2GFNA

Crystal structure of hth-type transcriptional regulator pksa related protein from rhodococcus sp. rha1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
196
structure length
192
Chain Sequence
IVDHDERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAALRRAGDIQGDRYRTILDEEGAGPIEKLRNITASILPLDERRLAMTRVFLFFYAEGTARGEIAAFLARWRGVVRESVVAAQREGTVSTDLDADAVTVALVALTDGLALQAILDPVVMKAISAEDAAARCVDAAVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HTH-type transcriptional regulator pksA related protein from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator pksA related protein
total genus 74
structure length 192
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13977 TetR_C_6 BetI-type transcriptional repressor, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2gfnA00
4AC0A 5F1JA 3ON2A 3G56A 3O8GA 1JT6A 3LJLA 2IU5A 3FK7A 2VPRA 2GFNA 3NRGA 5FKMA 5HSZA 1JT0A 3KKCA 5FKNA 4GCTA 1JTYA 5J1YA 2QCOA 3E7QA 3BTLA 5AQCA 2REKA 2XGCA 4GCLA 5FMPA 3CDLA 2ZOZA 3VW1A 3DCFA 4I6ZA 3KNWA 3QPLA 3BHQA 3EGQA 1A6IA 2ID6A 2ZCMA 3BR0A 2HXIA 2W53A 3ZQLA 3ANGA 1U9OA 2D6YA 3HGYA 4M3EA 4AUXA 2G7SA 3BR2A 5K7FA 3G1MA 2FX0A 5F0CA 3BT9A 3TP3A 3BTIA 2VKEA 3G1LA 4NN1A 3WHCA 5K7HA 5GPCA 1T33A 5GPAA 2FQ4A 4GCKA 3VIBA 2Y30A 3ZQGA 2PZ9A 3HGGA 4JKZA 4D7MA 4I76A 2QWTA 1JTXA 5K7ZA 5F04A 3VW2A 3AQTA 4X1EA 4D5FA 5H9TA 4G12A 5HAWA 2G7GA 2ZB9A 3FK6A 3VVZA 3BR1A 2G7LA 4CGRA 5K58A 3QQAA 2UXPA 3BR6A 3QPSA 4MO7A 5EZGA 5FKOA 2XGDA 2YVHA 2O7OA 2DG8A 2DG7A 5J3LA 5EFYA 2FD5A 4D5CA 1BJZA 3G7RA 2F07A 3KZ9A 4ME9A 3T6NA 2FJ1A 4M3GA 2TCTA 4W1UA 2QIBA 3BQYA 4GFKA 4V2FA 2ZCNA 5F08A 5CXIA 4AF5A 3VUQA 4M3DA 2HYTA 5HBUA 3QKXA 5FKLA 5CW8A 3VVXA 3GZIA 3LSPA 4W97A 3SDGA 5EYRA 2X6OA 2XPWA 4MXMA 3B81A 3S5RA 2UXHA 3BR5A 2QTQA 3HTJA 3ON4A 3NI7A 1JUSA 2QKOA 3VOKA 2X9DA 3VVYA 2G3BA 2GBYA 3ANPA 3CWRA 4YZEA 3Q0VA 3Q3SA 3VW0A 2O7TA 3ZQFA 2JJ7A 2XPVA 5D18A 3V6GA 4B1RA 2GENA 3KKDA 3NPIA 3PASA 2XPUA 3COLA 3VOXA 5IOYA 2I10A 3BJBA 2XRLA 3V78A 5GP9A 3F1BA 4GFLA 2OERA 3CCYA 1RKWA 4HKUA 2FBQA 3IH2A 2WUIA 3ZQIA 1Z0XA 5IP6A 3BTCA 5F0HA 4ACIA 2Y31A 4M3FA 2NP5A 3C2BA 5IOZA 1QVTA 2XGEA 3Q0UA 3LSRA 2RASA 2QOPA 3PM1A 2VKVA 3DPJA 5FGLA 1VI0A 3PPBA 4KWAA 2XDNA 3MNLA 4DW6A 2HXOA 4AC6A 2YVEA 3TP0A 1RKTA 2WGBA 3BTJA 4ICHA 