3KLSA 2J6EH 5FCSH 3QA3B 3BX7C 5I1KL 2DTMH 1A7OL 2CLVB 1S7RB 4WEMB 4MJ4A 2UWEA 4DGVL 4PJ8A 4M43H 5DD5H 2KBGA 3MJ7B 4WW2A 3NACL 3KPMB 4LLVA 3SGKA 3ZDXF 3MA7B 4JO4H 1XR9A 3BXNA 5J6GB 1F90H 5ACMA 5JDSB 3BQUC 1OTUC 2JJUA 1A1OB 2F54A 1I3UA 3P11H 5JXED 3DETC 4E42A 3QH3A 1RUQL 2AKRB 1DDHA 3BZ4B 1VFAB 2JE8A 4YHNB 3PXJA 4TNWK 5F7HA 1JUFB 3FB5B 4GS7B 3U1SL 2E8YA 1EEQA 3RUGF 1BD2D 1X5ZA 2DQTH 5IESH 4Q7DA 3U79A 4HAFA 3W9DB 1BFOA 5F7EH 2ESVA 1FORH 5EU5B 1T1YB 4UT9L 4KZEL 5DURB 1A9BB 3ZE2E 4GS7C 4JQVA 1SEBA 2BFVL 4KUZL 1G7PB 4PGBB 1NAKL 2V2TA 5F7UA 3DX6A 5FO8A 3GFUA 3HC0B 1NLBH 2ZSWA 3MV8B 3MRNB 3KPSE 3UPRB 4CW1B 3D39B 3VRLE 5A1AA 5I30L 1AO7A 1EUTA 5IG7A 4QLRA 5DVOA 4O58L 5L2JA 4PJ7B 3I02B 3PWNB 4R90H 4DAGL 3RY4A 3ZE0F 4XGZB 1UKTA 5DS8B 4EUPB 3KJ6L 1HHJA 5JMRA 4ELME 4NCC1 3U6RB 2ATPA 3FJTA 4DUWA 2QSTA 3R0NA 5MP6L 3HR5B 1S7XB 4N8CH 4AEIL 1BVKB 4PRIB 2V9TA 2HFGL 4HPYL 1SJEA 5FUOL 3H9HA 1G7HB 3ECBA 2DDQH 5EBMA 4LAQL 1FNGB 1R3LB 2FGWL 4NZUL 1LO2L 1T04B 3ULSB 1YNLH 4KJWD 1BZ9A 4Y5XA 1KYOK 1FNEA 4ZSOE 3H3PH 1TNMA 3JWDL 1PFCA 2P7TB 5HGBA 1GZPA 1Q9LB 3BPCB 1CFQA 1NBYB 2X4RB 4OF6A 5M95B 4OTXH 4LLAA 4M62L 2YXMA 3PWLB 1ZLVH 4X4ME 4Z0BH 1MLCA 3LKRA 3QPXH 3KWWA 1HHIB 1QR1A 2YUXA 4FHBD 1ZLSH 1Q94B 1B90A 3QEHA 4L8BB 4DW2H 4GMTL 5AG9A 4OLWH 1E4JA 2I07A 1NGXA 3OKKB 3NPZB 3QUXB 4NUJA 3IRPX 3RWHA 4IOFD 4XNYH 5K9JL 4HJ0C 4PG9B 3I75A 3IGAA 3QQ9C 3U4EA 2P24B 2VISA 4HT1H 4KDVA 1P53A 1WVZA 3TN0D 3UTTE 4JO2L 4H5SA 2PO6D 1A3LL 3QUXC 4QRPE 3G6AA 3RDTB 4ZFOB 3TA3A 3MODH 3QAZB 1HQRA 3FFDB 5E8PB 5E2UL 2IJ0C 4OQ1A 2GQHA 2E7CA 1QBMH 4IRSD 4QYOA 5ILTL 1FBIL 5A43C 2R0LL 4ZG1A 3RDTC 5ERWB 3OWEA 4J12A 3QAZC 3MV01 5T5NG 3ILQD 3PGCB 5E6ID 2WWMD 1G0XA 2NTFB 4ZYKB 4GAFB 2JB6A 5EUOF 3VXRA 2A6JB 1GGBL 1N0XH 2YA0A 4JAMA 3QHTC 4RX4D 3OR7A 3EJZC 4AM0A 1I1AB 5I15L 5FYKE 4Y1AA 4I0PD 1DBJL 2B1AH 1I1CA 4OLXH 1M05A 2G75A 4XXCA 1G7JB 1GIGH 2MHAB 1N5AB 2FNBA 5AUMB 5E24E 2DS4A 1I1AC 4D8PB 1RZJC 3QFJD 3WN5B 1S8DA 3A67H 2DKMA 2MKLC 1NSNH 3D0VB 2WP3T 1Q9OB 1T20A 4K8RC 1DTUA 5F7LB 5KVFL 5DRXA 1E6JL 4B7IA 1J0IA 1TETL 2O5XH 5HHMD 4B41A 2RBLA 4LSTL 5SX4I 5FO9B 3ROLB 2J5LB 1OWWA 1IC1A 3WN5C 1K3ZA 3W9EA 4DQOH 1W8NA 