2GFNA

Crystal structure of hth-type transcriptional regulator pksa related protein from rhodococcus sp. rha1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
196
structure length
192
Chain Sequence
IVDHDERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAALRRAGDIQGDRYRTILDEEGAGPIEKLRNITASILPLDERRLAMTRVFLFFYAEGTARGEIAAFLARWRGVVRESVVAAQREGTVSTDLDADAVTVALVALTDGLALQAILDPVVMKAISAEDAAARCVDAAVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator pksA related protein
publication title Crystal structure of HTH-type transcriptional regulator pksA related protein from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
total genus 74
structure length 192
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13977 TetR_C_6 BetI-type transcriptional repressor, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2gfnA00
2PZ9A 3BHQA 1QVTA 5F0CA 2RHAA 4V2FA 5AQCA 4B1RA 3LJLA 4JKZA 1RKTA 3BR3A 4M3EA 1JUMA 3Q0WA 3Q0UA 2DG7A 5J1UA 3BQYA 5FMPA 1ZK8A 4G12A 4D7MA 3O8GA 3AQTA 3E7QA 3ZQHA 2V57A 3CCYA 4M3DA 5FKMA 3BR1A 5EYRA 2NP3A 4NN1A 2G0EA 3NRGA 5GP9A 3RH2A 3G56A 2XRLA 2Y31A 2WUIA 3O60A 4X1EA 3LHQA 5EZGA 1ZKGA 3FK6A 2QOPA 3G1OA 3HTAA 3PPBA 2FX0A 3ANPA 1SGMA 4KWAA 3C2BA 3IH4A 2QKOA 2RASA 3B6AA 2D6YA 4V2GA 2DG8A 4CGRA 2ZCNA 1Z0XA 2NP5A 3CDLA 2XGDA 3HIMA 3F1BA 2XGCA 2IEKA 3T6NA 2OF7A 2DTZA 3G1MA 1QPIA 3JSJA 3O8HA 2HYTA 2YVEA 3P9TA 5FKOA 5F0HA 3CJDA 3DCFA 3WHBA 5HAWA 5HSZA 2HXOA 4UDSA 3VIBA 5FKNA 2VPRA 2I10A 3VOKA 5C4YA 1UI5A 2HKUA 2ZCMA 3NPIA 4NELA 2XB5A 3BR0A 4MK6A 3ZQLA 2WGBA 2JJ7A 2WV1A 2IAIA 4D5FA 4JYKA 3VVZA 4PXIA 5J3LA 4GFLA 2QWTA 2XGEA 3RD3A 3ZQGA 5K7HA 3QPSA 3KKDA 5EZHA 2NX4A 2IBDA 1ORKA 2NS8A 3BR5A 5FHPA 3VVXA 2X9DA 5F1JA 5D18A 5D19A 2ID6A 4W1UA 2W53A 2RAEA 2GENA 4I6ZA 3KKCA 4I76A 1Z77A 2PBXA 3QQAA 2XDNA 5DAJA 5K58A 5IPAA 4JNNA 3EUPA 4XK4A 5FKKA 4ABZA 5CXIA 2NS7A 4D5CA 5CXGA 3GEUA 5IOZA 3CRJA 1QVUA 