5J1UA 1QVUA 3G1OA 4MK6A 3B6AA 4L62A 2UXOA 1ZKGA 2Y2ZA 2HKUA 5CXGA 3LWJA 1Z77A 2IAIA 2NS7A 3BCGA 4JNNA 3SFIA 3CRJA 1U9NA 3WHBA 3ZQHA 1UI5A 2XB5A 3BRUA 2HYJA 2G0EA 3BR3A 3IUVA 3LHQA 2IEKA 2RHAA 3RD3A 2OI8A 3F0CA 3GEUA 3LOCA 2NX4A 2V57A 3VP5A 3VPRA 1ZK8A 5EZHA 5IPAA 4PXIA 3AQSA 5FHPA 3QBMA 3BQZA 3HTAA 2GUHA 3LSJA 2NS8A 3NNRA 2EH3A 1RPWA 3HTHA 2TRTA 3JSJA 2ID3A 3C07A 2NP3A 2RAEA 1ORKA 1JUPA 1JUMA 2PBXA 3DEWA 2UXUA 3B6CA 2ZOYA 1UI6A 4JYKA 5F27A 5C4YA 2IBDA 1QPIA 1SGMA 2UXIA 4NELA 5J1RA 3HE0A 3IH3A 2ZCXA 2JK3A 1T56A 3FRQA 3CJDA 5D19A 2DTZA 3O8HA 2Q24A 2WV1A 5DAJA 4V2GA 3FIWA 3HIMA 3P9TA 3Q0WA 3MVPA 2HQ5A 3EUPA 4XK4A 5D1RA 4M3BA 4ABZA 3NXCA 3O60A 4UDSA 3IH4A 2OPTA 3BNIA 2OF7A 4B3AA 3HTIA 4JL3A 5F0FA 5FKKA 4D7NA 3RH2A
chains in the Genus database with same CATH superfamily
4AC0A 5F1JA 3ON2A 3G56A 3O8GA 1JT6A 3LJLA 2IU5A 3FK7A 2VPRA 2GFNA 3NRGA 5FKMA 5HSZA 1JT0A 3KKCA 5FKNA 4GCTA 1JTYA 5J1YA 2QCOA 3E7QA 3BTLA 2R7SA 5AQCA 2REKA 2XGCA 4GCLA 5FMPA 3CDLA 2ZOZA 3VW1A 3DCFA 4I6ZA 3KNWA 3QPLA 3BHQA 3EGQA 3FHNA 1A6IA 2ID6A 2ZCMA 3BR0A 2HXIA 2W53A 3ZQLA 3ANGA 1U9OA 2D6YA 3HGYA 4M3EA 4AUXA 2G7SA 2R7RA 3BR2A 5K7FA 3G1MA 2FX0A 5F0CA 3BT9A 3TP3A 3BTIA 2VKEA 3G1LA 4NN1A 3WHCA 5K7HA 4U9LA 5GPCA 1T33A 3VTIA 5GPAA 2FQ4A 2YVXA 4GCKA 4C2MA 3VIBA 2Y30A 3ZQGA 2PZ9A 3HGGA 4JKZA 4D7MA 4I76A 2QWTA 1JTXA 2R7QA 5K7ZA 5F04A 3VW2A 3AQTA 4X1EA 4D5FA 5H9TA 4G12A 5HAWA 2R7UA 2G7GA 2ZB9A 3FK6A 3VVZA 3BR1A 2G7LA 4CGRA 5K58A 3QQAA 2UXPA 3BR6A 3QPSA 4MO7A 5EZGA 5FKOA 2XGDA 2YVHA 2O7OA 2DG8A 2DG7A 5J3LA 5EFYA 2FD5A 4D5CA 1BJZA 3G7RA 2F07A 3KZ9A 4ME9A 3T6NA 2FJ1A 4M3GA 2TCTA 4W1UA 2QIBA 3BQYA 4OD4A 4GFKA 4V2FA 2ZCNA 5F08A 5CXIA 4AF5A 3VUQA 4M3DA 2HYTA 5HBUA 3QKXA 4WIBA 2R7VA 4OD5A 5FKLA 5CW8A 3VVXA 3GZIA 3LSPA 4W97A 3SDGA 5EYRA 2X6OA 2XPWA 4MXMA 3B81A 3S5RA 2UXHA 3BR5A 2QTQA 3HTJA 3ON4A 3NI7A 1JUSA 2QKOA 3VOKA 2X9DA 3VVYA 2G3BA 2GBYA 3ANPA 3CWRA 4YZEA 3Q0VA 3Q3SA 3VW0A 2O7TA 3ZQFA 2JJ7A 4IRVA 2XPVA 2R7TA 5D18A 3V6GA 4B1RA 2GENA 3KKDA 2PFVA 4DVYP 3NPIA 3PASA 2XPUA 3COLA 3VOXA 5IOYA 2I10A 3BJBA 2XRLA 3V78A 5GP9A 3F1BA 4GFLA 2OERA 3CCYA 1RKWA 4HKUA 2FBQA 2R7WA 3IH2A 2WUIA 3ZQIA 1Z0XA 5IP6A 3BTCA 5F0HA 4ACIA 2Y31A 4M3FA 2NP5A 3C2BA 5IOZA 1QVTA 2XGEA 3Q0UA 3DU6A 3LSRA 4U9NA 2RASA 2QOPA 