3EHBC 1DBKL 2D03L 5IFAL 2AEPL 4KJYA 5FEBA 4NHCH 4KKCD 3QDGB 5BV7H 1ND0A 3NIFF 3FB8B 5KSAA 3WNPA 3KLHC 2AAVA 1VCAA 1IKNA 2J5LC 3EOAA 1YEKH 4PRHB 1CF8L 3PWPB 3DTXA 3L3IB 4KRPB 2IG2H 4NO0A 3AS3A 5GJTL 4N8VG 1I3GL 2P46B 4P59L 3OG4B 3QXWA 3K46A 2EDOA 3KPNA 1FNAA 4UQ2A 4PLJC 4LU5H 2F5AH 2MCPH 4HCRH 3VFPA 4GAGL 4KRPC 4ODBD 3GSVB 5I8CA 2VITB 5B38G 3QPQD 1YEDA 1VPOL 3A6BL 1MH5B 2CGRH 4GW1A 3LS4H 5I1HH 2NY4B 4LLDA 1S9WB 2F8VA 5ICXB 1NGQL 1ES0A 1CDCA 4FTVE 5ITFB 2PYEB 4OKVB 5KVEH 1YEEH 3RBSA 1H8NA 4XNMB 4CN1A 4HC1H 1UXWA 2NY4C 3D0LA 4XNXL 3FQNB 2AJSL 5H2BA 3BZFB 3GSUB 4J4PA 1BM3H 3ZL4L 3QJHA 4V1DD 4U6HB 2P8PB 1TCRA 2YUVA 4FMKA 3D5OF 3KYOB 3FB6B 1BQUA 1NGWB 1ITBB 3BYTA 5C0CB 3ORJA 2QQQA 4TSBL 4XPBH 3MGAA 4WDIA 3NABH 2NCMA 1INDH 5F7FA 4LP5A 4PLKD 3SPVA 4PJIA 3MLWH 4MVBC 1UWGL 1N8ZB 4OZFG 4OZGA 1U8MB 4C57C 5JR1H 4MZ3A 4IRJA 3KPRB 2Y36H 5E8EA 5ISZA 5I0ZA 3QCVH 2OTUA 3W5NA 1RJYB 4HBQA 1WCBA 4GG8B 4XPHL 3TT3H 5EN2B 1MAJA 4PRPA 3IU4L 1J9CT 3O8XA 4R4NC 1NGZB 4NRZB 4PLNC 4JFEE 5GJSL 3BKCH 1JPSL 1HXMB 4NFCA 4PY7B 2W9EL 2BNQE 4TVPL 3SQOH 3JTTB 4N0FB 4V2CB 2DQDH 3QIUD 1KIQA 2X4PA 2Y23A 5TE6L 5F1OB 4MX7A 1S7TB 2FX8H 4F7TA 4J23A 3VXOA 5D7JA 1OT1A 3DVGB 3Q0HA 3V9FA 4KMQA 1HSBB 1U8HA 1FE8L 3KPTA 3AS2A 4C56D 4KXZH 1U0QA 4TOYL 4FQJL 1T1WA 1UM6H 3VU2A 4MQSB 4G9FE 1E28B 5BS0D 5C2BL 3FO0L 1AKJB 1OTTC 1U6AH 4N8CL 3GBLA 5IBUB 2YA1A 5EOQL 1CGXA 3ME0A 3PDOB 2QKIB 3LKNB 3MOBH 3FO2A 1KJ3L 2BNRD 2ARJA 4L4VA 2EKJA 1T6WA 3PL6B 5DEGB 4PJCE 2CD0A 2B4CL 3LH2H 4KK6D 1XGYH 1EK3A 1RZKC 3EFFB 4U1NB 5I1JL 4BUHA 3RWJB 3NN8B 5IEKA 3RWCA 3QEQD 3NZ8B 4KQ3L 3HNTL 2ZWLT 4A6YL 3PL6C 3QNXA 2VAAB 4X7FC 3PGFH 4Z0BL 3B3IB 4M7KH 3O3AB 4NRYA 3BP4B 3GO1L 3DV6B 4RIRB 4X98A 3QG7H 1L7TH 3NZHL 1MCOL 3QUML 3ET9F 3L7FB 5D71L 1IM9A 5IB3A 2X7LA 4H0IA 3EKCA 4WI6A 3G5YA 5E8DL 3KLDA 5DHVB 3PWJA 1AI1H 1BFSA 3Q1SH 3LB6C 1JPTH 1S7UA 5IJKC 3HG1A 2BVUA 2ICES 2DWEA 4XCCH 1ZLUH 3KAAA 1HINL 1YYLH 4PG2C 4UV4H 4LP4A 3EBAA 3T09A 2X89D 5T5FH 5F96H 4F57L 3RZCA 4P9HH 1HOCA 3AREB 1LDSA 2X4UA 1I1YB 5L6YL 2YD9A 3VWKA 3QXAA 4WFED 5KSBA 4F7MB 4P4KD 3D3VE 4YHPA 2MTPA 5HJ3A 4Z6AT 3VRJA 1N3NA 4GKSB 5IVOA 3S6CA 1KPVB 3L6FA 5FKAB 4I3SH 