2GFBB

Crystal structure of a catalytic fab having esterase-like activity
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
DVKLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARGDYYGSRGAYWGQGTLVTVSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2A CNJ206 FAB (LIGHT CHAIN)
publication title Crystal structure of a catalytic antibody Fab with esterase-like activity.
pubmed doi rcsb
total genus 41
structure length 219
sequence length 219
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 1994-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gfbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gfbB01
3ARFB 1WTGT 4MAUH 2HWZL 4P46B 1YEGH 3NIFF 3AREA 2WW8A 4LBEA 2UV3A 4XI5C 4RFNB 4W4OA 4RX4A 4GLRI 1BLNA 4IJ3C 4Z7UE 4YIQB 4FTVA 2APXA 4M48L 5I75C 2QADD 3K1KC 4ODVL 4JQIL 4EN3D 3HZKB 4CN6A 4HPYH 3ES6A 4WVRA 4OCXH 4L3CA 3QXAB 3LKSB 3V4PH 4QTIL 5E8DH 4CU6A 4CRPA 4PREB 5GGVL 1U41A 3V6FB 1K5NB 5C07A 1VSCA 1CGTA 2BY1A 1JYXA 2GAZB 3DRTB 4HJ0C 3QR2A 2FH6A 4Y19B 4IBLT 1UB6B 1FCGA 4JO4L 3ME0A 3ZDYF 4G80A 5IT2H 3VFVA 4QRSB 3FQWA 4LPXA 1LE5B 1BBDL 1AY1L 2ESVB 3L5XH 4PRHD 3KPOA 4PB9H 1YUHA 4X6FB 4GW5B 1T5WA 3BVNB 2VSDA 3BXNA 4PY7A 5EZOH 4PGBA 3D3VD 3O3EB 3MRKB 4WV1B 4XP4L 2H6PA 5CAYB 4WO4D 4OUUA 4YAQB 5HYFA 1U8MB 1UKSA 4HG4J 1ZLUH 1OB1B 2DL2A 5DEGA 2DAVA 4TUJA 1OAYL 3IDIA 1J1XL 5T3XL 4DK3A 1A3QA 5KVEH 2YK1L 5LWYH 5A3IC 4G42B 3D0VA 2X1XR 1DN2A 5CJOL 3G9VA 1DBMH 3EOYG 2E5EA 5SWZD 3WD5H 1KCVH 1F2QA 3IS0X 3QIWC 4UOJA 1LILA 5HGHB 2JJVA 2AXGA 2YKLH 4PJ7E 2ADGA 5F71A 5JIHA 2KPNA 4X5XB 2Z35A 4E41A 5TF1L 3RWFA 5FKAA 4WI3A 5IVXA 4HEPG 1A1MA 1JV5B 1YPZF 1I3RA 3AROA 4JANA 5JLZA 1KENH 2GHWB 1VPOL 4XH2A 3RY6C 1E6JL 3VD9A 2R23B 3DX9A 3IVKB 2X1PA 1FZJA 4PTTB 1NLDH 2ITCA 1X4ZA 3HG1D 3P73A 1QLFB 5F7FA 4X0KA 2FL5A 2OSLB 4PJIE 1KBGL 2HAZA 5MHSE 5I0DA 3TT3H 1DLHA 2DQHL 4OIIH 5SWQB 1ACYH 5EC2B 4RNRB 4YHYB 4UU9A 4Z7VF 3BOVA 1I9JH 5F93C 2IALB 4NZUH 2JB6B 4GUPA 4XPAH 1WWWX 5C2UB 4PJXB 4PP1C 3VXOA 2EH7L 4P3DA 5JMOC 3QQ4A 2IGFL 2J12B 2YBRA 4P2OD 1RJZA 4Y0GA 1Q9KA 4UTBH 5DDHA 3TIDA 1UYWH 1MY7A 1AXSA 3DETD 2Q86B 4HLZG 2Q8BL 4FQ2H 4X9FA 3SKUD 1GZPB 3EO1B 3VGBA 2F8VA 2R15A 4PRAB 2P8LA 1N0XH 1LD9A 2FGWL 4R0LB 5HI5C 4PRIA 5DD1L 4JPKH 1FVCA 4HDIA 5IR1B 2BOBA 5IQ7L 2EIDA 3R0NA 5HHVL 5D7JD 4KK6D 3EFDH 3QUYC 1KC5H 2HYMA 1D7FA 5HPOA 4IS6B 1T03H 4YHMH 3U0WH 1NMAL 3V0VB 2EE3A 2CIKA 3RVUD 4WU7B 5CS7A 4ALAH 2H8PA 1CDIA 3TPKA 3JVGA 3CFJB 1DANU 4J4PC 3UBXG 4OFYD 3HC3H 1UM5L 4NYLA 3WJJC 5BS0E 4JRYA 1GGIH 2JJUA 2HLFD 4CN4A 4LLMA 4OCRH 4YBLB 4ETQA 3UJIL 4HPOH 2FO1A 4BSVB 4JFDD 1IM9B 4LSUL 1QSEA 3HAEG 5TDNA 2R4SL 1J0JA 1E27A 1KCLA 2E7HA 1KIRB 1TFHA 5DXWA 4FP8L 4KZEL 4M8VA 2H2PC 2QSVA 5D7IA 4TNWK 1F11B 1ZOXA 1ORSA 4QEGA 1ZS8A 1Z3GH 3DV4B 1I8LA 2DQTH 3PDGA 1K4DB 3L5JA 3FRUB 4NQXB 4AEEA 4J8RA 3HE7B 3MJGX 3FTGB 1W72H 2ZUQB 1NCNA 2M26A 5H2BB 5DD5L 3QNYB 4IHOA 3DUUB 2VL4A 4EDXB 4K71B 2HFGL 1EFXD 1T2QL 5ALBH 4NP4L 4I3RH 2AJ3A 3GSWB 3LKQB 3D18A 1GPOL 2Z31A 2VDPH 1DEDA 4WNQA 1A4KA 2E6PA 5HVFB 1P69B 1X9QA 3QWRA 3BUTA 3TPUA 1ZT4B 4E5XB 1C5CL 4TULH 3KPRD 4NDMB 5K9KB 4JGMA 4KJQD 3QEQB 3T09A 2EDXA 4MXVF 3V5DB 1XGYL 4JFFB 5JTWA 1AO7D 3ARUA 2EDOA 2HRLA 3O6KH 5TF0A 2FATH 3GIVA 4IIQA 4RGOL 3OHXA 3L3GA 2WQ8A 3ZKXB 2YD5A 1PGRB 1SYVB 3DLQR 3KWWA 4P57B 3O3DA 1FZKB 3EHBC 4MVBC 3KPMB 4KUZL 4LRIA 3H3KA 4NNXB 3D85B 4TVPE 5CHNB 3K81A 2CQVA 3U2SB 4YUEH 1BFVL 3P40A 1ADQL 1JNJA 1H8NA 3VH8A 1IGTB 2IFGA 2X4PB 1WICA 1A6ZA 1GHFL 3C8HA 5CWSA 2BOCA 2HMID 3V7MA 1EEYA 4ZPVB 4KWUA 5I17A 5E08L 4UV7H 3UO1H 1JPSH 2C1OA 1DFBH 3PGCB 1SJEB 1TZGH 3QI9B 1MJ7H 2PO6B 1RK0A 5E6ID 2I24N 3B5TA 3RAJL 5JHDB 3PL6C 5I9QC 1NGXA 3KYKL 2PYED 5EOTA 1XH3B 3U36A 4PYGA 3VD3A 2ZJSL 3M07A 3GMPA 4F7PA 2AGJH 3DI2B 3W0WE 3W82A 3K74B 4OZ4A 1TMCB 1J0KA 3CMOH 3NCFB 1TITA 1KTKE 3SCMB 5I1DA 2MQCA 4MMZC 3K3QA 1OD9A 4WHTB 4JZJB 2R8SH 1D6VH 1XIWA 5JZ7C 5AAWA 2MMXA 3GMLA 3VFOA 4WTZG 1KLUA 4L3ED 3LPWA 3QZWB 7FABL 4GQPH 5AWNL 4POUB 2BSSA 5T5FL 4OZIB 2WBJB 3QWOB 1S7XB 1B6UA 2DYPD 2CDGA 2AI0L 4TNVK 3UTPE 3W2DH 4UDTA 1WWCA 4OQ1A 3QQ3B 3TNNB 4XVSL 4QRUB 1OF2B 5IGXH 3LB6D 3LPFA 1V7NH 3VXUD 3VI3E 1MCHA 1N2RB 2DQIL 4GKOA 4URTB 3IETA 1GJIA 3MRBB 1ZVYA 4M3JA 2W60B 3QUMA 3T1FB 1FV1B 2R2EA 3C08H 3SQBA 5ADOH 4Z76B 3HPJA 4KHTL 3T0EA 4LPWA 5F1SA 3CXDL 4R97B 1L4IA 3G5VB 4KQ4H 3UJTL 3LQMA 1DEEB 2DQEH 4HQQH 3RDTA 2X41A 5DFVC 4UT7L 2ICWI 4KXZH 1MCBA 2NX5E 5MP6H 1VADB 1MNUH 4M6OL 4Y5XB 5FGBC 5FHBL 5DJXA 4BUHA 1RVFL 4M5YH 3UTQA 1T04A 1MI5B 1X5XA 3WJLC 5DC4B 3DROB 3VGAC 4HKZB 3HNVL 1MH5B 2E9WA 2BNRE 5A16A 2DIJA 3VWKD 4K3DH 5DK0B 1KB9J 3O6LH 1RAMA 3RUGA 1HINH 3SBWA 3BPCB 1VKXB 4FQXA 1DE4B 1A3RL 1RMFH 3MLZH 4GBXB 4M7ZC 1QFUH 2XA8H 1KUMA 2FX9L 3RVWD 1NDGB 1G7HB 1V8HA 5J6HA 4PRBB 4Z77B 1V05A 5B22A 1KN2L 2CK0H 4XCYA 4Y2OA 3D6GA 3JTTA 1J8HD 3TJHC 3ILQC 4Z7UB 1BVKA 5TDPA 3NAAL 2R4RL 3MLWL 3QJHA 4R7DB 3G6JE 3F6LA 3A6BL 4KMTL 4U1GC 4PRNB 3VGGA 4QHLA 2LU4A 3UZQA 3KPSA 2ICCA 2PTTB 4QRRB 3LSOB 5EOCH 1Q9WB 1P84K 3AM8A 4HWEL 1GGYA 2Y6SC 2YRZA 2OTUB 2YN5A 4I48B 3IDGB 4GAGH 1MIML 1SEQH 2HLAA 3MLVL 