3PM1A 2VKVA 3DPJA 5FGLA 1VI0A 3PPBA 4KWAA 2XDNA 3MNLA 4DW6A 3NS4A 2HXOA 4AC6A 2YVEA 3TP0A 1RKTA 2WGBA 3BTJA 4ICHA 5J1UA 3K8PC 1QVUA 3G1OA 4MK6A 3B6AA 4L62A 2UXOA 1ZKGA 2Y2ZA 2HKUA 5CXGA 2A2FX 3LWJA 1Z77A 2IAIA 2NS7A 3BCGA 4JNNA 3SFIA 3CRJA 1U9NA 3WHBA 3ZQHA 1UI5A 2XB5A 3BRUA 2HYJA 2G0EA 3BR3A 3IUVA 3LHQA 2IEKA 2RHAA 3RD3A 2OI8A 3F0CA 3GEUA 3LOCA 2NX4A 2V57A 3VP5A 3VPRA 1ZK8A 5EZHA 5IPAA 4PXIA 3AQSA 3KYLA 5FHPA 3QBMA 3BQZA 3HTAA 2GUHA 2R7OA 5CQGA 3LSJA 2NS8A 3SWHA 3NNRA 2EH3A 2ZY9A 1RPWA 3HTHA 2TRTA 3JSJA 2ID3A 3C07A 2B3WA 2NP3A 2RAEA 1ORKA 1JUPA 1JUMA 2PBXA 3DEWA 2R7XA 2UXUA 3B6CA 2ZOYA 1UI6A 4JYKA 5F27A 5C4YA 3DU5A 2IBDA 1QPIA 1SGMA 2UXIA 4NELA 5J1RA 3HE0A 3IH3A 2ZCXA 2JK3A 1T56A 3FRQA 3CJDA 5D19A 2DTZA 3O8HA 2FJI1 2Q24A 2WV1A 5DAJA 4V2GA 3FIWA 3HIMA 3P9TA 3Q0WA 3MVPA 2HQ5A 2B1EA 3EUPA 4XK4A 5D1RA 4M3BA 4ABZA 3NXCA 3O60A 4UDSA 3IH4A 2OPTA 3BNIA 2OF7A 4B3AA 3HTIA 4JL3A 5F0FA 5FKKA 4D7NA 3RH2A
chains in the Genus database with same CATH topology
4AC0A 5F1JA 3ON2A 3G56A 3O8GA 1JT6A 3LJLA 2IU5A 3FK7A 2VPRA 2GFNA 3NRGA 5FKMA 5HSZA 1JT0A 3KKCA 5FKNA 4GCTA 1JTYA 5J1YA 2QCOA 3E7QA 3BTLA 5AQCA 2REKA 2XGCA 4GCLA 5FMPA 3CDLA 2ZOZA 3VW1A 3DCFA 4I6ZA 3KNWA 3QPLA 3BHQA 3EGQA 1A6IA 2ID6A 2ZCMA 3BR0A 2HXIA 2W53A 3ZQLA 3ANGA 1U9OA 2D6YA 3HGYA 4M3EA 4AUXA 2G7SA 3BR2A 5K7FA 3G1MA 2FX0A 5F0CA 3BT9A 3TP3A 3BTIA 2VKEA 3G1LA 4NN1A 3WHCA 5K7HA 5GPCA 1T33A 5GPAA 2FQ4A 4GCKA 3VIBA 2Y30A 3ZQGA 2PZ9A 3HGGA 4JKZA 4D7MA 4I76A 2QWTA 1JTXA 5K7ZA 5F04A 3VW2A 3AQTA 4X1EA 4D5FA 5H9TA 4G12A 5HAWA 2G7GA 2ZB9A 3FK6A 3VVZA 3BR1A 2G7LA 4CGRA 5K58A 3QQAA 2UXPA 3BR6A 3QPSA 4MO7A 5EZGA 5FKOA 2XGDA 2YVHA 2O7OA 2DG8A 2DG7A 5J3LA 5EFYA 2FD5A 4D5CA 1BJZA 3G7RA 2F07A 3KZ9A 4ME9A 3T6NA 2FJ1A 4M3GA 2TCTA 4W1UA 2QIBA 3BQYA 4GFKA 4V2FA 2ZCNA 5F08A 5CXIA 4AF5A 3VUQA 4M3DA 2HYTA 5HBUA 3QKXA 5FKLA 5CW8A 3VVXA 3GZIA 3LSPA 4W97A 3SDGA 5EYRA 2X6OA 2XPWA 4MXMA 3B81A 3S5RA 2UXHA 3BR5A 2QTQA 3HTJA 3ON4A 3NI7A 1JUSA 2QKOA 3VOKA 2X9DA 3VVYA 2G3BA 2GBYA 3ANPA 3CWRA 4YZEA 3Q0VA 3Q3SA 3VW0A 2O7TA 3ZQFA 2JJ7A 2XPVA 5D18A 3V6GA 4B1RA 2GENA 3KKDA 3NPIA 3PASA 2XPUA 3COLA 3VOXA 5IOYA 2I10A 3BJBA 2XRLA 3V78A 5GP9A 3F1BA 4GFLA 2OERA 3CCYA 1RKWA 4HKUA 2FBQA 3IH2A 2WUIA 3ZQIA 1Z0XA 5IP6A 3BTCA 5F0HA 4ACIA 