5GPCA 3LOCA 1U9OA 4M3BA 3FRQA 3V78A 5CW8A 2G7GA 2ZCXA 4B3AA 4GCLA 4M3FA 5D1RA 2FQ4A 1T56A 3BTLA 3NXCA 3VVYA 4ACIA 3LSJA 2ID3A 5F08A 3HTHA 4AUXA 3BRUA 3VW0A 2Q24A 3BTJA 2O7OA 3VOXA 3V6GA 1BJZA 2REKA 3VPRA 5J1RA 5IOYA 2G3BA 1JTYA 4M3GA 4GCTA 3C07A 2QCOA 2UXOA 3VW1A 3VUQA 3MVPA 2QTQA 2GFNA 2Y30A 3HTJA 2YVHA 3KZ9A 3ON4A 3IH3A 3HGGA 2XPWA 3BJBA 3TP3A 2TRTA 4AC0A 4AF5A 4GFKA 4GCKA 3DPJA 3BT9A 2OPTA 3ZQFA 4MO7A 4DW6A 3LSRA 2UXUA 2GUHA 3NNRA 1VI0A 2UXPA 3LWJA 2F07A 5GPAA 2G7LA 2X6OA 2ZOYA 2XPUA 3BNIA 2OI8A 2XPVA 5F0FA 1JUPA 2UXHA 1JT0A 3FIWA 5H9TA 1RPWA 3QBMA 4D7NA 1UI6A 2ZB9A 3TP0A 2OERA 4ME9A 3HGYA 4YZEA 3VP5A 3IH2A 3MNLA 3B6CA 3AQSA 3ZQIA 2ZOZA 3GZIA 4JL3A 4MXMA 3PASA 2O7TA 2IU5A 5F04A 3FK7A 4AC6A 3BCGA 5FKLA 3F0CA 3BR2A 3LSPA 3ANGA 2FD5A 2G7SA 3QKXA 3COLA 3SFIA 5K7ZA 3IUVA 2QIBA 2HQ5A 1T33A 3HTIA 3G1LA 3QPLA 1U9NA 5HBUA 2VKEA 3S5RA 1A6IA 1JUSA 3HE0A 3WHCA 3ON2A 3CWRA 4ICHA 2EH3A 4L62A 3KNWA 3G7RA 1JTXA 3EGQA 2TCTA 2VKVA 2JK3A 3BR6A 5IP6A 5F27A 2FBQA 3BTCA 4W97A 2UXIA 3VW2A 3B81A 3BTIA 2FJ1A 3DEWA 5J1YA 5K7FA 5EFYA 2Y2ZA 2HXIA 1RKWA 3SDGA 2GBYA 3Q3SA 5FGLA 3NI7A 2HYJA 3Q0VA 4HKUA 1JT6A 3PM1A 3BQZA
chains in the Genus database with same CATH superfamily
2PZ9A 3BHQA 1QVTA 5F0CA 2RHAA 4V2FA 5AQCA 3VTIA 2ZY9A 4B1RA 3LJLA 4JKZA 1RKTA 3BR3A 4M3EA 1JUMA 3Q0WA 3Q0UA 2R7TA 2DG7A 5J1UA 3BQYA 5FMPA 1ZK8A 4G12A 4D7MA 3O8GA 3AQTA 3E7QA 3ZQHA 2V57A 3CCYA 4M3DA 5FKMA 3BR1A 5EYRA 2NP3A 4NN1A 2G0EA 3NRGA 2R7QA 5GP9A 3RH2A 3G56A 2XRLA 2Y31A 2WUIA 3O60A 4X1EA 3LHQA 5EZGA 1ZKGA 3FK6A 2QOPA 3G1OA 3HTAA 3PPBA 2FX0A 3ANPA 1SGMA 4KWAA 3C2BA 3IH4A 2QKOA 2RASA 2YVXA 3B6AA 2D6YA 4V2GA 2DG8A 4CGRA 2ZCNA 1Z0XA 2NP5A 3CDLA 2XGDA 3HIMA 3F1BA 2XGCA 2IEKA 4WIBA 3T6NA 2OF7A 2DTZA 3G1MA 1QPIA 3JSJA 4U9NA 2R7SA 3O8HA 2HYTA 2YVEA 3P9TA 5FKOA 5F0HA 3CJDA 3DCFA 3WHBA 5HAWA 5HSZA 2HXOA 4UDSA 3VIBA 5FKNA 2VPRA 2R7RA 2R7XA 2I10A 3VOKA 5C4YA 