3O3BB 4HKJA 2PYFB 2NQCA 3BISA 1U8JB 1TQCC 2RR3A 2VAJA 4L9LB 3DECA 4FXKA 2WLZA 1B0GA 4U1MA 5T3XD 2NXZC 3SJVA 3T77A 5ISZB 3FOMB 3QQNA 4ZS6C 4GLRH 3GMOB 1SEBA 4OLUL 4ONGL 5HPMA 1WFOA 3MBXL 1VACB 4L5FH 4C58B 2I60H 4Y16B 2CIIA 2COQA 2NZ9D 5B38A 2YMXH 2B1AL 4PFEA 4ZUTB 1OSPL 4LK4A 3CVIL 4LIQE 1P7QB 4FMKA 3IDUA 3P77A 4MNHA 4H8WL 3K2UL 3TH3T 4Q2ZB 2J8UB 3O2DL 1MHCB 4ESKA 2YUXA 3MBED 1JGDB 3SGDI 4F7MA 1CGWA 2VUOA 1PG7X 3L5WA 1NJ9B 1MFCH 5HYQB 5CD5C 4OZFB 4YBQD 5CEXB 4PJ7B 4EN3A 3WDJA 4O02H 2FBOJ 2VUYA 3TBTA 5EA0H 4CW1A 1PG7H 4OIBA 5F9OH 1MWAL 1F90H 4APQD 3L7EA 3CSYA 3RWDB 1FE8L 2NMSA 3WEXB 1HDMB 1TETL 2PW2B 3GNMH 4OD3H 5JW5A 4PJDF 4HKBB 3AXLA 2VC2H 4K3JL 5IHUH 4NGHH 5F6HI 3ZTJG 4M6NL 5BVJA 2ZUUA 2B1HH 1BVLA 4NO2A 1MCSA 1QBLH 4YHNA 4PRHA 2FB4L 1U8PA 3WLWD 3SDCD 3U7YL 1G9MH 3ZL4H 1A4JA 3L3IA 4ZXBC 3WFBL 3DV6B 5F96L 4NM8H 3SE3C 3D3VA 5TGBB 1KG0A 4WO4A 5E8NA 5CKAA 1B0RA 3HMXA 5C0EB 5JUEH 5L6YH 4KK5D 1OW0C 4P23B 4HWBH 1L9MA 4R4FH 4Z7WA 4G9FD 1T66D 4OCWL 4WEUD 1CGUA 2BC4A 2APVA 2JJSA 5SWZA 2NY5H 3GSUB 3UYPA 3OKMB 3UX9B 1KPRA 3BEVB 4CN1A 5E1AA 3LQZA 4TOYH 3B9KB 4KZDH 3V6OC 3WCYA 3ZTNL 2P47B 1R24A 3JZ7A 3MUGA 2Y4SA 5EULV 3GBNH 5GRUH 4OD2B 5E5UB 5IHZA 2GTWB 2VISB 2FIKA 3IJYB 4G7YL 1R5VB 1ZE3C 5HHQB 5I16A 5ETUB 3BHBA 1CXKA 3G5XA 1Q9OB 4JGUA 2JCCE 4IMLA 5I1GH 1N6VA 2DM4A 4PV9A 5ICXB 5JOEA 2BMKB 2DLFH 4RFNC 4O51B 3HG1A 4Y8DC 1JGVL 3T65B 5IMMB 4Y4KB 5KG9B 1DVFB 2EZ0C 1U9KA 3WFZA 3FQUA 5DRXA 4QF1B 3K0WA 4R26L 2HVJB 2GJJA 2QSCL 2YUWA 5HI3D 1CDHA 1FNEA 4KK8C 5D6CA 4ZAKB 4PLJD 3GM8A 1S9WA 5T3ZD 3MJ9L 4NN6B 2X70A 1KCUH 4N0UB 1T1WB 4C83B 3OKLA 1ZV5A 4YDIL 4P2OA 3RGHA 1EVUA 2EDWA 2V5MA 2W0KA 4QCIA 4XHJD 4OKVB 3DVNA 1UJ3A 4RAHA 4UOW0 5CSGA 4ZS7H 1KT2B 2EC9T 5L7XH 3B6SA 4LSQL 2NW2B 4RFOH 5AEAA 4PJ5E 5I18H 5DMKB 5BRZB 5I8CB 3FB5B 3TVMD 3ZDYE 1X5LA 2CLVB 1MFAH 2OL3H 43C9B 1J12A 3B2UD 3OKEA 2VKWA 3RZCC 3V6OE 4IRJB 3KLSA 5E00B 5ICYB 5D7JA 3KPLB 3TWCH 4M62H 1M7IB 4YPJA 3ESUF 5CCKL 2ZUWA 1MCCA 4JRWA 4Q7DA 4HFUL 1YYMH 1DQML 3AY4A 5AD0A 2V7HA 2Y5TA 3E1F1 1U8KA 3QHZH 2OK0L 1ED3A 5F8RC 4PJEA 4UBDC 4QXUH 5ESAB 3CCHA 4L8CB 3MNVB 4ONHB 3QFJD 5IVOA 4OFYA 4KDWA 4XCCH 4AQ1B 4X6DF 3PWUB 3LKOB 3QISA 4U1HA 2V2XA 1QLRA 4YJZL 4M43H 4KRPD 2UVEA 2FBJL 1UB5A 4JFDA 4ZODA 5E8EA 1IEAA 3GRWH 1OGAD 1T0MB 3MV7D 3DSFH 1JWUA 4NRZB 2AJUH 4NQCE 5KSBE 3SKMB 3O9WD 3TA3C 1QNZH 3PJSB 1N26A 4IOFD 4OT1H 3B2VL 1DN0B 1Z5LA 4LCWD 5L0QB 5HHOB 1JE6A 4HIIB 4OQTL 1OP9A 1YPZE 4UV4H 4DOHB 3GSOB 4OD1H 1INEL 5HHMB 3QIBB 2OBGA 3BZEB 2CR3A 1I1AC 4UT9L 3NH7H 3LD8C 3KS0J 3CFBA 5LVEA 2EE2A 2FO4B 1HZHL 3SKOA 4OGYH 2GJZA 4LCUB 2UWEA 5KSAD 4PGJA 4HXBH 1DQJB 4JO2H 1BX2A 1D5ZB 2ICEA 3L5IA 5IG7B 1EFXA 1ZA6B 5E5MA 5L2KD 2XKSA 5LCVL 4QHMB 4Z7VE 4R3SA 3WS3A 2DTMH 4FQPA 1KGCD 35C8H 1XCQA 2EO9A 3VFPA 3LN5A 3KPRA 2D9QB 1MUJA 2Z93B 2BNQD 3EZJB 5I30L 5ESQB 2DQCH 1AO7A 1PKQA 1T4KA 1X5FA 3HI5L 2DRUA 4KJWD 2R0WH 4PD4J 5GJTL 3S37L 4MAYD 4LDLB 4LARL 1OQXA 1HWHB 3IB4A 5T1MA 4XP6H 4FMFA 5E1HB 1HH6A 4YHLL 4R7NA 4NZJA 4R2GB 3DVGB 4R0LC 5TQ2L 4WFFE 3RKDC 2PXYD 3BZFA 4L4VE 4QTHA 3MRNB 3PQYB 4BQCA 2YD1A 3ZLQC 3B9DA 1V3JA 2Z91A 4IMKA 4UUJB 5C0CE 4C59B 2VYRE 5F3BB 5IW6A 3T0DA 1S5IL 5IV2A 3ARBC 3UDWA 3FL7A 2QSTA 1IGYB 1A9BA 1T1XB 4M02A 2VSCA 4D3CH 3QDGE 1BOYA 2XACC 1I4FA 4XAWH 2CUHA 5DS8A 5CJQH 1FRGH 2CLZA 4DKEL 5KSUA 3WN5C 2PYEA 1CF8L 2H3NA 2DLGA 1GIGL 2R2HB 4PJ9B 4PJFA 4E9LA 1N5AA 3EOAA 4OLVL 1CLZL 5E8PA 3EDKA 1CGXA 1OAZL 1P9MC 4NUGH 4PJAA 4P49A 5DRNA 2AERT 4AENA 3QUXB 4LGSB 1YNTA 3NPSC 4GS7C 5D1ZB 1PFCA 3GKWH 3BO8A 5C6TL 5CILH 3HE7C 4QGTA 2BNRB 3U0PA 2CKBA 1OOAA 5DGRA 3THMH 3BH8B 4RFEA 1ZANL 2XZAH 4L3EA 1KCRH 1IGFL 5E24E 1IC1A 5J9PB 4KVCH 4J6RH 2FECI 3U4BH 5HYSB 4MDIB 5GXBB 3GSNL 2DYPA 5SWSE 3RL2B 5DUML 3UTTB 2GFBB 3CXHK 4L4TD 2DQGL 3VU2A 5TPWL 5DO2D 4CVZB 5AG9A 1K8DB 3VXUA 4WHDA 3WIIH 1YDPB 2ZOLA 4MQSB 4X4ME 5HYJD 1RIHH 4P3CH 1LP9B 4TVPL 1ZSDA 3BESR 3MRCB 4YWGH 5F7YC 3PWPB 2QHLA 1C5BH 4MXVE 3H9SB 1J1PH 4KRNA 4X7CC 3HZVB 2VDKH 1KJ3L 5EZJB 4LVEA 4A6YA 2CJUH 4H5SA 4YXHL 3MROA 4LSRH 3WIFB 1BZ7A 4I0KA 4UQ3A 2Y1VA 4OZGB 2DBLL 4LLUB 1K9TA 4LGRB 1BD2D 2KBGA 2F9BT 1J11A 1DQDH 3MODL 2O61B 4B53A 1AE6H 1G9NC 5FCUL 1X5AA 3MRPA 3EYUL 1JPTH 2EYTA 3GIZL 5JHLH 5FKPB 5FGSA 3ULVH 2H26B 5JOFB 1YN6B 2OMNA 2F58H 2ZKHH 1Y6KR 1MJJB 1FAIH 3VWKA 5KS9B 4ODHH 1QHPA 2AABH 4RGNB 1YEEL 4MHHG 3FN3A 1G7LB 3BKJH 2SEBA 4OCNC 1FNGA 1F58L 4S0SD 1WIPA 3F65A 4G8IB 4PLKC 2GJ6D 3UTSB 4B0MM 1JHLH 2LU3A 2DKUA 3QO0B 4MNQE 1J8HA 2ARWA 3V6ZA 4BQ8A 4F7CA 1UH2A 3WNKA 2FJGB 1VGEH 2X4SB 1HHHB 4RWHA 3QEUA 4JZJC 4JJ5B 5AZ2H 4GW4B 1EEZB 2YEZA 1K4CA 2VLKD 4U31A 2OS7A 1XFPA 3CZFA 4KJYA 2HRPH 1U8NB 3OKKB 2AV1B 3WNLA 3IDJA 3RL1A 2R1XA 2J8HA 3CVHL 4D0DA 5B8CA 2P1YA 5EOQH 1RZKC 3SGDH 3VWJC 5HDQH 1NGWB 1I9IH 1U3HB 5KW9L 1MHPL 5LBSL 2C9AA 1A7QL 4RAVA 5T1DH 4DFIA 4NWUL 5CJBA 1UG9A 2P24B 1JGLL 3TBSB 4PLOB 5DK3A 1M05B 2WWKO 3EOBB 4X6EA 1UT9A 5FYJD 3RNQB 4L8BB 3FB7B 4IRZH 1FG2B 4DVRH 2H32A 2XWTA 3MBEA 3BQUD 4LCCC 4Y5XC 3VXME 3MRGA 4PRPE 3V5HB 4NQDE 3BUYA 5BMFH 2I9LB 1AHWC 4HG4K 3NABL 1S7WA 1XF4A 1KN4H 2V5RA 