2Y31A 4M3FA 2NP5A 3C2BA 5IOZA 1QVTA 2XGEA 3Q0UA 3LSRA 2RASA 2QOPA 3PM1A 2VKVA 3DPJA 5FGLA 1VI0A 3PPBA 4KWAA 2XDNA 3MNLA 4DW6A 2HXOA 4AC6A 2YVEA 3TP0A 1RKTA 2WGBA 3BTJA 4ICHA 5J1UA 1QVUA 3G1OA 4MK6A 3B6AA 4L62A 2UXOA 1ZKGA 2Y2ZA 2HKUA 5CXGA 3LWJA 1Z77A 2IAIA 2NS7A 3BCGA 4JNNA 3SFIA 3CRJA 1U9NA 3WHBA 3ZQHA 1UI5A 2XB5A 3BRUA 2HYJA 2G0EA 3BR3A 3IUVA 3LHQA 2IEKA 2RHAA 3RD3A 2OI8A 3F0CA 3GEUA 3LOCA 2NX4A 2V57A 3VP5A 3VPRA 1ZK8A 5EZHA 5IPAA 4PXIA 3AQSA 5FHPA 3QBMA 3BQZA 3HTAA 2GUHA 3LSJA 2NS8A 3NNRA 2EH3A 1RPWA 3HTHA 2TRTA 3JSJA 2ID3A 3C07A 2NP3A 2RAEA 1ORKA 1JUPA 1JUMA 2PBXA 3DEWA 2UXUA 3B6CA 2ZOYA 1UI6A 4JYKA 5F27A 5C4YA 2IBDA 1QPIA 1SGMA 2UXIA 4NELA 5J1RA 3HE0A 3IH3A 2ZCXA 2JK3A 1T56A 3FRQA 3CJDA 5D19A 2DTZA 3O8HA 2Q24A 2WV1A 5DAJA 4V2GA 3FIWA 3HIMA 3P9TA 3Q0WA 3MVPA 2HQ5A 3EUPA 4XK4A 5D1RA 4M3BA 4ABZA 3NXCA 3O60A 4UDSA 3IH4A 2OPTA 3BNIA 2OF7A 4B3AA 3HTIA 4JL3A 5F0FA 5FKKA 4D7NA 3RH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AC0 A;  5F1J A;  3ON2 A;  3G56 A;  3O8G A;  1JT6 A;  3LJL A;  2IU5 A;  3FK7 A;  2VPR A;  2GFN A;  3NRG A;  5FKM A;  5HSZ A;  1JT0 A;  3KKC A;  5FKN A;  4GCT A;  1JTY A;  5J1Y A;  2QCO A;  3E7Q A;  3BTL A;  5AQC A;  2REK A;  2XGC A;  4GCL A;  5FMP A;  3CDL A;  2ZOZ A;  3VW1 A;  3DCF A;  4I6Z A;  3KNW A;  3QPL A;  3BHQ A;  3EGQ A;  1A6I A;  2ID6 A;  2ZCM A;  3BR0 A;  2HXI A;  2W53 A;  3ZQL A;  3ANG A;  1U9O A;  2D6Y A;  3HGY A;  4M3E A;  4AUX A;  2G7S A;  3BR2 A;  5K7F A;  3G1M A;  2FX0 A;  5F0C A;  3BT9 A;  3TP3 A;  3BTI A;  2VKE A;  3G1L A;  4NN1 A;  3WHC A;  5K7H A;  5GPC A;  1T33 A;  5GPA A;  2FQ4 A;  4GCK A;  3VIB A;  2Y30 A;  3ZQG A;  2PZ9 A;  3HGG A;  4JKZ A;  4D7M A;  4I76 A;  2QWT A;  1JTX A;  5K7Z A;  5F04 A;  3VW2 A;  3AQT A;  4X1E A;  4D5F A;  5H9T A;  4G12 A;  5HAW A;  2G7G A;  2ZB9 A;  3FK6 A;  3VVZ A;  3BR1 A;  2G7L A;  4CGR A;  5K58 A;  3QQA A;  2UXP A;  3BR6 A;  3QPS A;  4MO7 A;  5EZG A;  5FKO A;  2XGD A;  2YVH A;  2O7O A;  2DG8 A;  2DG7 A;  5J3L A;  5EFY A;  2FD5 A;  4D5C A;  1BJZ A;  3G7R A;  2F07 A;  3KZ9 A;  4ME9 A;  3T6N A;  2FJ1 A;  4M3G A;  2TCT A;  4W1U A;  2QIB A;  3BQY A;  4GFK A;  4V2F A;  2ZCN A;  5F08 A;  5CXI A;  4AF5 A;  3VUQ A;  4M3D A;  2HYT A;  5HBU A;  3QKX A;  5FKL A;  5CW8 A;  