1QRNE 3TBWB 3AREC 5J0BA 1MPAL 4LRNL 4D9RE 4C58B 4HIHA 3N1PC 3OXRA 1A6TA 4X5LA 1RURH 1D6VH 3I84A 1PZ5B 1S7SB 1PG7W 4FQXD 4Y89A 1IGYB 2PYFB 5FGBC 2P5WE 1G7IB 4NQEE 5DQ9B 1LO4L 1AE6H 2EYTA 3FRPA 5CCKH 3MRPA 3OJ2C 4DKDC 5EU4B 2YPLE 1Z3GH 3U83A 1EEYA 3UJTL 3ARSA 3CK0L 4UINH 4Z7WE 4R7DB 4JFDB 1HEZB 2Y7QB 2ADJB 4XB7A 3BPNB 2ZUYA 1VACA 3ABZA 1O7SA 5JOFB 3ARZA 3MRIB 4DVBA 1CU4H 2NMSA 4LPXA 5GS2D 5ABDE 1UCTA 2XNAB 4NJ9H 3C6LB 1SJXA 1KCRL 5FIEA 4XPTL 1T7ZA 3BPNC 1RZJH 3I6GA 4MNGA 3MRJA 5H94A 3VFWA 5ACLA 3FT2B 4I2XA 2ENYA 3T2NH 4XNUL 4NN7B 1EEZB 2DD8H 4K7PY 4M7JH 4P5TB 3WEXB 3MLRH 1TZIA 1IZJA 3C6LC 4AL8L 4PJFE 2P48B 3DIFA 3MRLB 1M1SA 5SV3A 4XVSH 3MNVA 5INCA 4ZXBA 1MJUL 5DRNA 5C8JA 4NN7C 2EH7H 4APQB 3LQZA 4P5TC 3RVXC 1UENA 2AJYL 1A1NA 4F7PB 3SGEH 4NKDA 5J56B 1KGCE 1E4WL 1YMHB 4JFQA 8FABA 4APQC 2ZOLB 3VRIA 1T5WB 1KPUA 5AYUL 1FAIH 4EQ2A 4U7SA 1A4JB 3ULVE 2Z9TA 1N7MH 2D2OA 1Y0LA 1KN4H 4P2OB 1YMMB 5EIIB 2HJFA 5C0IA 3OKMB 3QDJD 1JHKH 12E8H 4U1HA 5E1HB 4PJGF 3TIDA 3NTCL 1AR2A 3HMXA 3MOAL 5IBTL 3BVNA 2X70B 4P2OC 3GHBL 1KSRA 2QR0A 5TJWK 4OF3A 4HUUB 2AJZA 3QCTL 5F1IB 4NRXB 1BWWA 3GSOA 1MRDL 2X5PA 5HYEA 4JRXA 4BM7A 3ARDA 5M94B 3UO1L 1RIVH 1PX3A 4EDWL 4GW4B 1LEGA 5K59F 5IVXA 2APTA 3C60B 5A3IC 1A7RH 2YBRB 3TT3L 5I0DA 1O7VA 2DKSA 4ONFL 1JNLH 5DJYA 4Z7VE 4OLZH 3QWRA 3RWIA 5CP7A 4M3KB 4IMLB 5ENWA 1MREL 4XMKH 3UYOD 5EU3A 2X4OB 1V7ML 3CFDB 4Z7OF 1IGFH 2ITCB 3C60C 3WJLC 1L9NA 3L3JB 3OZ9L 1UH3A 3SGDH 1AH1A 1W72L 3KYMB 2H26B 3MOQA 4FFYH 3ZYIA 2D7NA 1KLFA 4PYHA 1ZVHA 4OLUH 4U1SA 5CIPB 4JPKL 2ZOKA 4BSWA 3S4SB 3RGVB 3PHQB 5D2NA 5BRZE 1DQLH 1SYVB 3CLEL 1RD6A 5DMJB 5C9JB 2AK1L 2HT4D 1P84J 2R2EB 3VXPA 1C7TA 5JIHA 5E9DD 1AJ7L 2NTSP 3RAJL 3RGVC 5ETUB 2IAND 5DD6B 1LEIB 2DF3A 2QQKL 4JJ5A 3O9WB 4PBVC 4F33A 3VA2C 5F9OH 2VQ1A 3U82B 3RKDC 3Q6GH 1MY5A 2X1XR 4ZAKB 5TDPA 4AMKH 5JW4M 1S5HB 5I1LA 1ED3A 5FKPB 1KEML 3DXAA 4NKQB 4S1QH 5T3XH 1JGUH 2VLJE 4ZNCD 4MXVF 4M9OA 3O9WC 3O45B 5F3HA 1JPST 4ZAKC 3TJEL 4NNXA 1CFTA 3FONB 4GG6E 4W4OA 1CD1A 2YUZA 2VDPL 3P0VH 1IL1B 3P4NA 2D0HA 2EKSA 2RB8A 2PTVA 4H26B 4PGCB 1NDGA 4RMUA 1CK0H 1OM3H 1YN6A 5HXMA 1NJ9A 2WQ8A 4JFFA 2BSTA 2Y6SC 5FB8A 4K2UL 4G9DA 