2AEQH 4TTDC 1LE9A 3P11H 1PG7W 4U2YA 4APQA 4LLQB 3CK0L 3FZUD 4QT5A 4TRPH 2ARJB 4Q0XL 4TSBL 4JY6A 1J0IA 1WCQA 3SOBH 4MB5A 1SJVA 2CGRH 5FUOL 5FYKE 4XXDB 3U4AA 3O3AB 3RPIB 3NZ8A 3UMTA 3HZYA 4CU7A 5D7SH 3K1DA 3MX0A 4XXCA 3SDCA 3NFSH 1F00I 2KZ1B 4L8SC 2E7BA 1FZOA 3LY6A 3MREB 5DVKA 3ARSA 2BHZA 3MRHA 4ZQKB 1MIEH 4XI5D 3DIFB 4ISVA 1JZ6A 1G84A 2P8MB 3UZVB 3T3MF 4Q9BA 1EHXA 1IE5A 4G9FA 3EYOA 3QXUA 4JM4L 2E7LA 3VRLF 4FQHA 4LIQL 4AM0A 4S1RH 4N90E 3MRQA 4OSUH 5EPMB 1IILE 4XRCA 1H8SA 5JR1H 1CG9B 3C9NA 3VDBA 5T1LD 4N9GA 3MSPA 2OTWA 2RBLA 3LOWA 2HFEB 3BD3A 2YHGA 5JA9A 4HJ0D 4S1QL 4XPBH 4ZSOA 1TVDA 4A2MA 2NW3A 5AG8A 3O8XB 4P5TB 4X4XA 1GGCL 1L7IH 1YEFL 3MJ8B 1U93B 4X99B 3RX5A 4D0BA 1CLYH 2XZCH 1NC4B 1ETZB 1AQKH 4Z7QF 1XF3B 5I76A 5MHSD 3L3JB 3NMEA 2HJFB 5DD6B 1ZLSL 1ZTXH 2BVQA 4MZ3A 1A5FH 2MNUA 3KJ6L 3KPTA 3GDBA 3MLUL 1AXTL 3CUPA 2W0FB 3F5WB 4YXKH 1KCSH 4ONFH 5H37H 5E6YA 5EBWB 1LMKA 5KSBB 2O5XH 5DJZA 5A3ID 1AGDB 1X5HA 2VR4A 4U1SA 5F3HB 4GG6B 1NMCC 4LKCA 3QIWD 1I85A 5KSVA 4RISL 1PEZA 3QHFL 3C87A 5HTSA 5ADPH 2BRRL 4AG4H 3FQRA 2ZWLT 4UIKL 2EYSA 2G60L 1HXYA 3OAUH 3QJFA 3VMOA 3NIGF 4PJDE 3TVMA 5KZCB 1IFHL 4M6AA 4YHZH 2ATKA 4JFQB 3GJFB 1F4AA 4TQEH 3GK8L 4MJIE 5DZNA 1HH9A 2XN9E 2HFFA 2DWEA 2R0LL 4H1LA 3GKZA 4WWKC 1BJMA 1QBML 3CLFH 1KEGL 2GT9A 2W9LA 5BS0D 4HZLA 2YN3A 3DX7A 3HMWH 5ITBH 3HLAB 1ADQA 4NO5B 2D0HA 1AC6A 1RK1B 3LV3B 1KOAA 4D8PB 3TIEB 3QFJA 4KKLC 4WFEE 4PP2A 1INDH 1S9VB 5I1CL 5AUMA 4IOIA 3R06B 3MXWH 4LAQH 1U8LB 4PP1D 4GO6B 1OGAA 5INDA 3SE9L 1TLKA 3MV7A 4ZO6A 4YO0A 1OARH 3STLA 2FEEL 5C0GB 2E8ZA 1UCBL 4NHCH 2XNAA 1KXTB 2ZNWA 2Q7NA 3O9WA 4M5ZH 4Y4HB 1IARB 5I1LB 5D2NB 3GBLA 5IUSA 3KXFB 3OR6A 2AXFA 1FL6A 4D9QE 4LCWA 2C3VB 4FFYL 1S7RB 1RY7B 3LH2L 1B2WL 1ZHKA 2IADB 4NWTL 4HS6B 5HI5D 4Z8FH 5E94B 3I50L 2F53E 2RGSA 2W59A 1OTTC 3BW9B 4ZUWA 4NFDA 4X9BA 3UJJH 3QUYD 4XNXL 1DVFC 1MRCH 2BY2A 5KSAA 4I4WA 1H3UA 1BQLL 3ULUH 3M1BB 4OZHA 1IC5H 2XTJB 3PP4L 2YPLE 5L2KA 3X13B 5GRYA 1YY8B 4J4PD 1P1ZB 4YPGA 4ZAKC 2ED8A 1FGVL 4F3FB 4N8VG 5EWIL 4ZUVA 1A1OA 2FDBP 5ALCL 3IDYB 5FB8A 1RV6X 2BNQA 3C6SB 3OWEA 1DUYB 5D93B 1LHZA 3MO1A 2YPKB 4MAYA 3X11B 3F7YB 1JZ4A 2H2PD 5JO5A 5IFJA 4S2SA 1NFDA 2X4RA 1G6RH 3G5ZA 4CDHA 3TBVB 5EO9A 4IRJC 2PXYA 3KPNA 1P4BH 3QULA 5EO1A 1YC8A 2CDFA 5FO9A 1G1CA 2HTLC 4U3XA 3D2UB 1Q72L 4LCYA 4OFIA 3S3PA 2WIIA 5JW4M 2VLRE 4NFCA 3T0AA 2C5DC 2Z9TA 2FHCA 1CQKA 1D6EB 3FT3B 1NUNB 1L0QA 4G8GB 4DN3L 3IU4L 4X9GA 1FGNH 5EOCJ 5C0JB 4X6DE 1P7HL 3W0WD 1F3JB 1SBSL 1D5MA 3MLYH 4FZ8H 1MCOH 1PJ9A 3HC0A 4XBEL 4LHJB 2WV3A 3X14B 3UTZA 5DMGC 1RUKH 3QXWA 1G7IB 1JMZA 1XGTA 2X05A 4EI5B 4KTEL 4Z95L 4GRLC 1MREL 3U9UB 1IAKA 4H0HB 5GJSL 3EHBD 5CEYB 4MVBD 4WDIA 3L1OH 3OGOE 5J1AA 4GAFB 4HCRA 4FTVE 3U6RA 2H1PH 5FYLH 4LNRB 2IG2H 2VTFA 1R3JB 1LO2L 3Q5OA 3NACL 3QT2A 4W6XB 4LQFL 4WW2A 1GH7A 2YA1A 1T21B 3IFPA 4HT1L 5LGJA 2J88L 3BIBX 4HF5L 1CGSL 2E8YA 4RZCB 4P2RE 4JN1L 4ZDHA 1R3IL 1T80A 4L4TA 4YDJA 5BQ7B 1HHGA 5GSVA 1LEKB 2AKRB 2E27L 4NC2B 4XP9H 1JRHL 1KB9K 3DGGA 4Y88A 5C0AE 1JPST 5E2TH 4Y5VB 5KOMC 3PL6D 5HYJA 1SY6H 1T0NA 4OLYH 3IAPA 5A2IH 1IAMA 1N6QH 1MAJA 5GISH 4UILH 3TN0C 4QRTB 3GSQA 5GRJH 2ZOKA 3E8UL 5LXGL 5J11B 2NX5D 4HIXL 4XCEA 5D1QC 2O5YL 1JNNH 2X1OA 4AQOA 5BW7C 4PJEF 1BD2A 5JZ7D 2A83B 2QQLL 1CS6A 2BY0A 1OAKL 2FJFA 2NXYB 3RWJB 5DRWB 2P42B 5CSBA 2VDRH 1ACZA 3BIKB 4JG0L 1QEWB 4YHKH 3VRJB 3JV4A 3JTSB 1SMOA 2VXSH 3MYJA 3MFFB 1XGQA 3IXTB 1GOHA 1VHPA 3GHBL 3FCTA 4WEBH 1AKJD 1E4KC 1B6DA 5EUKA 5C70A 1J88A 1E4XH 3DMMA 3S36H 5MEOB 4PJ9C 4DGVH 1MWAA 5HJ3A 3IJSB 4M7LH 1MQ8A 2GJ6A 2DIAA 3UBXA 5A43C 2X4NB 1OGTA 1TJGL 5HHPB 2HT2C 2DMBA 2WBKA 4U6VH 2AK4E 5DUBB 4X5WA 5EU6E 5I66B 1F3RB 1MCRA 3KR3H 2VERN 1YZZA 5DJ2A 1DUZB 5DHVB 3HAEA 4EBQH 4MA1B 5DFVD 2V7NA 3VJ6A 5C7XL 3SO3C 1KSRA 1ONQA 2VLKA 1YN7A 2EDYA 3PXHA 4AT6B 3VE0A 2QHRH 1KTLA 4PJCF 3KLAB 1JGUH 5C0DA 3IS1X 2VLJB 4F2MA 4FG6C 4JREC 4JCLA 4YR6B 1MFEH 2X4UB 1KELL 2E6JA 1M4KA 1MCWM 3WIHL 2OZ4A 4NNPH 3WFCL 4I3SH 3I6LE 3KDMB 2NZIA 5DR5L 3ROLA 3LS4H 3SPVB 3IRPX 1OAQH 1RZ8A 4RGMB 5DJDA 2EH8H 5DC9B 1RJYA 2NY1B 2Y06H 2F5BL 2GTZB 3DHMA 3GBML 4PRIE 2HT4C 4EDWH 1MJUL 3Q6GH 3TJHD 3ILQD 2A74A 1HCFX 5DJ0A 3BQUA 5F6IB 2FHFA 3WDHA 4JPVL 1XF2B 3S5LB 5ACZB 1DQTA 3WHXA 1I3GL 3U9PH 2AXHA 3TJEH 1J8KA 2Y6SD 2VLLB 5JQ6L 4JY5H 1FO0L 4JRYE 1XGPB 3W81A 4HC1L 4WUUD 3EO9H 1UWXK 1CBVL 1RZFH 4PJFF 4NN5C 3ULVF 3OF6D 3PWLB 4WCYL 1S8DA 3TGXA 1JNHA 4PJHF 2BX5A 2NXZD 4MNGB 4PJAF 4ZS6D 5ILTH 5DEFB 3CC5A 1C16B 4K94H 2YD6A 3UCRA 4OJFH 1I8KA 3ZSTA 5E70A 1Q0YH 1KIQA 4XVJH 2IAND 5E9DD 1DBJH 1AP2B 1CLCA 3H9HA 2PR4L 3WE6A 3OKDA 4QKXB 5DI8B 1H3PL 5DMIL 4G6FB 1CLOH 5GRZA 3IDNA 3O6ML 3L7FB 3LPGA 3N0PB 5CD5D 2W9EL 5C8JA 3C5SB 3IDMA 4MWFA 4CJ0A 1G1YA 1IQDA 1A1NB 5C08B 2UUDH 2FYYB 3QCVL 3RWHA 2MFNA 4F57L 1A64A 1T3FB 4WTZA 4DZBA 8FABA 4YX2L 3V8OA 3S4SG 1MCPH 2YA2A 2QQKL 5FO8B 5T1LA 4ELMB 5D5MF 9CGTA 1G9EA 3WNMA 4NRYA 5EZIH 5LG1A 3DYPA 3P9MA 4BH7B 5K9OB 2C3XA 4XB8A 4LSVL 1G7PB 1JK8A 1P5VA 4HUNB 4QYOB 2DJUA 3C6LB 5A2FA 5KVGL 4MMXC 3S88L 3PGFL 1U91B 2D7OA 5IESL 1IAII 4DVBA 1NANI 4V1DB 4ZXBD 5F7UA 2L7UA 4OQTA 