3VVX A;  3GZI A;  3LSP A;  4W97 A;  3SDG A;  5EYR A;  2X6O A;  2XPW A;  4MXM A;  3B81 A;  3S5R A;  2UXH A;  3BR5 A;  2QTQ A;  3HTJ A;  3ON4 A;  3NI7 A;  1JUS A;  2QKO A;  3VOK A;  2X9D A;  3VVY A;  2G3B A;  2GBY A;  3ANP A;  3CWR A;  4YZE A;  3Q0V A;  3Q3S A;  3VW0 A;  2O7T A;  3ZQF A;  2JJ7 A;  2XPV A;  5D18 A;  3V6G A;  4B1R A;  2GEN A;  3KKD A;  3NPI A;  3PAS A;  2XPU A;  3COL A;  3VOX A;  5IOY A;  2I10 A;  3BJB A;  2XRL A;  3V78 A;  5GP9 A;  3F1B A;  4GFL A;  2OER A;  3CCY A;  1RKW A;  4HKU A;  2FBQ A;  3IH2 A;  2WUI A;  3ZQI A;  1Z0X A;  5IP6 A;  3BTC A;  5F0H A;  4ACI A;  2Y31 A;  4M3F A;  2NP5 A;  3C2B A;  5IOZ A;  1QVT A;  2XGE A;  3Q0U A;  3LSR A;  2RAS A;  2QOP A;  3PM1 A;  2VKV A;  3DPJ A;  5FGL A;  1VI0 A;  3PPB A;  4KWA A;  2XDN A;  3MNL A;  4DW6 A;  2HXO A;  4AC6 A;  2YVE A;  3TP0 A;  1RKT A;  2WGB A;  3BTJ A;  4ICH A;  5J1U A;  1QVU A;  3G1O A;  4MK6 A;  3B6A A;  4L62 A;  2UXO A;  1ZKG A;  2Y2Z A;  2HKU A;  5CXG A;  3LWJ A;  1Z77 A;  2IAI A;  2NS7 A;  3BCG A;  4JNN A;  3SFI A;  3CRJ A;  1U9N A;  3WHB A;  3ZQH A;  1UI5 A;  2XB5 A;  3BRU A;  2HYJ A;  2G0E A;  3BR3 A;  3IUV A;  3LHQ A;  2IEK A;  2RHA A;  3RD3 A;  2OI8 A;  3F0C A;  3GEU A;  3LOC A;  2NX4 A;  2V57 A;  3VP5 A;  3VPR A;  1ZK8 A;  5EZH A;  5IPA A;  4PXI A;  3AQS A;  5FHP A;  3QBM A;  3BQZ A;  3HTA A;  2GUH A;  3LSJ A;  2NS8 A;  3NNR A;  2EH3 A;  1RPW A;  3HTH A;  2TRT A;  3JSJ A;  2ID3 A;  3C07 A;  2NP3 A;  2RAE A;  1ORK A;  1JUP A;  1JUM A;  2PBX A;  3DEW A;  2UXU A;  3B6C A;  2ZOY A;  1UI6 A;  4JYK A;  5F27 A;  5C4Y A;  2IBD A;  1QPI A;  1SGM A;  2UXI A;  4NEL A;  5J1R A;  3HE0 A;  3IH3 A;  2ZCX A;  2JK3 A;  1T56 A;  3FRQ A;  3CJD A;  5D19 A;  2DTZ A;  3O8H A;  2Q24 A;  2WV1 A;  5DAJ A;  4V2G A;  3FIW A;  3HIM A;  3P9T A;  3Q0W A;  3MVP A;  2HQ5 A;  3EUP A;  4XK4 A;  5D1R A;  4M3B A;  4ABZ A;  3NXC A;  3O60 A;  4UDS A;  3IH4 A;  2OPT A;  3BNI A;  2OF7 A;  4B3A A;  3HTI A;  4JL3 A;  5F0F A;  5FKK A;  4D7N A;  3RH2 A; 
#chains in the Genus database with same CATH topology