3PWUA 1MHCB 1MVUA 1W0YT 5IW6B 1QFHA 2HH0H 3BP5A 4QHMB 1FFNA 2BNUB 1TTUA 4Y16A 3ZKMC 3WL9A 1JVKA 4F8TA 4N5ED 4LLMB 1CE1L 3HZVA 3JTSB 4PTUB 4UILH 4G43A 4OFYA 2R8SL 5D70H 2Q20A 2W65B 4DN3L 3ZTJH 4UT6L 2H6PB 1H3PL 3V0VA 5DJ6B 5HVWA 2IEPA 4NQXB 2SEBA 4A6YA 4JHAH 1KJ2B 3CIQA 3OKNB 4PS4H 5DRZA 4ODUA 3QUMA 5FF6B 3WS6A 3DRQA 4FQ2H 1WT5C 3SCMA 2NY6D 3C5ZD 3OB0K 4YUEL 3JV6B 5IW1A 3CCHB 3SE4C 5DUPH 4P57B 1T89A 4I4WB 2PW1A 2JCCA 3MRGA 5IMLB 3N1GC 3T0EC 1T1XB 1KELH 1MEXL 2VDLH 4JRYB 1RUPL 2FWOA 8CGTA 1XGQB 4Z5RB 1JI2A 3BO8A 3LN4B 3WYRA 4H1LH 5GZOD 4UMGA 4XP1H 4X7TB 4E5XB 1F11B 2HVJA 5GSVA 5CEZH 4QXTA 4K9EL 4L29A 4JR9L 5HYSA 1IZKA 4MA3B 2JB5L 1XCQA 3N85L 5IB2A 2XZCH 3QRGH 3S8WA 1Q1JH 3VH8A 3HI5L 2B1HL 4MA7H 43C9A 4R8WL 3S35X 4LGSB 3MRKA 5C0BB 5F71A 2DMCA 1KG0B 3O6KL 1DLFH 3RL2A 5IWLC 3CDGA 3S36H 4FQQA 4LGPB 5SWSB 1DQDL 5DDHA 2EE6A 3BT2L 4IDJH 1OTUD 2G9HA 5BZWB 2BOCA 2O5ZH 3DETD 1KJVA 4KI5C 4GSDL 1KEGL 3VFNA 2EDYA 1N5YL 4ETQB 3MCKB 4OGYH 3MMEA 3UPCA 3WUZA 5CLTA 2FR4B 4OFPA 1A22B 1T7YA 1VADB 4JVUA 1J8KA 5KVMC 4Y2OA 3DV4B 2UWEE 2BOBB 2XKNA 1CLYH 4WUKL 1EEUA 5FECA 5MERB 3ZKXB 5E95B 1LO5A 2VLKE 1T80A 1WLHA 1NUDA 1YEHL 3PQYA 5E99H 2PKDA 4I13B 4ZOAA 1UH4A 5DURD 2F54E 1EFXB 1MJJB 1CIDA 5J89A 1MFDL 3ZKXC 4YWGL 3WBDA 4XPFH 1Z5LA 5HHOB 1YY9C 1DQJB 5GRVK 3MV8D 4PJHA 2BVYA 4YX2H 2R0KL 5DJ0B 5TQ0H 2ESVE 4WI9A 2W9DH 3D39D 3U7WL 2HG5B 3HPLB 3MJ8A 3WJJC 2IPKB 5IBLC 2DTSA 3P73A 1TVHB 3GKWH 2E6QA 5C09A 1BF8A 4K94C 5I75B 2DICA 5F7DB 4NM4L 3O4LA 4HCRA 1DBAH 3DYPA 5HDOA 1AR1C 1HHKA 5IVZA 1QPPA 2GITB 2UZXB 2IALA 1AO7E 3AFLA 4YDLB 4I8DA 4LSVH 4PRID 3O3BB 2VLME 4FZ8L 3V4UL 3DUHA 5AWNH 5I75C 3ARQA 2DLFL 5GZNC 1F58H 1M71B 4A2LA 5DI8A 3MLVL 1QBAA 4YDLC 5TGBA 3BH8B 3QCUH 4BH8B 4XMKL 1CDGA 3OKEB 3GIZH 4U1IB 3IVKA 2MSPA 4MNHA 4LRIC 3OPZH 4B53A 5C0EA 1QA9B 2X40A 4P5MB 4QHLB 3MLUH 1LK2B 1YN7B 1L0YA 1KXQE 1QSFB 2ZCLL 4HJ0D 4J3OC 1CGSL 3MCLH 3NCEB 4P2QB 5D6CA 3QQ9D 3OMZA 2ZUSA 1MIEL 2R15A 1OTSC 3OAUL 1EO8H 3QUXD 3MRRA 4YDVB 2L7JA 5E8OB 4OF0A 1PBYA 4PJBF 3TFKC 3C5SA 4G42A 4NUGH 4RMTA 3V52H 2GCYA 2B8OT 2FGZA 4RMSA 5BVJB 2RIKA 3CFBA 1BAFH 3W2DH 2MPAH 4WEBH 3WSQH 1J0YA 3RDTD 5CIPH 1NMCB 2V2XA 