5K9JL 1XZ0A 3ISWA 3WXVH 4UMGA 5DD0H 3QUZC 5FUCC 2L4OA 2OP4L 5ERWA 1RZKL 1U8QB 5HHNA 3SGKC 5CIPH 4WI7A 5FYKL 4XPGH 3IF1B 4HUXA 1FJ1A 1NAMH 1IZJA 3MRRA 4X7TB 1P2CA 1A6UH 5GS2H 2YC1A 3CX2A 4U6TA 4PJ5D 1U8OB 4CMMA 3QIWA 3RNKA 4PRDB 5TH2B 4M3KB 2EDQA 3UYRL 3P0YH 4QHNB 5CD3B 1YEJL 4PGDB 4P99A 1RURL 1CD1B 4NKMA 3QP3A 4DN4L 4OCYH 3PGDA 4HUVB 3GJEB 1QP1A 5I15H 2DLHA 4KTDL 4X83A 4HWZA 3RY6A 1K2DB 4K7PX 2IBZY 5J13B 4I5BB 3I9GL 3TV3H 4QOKE 3E6FB 3W39B 3BZ4A 4PR5A 4MX7B 4YGAB 1H3TA 1X5ZA 4HJJH 4PJBF 5BS0A 4JR9H 4X6CA 2D9CA 3VCLA 1NSNH 2EZ0D 4NCC2 5J7CC 5D71H 4P4RA 1NC2B 2AK1H 1RZIA 2W65B 3D0LA 3IGAA 1IM3A 3T3ME 4FQJL 4KK8D 4KK9C 3H9ZA 2PCPB 4NQCD 1CFSA 4HIJB 2P5WE 1LK3L 3MZTA 2PUQT 1JPFB 2AJZA 2BVPA 4P0DA 1KNOA 1NCCH 3D39E 5E2UL 4Z0XB 2J6EH 5INCB 1U8IB 4PJGB 5HDOA 4PD4K 3JUZA 2BK8A 4LMQE 2ICWJ 4XNMB 3O8XC 5JNYA 2XFXB 2VH5L 4MDJB 3HNTL 1TJIH 3ROOB 5CZVH 2F74B 3T0XA 5I8OL 3O2WH 2C3WA 4GAJL 1G9MC 4E42B 4MCYA 3R1GH 1XF5B 3IAGC 3RZCD 2QR0A 3DNKA 4Z7QE 1CFVH 1J5OH 3TO2B 1EAJA 3VA6A 3QUYA 3V2AR 1EZVY 4K23L 3TBWA 5D4QA 1T0PB 4Z18A 1I1RA 4UBDD 3RTQB 3NA4A 4MB4A 5BOZG 4HK3N 1ROWA 4J4PA 3DX6B 3VFNA 1OSZB 1X4XA 3GSNA 2NY5C 3NZHH 4MGXA 2FNBA 3WJJA 4OFKA 1WBZB 3QUKA 3HUJF 4XC1L 2AEIT 4S10A 2R29L 3HN3A 2DQFA 4LBEB 2HT3C 1JGEA 5GGQH 3F7QA 1BLNB 3C60C 4WFFD 2MQ0A 4KFZC 2CLRA 3TA3D 5GS0H 2MPAL 3EJJX 4WIQA 3TYFA 5ANMB 3VD5A 1BGXL 3QB7C 5JXEC 2DB8A 1VA9A 4P2YA 3NIGE 3KPSE 4L3CB 5BZDA 2VDNH 2VDLH 5C0CD 3LEVH 3QIUB 1I1AD 4XNZC 2Y36H 1LDPH 3VRIA 2XPGA 3GI9L 5IBUG 4HMDA 5C07B 2IPKA 2IPUK 5KANI 3LKNB 4X7DC 1IKFH 4G80B 4NJ9L 3CU7A 4MA8H 3VFVB 3OGCB 1MHHB 3FQWB 4XWGH 5CUSH 3FO0L 1RD6A 3KPOB 4LLYB 3W0WA 1T5WB 4WY7H 4PTUA 1Q94A 5JXAL 3BXNB 4FOMA 4RWYL 4PY7B 3SGEI 1JHKH 4PGBB 1XGRA 4EUPA 5F7EL 4HS3A 4AH2B 1JUFB 1R5WA 1WGOA 2H6PB 3VXNA 4Y4HC 3FOLA 4LP5A 4MAUL 3C8DA 1MHEB 2Z0BA 4RDQF 1FVDA 5DEGB 3GM0A 1N4XH 1NBZA 3IDIB 3D0VB 3OJDA 4LSSH 3RKDD 3OKYA 1R3HA 3FFCB 5DHYA 5SWSD 2BVTA 4JQXA 2VL5B 3PHOA 2AXGB 3FO9B 1PX3A 4P3WA 3LZFH 3C5ZB 5FOJA 4HPYL 2Q8AL 2Z35B 3RGVB 4E41B 5IFHH 2YD3A 1BZ9B 4OCXL 3RWFB 5FKAB 3QEGH 5IVXB 3B83A 3NTCH 1A1MB 2NY3B 3ARBD 5E8DL 4XWOC 4M9OA 5CBEB 2BCKB 1DL7H 2EO1A 2P5EE 4J2XA 5JLZB 3LS5H 4UT6L 1GC1H 4XH2B 1HHIA 1JWMA 1HQRA 3X3FH 3CVHA 1MCEA 5F6HJ 3IDYC 4PUBL 3PL6A 3U30B 3BKYH 1EBAA 2ITCB 1ZLUK 3UPCA 2E7CA 3VXSB 5IT2L 3P73B 3D48R 4PPTA 4X0KB 3VG9C 2FL5B 12E8L 4ODUB 2YRPA 1WBYA 4PRHE 4BA8A 5C9JA 5LKNA 2NX5A 1YEKL 2R0ZH 4UU9B 2AJXL 2H9GA 5MERB 4JHZA 4BKLB 2WAHA 4M4PA 4LCIH 2DJSA 4GUPB 5TE4L 3B9EA 4CMHB 4G5ZL 5C0RH 3MNZA 4ZUSA 4P3DB 3HE7D 5MI0C 1HSBA 1RJZB 5E5RB 1WJ3A 1Q9KB 1Z0MA 2ZCKH 3FT2B 4FXLA 3TIDB 4ZO7A 3G04B 1DBML 5I19L 1OAXH 3LKPA 1AXSB 4XBGB 1S7SA 3WD5L 4C56D 4L9DA 3H3PH 5TDOA 3NGBB 2QJDA 1WC7B 4LPYA 4TSAL 3S35L 1AKJA 1W8OA 2YKLL 3W5NA 2P8LB 3FAWA 1LD9B 5HVHB 3BRFA 5EBGA 4MNQD 4M8QA 4HDIB 2ORBH 5F44A 1OPGL 5ACLA 1QR1B 4AY0A 4K3GA 1KENL 2FD6H 4YEEA 5HD8C 4WI9A 3LRGA 2BSRA 2CIKB 2GSIB 4LSPH 2H8PB 3KGRA 3VGHA 2D7MA 4HGMA 5DD3H 1U58A 2UZIH 4AL8H 3U83A 5KJRH 1CU4H 4GXVH 4NYLB 4JRYB 2DQDH 3U1SH 4LLMB 3D85D 4OZHF 4ETQB 1A47A 3TT3L 1C8PA 2DDQL 1QSEB 2VJXA 3CFEB 4XP5H 5EO0A 5TDNB 5FGBA 3ZT6A 4NC1C 3P2TA 4XPAL 2W91A 3WJLA 1JTOA 4GKZB 4XC3L 5D7IB 3SE4C 4FQIL 1ORSB 3G08A 1ZS8B 4UTBL 1QRKA 1BWWA 3FMGH 1FQ9C 4YHOL 4J8RB 4I8DA 3BPNB 3CLEH 1DTUA 1MAML 2MQ3A 4PLKD 1YYLH 5DVLA 4DEPC 3LN4A 4Z6AT 1M7DA 5J11C 4TVSa 3VD7A 2BSTA 3OBAA 1A3LL 2AJ3B 4JKPH 4PRPD 2Z31B 4H20H 2IPTH 4NO3A 3T8XA 4WNQB 1A4KB 1QG3A 1QKZH 4LASL 3FB8B 5FGCB 4YQXL 3TPUB 3F8UB 3QRFM 1O7SA 1CD8A 4ALAL 1RZJC 4XNUH 2XYCA 4PJEE 4PGEA 3DO3A 5J6GA 3HC3L 1KB5H 3GIVB 4IIQB 4KVNL 3OHXB 3L3GB 3PHQB 5CMAB 1LDSA 1N3NB 3J8F7 2ZCHH 3JXAA 4J3OC 4WUUA 3KWWB 4HPOL 4LLDA 3O3DB 1DBBL 4BFIB 5C0IB 3QPXL 3OF6A 5E7BA 1W8NA 4OCSH 5EU3A 3TYGL 2NR6C 5FYKD 3VWJD 1FPTH 1K3ZA 1G7JB 1FVEB 3VH8B 4JAMA 1BQHG 3NCJL 1EH9A 1A6ZB 3WXWH 3P30H 1Z3GL 5CWSB 2BOCB 2JB5H 2DQTL 2ED7A 1EEYB 5I17B 3PUCA 2C1OB 3MTRA 4U4BA 4ODTH 3E6HB 4OM1L 2IANA 5E9DA 5BV7H 4MJ2A 5B38G 1DP0A 2B8OT 2ZUTA 1RK0B 5BCAA 1A7NH 1G7QA 4WW2F 5JW3L 4JQVC 3QEHB 5MEND 3VW3H 1OAUH 3QH3A 1RUAL 3KLHC 1I1YA 4U1LB 5ALBL 1RJLA 4X9IA 2VZSA 4NM4H 4N90D 3ULVC 4F7PB 4JFXA 1AR1C 1N0LA 1PDKA 1TXKA 4JB9L 4PJCE 3GI8H 5DUPL 1NEZG 3BDXA 4OZ4B 1IAIH 4PBWD 1NANH 1FDLL 4TTDD 5IJVA 1GGBH 1TVBA 3HPLA 1TTFA 5I1DB 2A73B 1PKQE 3QWQB 3VFTA 4DW2H 1XIWB 3GMLB 3VFOB 3GB7B 1KLUB 4YE4H 4K8RL 2GW5A 2HWZH 2NY1C 3ARGC 1UXSB 1CICB 2JCCA 4HH9B 2HFTA 1RI8A 3MRMB 3R8QA 4YEFA 2CDGB 3EFFA 4ZTPL 5C0FA 4TUOA 4M48H 4OKDA 4JHBA 4GMTL 4ODVH 1H9VA 1CDCA 4JQIH 4MD0A 4KMLB 1I1FA 4ZXBA 3CSGA 3DWTA 3AAZA 3B9AA 3IETB 3OAZH 4YHPA 2A1WL 2GYSA 1DFBL 2XOTA 4QTIH 1HK6A 2NCMA 2QV2A 3O45A 3QUMB 5GGVH 4O9HH 1OW0A 3FO1B 3CH1A 3HPJB 5E99L 3T0EB 1R5IA 1FH5H 2PYEE 1NUFA 4FZEH 4ODWB 1KTDA 1A6WL 2X44D 4JO4H 4G6JL 4PJFE 3RDTB 4O4YH 3ULSB 2F54B 4PJ5A 3ULVE 1BBDH 4PJHE 2Z4QA 1AY1H 4JZOA 3SDDB 4PJAE 4UOW1 2X5PA 1HHJA 1ZVHA 1XR9A 3V6OA 3UTQB 1T04B 3MLXH 4JRXE 4MJID 1C5DA 4XP4H 3W9EA 5A16B 3BWUC 1V3MA 2W38A 4L3EE 4OLXH 5T3XH 1OAYH 1J1XH 3RUGB 2RCSH 