1UI5A 2HKUA 2ZCMA 3NPIA 4NELA 2XB5A 3BR0A 4MK6A 3ZQLA 2WGBA 2JJ7A 2WV1A 2IAIA 4D5FA 3FHNA 4JYKA 3VVZA 4PXIA 5J3LA 4GFLA 2QWTA 2XGEA 3RD3A 3ZQGA 5K7HA 3QPSA 3KKDA 5EZHA 2NX4A 2IBDA 2R7VA 1ORKA 2NS8A 3BR5A 3SWHA 5FHPA 3DU5A 3VVXA 2X9DA 5F1JA 5D18A 5D19A 2ID6A 4W1UA 2W53A 2RAEA 2GENA 4I6ZA 3KKCA 4I76A 1Z77A 2PBXA 3QQAA 2XDNA 5DAJA 5K58A 5IPAA 4JNNA 3EUPA 4XK4A 5FKKA 4ABZA 5CXIA 2NS7A 4D5CA 5CXGA 3GEUA 5IOZA 3CRJA 1QVUA 5GPCA 3LOCA 1U9OA 4M3BA 3FRQA 3V78A 5CW8A 2G7GA 4U9LA 2ZCXA 4B3AA 4GCLA 4M3FA 5D1RA 2FQ4A 1T56A 3BTLA 3NXCA 3VVYA 4ACIA 3LSJA 2ID3A 5F08A 3HTHA 4AUXA 3BRUA 3VW0A 2Q24A 3BTJA 2R7OA 2O7OA 3VOXA 3V6GA 1BJZA 2PFVA 2REKA 3VPRA 5J1RA 5IOYA 2G3BA 1JTYA 4M3GA 4GCTA 3C07A 2QCOA 2UXOA 3VW1A 3VUQA 3MVPA 2QTQA 2GFNA 2Y30A 3HTJA 2YVHA 3KZ9A 3ON4A 3IH3A 3HGGA 2XPWA 3BJBA 3TP3A 2TRTA 4AC0A 4AF5A 4GFKA 4GCKA 3DPJA 3BT9A 2OPTA 3ZQFA 4IRVA 4MO7A 4DW6A 3LSRA 2UXUA 2GUHA 3NNRA 1VI0A 2UXPA 3LWJA 2F07A 5GPAA 2R7WA 2G7LA 2X6OA 2ZOYA 2XPUA 3BNIA 2OI8A 2XPVA 5F0FA 1JUPA 5CQGA 2UXHA 1JT0A 3FIWA 5H9TA 1RPWA 3QBMA 4D7NA 1UI6A 2ZB9A 3TP0A 4OD4A 2OERA 4ME9A 3HGYA 4YZEA 3VP5A 2FJI1 3IH2A 3MNLA 3B6CA 3AQSA 3ZQIA 2ZOZA 3GZIA 4JL3A 4DVYP 3NS4A 4MXMA 3PASA 2O7TA 2IU5A 5F04A 3FK7A 4AC6A 3BCGA 5FKLA 3F0CA 3BR2A 3LSPA 3ANGA 2FD5A 2G7SA 3QKXA 3DU6A 3COLA 3SFIA 5K7ZA 3IUVA 2QIBA 2HQ5A 1T33A 3HTIA 3G1LA 3QPLA 1U9NA 5HBUA 2VKEA 3S5RA 1A6IA 1JUSA 3HE0A 3KYLA 3WHCA 2A2FX 3ON2A 3CWRA 4ICHA 2EH3A 3K8PC 4L62A 3KNWA 2R7UA 3G7RA 1JTXA 3EGQA 2TCTA 2B3WA 2VKVA 2JK3A 3BR6A 5IP6A 5F27A 2FBQA 3BTCA 4W97A 2UXIA 3VW2A 4OD5A 4C2MA 3B81A 3BTIA 2FJ1A 3DEWA 5J1YA 5K7FA 5EFYA 2Y2ZA 2HXIA 1RKWA 3SDGA 2GBYA 3Q3SA 5FGLA 3NI7A 2HYJA 2B1EA 3Q0VA 4HKUA 1JT6A 3PM1A 3BQZA
chains in the Genus database with same CATH topology