3FCTA 3UC0L 2VRAA 2VXVH 3L1OL 1S5IL 2F58L 3IF1A 1OSZA 5D8JH 1DANU 3DVNB 1JGUL 3PHSA 3QO1A 5D1XB 1W72A 4P9ML 3T0VA 3G04B 1BEYH 3AVEA 3MC0A 5CHNA 4G8FA 1ZGLA 3EJZD 1NMCC 3LAFA 4NQSA 1GC1L 5MENA 2B5IB 4HWZA 3ZSTA 5C07B 1UB5B 4UT7L 5KS9B 3MXWL 5B4MC 5D1XC 2XIDA 1ORQB 2X42A 5CILH 5GRZA 1IEBB 6FABL 2R4RL 3GMPB 1I1AD 3LQAH 4NC1C 2VXUH 3ZKSD 1CGUA 2B5IC 5DJ8B 1CK0L 4TTDC 4MZ2A 5FHBH 5DHYA 3RUGA 3VFUA 2J8OA 4K8RD 1MHPL 1J1PH 1UZ8A 3PP3K 3VXRE 4QRQB 4XCFL 3MR9A 1S9VB 3IDXL 4DKFL 2J8UF 4KRMB 1UQSB 4RDQG 4TULL 1FVEA 4HHAA 4Y1AE 2XTJE 4G3YH 4ZTOL 1XZ0A 3GDBA 2P8LA 4MXWH 1T1ZB 2AP2A 2XY2A 1UG9A 1NC2A 5I6XB 2R56H 3KLHD 3G6DH 3L3DB 3L9RB 3X3GL 5F72S 5B3JE 1SHMA 2YC1A 4Y5VA 5GS0C 3EYUL 4OB5L 2XWJB 1CICB 4OCSL 3FQWA 3RWDA 3VDAA 2WUCH 3QDGD 3HI1A 3MXVH 1BREA 1F6AA 3MSPA 4PLJD 5DMKB 5I6XC 1CBVH 1R3KA 1RMFH 4NCDA 2FYYB 5DK3A 3PWPD 4KRPD 3FN3A 1CICC 5EG6C 5ESVA 5KBNC 1F00I 4N9OB 2W0FB 4GUPA 3DMMB 1HNGA 1OLZA 2CLZB 3IS0X 4P3DB 2K7PA 4P2RE 5MEOB 5ESAB 2C3HA 1QBBA 3L5WB 1YPZF 3OKDA 5IKCA 2B39A 3SKNA 3DMMC 2NY4D 1FCGA 1XF2A 3QHFH 4MA7L 3DNKA 4OZ4B 5GRJL 3HUJE 3BMWA 2PYED 3FN0H 4W70A 5ADPL 1RUKH 4OCYH 4GOSA 5DFWH 2CUHA 2VH5H 4L3EB 5CD3A 1OY3B 2GT9B 3LEYH 1YJDL 4MVBD 5FUZH 4CVWA 1R3HA 1WBXA 1P4IH 3ARFA 5EORH 3VWJA 4H8WC 5E2TH 5F7KC 1ADQL 2XA8H 4J8RB 4BSVA 4OT1H 5C0CD 4X99B 4MJIB 5LG1A 3K4AA 1RSFA 3PGDB 4PJ5A 5HI4C 3V4PL 1S7QB 1F4YH 4R4ND 4G8EA 3U9UA 1T3FA 5JW3L 2AXGA 3IU3A 3CH8A 4NDMA 3KPRD 3QUZA 3CSYA 4HIXL 3D25A 2WUBH 3RNQB 4P5KA 4LBEA 1TVBA 3O2DL 4R4BB 1JTTA 5AAMA 5AZ2H 1CS6A 2CK0H 4MB3A 2NW2A 1X5IA 4LCWA 4QHNB 4NPYB 5ISZE 4WY7H 4BFEA 1DUZA 2JJSC 4Q6YA 4JZOB 4PRPE 1NCWH 5EA0H 4WWKB 1OTTD 5JUEH 1CGVA 3B9DA 3S98A 4Y4KA 3KPQB 4PJ7F 4Q9QH 5T3XD 3BWAB 3QDMB 1UB6A 1KPRA 2ATKA 1FZKA 4JPVL 3C2SA 1T2JA 1BP3B 4GAJL 5DJDA 1AHWA 2ZCKH 5TFSH 2R2CA 3CVHL 5HGHB 4WWKC 2EDNA 1AKJD 2EYRB 4AIXA 5CBEB 4CRPA 3AAZA 3U7AA 2EE2A 3QIWB 2NLJB 1XF4B 3E3QC 3UTPE 4X7CC 3RVTC 1A47A 3GJFH 3PL6D 4PBXA 5I76A 2ZPKL 4XP6H 5KZCB 3EOBB 2C9AA 4GJTB 4X6CB 4NGHH 4QHKJ 4YXHH 3VFGH 4Z7UA 3TPUB 2FJFB 1EAJA 3QIWC 2EIDA 4IMKA 4M9PA 2YWZA 3QI9B 4L4VE 4HKBA 4GBXB 4UIMB 5GISH 2ZUUA 2R0ZH 4MDIA 4KJQD 1TJHH 1N64L 