 4AC0 A;  5F1J A;  3ON2 A;  3G56 A;  3O8G A;  1JT6 A;  3LJL A;  2IU5 A;  3FK7 A;  2VPR A;  2GFN A;  3NRG A;  5FKM A;  5HSZ A;  1JT0 A;  3KKC A;  5FKN A;  4GCT A;  1JTY A;  5J1Y A;  2QCO A;  3E7Q A;  3BTL A;  2R7S A;  5AQC A;  2REK A;  2XGC A;  4GCL A;  5FMP A;  3CDL A;  2ZOZ A;  3VW1 A;  3DCF A;  4I6Z A;  3KNW A;  3QPL A;  3BHQ A;  3EGQ A;  3FHN A;  1A6I A;  2ID6 A;  2ZCM A;  3BR0 A;  2HXI A;  2W53 A;  3ZQL A;  3ANG A;  1U9O A;  2D6Y A;  3HGY A;  4M3E A;  4AUX A;  2G7S A;  2R7R A;  3BR2 A;  5K7F A;  3G1M A;  2FX0 A;  5F0C A;  3BT9 A;  3TP3 A;  3BTI A;  2VKE A;  3G1L A;  4NN1 A;  3WHC A;  5K7H A;  4U9L A;  5GPC A;  1T33 A;  3VTI A;  5GPA A;  2FQ4 A;  2YVX A;  4GCK A;  4C2M A;  3VIB A;  2Y30 A;  3ZQG A;  2PZ9 A;  3HGG A;  4JKZ A;  4D7M A;  4I76 A;  2QWT A;  1JTX A;  2R7Q A;  5K7Z A;  5F04 A;  3VW2 A;  3AQT A;  4X1E A;  4D5F A;  5H9T A;  4G12 A;  5HAW A;  2R7U A;  2G7G A;  2ZB9 A;  3FK6 A;  3VVZ A;  3BR1 A;  2G7L A;  4CGR A;  5K58 A;  3QQA A;  2UXP A;  3BR6 A;  3QPS A;  4MO7 A;  5EZG A;  5FKO A;  2XGD A;  2YVH A;  2O7O A;  2DG8 A;  2DG7 A;  5J3L A;  5EFY A;  2FD5 A;  4D5C A;  1BJZ A;  3G7R A;  2F07 A;  3KZ9 A;  4ME9 A;  3T6N A;  2FJ1 A;  4M3G A;  2TCT A;  4W1U A;  2QIB A;  3BQY A;  4OD4 A;  4GFK A;  4V2F A;  2ZCN A;  5F08 A;  5CXI A;  4AF5 A;  3VUQ A;  4M3D A;  2HYT A;  5HBU A;  3QKX A;  4WIB A;  2R7V A;  4OD5 A;  5FKL A;  5CW8 A;  3VVX A;  3GZI A;  3LSP A;  4W97 A;  3SDG A;  5EYR A;  2X6O A;  2XPW A;  4MXM A;  3B81 A;  3S5R A;  2UXH A;  3BR5 A;  2QTQ A;  3HTJ A;  3ON4 A;  3NI7 A;  1JUS A;  2QKO A;  3VOK A;  2X9D A;  3VVY A;  2G3B A;  2GBY A;  3ANP A;  3CWR A;  4YZE A;  3Q0V A;  3Q3S A;  3VW0 A;  2O7T A;  3ZQF A;  2JJ7 A;  4IRV A;  2XPV A;  2R7T A;  5D18 A;  3V6G A;  4B1R A;  2GEN A;  3KKD A;  2PFV A;  4DVY P;  3NPI A;  3PAS A;  2XPU A;  3COL A;  3VOX A;  5IOY A;  2I10 A;  3BJB A;  2XRL A;  3V78 A;  5GP9 A;  3F1B A;  4GFL A;  2OER A;  3CCY A;  1RKW A;  4HKU A;  2FBQ A;  2R7W A;  3IH2 A;  2WUI A;  3ZQI A;  1Z0X A;  5IP6 A;  3BTC A;  5F0H A;  4ACI A;  2Y31 A;  4M3F A;  2NP5 A;  3C2B A;  5IOZ A;  1QVT A;  2XGE A;  3Q0U A;  3DU6 A;  3LSR A;  4U9N A;  2RAS A;  2QOP A;  3PM1 A;  2VKV A;  3DPJ A;  5FGL A;  1VI0 A;  3PPB A;  4KWA A;  2XDN A;  3MNL A;  4DW6 A;  3NS4 A;  2HXO A;  4AC6 A;  2YVE A;  3TP0 A;  1RKT A;  2WGB A;  3BTJ A;  4ICH A;  5J1U A;  3K8P C;  1QVU A;  3G1O A;  4MK6 A;  3B6A A;  4L62 A;  2UXO A;  1ZKG A;  2Y2Z A;  2HKU A;  5CXG