1T7YA 4WFED 1FORH 1BVZA 1CIDA 4YIQA 3L3OA 5J6HB 5IGXL 4LRNL 5CIPB 4XCYB 5IW1A 3JTTB 3U79A 1NAMB 5TF1H 1BVKB 1GCFA 5TDPB 5DRZA 5I8EA 4NQCA 5TFSL 5EBMA 1BQSA 4ZFZB 3B9VA 3IFLH 3KPSB 5D8JL 5IB4A 3V6FA 1K85A 1VPOH 3GMRA 1YPZA 3TT1L 2GAZA 5D5ME 1PD6A 3O4LE 5GS1C 5F7DB 5EU4A 2OXHA 1IC4L 3C6LC 4QRSA 3RY5A 2XG5A 4NO0B 1LE5A 2LFGA 5F8QC 5D9SA 4FXKB 3CH8A 4PBVC 4U1MB 4X6FA 1MF2H 3RZCA 4KROB 2VRAA 3SJVB 4JFEB 4DGIL 1SEBB 3O3EA 4WWKD 1FC2D 5L8LB 3B43A 2V17L 5HPMB 4YDKL 4Z7VA 1ZGLP 3I3DA 4J3WA 2KQMA 1U8MA 1AGFB 2IGFH 4Q9RL 2CIIB 1OB1A 2R2CA 4K3DL 5IJKA 4U2ZA 1CL7I 3B5HA 1I8IA 1KJMB 1EK3A 4MNHB 4M93C 4KKLD 1T1ZA 3PIQB 3CZJA 3H2WA 5E4EB 3U7WL 5CGYC 4DQOH 2Q8BH 4B7IA 1XGUA 1Q38A 2NLJA 3HTLX 3L5WB 1MRFH 3UC0L 2FGWH 5DD1H 4Z0BL 2NTFA 4NKIL 3SEPA 4LQ1A 2AEWA 5IQ7H 4B50A 3TA3A 4Y1AE 2IQAA 1JV5A 4EN3B 1N7MH 1LEIA 2WLYA 1K6QH 3FJTA 5EOCL 1NMAH 3K2MC 4CW1B 4XMLH 5C0CA 4U3CA 4JHAH 2JKXA 3SGEH 3CAFA 3D9AL 2VLRD 4JZNA 3REVA 1I1AA 3ALWA 4GAGL 3L7EB 1Q8MA 3WHE0 5C0BB 1OTTD 1T7WA 1UM5H 5FOBB 2ADJA 3MCKB 3SKJH 3QUML 4JY4A 2DQJL 1B4JL 2Q7YB 4XZUB 1DVFD 3UJIH 4PJBE 5FCSH 4X80L 4CVUA 3DO7A 3P4NB 2R4SH 2IALA 1ITCA 1BVLB 4ZAKD 1U8PB 1T22B 3CFCL 3QO1B 2Z92B 4PJ8B 4PJXA 1RUQL 4WHYH 4FP8H 3L3IB 4KZEH 2W9DH 2I60L 3D3VB 5BXFA 1KG0B 4WO4B 3X12A 5C71A 1L0YA 2JK5A 5E8NB 4YFLF 1B0RB 4OUOA 2Q86A 1G0XA 3VGDA 4I0CC 3NCCB 2EKJA 4Z7WB 1BECA 4I18B 1F6FB 2IEPA 5DD5H 1UH4A 1H0DA 2BC4B 4PRAA 1MFCL 4R0LA 5BZWB 1Q0XH 5SWZB 2RFXA 4IRJD 2VABA 5SWSA 1PY4A 5GSRB 1WZMA 1T2QH 5SV4A 4P2RD 1GPOH 2VZUA 2HTLD 4YNYA 3BMWA 4M7JL 5HDLA 1KPRB 4O02L 5E1AB 3LQZB 4JFOB 3V0VA 3Q5YA 4WU7A 1C5CH 4Y5YB 1R24B 5C0AD 5F9OL 3MUGB 4V2CB 3RTQC 1F90L 2C4XA 2N1KA 5JDJA 3ARBA 5IHZB 3CFJA 2F5AL 1XGYH 4DTGH 5I16B 1FIGL 4RGOH 3BHBB 3G5XB 1MPAL 5D7LB 4IMLB 1AFVL 3VXQB 4BSVA 1NL0H 4JE4B 5F88B 3KNBA 3WN5A 5IHUL 1RFDH 3EUUA 3HZMA 4GRWF 3HG1B 4KUZH 1E28B 1KEML 5DMGD 2VWEC 5B4MC 4M9PA 1P9MA 2DN7A 3ZL4L 3OJ2C 4BZ1L 3OXRB 1D5XB 2VLMD 4MB3A 4GRLD 4NM8L 1GHFH 5HHOD 1FNEB 1IGMH 4X6CF 1S9WB 1CFTB 4ACPA 3VFMA 3QIUC 1OT2A 2OR9L 5E08H 3HE7A 5L6YL 1REIA 4P2OB 4JDTL 3NFPB 1NKRA 4HWBL 5E2JA 1PKOA 3ULUC 3RAJH 4K7PL 3DUUA 1KJ2A 1N5YL 4C56A 1BBJB 5EU5A 3GSWA 3LKQA 3GFUA 4NNYA 4KTYA 4X6BB 2ZJSH 2D4FA 1P5UA 1FO0A 2XXCB 5DURD 5DZLA 3CX5J 4LL9A 4MNQA 4KZDL 5J4MA 2W0PA 5HDBF 4BQBA 5KVFL 1TVHA 3GBNL 5GRUL 3GUTA 2AK4D 2Q87A 4MA7L 5EU6D 5AD0B 2V7HB 2Y5TB 1U8KB 5I74B 1CK0L 1YY9C 3TBYA 3TN0D 4QHKJ 2K9UA 3QDMB 4P57A 7FABH 3CCHB 1JFQH 5IP4A 5AWNH 1WIOA 4KI1A 4GH7B 2MKLC 4UB0L 5IB5A 5D72L 3VXTA 2V2XB 5D1QD 1QLRB 2PF6A 2VWEE 4OV5A 5CGMA 3D85A 3RU8H 3J7HA 4FXGA 4JG1H 3T1WA 2H45A 4X9HA 5HSFA 4JFDB 1IEAB 1JZ5A 3GZKA 4ZNEE 3C5ZC 1IGTA 3QCTL 1JWUB 4OBRA 3RGVC 2VO5A 4J3SA 3I6LD 2DQIH 3S98A 5T3ZE 5GGTA 4HAGA 5IIEA 1Z5LB 2Q6WB 1UWEL 2Y9RT 1FN4A 4ELKA 3CNKA 3BE1L 4ZS7L 4RMTA 1OP5H 1KFAL 5L7XL 4KHTH 1DLFH 1S9KC 4N5EC 5J1SC 3CFBB 4NQVA 3CXDH 4PJ9D 3UJTH 3HMXL 2AXJA 2OX5A 3ARDB 4N1CA 2R39A 3SKOB 2AP2A 2GJZB 1MFAL 2UWEB 4UT7H 3BPOC 1XEDA 1BX2B 3MJ6A 2ICEB 3JSSA 4KUCF 1EFXB 2HT2D 4M6OH 3QG6A 4N8VA 3MOQA 4M7LT 5FV1L 5FHBH 4M62L 4PRPA 1EEQA 1RVFH 5JPNB 4KY1L 1ND0A 4CMHC 3WS3B 4JZJA 3QHZL 1XCQB 3NVQA 5CJ8A 3VFPB 3KPRB 1FHGA 4CUCA 1TTUA 4TUKL 2R1WB 5K33A 1PY9A 3Q2CA 2YD9A 4O2FB 3PV6A 3U46A 1AO7B 4XNQB 4G6AC 4DCQB 1T4KB 3QQ9C 5CP7B 4XCCL 4OZIA 2CRMA 1S7XA 2B2XL 1UA6L 4EXKA 1A3RH 4FG6D 1FYHB 4M43L 5SX4I 3UTTD 4ODBD 1HH6B 4R7NB 4QRUA 1R6VA 1OGAE 3DSFL 1MQKL 4O2CA 3VWJA 2AJUL 3RZWA 3BZFB 4GT7A 1N2RA 1QVOB 3NAAH 2R4RH 5DQJB 1I7TA 4DKAA 1YC7A 4XMPL 4D9RE 2Z91B 3A6BH 4LCWE 1QRND 3HRZB 2W60A 5IW6B 1WZKA 5IV2B 1NCAL 4HWEH 1S3KL 3C2AH 2VQUA 5CBAB 4D0CA 2HT4D 1MRDH 1A9BB 1F2XK 2XT1B 4FQQB 4HS8L 5DQDH 4MJ4A 3ZYIA 3MLVH 4JFZL 5E6IB 1NBVL 1I4FB 4H25A 1ES0B 3MRFB 5MENA 4HXBL 4JO2L 2CLZB 5KSUB 3DI3B 2PYEB 4OZHE 4LCCA 2H3NB 3HFMH 4Y5XA 5C6WH 3EOAB 1KJVB 1KB5B 4MSWA 1JIBA 1AHWA 5ID0A 3IU3A 4DGYH 3S7GA 4W6YB 1YEHH 5FYLE 4ONGH 4HKZA 5DSCB 3MPCA 5DRNB 3MBXH 1S7TA 1YNTB 3MLTB 2B1AH 1VFAA 2DQCL 1OSPH 3BPCA 3CVIH 3NIDF 1VKXA 3O4OB 4H8WH 4FQLH 1DE4A 3BPNC 4RFEB 5I2IA 2IBBA 3HA0A 4R9HA 4G9DB 4XP6L 3O2DH 3M8OL 2YD7A 4HLZH 4Z77A 3T4YB 3UTSD 2ITDB 1NGPL 5FV2A 2DYPB 5DEZA 5E2VL 3MCG1 4P9ML 2DQUL 5H37G 1C08A 5BVPL 2HKFL 4L8SA 4JDZA 4PRNA 2YOCA 3VXUB 1ZA3A 1N8ZA 2PTTA 3MLSL 3TEUA 2ZUXA 4U0RC 4F7EA 5D2LB 4XAKE 1AD0A 5HGGS 2OTUA 3IDGA 4KDVA 3I6GB 4N68A 3P4OB 1FE8H 4LVHC 3BKMH 3MGAA 5CJQL 4JKLA 3RI5F 1U8JA 4H5SB 1RSFA 1CDBA 2BXZA 3MROB 1P4LB 4HUKB 4S1SL 3MC0A 5F9WB 3SY0B 4AK1A 4EXPX 1BZ7B 4K3JH 5IQ9B 3LIZL 4PGCA 3SDXB 5I1AB 4M6NH 1DR9A 5DGQA 4YFEA 4LFHD 5EFIB 2CUIA 1IEHA 1WFTA 4X8XA 1IC7L 2X9WA 1VACA 4WI8A 2WMPA 4LPTA 4CNIA 5F96H 2QKIB 4MJIA 4YHIA 3BD4A 2VQ1B 4QOKD 2RQ8A 3EJZC 5IB2A 3THML 4M1GH 1KCRL 3VWKB 1RZJL 1MHCA 3H42L 3BP7A 2OMBA 3N85L 2SEBB 3MRDB 4YGVB 1A6TA 1FNGB 3DMMC 3Q48A 5I71B 1H3VA 2OTPA 3CDFA 5JW4R 4L4TE 3QUZD 1NFKA 2P5WD 3O3UN 4RDQG 5CEXA 1J8HB 3T0VA 2B4CL 3V6ZB 3E0GA 3D39D 2IC2A 4GMSL 4WGVB 8CGTA 1YMME 3ZTNH 1R3LB 1K3IA 1TCRA 2VIRB 3QEUB 3RWDA 3WFDL 4KHXH 1C5BL 3A67H 1WITA 4G7YH 1XR8B 1CFNB 2A9ML 