3LB6D 4TSCH 5F89A 1P6FA 4IOSD 3IFLL 1NEUA 4LASL 3C5JB 4E0RB 4WUUE 1WTGT 3SY0A 3QI9C 4GKNB 5CJQL 1CGYA 4GBXC 3X11A 3FO1B 1FVDB 1IT9H 3REWB 2DQCH 3UJIL 1RY7B 2LU3A 2NNAB 3FZUC 2BY2A 4R7NB 3QULB 3V7AE 4LSSL 1NFIB 1Q9WB 3B9VA 4JQXA 5DXWA 1X4YA 3R06A 2X4TB 5IJVA 4M1CC 4YPJA 4J6RL 1J1OH 3TGXA 5ANMA 1A6VH 3KPPA 4NNYA 2VXVL 3INUH 5E4EB 1JJUA 3QEUB 4I1NB 1WZLA 4MJ6B 1XMWA 4GLRI 2ADIB 3ARED 4XRCB 2GTWB 1UGNA 4QRTA 5DD0L 4Y2DB 4X7SL 3IDJB 1HH9B 4KTYA 1PEWA 2D31A 4XNZB 3H7BB 5E4EC 5HDQH 4MD0B 4F2MA 1T21A 3SEPA 1PLGH 4GQ9H 1KB5L 4HWBH 5J7CC 1MIMH 3C6SA 3O3EA 4Y2DC 3N1FC 1FQ9C 5J1AA 1RULL 3BYYA 3U4BH 3HCVB 4XNZC 1I8IA 3PJSB 5JXEA 5A2LH 1C1EL 1FIGL 4ONHA 4POZC 4LVHB 5KSBE 4MD4B 4PV8B 3V7AG 1VESA 1JZ4A 2JLLA 2QHRH 3HRZA 3G5XB 4U2ZA 3MBXH 1BD2A 5A40E 5B38B 3GI9L 3O6ML 2YZ1A 2V5SA 4H20H 3KPOA 4XCNA 1OGAB 3LS5L 1V7NL 4BQ6A 2YHGA 4IDLA 3AU1B 4JFDD 3V5HA 5IMKB 4LVHC 1CXIA 2E7HA 3QFDA 2FRGP 3WFHB 1D5ZA 5FA4B 5DMGC 2GHWB 2QSVA 4NO5A 3C6LD 2VLRB 1X9QA 3G6DL 4HIJA 3AMLA 2C4XA 3VFSA 4HGKC 2L7UA 1MCIA 4X4XB 3L3HB 5F9JB 4R26H 4ONGL 3IDIB 5E4IA 2NQCA 1IC4H 3WIFA 4P5TD 3RVXD 3MXVL 3WLBA 4HXAL 4BZ1H 2FSEB 5EFIB 2C3XA 3SKJH 4U6VH 3MQIA 5IFHH 5JOPE 1PSKL 4OGZA 5F6HJ 3MRMB 4OZFB 2IAMA 2CMRL 1RAMA 2Y72A 4I2XE 4APQD 4WGWB 5SX5H 1WFNA 1FPTH 1MCCA 2YRLA 5EBGA 3F5WB 4S0SD 1R3JB 4KRLB 4LSRL 1C5DB 3RVUC 2Q6WB 2V9QA 4S1SH 3H9SA 3GIVA 4LPTA 1CFVH 1P9MA 4JO3H 1EGJH 4CMMB 1UACL 5BZDA 4HIIB 5DK2A 5DUBA 1YMMD 3HS0A 5TH2A 4LQFH 4FZEL 4OCYL 3V8CA 1SEQH 3T0BA 3EFDH 2VH5L 2OJZH 4WVRA 3REVB 3U36B 1BMGA 2G2RB 2R29H 1QVOB 1AGCB 1MCBA 4J1UB 1OARH 1IVLA 3UROR 4H1LA 1NUNB 2J1KA 1RHHA 3P77B 3O3DB 5A3ID 4PJDB 4YO0B 4HLJA 1OD9A 4U1MB 2PO6A 2NX5E 3CVIH 1QBLH 1JHTB 2VNCA 4H8WH 1WZ1L 1T22B 3D1MC 1YY8B 2AJVL 3RIAK 3C60D 5JA9A 2WUBL 4IRSA 4PTTB 4Z18A 4TUJB 4JRXE 3P0GB 1C7SA 4AYFA 4BKLA 3SE9L 4XCYB 4OGAC 4ZO7A 5E6IA 4OCWL 2FB4L 2OS7A 2N4IA 1G7LA 3RWFB 3E6HB 1XR8B 5IVXE 4PGDA 2IBZY 4YPGB 5KVGH 5JORA 1CYGA 1ADQA 4NBXB 4NQUA 3AXLA 1X5XA 2R1WB 2J88H 3FOLB 4I0PA 5FYJD 3RGVD 3WKNA 4LFHD 3P9WB 2H32H 4POYA 2XXMB 3DRTB 2R1XB 4G7VL 1G84A 35C8L 3QQ3A 2VL4A 4LMQI 2ZUXA 2FX9L 2KH2B 4Z7QE 3SJVA 1MFAL 4JM4H 4UTBH 3RKDD 