A;  2A2F X;  3LWJ A;  1Z77 A;  2IAI A;  2NS7 A;  3BCG A;  4JNN A;  3SFI A;  3CRJ A;  1U9N A;  3WHB A;  3ZQH A;  1UI5 A;  2XB5 A;  3BRU A;  2HYJ A;  2G0E A;  3BR3 A;  3IUV A;  3LHQ A;  2IEK A;  2RHA A;  3RD3 A;  2OI8 A;  3F0C A;  3GEU A;  3LOC A;  2NX4 A;  2V57 A;  3VP5 A;  3VPR A;  1ZK8 A;  5EZH A;  5IPA A;  4PXI A;  3AQS A;  3KYL A;  5FHP A;  3QBM A;  3BQZ A;  3HTA A;  2GUH A;  2R7O A;  5CQG A;  3LSJ A;  2NS8 A;  3SWH A;  3NNR A;  2EH3 A;  2ZY9 A;  1RPW A;  3HTH A;  2TRT A;  3JSJ A;  2ID3 A;  3C07 A;  2B3W A;  2NP3 A;  2RAE A;  1ORK A;  1JUP A;  1JUM A;  2PBX A;  3DEW A;  2R7X A;  2UXU A;  3B6C A;  2ZOY A;  1UI6 A;  4JYK A;  5F27 A;  5C4Y A;  3DU5 A;  2IBD A;  1QPI A;  1SGM A;  2UXI A;  4NEL A;  5J1R A;  3HE0 A;  3IH3 A;  2ZCX A;  2JK3 A;  1T56 A;  3FRQ A;  3CJD A;  5D19 A;  2DTZ A;  3O8H A;  2FJI 1;  2Q24 A;  2WV1 A;  5DAJ A;  4V2G A;  3FIW A;  3HIM A;  3P9T A;  3Q0W A;  3MVP A;  2HQ5 A;  2B1E A;  3EUP A;  4XK4 A;  5D1R A;  4M3B A;  4ABZ A;  3NXC A;  3O60 A;  4UDS A;  3IH4 A;  2OPT A;  3BNI A;  2OF7 A;  4B3A A;  3HTI A;  4JL3 A;  5F0F A;  5FKK A;  4D7N A;  3RH2 A; 
#chains in the Genus database with same CATH homology
 4AC0 A;  5F1J A;  3ON2 A;  3G56 A;  3O8G A;  1JT6 A;  3LJL A;  2IU5 A;  3FK7 A;  2VPR A;  2GFN A;  3NRG A;  5FKM A;  5HSZ A;  1JT0 A;  3KKC A;  5FKN A;  4GCT A;  1JTY A;  5J1Y A;  2QCO A;  3E7Q A;  3BTL A;  5AQC A;  2REK A;  2XGC A;  4GCL A;  5FMP A;  3CDL A;  2ZOZ A;  3VW1 A;  3DCF A;  4I6Z A;  3KNW A;  3QPL A;  3BHQ A;  3EGQ A;  1A6I A;  2ID6 A;  2ZCM A;  3BR0 A;  2HXI A;  2W53 A;  3ZQL A;  3ANG A;  1U9O A;  2D6Y A;  3HGY A;  4M3E A;  4AUX A;  2G7S A;  3BR2 A;  5K7F A;  3G1M A;  2FX0 A;  5F0C A;  3BT9 A;  3TP3 A;  3BTI A;  2VKE A;  3G1L A;  4NN1 A;  3WHC A;  5K7H A;  5GPC A;  1T33 A;  5GPA A;  2FQ4 A;  4GCK A;  3VIB A;  2Y30 A;  3ZQG A;  2PZ9 A;  3HGG A;  4JKZ A;  4D7M A;  4I76 A;  2QWT A;  1JTX A;  5K7Z A;  5F04 A;  3VW2 A;  3AQT A;  4X1E A;  4D5F A;  5H9T A;  4G12 A;  5HAW A;  2G7G A;  2ZB9 A;  3FK6 A;  3VVZ A;  3BR1 A;  2G7L A;  4CGR A;  5K58 A;  3QQA A;  2UXP A;  3BR6 A;  3QPS A;  4MO7 A;  5EZG A;  5FKO A;  2XGD A;  2YVH A;  2O7O A;  2DG8 A;  2DG7 A;  5J3L A;  5EFY A;  2FD5 A;  4D5C A;  1BJZ A;  3G7R A;  2F07 A;  