2PW2A 4OAWA 1CICC 4J1UB 4S0TD 3VGEA 4IDJH 2EDLA 1CL7H 4K94C 3CZFB 1S5HA 4KJYB 2V2TA 4EI6A 3PWVB 2A0LC 4M6ML 2WUCL 3IDJB 1JGVH 3RL1B 2R1XB 3FONA 4D0DB 4N0CC 1BD2E 5TE7L 5B8CB 3CXHJ 4P2QE 3E2HB 1AE6L 2XKNA 5MEPB 3QAZB 3WUWG 4R26H 3ZDZF 3QCUL 4U6XA 3ULVL 4WWKA 3BKCL 3QDHA 4Y4FC 3FQXA 4RAVB 3MJ9H 3I3BA 1CFQA 5I1HL 5C0EA 2ZNXA 1FAIL 3MACH 4H1LG 5DT1H 1MLBB 2AABL 2NY4C 4X6EB 3BKJL 2GIYA 4YXLH 4LSQH 4UQ2A 1EO5A 4KK9D 1YEIH 2CKBL 4XTRC 2KKQA 2XWTB 1RZ7L 3DBXB 3O2VH 5DYOA 4HFWA 3BEVA 3VI4F 1P4IL 1JZ7A 3MRGB 1HI6A 2DBJA 3BUYB 4ZFOA 1VGEL 4LEOA 5D7KE 5DHXB 4OZFH 2GY7B 1XF4B 5J06A 3O8XD 3ARZA 3IJYA 5AZ2L 4HFUH 5HHQA 1LE9B 5ETUA 2OK0H 1R0AH 5LGHH 1Q9OA 1R3KB 1OP3H 2VLKE 4APQB 3SDAC 2GKIA 5ICXA 1EHLH 4CDGC 2HRPL 1T83C 1A2YA 1NBYA 3SKNA 3L95A 4JY6B 4EKXA 1CE1L 2A6JB 1WQVT 3VFGL 3P9LA 1DVFA 1QSFE 1PZ5A 4D94A 2F19H 4A6YL 1EMTL 1LNUB 3HZYB 3ET9F 4ZAKA 1X5IA 5T1DL 3SDCB 3KLDA 1FZOB 3B2VH 4C83A 4U7KA 3VFUB 3H7LA 3MRHB 1HHKB 2O5ZH 1GZQA 2OI9B 4OV6F 2HT3D 5D96B 5FYJE 4ISVB 4UT9H 4XPTL 3C60D 4H0GA 4IRZL 4DVRL 1YQVL 1MJ8H 3BPLB 4FQCL 5BRZA 4K3EL 4G9FB 3EYOB 1HZHH 5JXED 4Y2DB 5H94A 2CLVA 2HTKC 1RUPL 4FQHB 3S4SA 1EGJH 3RJQB 4IRJA 5DC0A 5E00A 2DLTA 4XRCB 3KPLA 4P2RA 3S37X 2P5ED 3C9NB 4F80A 1J05A 1KN4L 4U1NB 4N9GB 5E6ZA 2XI9A 2OTWB 4YK4B 5DVNA 3N9GL 5C0AA 4ZSOB 4XHQA 5ESAA 3ZKMC 5I30H 1FYTD 3MNVA 3LCYA 4X4XB 3HI5H 4D0BB 3PWUA 5E4EC 5GJTH 4ERSH 3S37H 4NZTL 1WBXA 5I76B 2AQ1A 2CGRL 4GRMA 1T0MA 3OZ9L 2BVQB 2W07A 4NRZA 3OKOA 5ENWA 1ZWIA 3DYMA 2N4IA 2X09A 3TP4A 1FSKB 1M71A 4HUUA 3SKMA 1A0QL 4JFPB 4Y4HD 4JVPA 3EDJA 1DN0A 4GRLA 5HHOA 1WF5A 1OHQA 1EAPB 2I07A 1RZGB 4F9LC 3BP4B 1WIUA 5CJXC 1S5IH 1GAFL 2BVYA 4HV8A 1D9KC 4NJAL 3KHQA 3ZT5A 4LKCB 4MHHI 1VFMA 4KJPC 3PE9A 1Z9SA 1ODAA 1YNKH 3VXPA 2BJML 5ECJE 3FQRB 1OTUC 1M6OA 4LCUA 1DQJA 4LVNB 2BVEA 1CF8H 1NGZA 3FFDA 3BMVA 1BM3L 4XWOD 1K8IB 4O58H 3TVMB 1ZT7A 2ZUYA 4XMKL 1CLZH 1UM4L 3LQAC 1XT5A 2O93L 4PJ8C 4XPFL 2ATKB 5TQ0L 3QDJB 4HBCH 4XPBL 1HH9B 3PWNB 4LNVA 3CFDA 2HFFB 2WINB 2AK4A 5EU6A 1L7IL 2GT9B 1E4WH 5C6TH 1CLYL 4HZLB 4LSTH 1DSFH 3TN0A 5GS0C 4DK6A 4BZ2L 1VFBA 2WWKT 1ZANH 5KVDL 1IGFH 1X7QA 4I18C 4XCFL 3QFJB 1ZTXL 5AUMB 4POZC 5D1QA 3ZMRA 3HE6C 4KRPB 1MCFA 4OF3A 4ZTOH 2GUOB 4ZYKB 3RWGA 5BW7A 3SE8H 1W72A 4YXKL 3MV7B 3D2UD 1MVUA 3TO4C 3H9YA 4YH6A 3STLB 4U6HA 4UUJA 2MJWA 5FAAA 3WFHA 1J87A 2XNAB 4Y5YC 3O9WB 1LK2A 1IT9H 4TVPH 4Q9CA 3OR6B 2AXFB 2FZ3B 1FL6B 3G6AA 4LCWB 1IGYA 4YDLB 4YC2C 3OAYH 4MD4A 1E4KA 4U1KB 3KJ4C 1JI2A 1C12A 1QFWM 3OAUL 5FM8A 4PJ9A 4ZUWB 1HOCB 4JPWL 3DJ9A 4JN2A 1MFDH 1KYOK 1TIUA 3HS0B 4GRWE 4I4WB 5KSAB 1ZEAL 1OCWL 4F33A 4YHZL 5HD8D 1JRHI 3AS3A 4TQEL 4BYHA 4O5LL 5L2KB 3RBGA 3MOBL 5CGTA 1CCZA 3CLFL 2H2SC 4DFHA 4ZUVB 5ITBL 4X6CE 1YJDL 4G7VL 3BH8A 4OTXH 3GSRA 2BNQB 1JYVA 5FA4B 1NPUA 1L0XA 5J9PA 2B0SL 1F3DJ 2YS4A 5E7FA 5HYSA 3MO1B 1YEEH 4MDIA 2GITA 1PQZA 4PJXF 3RL2A 2VN4A 3UTTA 2DWDA 2MOVA 5JO5B 5IFJB 1I3VA 1GC1C 1NFDB 2X4RB 3G5ZB 5D70H 1AQDA 1OARL 5GZOC 4NHCL 3KPNB 3QULB 2EDTA 1F6AA 5HDBE 4LCYB 1QRNA 1WWBX 2WIIB 4ZPTB 3VFWA 4Z8FL 1Y0LA 4PYHA 3QRGL 4ZFGH 5T3ZL 3JV6B 2QTEA 4EOWH 3UJJL 4U7SA 4ZOEA 5FA3B 5GRWA 2OQJA 3ZE2E 2YUVA 1EX0A 3CVHH 4GXUN 4R4BA 1D5MB 1KACB 3HC0B 3UTZB 3PNWB 4NCC1 5KW9H 5GGRB 4KV5E 4PS4L 4LU5L 1MHPH 5LBSH 1XGTB 2PKDA 1YEDB 3ARTA 1YN6A 3GMNA 3MUJA 4NWUH 2EIEA 2IBGA 1JGLH 1IEBA 2NY2C 3AS1A 4WDIB 5JA8B 2NR6D 5J1AB 3HC4L 4RMRA 1TPXB 1EJOH 4P5KA 1ZHNA 1FNFA 3ARDC 4JQXC 5GIRA 5K9QG 4UDUA 3MXVL 1G6RL 3UTSA 3QO0A 3EJYC 1EHNA 3EYFA 3IFPB 4EZMA 5LGJB 1P4BL 1RJCA 1A7RL 5HY9A 1VGKA 4YDJB 5GSVB 3FN0H 1HHHA 2GSGA 3M45A 4XT1C 3BT2L 1WISA 1EEZA 3MV8E 4LSDA 2P44B 4PY8J 5HYJB 1T0NB 3KLHD 5IK3B 1T20A 3FRPG 3CK0H 4OF6A 1FGNL 4MS8C 3ULVD 3GSQB 4Q0XH 2EEBA 1AR1D 4TSBH 2V5TA 2AV1A 2ZOKB 3V4UH 4G6MH 3P0VH 3MLYL 2J5LB 5FUOH 3GMQA 1RUKL 4JRXD 2CSPA 5HYIA 4Y7MA 1BD2B 3MV9E 2FJFB 3T2PA 2P24A 2NY1D 3ARGD 4JGJA 5ABDE 3RVXC 3EIFA 3MUY1 3VGFA 3WSQL 3EOBA 4QOKA 1SVCP 1NGQH 3MYJB 1XGQB 2V5YA 2H1PL 3FB7A 5FYLL 2IG2L 4QRQA 3BSZL 2XV6B 5EUKB 3K8MA 3WDIA 3DXAE 4G8FB 5ID1B 4LVOB 1MWAB 2C7UB 5HJ3B 4QRPB 2I9LA 3QUZA 2GJ6B 2P5WA 3UBXB 2EDBA 4XP9L 3SGKA 2MSPA 2FWOA 3BDBA 1W0WA 3D39A 2NTSP 5EUOB 4S1QH 1Z9MA 1N6QL 1WZ1L 4LLQA 3O4LD 3HAEB 1GGCH 1YEFH 5F9JA 3TNMA 2I9TB 3O4OC 2ARJA 2V7NB 5GRJL 2W1NA 3VJ6B 1I75A 1B3JA 3NIDE 1ONQB 3AB0B 4ENEC 1YN7B 2K7QA 3VE0B 1KTLB 1CVRA 1CFBA 2MHAA 3T0BA 1H5BB 3RPIA 1ZLSH 2AEPH 3WO4B 2QQNH 3I02A 1NMBL 3KJ6H 5BV7C 4CADA 1AXTH 5DLML 2D7NA 2C3GA 4OZIF 2HP4A 2PW1B 1C1EL 3F62A 4XCNB 3MREA 3PDOA 1KPVB 4YHKL 4PG2C 3ROLB 1RZ8B 2HJLB 3LKRB 1GSMA 1RJYB 4U6YA 1S9XA 1CI5A 2P8MA 4I2XE 4RISH 3QHFH 1RULL 2BRRH 3D25B 3O6FB 1E4XL 2C4FU 3DX8A 3VXRE 1F4YH 3S36L 5F9WC 3C5JA 2G60H 2A74B 4HCRL 2BY3A 1QLEL 2VDML 4KGJA 3BQUB 4Y1AD 5DJ0B 3FB6B 1MSPA 2FX7L 2VDQL 5I1KH 3O11A 2R69H 3K4ZA 1CTNA 1LO5B 3BEWA 3I2CH 3RVVC 3GK8H 4LHUD 3KR3L 2R0LH 4HXAL 1QBMH 3JWOH 3O8XA 4CBPA 3MJ8A 5B3JF 3C6LD 1HQ4B 4G6KL 4K7FA 1BMGA 3OXSA 2CRYA 1N6UA 2PETA 1JNHB 5DVOA 3BGFB 1BQHA 5DD6A 4RIRA 3DYOA 3ZHKA 1I7RA 4N0FB 1LO4H 3EO0A 4NPYA 1KLGA 3KYAA 2ERJC 4I3SL 4HWBA 