1NGYA 4O2EA 2EH8L 3O6FD 3GGWB 3QFJA 5CEYB 1RQ5A 1DBMH 3OF6A 3ZT7A 1HILB 3LRSB 5HVGB 5D2NE 3LV3A 3O9WD 4DGIL 2IPTL 2C3VB 2B0SL 5D2LE 3STLA 4ZAKD 4UDUB 2ZJSL 2UZIH 2NR6C 4LQ1A 3FO9A 2C7UB 1YC7A 1ZXQA 3U0WH 4WFHD 43CAA 5IQ7L 4OAWB 1QR4A 1CXFA 1Y18B 3V6FB 5ALCH 1A4KA 5GIRB 3KVQA 2YD8A 1J8HA 5I1AA 2PW2A 1BIIB 4YQXL 4ZD3H 2DM2A 1X6LA 1RJLB 4HUVB 3VXME 4TVPE 3OKLB 2A77H 2Y6SD 4TVSa 3DXAE 3K2UH 4HGMA 1W0WA 4Q58C 4G80A 4PUBH 5JZ7C 1D5IL 5C0DB 3CVHA 1B4JH 1LO0L 4K7PX 4ZO8A 3ZKMD 5JQ6H 1RUAH 3WFZA 3CMOL 3MBEA 1S78C 4HFWB 3CFEA 1BBJA 2YZ8A 2WW8A 3UDWC 2FECI 2VZVA 2R0WH 1I9IH 2Q86B 4P23B 2E7LA 3GSNB 3HNSH 5LAXB 4PD4K 2A9NL 4U0RB 5KSVB 1R5IA 1P2CB 3ARGA 3BN9C 3ZHDA 4FQCL 4KHTH 3QT2A 1CE6A 1QRNB 1PQZA 3BH9B 2DMBA 1G9NH 1PYWA 4P23C 4PRBA 4PJGA 3HC3H 4U0RC 2M8XA 4AG4H 1FDLH 1K4CA 4V1DA 4Z78B 3KNBA 1MCPH 4PP2A 3T3ME 1IKFL 3RX8A 1P5UA 1GAFH 1L9MA 2QV2A 1EHAA 3L5HA 4JKPL 4Z7NF 3HZMA 5HPMB 4MHHI 4Z7WB 4AJ0A 1D5XA 1OVZA 2E8ZA 4FNLL 4XVJL 2ARWA 3TVMA 2EXWC 4JRYD 1T4KB 3MRCB 5DD3L 2VSDA 3GBNL 5FXCH 4XMLL 3MNWA 2FLBT 3WE6B 5KJRH 1QHPA 4YIQB 2FLRT 4KFZC 5IFJA 4WWID 4X5WB 2D0FA 5D72H 5FYKH 1NEZA 1B0RB 4LVNB 1LP9E 1OAZH 2K3TA 3HB3C 4GRMA 4QRRB 2GJZB 2AK4D 3MUJA 3W0WA 1N0LA 1A3RH 5IB5A 3CFCH 2YRZA 4GXVH 5DJCB 1EVTC 5TE4H 1KF9B 3LKSA 4KI5D 1U8IB 3ARPA 4LVNC 2WINA 1KTLB 3QUYB 3W39B 2BVTA 5C0BD 2FH6A 4PJAB 4YXKH 2JIXA 1NFDB 2HN7A 1KB5A 1F4XL 2X1QA 3DGGB 3MO1A 1NDMB 5T1KB 5SWSD 3TBYA 2NY1B 4EI6B 1FL6A 4MGXA 4WV1A 4C56A 4N1HB 2H8PB 1FZOA 3QUYC 3QZWA 2DQEH 4J3TA 1NCNA 1AD0A 3DURA 5IV2A 1CFNB 3C08H 4MQ7B 1U42A 5BS0A 4ODWB 1EH9A 2NY1C 3QXTA 4HUXB 1I8LA 1S7VB 1NAML 4G5ZL 2IC2A 3KPLB 4IOIB 4OLVH 4O51B 4WI3A 1YEIH 1OQOA 1VFUA 4DZ8A 1RUMH 1FO0B 1JHLH 5I1CH 3T04D 3AMKA 2YN3A 1Z9LA 1YY9D 1XH3B 3MV7B 1W0VB 4S1SL 4HUWB 2FIRT 2MJWA 3LPGA 5KTEL 4HF5L 1EFXD 3S5LA 2CO7B 4OZFH 4OI9A 4ZOEA 4GKOA 4LHUB 5IBLD 5HYSG 5HHOD 1RFDH 3OXSB 5CUSL 3KLAB 1LE9B 5L8LB 3JWOH 4R96B 4ZUWB 1UM5H 1AR1D 2AGJL 4RGNB 2VXQH 5B8CB 3EGSB 4XT1C 2EYSA 5C08B 3QQ4A 3TT1L 5D7IB 1MJ8L 4OGXH 1XF5A 3TEUA 2GEEA 4HH8A 3Q6FB 1XGPA 4RFOH 1JGEA 1FV1A 4RGNC 5B8CC 1TJIH 4FP8H 5GZND 3T65B 1I7UB 3WIIH 5CAYB 4Z7VB 3SDXB 1MFEL 2X4NA 