3KZ9 A;  4ME9 A;  3T6N A;  2FJ1 A;  4M3G A;  2TCT A;  4W1U A;  2QIB A;  3BQY A;  4GFK A;  4V2F A;  2ZCN A;  5F08 A;  5CXI A;  4AF5 A;  3VUQ A;  4M3D A;  2HYT A;  5HBU A;  3QKX A;  5FKL A;  5CW8 A;  3VVX A;  3GZI A;  3LSP A;  4W97 A;  3SDG A;  5EYR A;  2X6O A;  2XPW A;  4MXM A;  3B81 A;  3S5R A;  2UXH A;  3BR5 A;  2QTQ A;  3HTJ A;  3ON4 A;  3NI7 A;  1JUS A;  2QKO A;  3VOK A;  2X9D A;  3VVY A;  2G3B A;  2GBY A;  3ANP A;  3CWR A;  4YZE A;  3Q0V A;  3Q3S A;  3VW0 A;  2O7T A;  3ZQF A;  2JJ7 A;  2XPV A;  5D18 A;  3V6G A;  4B1R A;  2GEN A;  3KKD A;  3NPI A;  3PAS A;  2XPU A;  3COL A;  3VOX A;  5IOY A;  2I10 A;  3BJB A;  2XRL A;  3V78 A;  5GP9 A;  3F1B A;  4GFL A;  2OER A;  3CCY A;  1RKW A;  4HKU A;  2FBQ A;  3IH2 A;  2WUI A;  3ZQI A;  1Z0X A;  5IP6 A;  3BTC A;  5F0H A;  4ACI A;  2Y31 A;  4M3F A;  2NP5 A;  3C2B A;  5IOZ A;  1QVT A;  2XGE A;  3Q0U A;  3LSR A;  2RAS A;  2QOP A;  3PM1 A;  2VKV A;  3DPJ A;  5FGL A;  1VI0 A;  3PPB A;  4KWA A;  2XDN A;  3MNL A;  4DW6 A;  2HXO A;  4AC6 A;  2YVE A;  3TP0 A;  1RKT A;  2WGB A;  3BTJ A;  4ICH A;  5J1U A;  1QVU A;  3G1O A;  4MK6 A;  3B6A A;  4L62 A;  2UXO A;  1ZKG A;  2Y2Z A;  2HKU A;  5CXG A;  3LWJ A;  1Z77 A;  2IAI A;  2NS7 A;  3BCG A;  4JNN A;  3SFI A;  3CRJ A;  1U9N A;  3WHB A;  3ZQH A;  1UI5 A;  2XB5 A;  3BRU A;  2HYJ A;  2G0E A;  3BR3 A;  3IUV A;  3LHQ A;  2IEK A;  2RHA A;  3RD3 A;  2OI8 A;  3F0C A;  3GEU A;  3LOC A;  2NX4 A;  2V57 A;  3VP5 A;  3VPR A;  1ZK8 A;  5EZH A;  5IPA A;  4PXI A;  3AQS A;  5FHP A;  3QBM A;  3BQZ A;  3HTA A;  2GUH A;  3LSJ A;  2NS8 A;  3NNR A;  2EH3 A;  1RPW A;  3HTH A;  2TRT A;  3JSJ A;  2ID3 A;  3C07 A;  2NP3 A;  2RAE A;  1ORK A;  1JUP A;  1JUM A;  2PBX A;  3DEW A;  2UXU A;  3B6C A;  2ZOY A;  1UI6 A;  4JYK A;  5F27 A;  5C4Y A;  2IBD A;  1QPI A;  1SGM A;  2UXI A;  4NEL A;  5J1R A;  3HE0 A;  3IH3 A;  2ZCX A;  2JK3 A;  1T56 A;  3FRQ A;  3CJD A;  5D19 A;  2DTZ A;  3O8H A;  2Q24 A;  2WV1 A;  5DAJ A;  4V2G A;  3FIW A;  3HIM A;  3P9T A;  3Q0W A;  3MVP A;  2HQ5 A;  3EUP A;  4XK4 A;  5D1R A;  4M3B A;  4ABZ A;  3NXC A;  3O60 A;  4UDS A;  3IH4 A;  2OPT A;  3BNI A;  2OF7 A;  4B3A A;  3HTI A;  4JL3 A;  5F0F A;  5FKK A;  4D7N A;  3RH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...