3SE9H 4KKCC 1MCQA 3LS4L 5C09D 3BDYH 1JTPA 1KIQB 5SX5H 1AGDA 4JKMA 3CD4A 3H9HB 5CGYD 4IRSB 3WE6B 4HHAB 3OKDB 5FGRA 4FFYH 3CPLB 4Q97A 3WKML 3IDNB 3LH2H 1B2WH 4GAYA 4Z7UF 2DL9A 3V8CA 1U42A 5GRXG 4W81A 5IBTL 4GKSA 1NEZA 2LTQC 2VXTH 3C60A 3I50H 5C8JB 2H41A 4U0QB 3IDMB 3LEXA 5I75B 1IGCL 5LGKA 1IQDB 3H7BA 4DAGL 2A6KB 2NY0C 5FHAL 3RWHB 1XCTA 4JO1L 3NOIA 4FFVC 5JXEA 4Q6IC 2XICA 2JIXB 4P9HL 2QEJA 1U8HA 4JFQA 5DJ6B 4G8EB 3JWNC 3PP4H 1QSZA 2KH2B 1EVTC 4LKXA 1RHHA 4JY5L 4LDEB 2PN5A 2P5EA 1KIUA 3LDBB 1FGVH 3ZDZE 3W11C 5T1LB 2X9YA 1VEPA 4WUUE 3EO9L 1RZFL 1D3CA 4J23A 3S96A 5ALCH 3P9MB 4NO5A 2VXUH 4XBPB 1NC2D 1RK1A 3EBAA 3L9RA 1JK8B 1FYTA 15C8L 1RIVL 2VOTA 5F1IA 2ATPA 2UY7A 4ORZC 5ILTL 4PJIB 1JWSA 5J12B 1I9RL 4HW6A 1U8LA 3CX5K 4DVBB 1G0DA 2GEEA 2JELL 4O00A 4QXTB 1ZLVH 5KTEH 1XZ0B 2DM7A 4OJFL 1B0WA 1YMHA 2UUDK 4LF3A 3VI4E 1BQUA 3PV7A 4XVJL 2J8UF 3OTTA 3S8WA 4Y4HA 5I1LA 2IANE 5E9DE 3RIFF 4EUPG 2AAVA 7CGTA 1S7RA 5GHWL 2OZ4L 4WWID 3KYNA 4HUXB 3DPBA 2OL3A 2IADA 1P2CB 2IH1A 1J0ZA 1CQYA 4WFHE 5E94A 3GSVA 4HK3J 2IAMB 1G7MB 4PJ7F 5E0QA 5CP3H 4LLAA 3G5YA 4CMMB 3QIWB 3MV11 2BNUB 3CMGA 1AC0A 4DN3H 3IU4H 1SYSA 3QG7L 1HSAA 3X3GL 3MRJA 1NDMA 1SBSH 4OGXH 3BFOA 5FYJL 4AEIL 3RTQD 4NKMB 1OY3B 1OM3H 1YY8A 2WK2A 1VFOA 5F9AC 4R90L 2FJHA 4XVUC 4HWZB 5B39G 4P4KB 3REWA 3ARFC 3F7PC 4P46C 4Z95H 3GRWA 1RQ5A 2X1QA 1RIUL 3GJFH 3QXDB 3BZ4B 4PR5B 5GJSH 1DUYA 3D69A 5BS0B 4JCMA 4KMQA 3JUYA 3VCLB 3NIFE 5HGAB 5B4MD 3KYOA 4P4RB 3RWEA 4X8JA 3IGAB 1EO7A 1ZHLB 4Y2DC 1LO2H 1BFSA 1D5BA 2N7AA 2GQHA 1QBAA 5DD0L 4HF5H 3QIUD 1CGSH 2VR5A 2ZSVA 2AJZB 2BVPB 1R3IH 4ODSH 5EC1A 1T2JA 1FLTX 1KNOB 3D2UA 2E27H 1F4WL 1JRHH 2X89D 4WU5B 5EBLA 3ULUD 5BO1H 2ZUVA 1X6LA 2HJKA 5JNYB 2XQYK 2V9RA 3JWDH 4JVWA 3RA7L 4ZFFB 1H15B 3UPRA 3BAEL 1FG9C 3E8UH 1F3JA 2QR0B 4KQ3H 4HIXH 4NZRH 3QUYB 4L8DA 4R6UA 1G7IA 4WV1C 2R1YA 3TBWB 3VFSA 3V6BR 1YY9D 4GFTB 4ZNCD 3INUH 2QQLH 1OAKH 5IKCA 5IJKC 5L88L 3HCVB 3U9UA 4PV8A 3VFNB 4AZ8A 4P48A 3GSNB 5CEYA 4HJJL 3FFCD 1NSNL 4ORGB 3BGMA 5D71L 2DQFB 5HGBA 3CDGB 1PSKL 5LAXA 1S7UB 4GJTB 2YSSB 3C5ZD 5ESVA 3RGVD 1JGEB 2R56L 1TZIA 3KPPA 4LVNC 4Q74A 3QDAA 2CMRH 1T21A 4H88L 4RZCA 3TYFB 3SE4A 4D9RD 1LEKA 2AKRA 1EA9C 4WRLA 2D31A 1JYWA 3IKKA 2J6EL 1TJGH 4BFEA 5KN5B 4NBYB 4Y19E 4N5ED 2XPGB 2A9NH 5FK9A 3VXSD 1TJIL 2YA0A 3MLRL 2IPKB 1JPGA 1Y6MR 2ESVE 5C7XH 4FABH 1PZUB 1MFBL 2C3HA 1LEGA 3C09B 2Q3ZA 2P49B 1CFVL 1QACA 4YHYC 2FCBA 4GSDL 3QSKB 2EIZA 2LV4A 4PJCA 5EIQA 3W0WB 1U6AL 4PTUB 2FIRT 4HX1A 5FYLD 3WIHH 3EOTL 3RWJA 1XGRB 1Z0NA 4UAOB 5DRWA 1DDHB 2MCPL 1UENA 3FQTA 2R9HC 4G3YH 4X5LA 4G6AD 2XTLA 1JI1A 1KIPA 3QQ9D 3VXNB 5DR5H 3FOLB 2AJVL 2P7TA 3LQAL 3VRJA 3JTSA 4KAQH 1NBZB 1IZKA 2BP3A 2FX8H 2ICWA 2F5BH 1BJ1H 3OJDB 4WHCA 1IBGL 1URLA 2EXYC 3GBMH 2APTA 5GGQL 1R3HB 4E0RB 1MJUH 1BAFH 5MEOA 4DZ8A 5GS0L 4ZUUA 1WVZA 4I9WE 1A14L 3ZE1F 4JPVH 3S34L 1NFIA 1JZ2A 1T5XB 2A38A 3LEVL 4JO3L 4GQ9L 1I3GH 4XAKD 4NKDA 5JQ6H 3P4MA 4PG9B 1DUZA 3ESVF 5F7NC 1HHIB 3I6KB 2APFA 3TZVB 4HC1H 1JWMB 4QXWA 3CVHB 4H26A 4JQVA 1CBVH 4YBLC 3ABZA 1IKFL 2LU7A 5I9QB 1HIML 1L7TH 5A40E 4XWGL 1YECL 3DUSA 3I75A 5C9JB 4YR6A 4PJHA 4PJXE 4WY7L 1UM6L 5IMLA 2NX5B 4CAGA 4K07A 4F37F 2H9GB 3QYCA 3KDMA 4JRXA 1A6AB 3ZZ1A 3MNZB 1U2CA 1HSBB 3AUVA 2ZSWA 1N4XL 2AJYH 2PR4H 5DJYA 3ARGA 1GVIA 3RVTC 4D9LL 2ZUQC 2VE6A 1QQDA 3ARPA 1S7SB 2EKSB 3SO5A 5LQBL 5TDOB 4K71C 1BIIA 2W9EH 5CZXC 1AKJB 1D5IH 4OF8A 3KHOA 3IAQA 5IFHL 3QCVH 3BH9A 3WS6C 1MY5A 4F57H 2VZ1A 4LEXL 4ZO9A 1YMMD 2D7PA 3FO2A 4RBPH 2VLLA 1MFNA 3G6JB 1MLCB 4YX2H 1GC1L 2BSRB 5I1IL 1ZAGA 4HGWA 4MJ5A 2WWMC 3X3FL 2VDOL 1DQLH 3ZKXC 1U58B 1FFQA 5I73B 5DZOA 3HI1B 3PWLA 2VITA 5D5MA 3OL2A 3O4LA 3IDXH 5IROC 5IWLC 1TZHA 5KVGH 4MNGA 3S88H 4CU8A 1F8TL 2AV7A 4WUKH 5DHVH 3MCLL 5EO0B 2R0ZL 4P2QD 4FQ1L 3OB8A 1C16A 4FHBD 4JM2B 1UJTA 4LCIL 2N7BA 5ELIA 2R0KL 1X5KA 2CUMA 3EJZD 1RHFA 3WFEL 3G08B 4NQED 5JORA 1AP2A 2OP4H 4HUWA 4AEHH 4UZGA 3QI9C 4X4YA 2EYRB 2PO6C 1QFWL 3K4AA 4C56E 4M7ZB 2XG4A 3DMMD 2PTUA 3C5SA 1KXQE 2UYLA 1GOGA 3LN4B 4F7TA 3IKCA 1M7DB 2FYYA 1ERNA 2ORBL 1LP9F 2G2RB 2J5LC 3TF7C 1YEJH 1RURH 3QEQE 3T8XB 3NCYS 4U1GB 4Y1AA 4QXGH 4JFFE 5D7KD 2GK2A 3SCMC 4RMUA 4H8WC 5IB3A 5E2WL 4KTDH 3G6DL 4PGEB 1CICD 4LHUA 4BH7A 4AL8L 4OZGF 5KJRL 1CU4L 2YUZA 5GS1A 1G7PA 2A0LD 4MXQC 2DQDL 5FXCH 3RWIA 3HKFA 2WBJC 1BWMA 3MA9L 3C6LA 5I6XB 4L1DA 1UWGL 4Z7NF 4N0CD 3L3HA 4XP5L 4KI5F 4M61A 4PJBA 1QSFD 1DQQA 3MV01 2NXZB 5GGUA 4AJ0A 1U2HA 3WHE1 1NCUA 3ZE0F 1WEJL 4Y4FD 2ADFH 2Y7QA 3KS0H 5KS9F 2NY4D 5A1AA 3IF1A 5C09A 1HN1A 5JHDE 5I1JL 4X7TA 5IM7A 4RAUA 3DRQA 5DK2A 4R97C 3CLEL 1Y18A 4KU1A 3WV0A 4XTRD 2VH5H 1G7QB 2F54D 2AQ2A 2ID5A 3QH3B 3RI5K 2JJTC 5TH2A 5FECA 5I8OH 1I1YB 1IJ9A 1UACL 2NYYC 4QHNA 4JKPL 2AS5M 2IPTL 1H5BC 4JFXB 1Q1JH 4GKNA 1OTSC 2IMMA 1QZ1A 2CKNA 4WENB 4NSKB 5GRVK 1TVBB 1K2DA 3QNXA 4HD9A 3HPLB 4I5BA 3LRHA 3SDAD 1FNHA 3ZDXF 4ZD3L 3E6FA 3W39A 4OZIE 3CSPA 5TE6L 2XRAL 1KTRL 2C1PB 3JBG7 4XP1H 4KXZI 1JF1B 5E56A 2D7TH 4GBXC 4C4KT 4R8WH 4XC1H 4TSCL 2JCCB 1NC2A 2R29H 3MOAL 3HUJA 3O6FC 3OV6A 4JDVA 1F4XL 1FPTL 1QYGL 4XNYL 3NCYP 1WSST 5F7HA 4TUOB 5GS2D 2WNGA 