4QTIH 4Y4HB 4TPRH 1BLNB 2WLZA 3D2UB 2BSRB 3GMNB 2EZ0C 4XXDA 2VR5A 1J5OH 3PIQA 3KYAA 3X13B 2X89A 4EVNA 5C09E 1TTGA 4UQ3B 2F19H 2J7LA 4QHUB 2VE6B 3FFCE 5DJ2A 4Y4HC 2H9GA 1B0GA 1JE6A 4JY5H 3ZHLA 2XT1B 5IHUL 2YKLH 1S9XA 5KVDH 2VYRE 3TBTA 4JM2B 1FCCA 1DE4A 4QCIB 2CIKB 5IR1B 5KSUA 4O2CA 1MRFH 1E4XI 1HH6B 5DSCA 1BZ7A 3CXHJ 1ACYH 4CNIB 3TFKD 1FH5H 1QSFD 4OF5A 4P2QD 4JM2C 1JPFA 3HI6L 4B7LA 5BMFL 1QNZH 2D7TH 2HKFH 4DCQA 1LQSR 4RZCB 1KACB 3ZTNL 1YDPA 2NYYC 2D9CA 5DMYA 5IB1B 4D0DB 1INQB 1OAYL 3AUVA 2PTTB 2G5BA 3FQTA 3K2MC 2XQYG 1ZVSB 4X6FB 5GRUL 4P48A 4ODSL 1TJGL 3DHJA 5D9SA 4PJXE 1U8QB 3O41B 1HCFX 5DO2C 4X9FA 5DRWA 3K8LA 3X14B 3D69B 1YYML 1PX4A 3U7YH 5B4MD 2VUYA 2G5RA 4QXGH 5D1XD 4ZPVB 4HWUA 1QOKA 1E4KC 4L4JA 5EZOH 2V7HB 4I9WD 1M4KA 4TTDD 3AM8A 5C07D 4QXWA 1OAUH 5FK9A 5I1EL 2YD3A 1KIRA 2QSCL 1GYAA 3RFZC 2A73A 1MF2L 3GNML 2BVPA 2DQIL 4G8IB 5I17B 1CTOA 1AXSA 5FUCC 1ZA3B 1WEJH 5KANI 3ZDXE 1HQ4B 3TCLA 5ADOH 4JY4B 1D5BB 5HHPB 3BKML 2DQUL 5EU7C 2IPUK 4LEOB 5JPNA 4NHUA 4UU9B 1JTOA 1R5VA 4JZNA 5GS0D 3WNMA 2VDOL 2CKBL 3DWTA 4LL9A 4NQTA 2AEQL 5E2JA 4TUOB 4YBLB 3RUGE 3BPLB 5FOBA 2FECL 3WNOA 4Z77A 2F5BH 4DZBB 5ITBL 4EXKA 3WD5H 3WKMH 1BGXL 4NO3B 4RAVB 1P4BL 1CICD 2E5EA 4D0BA 4NZRL 1Z0MA 3S96A 4K3JL 3WO4B 4YBLC 1Q72H 5DJXA 1EFQA 2C4FU 3BPLC 3VFTB 4HZLA 3BZDA 3SHSA 5BXFA 4K7PL 2VZ1A 3D9AH 4QNPF 1BFVH 5IHZA 4YHMH 5AD0A 3Q3GB 3PV6A 3VCLA 3WO4C 2D9QB 4NQDE 2FJGA 5KAQF 1JPGA 2F8OA 3F58L 2RQ8A 3DMMD 5LWYL 5D7LB 1RK0B 3VXNB 3ZE0E 3BP6A 4TRPL 3EYFA 3OR6B 4MQTB 3WFDL 3S36X 2V5RA 1R0AL 5JIPA 4AENA 2HRPL 4ZFOL 1P7KB 1P4LB 2QSQA 1H9VA 2CXKA 3AY4C 2X05A 4KI5F 5HHQA 3BPOB 1IQWH 3T0AA 4PV9A 4OZIB 4NFBA 1I4FA 1KTRL 3MUGA 5E5MB 2Q3ZA 2VO5A 2A6IA 2CPCA 4R9HA 4JCMA 1BQHA 2YD5A 4L3ED 1D6EA 4PJ8B 2BSSA 2CJUL 3BPOC 5E08H 5HI4D 3MGOA 4JN2B 2FJHA 1QUNA 4P4RA 4XCEA 1JWUB 3RL1B 3VXSB 5FOJA 4LLVB 5L88H 1MCRA 4PJBA 4UV7L 4FQPA 3QISA 1ZHNA 4MJID 4ORGA 1XR9B 3BXNB 2GK2A 4CVXB 4PJ8C 3IYLW 3QH3B 4RMVA 5ID0A 4K8RL 3EZJB 1DDHB 3A6CH 3PNWA 3SGKC 3IETB 4ZUTA 1IGJA 3BHBA 3PP4L 4YHKH 2HKHL 1A6ZA 3QJFA 4R6UA 2XWBA 4N0UB 1SVCP 3O11A 3JVGA 1G6RL 4WRLA 1PG7L 1QLEL 2VDRH 4NZJA 1A2YA 1CG9A 1EXUA 5IMMB 1I3