1J1OH 4HIJA 2MPAH 4FNLL 4K3HA 4MD0B 1QA9A 1I1FB 4ZXBB 1JPFA 2Y07L 3AAZB 4Z0XA 3ALPA 4YHPB 5INCA 3NBNA 5C3TA 1U8IA 1YNLL 2CH8A 3K7UA 5BV7L 3F12A 1UXWB 2X4TB 3O45B 4XNMA 2XFXA 2WUBL 3DARA 3CH1B 4KGLA 2F74A 5MENE 2JF1A 1R5IB 1HILA 5B3JE 2HTKD 4L9LC 3LHPL 2Y25A 4NJ9H 5EIIA 3V52L 4PJ5B 1AGBA 3TO2A 2XWBA 4JFED 1MI5E 2OM5A 3SQOH 1JN6A 3IXAA 1HHJB 1XR9B 5DQ9B 2HN7B 5JXAH 4MQ7A 4RWYH 4Y16C 3RTQA 1C5DB 5F7EH 4NIKB 1NAKH 3ZKMD 3W9EB 2V5SA 4LPUA 5HYEA 4IRSC 1WBZA 3OAZK 1RUML 1SBBA 4M00A 3OJMB 3Q3GA 2B5IB 2F8OA 3LRSA 4LMQI 2F15A 4J7RA 3L3OB 1HEZA 3WBDA 3BWAA 5ANMA 5T5NF 1NLBL 5IW1B 3MMEB 4ZNEA 2Q8AH 5JPMA 4QRRE 2C4FT 5DRZB 5I8EB 4NQCB 5EBMB 2RB8A 3QIUA 2GCYB 4P5MA 4TPRH 5HVGB 1D9KD 3LDBC 5C0BD 4O9HL 5IB4B 4KJPD 4UT6H 3D1MC 3GMRB 1YPZB 5DWUH 2X89A 3LKNA 1Z9OA 1F02I 1MEXL 1OTUD 1AI1L 3LMJH 1FH5L 4FZEL 2OJZH 3TM6A 4KPHH 4PUBH 2Z8WC 1EXUA 5EU4B 4O4YL 4OI9A 3WUWA 3OGCA 1MHHA 4WTXA 5ISZE 1E6OL 4OF5A 12E8H 1V5JA 5CINL 4PJ8D 3RWCA 5D9SB 4HK0A 3RZCB 1A7PL 4LLYA 1S7VA 4U1IB 1YEKH 3MLXL 2AJXH 5IMOA 43CAA 3MR9A 4AH2A 1JUFA 2CDEB 1IKNC 5TE4H 1HKLH 4Z7VB 4G5ZH 3S35X 2ED9A 5GS0D 1MHEA 1DBAH 4OLXL 2J8UE 4K55A 3WLBA 2RCSL 1I8IB 4P23C 1G6RA 4JHWH 4M7KL 1T1ZB 5I19H 1FORL 4POZD 2IAMC 3EDDA 3FFCA 3FHAA 3HE6D 1NCDH 1XGUB 3HI6L 2VL5A 4TSAH 2NLJB 2YRLA 3S35H 2A77H 3EYVB 3FO9A 5KSBF 3C5ZA 1VB9A 3TO4D 3RGVA 1AGEB 1BZ9A 2NTFB 2EDDA 4L4VB 3B9KC 1AD9A 3TA3B 4GG6F 2IQAB 1LEIB 6FABL 32C2A 1OPGH 3BD5A 4N1EA 5CBEA 2BCKA 3IFLL 1ZT1A 3Q1SH 1ZLWH 1OLZA 5C0CB 4P4KC 2I26N 2MTPA 5D7LD 4JZNB 3REVB 1A9EA 1I1AB 4MXWL 1IQWL 3HNSH 3LD8B 3BZDA 1NCBL 3ILPB 1UQSB 3VXSA 2ZG1A 3GHEL 2ADJB 2BSED 1FZMB 4JY4B 3QDGB 4ODUA 5F89A 3P4LA 4Y4KC 2DDQH 2FRGP 4BELD 1MF2L 5L2JB 3DO7B 3MZGB 4WW1A 5MERA 4BKLA 3ZHDA 1FLRL 4I13B 5L9DH 4NQTA 2H2SD 1I8MA 1A6VL 4XPHL 4NN6C 4XC3H 4FQIH 4HIHA 4X7SL 1FL3A 1X5YA 3IFOB 5BXFB 3FT2A 3X12B 2JK5B 2V2WA 3G04A 5T1KD 4YHOH 3WMSA 25C8L 4XBGA 2MCG1 4DQOL 3QZWG 2OR7A 1CGVA 1WC7A 4JLRB 1MAMH 4J3XA 1H0DB 5DTFB 1JF6A 4OLZL 1MRFL 4JFYB 1MAKA 5AYQA 2RFXB 5GZOD 2VABB 2VN7A 5SWSB 3GO1H 1SY6A 1A3LH 1N7ML 4YNYB 5FYKU 4J3VA 1QR1A 4KUCD 1K6QL 4LASH 1T2XA 4YQXH 5C0NC 4XMLL 2GSIA 4O2EA 3U7AA 4JHAL 3UPAA 1PYWA 1U92A 3QDMD 5DJCB 3MV8D 3ARBB 2G9HA 5IFAH 4OLEA 3EKCA 4P59L 4QHUB 1AGCA 4KVNH 5A2JH 1A8JH 3SKJL 2K1MA 1DBBH 4NKOA 3KNBB 3T3PF 3T4AB 3WN5B 3QPXH 3CFEA 3HB3C 3HZMB 5FM4A 3TYGH 1INQA 3BYYA 1T6VN 5J0BA 3STZA 4ODXA 2W9DL 4N0UE 4GKZA 3MV9D 4N8CL 3NCJH 5L0QC 1XMWA 2NY2D 3NPSB 2GI7A 4GS7B 3ARVA 3VFMB 3QIBC 1X5GA 3QFDA 4OM1H 3CDYA 3IFNL 4HJGA 3ARDD 3EDFA 5BRZE 1CXHA 5JW3H 3VFRA 1ZHBA 1Q0XL 1EHAA 1F13A 1KJ2B 1RUAH 3EJYD 4X4ZA 4C56B 4CVXA 2BDNL 3ZKNC 5EU5B 3C09C 3DXAD 2D03L 4UTAL 4C55A 2EE9A 4NNYB 1HNGA 1FO0B 4G43B 3FB8A 4JB9H 4U1JB 4MNQB 5DUPH 3ZT7A 1WV7T 1FDLH 1CXIA 1TVHB 1KULA 3ZYOA 4UAOC 3GUTB 2R2BB 1YMMA 5CEZH 4KRLB 4DTGL 2FLRT 3TBYB 3DURA 3N1PC 3PHQA 5CMAA 1N3NA 4MS8D 3TCXA 1IGIL 2FR4A 4K8RH 3A6CL 2BRQA 1NL0L 4HIEA 2ZCLL 4BFIA 5C0IA 5IB5B 4JEGB 1RFDL 3VXTB 4R2GC 4OV5B 3MA7B 4FXGB 1G7JA 1FVEA 2JLLA 1MCJA 4ZTPH 5IVZA 4LLVA 4GMTH 2VLME 4P2QA 4F58L 5HGDB 1IGML 5HHOE 3ARQA 3Q6FA 1P7KB 3RVXD 4DOHE 5HHME 2A1WH 5EORL 3V9FA 3ZE1E 2I5YL 5IIEB 1JP5A 3E6HA 5IHBA 4NQEA 2WBWB 4WGWB 3T2NL 1L6ZA 3NN8A 1ORQA 2GY5A 1FN4B 3OPZH 4ELKB 3TZVC 5GGSB 2P8PB 3QEHA 5IVNA 5E99H 3C8KA 4MA3A 1T1YA 4NQVB 4U1LA 3VXRD 3GSXB 3JV5A 1A6WH 1AIFB 1S7QA 4G6JH 2VQTA 4K7PY 1GL4B 5CSZB 3RKPA 4OF0A 4M03A 2X10A 3BP6A 4OI8A 1BFTA 3AC0A 4F8QA 4N8VB 3QG6B 5E8OA 3OX8A 4OZFG 4HWUA 3VXMB 1HYSC 4PRPB 4NQDB 2LVCA 4WI6A 2VXVH 1N59A 1ND0B 3QUXC 2A73A 2X4OA 3N1GC 5D1ZC 3MYZA 2J4WL 2N56A 1GXEA 1FFNA 3GB7A 3CIQA 2PNDA 5L8JB 2J1KA 1JFQL 4WFGE 5FF6A 2IH3A 4ENED 1UXSA 3MRIB 3MLPA 1CICA 3PV6B 3U46B 4HH9A 4FFWC 3MRMA 3RU8L 3L5HA 4JG1L 1OP5K 3PQYE 1FBIH 4LRNH 5IEHA 4O2CB 1QSFA 2IPUG 3VWJB 4I0PB 4UIMA 2OJEA 2HH0L 3N1QC 3PP3H 1I7TB 4Y4FA 3PG2A 5TFSH 1JNLH 3UAJC 4J12A 3V7AE 5D8JH 4CJ1A 3FO1A 4PB0L 1B9ZA 4Z5RA 1CT8A 3ECBB 1DLFL 3TT1H 1FNAA 4D0CB 5I73C 3AGVA 2DD8H 4ODWA 2RAMA 1IAOA 4BH8B 1HXMA 3ULSA 1IC4H 2F54A 2X7LA 4NBXB 4H25B 5MENB 3QXTA 4LCCB 1I7UA 3SDDA 4Z78B 4QWWC 4HZAA 1TJHH 1KJ2L 3RVVD 2BVOB 2ZG2A 4LLWB 4MYWB 4MSWB 4JM2C 5JIPA 3WNPA 1AHWB 4KI5C 3V5KB 3MRLA 4DGIH 5ID0B 1EUUA 3IU3B 3RPKA 3OKNB 4M1DL 3BJLA 2V17H 1NKOA 4MD5B 4YDKH 1CR9L 1S7TB 3H0TA 3SN6N 4Q9RH 5C6PB 5JDSB 1VFAB 2EEDA 3SDAA 3DTXA 4RGNC 4MQXC 1T83A 1VERA 5I2IB 3U7WH 3UTTE 1U95B 4NHUA 1FFOA 5ITFA 3NFNA 5CIPA 1SHMA 4KKCD 3UC0H 3A6OA 4LPVA 1NAMA 3F7VA 4Z0BH 4NKIH 1BIHA 1C08B 1LP9E 4L8SB 5GQBA 4JDZB 4ZFZA 3PWPE 1ZA3B 1QRNE 2B39A 3VG0L 4RQQB 1G9NL 1N8ZB 3FRPA 3H9SE 5HHXH 3FKUS 4AMKH 3C2AL 4F7EB 4Q9QL 1W0VB 1AD0B 1T89C 3D9AH 1MRDL 3F58L 4BSWB 5DQDL 5GGTL 1KPUB 2ZG3A 4WFHD 1ITBB 2X2YA 5F7DA 3B4NA 5I6XC 4OZGE 4NO0A 3B5GA 2XZQH 2NY0D 3QUMH 4UINL 2DQJH 1B4JH 1UC6A 4FFVD 4OB5H 3HFML 2QSQA 4Z7NE 4X80H 4PGCB 4QGYA 4OLWH 3U4EA 1JMXA 4KI5E 4BSJA 4PJDB 4JFEA 1U3HC 4W6WB 4DGYL 1YEHL 3CFCH 3W11D 3N06B 2Q1EA 1RUQH 3ZE0E 1AGFA 1QUNA 2DF3A 4CNIB 3TC9A 4YHIB 4MJIB 3RHWK 2XN9B 3DGCR 5KS9E 4RGNE 1KJMA 4EVNA 4FQLL </