2PZ9A 3BHQA 1QVTA 5F0CA 2RHAA 4V2FA 5AQCA 4B1RA 3LJLA 4JKZA 1RKTA 3BR3A 4M3EA 1JUMA 3Q0WA 3Q0UA 2DG7A 5J1UA 3BQYA 5FMPA 1ZK8A 4G12A 4D7MA 3O8GA 3AQTA 3E7QA 3ZQHA 2V57A 3CCYA 4M3DA 5FKMA 3BR1A 5EYRA 2NP3A 4NN1A 2G0EA 3NRGA 5GP9A 3RH2A 3G56A 2XRLA 2Y31A 2WUIA 3O60A 4X1EA 3LHQA 5EZGA 1ZKGA 3FK6A 2QOPA 3G1OA 3HTAA 3PPBA 2FX0A 3ANPA 1SGMA 4KWAA 3C2BA 3IH4A 2QKOA 2RASA 3B6AA 2D6YA 4V2GA 2DG8A 4CGRA 2ZCNA 1Z0XA 2NP5A 3CDLA 2XGDA 3HIMA 3F1BA 2XGCA 2IEKA 3T6NA 2OF7A 2DTZA 3G1MA 1QPIA 3JSJA 3O8HA 2HYTA 2YVEA 3P9TA 5FKOA 5F0HA 3CJDA 3DCFA 3WHBA 5HAWA 5HSZA 2HXOA 4UDSA 3VIBA 5FKNA 2VPRA 2I10A 3VOKA 5C4YA 1UI5A 2HKUA 2ZCMA 3NPIA 4NELA 2XB5A 3BR0A 4MK6A 3ZQLA 2WGBA 2JJ7A 2WV1A 2IAIA 4D5FA 4JYKA 3VVZA 4PXIA 5J3LA 4GFLA 2QWTA 2XGEA 3RD3A 3ZQGA 5K7HA 3QPSA 3KKDA 5EZHA 2NX4A 2IBDA 1ORKA 2NS8A 3BR5A 5FHPA 3VVXA 2X9DA 5F1JA 5D18A 5D19A 2ID6A 4W1UA 2W53A 2RAEA 2GENA 4I6ZA 3KKCA 4I76A 1Z77A 2PBXA 3QQAA 2XDNA 5DAJA 5K58A 5IPAA 4JNNA 3EUPA 4XK4A 5FKKA 4ABZA 5CXIA 2NS7A 4D5CA 5CXGA 3GEUA 5IOZA 3CRJA 1QVUA 5GPCA 3LOCA 1U9OA 4M3BA 3FRQA 3V78A 5CW8A 2G7GA 2ZCXA 4B3AA 4GCLA 4M3FA 5D1RA 2FQ4A 1T56A 3BTLA 3NXCA 3VVYA 4ACIA 3LSJA 2ID3A 5F08A 3HTHA 4AUXA 3BRUA 3VW0A 2Q24A 3BTJA 2O7OA 3VOXA 3V6GA 1BJZA 2REKA 3VPRA 5J1RA 5IOYA 2G3BA 1JTYA 4M3GA 4GCTA 3C07A 2QCOA 2UXOA 3VW1A 3VUQA 3MVPA 2QTQA 2GFNA 2Y30A 3HTJA 2YVHA 3KZ9A 3ON4A 3IH3A 3HGGA 2XPWA 3BJBA 3TP3A 2TRTA 4AC0A 4AF5A 4GFKA 4GCKA 3DPJA 3BT9A 2OPTA 3ZQFA 4MO7A 4DW6A 3LSRA 2UXUA 2GUHA 3NNRA 1VI0A 2UXPA 3LWJA 2F07A 5GPAA 2G7LA 2X6OA 2ZOYA 2XPUA 3BNIA 2OI8A 2XPVA 5F0FA 1JUPA 2UXHA 1JT0A 3FIWA 5H9TA 1RPWA 3QBMA 4D7NA 1UI6A 2ZB9A 3TP0A 2OERA 4ME9A 3HGYA 4YZEA 3VP5A 3IH2A 3MNLA 3B6CA 3AQSA 3ZQIA 2ZOZA 3GZIA 4JL3A 4MXMA 3PASA 2O7TA 2IU5A 5F04A 3FK7A 4AC6A 3BCGA 5FKLA 3F0CA 3BR2A 3LSPA 3ANGA 2FD5A 2G7SA 3QKXA 3COLA 3SFIA 5K7ZA 3IUVA 2QIBA 2HQ5A 1T33A 3HTIA 3G1LA 3QPLA 1U9NA 5HBUA 2VKEA 3S5RA 1A6IA 1JUSA 3HE0A 3WHCA 3ON2A 3CWRA 4ICHA 2EH3A 4L62A 3KNWA 3G7RA 1JTXA 3EGQA 2TCTA 2VKVA 2JK3A 3BR6A 5IP6A 5F27A 2FBQA 3BTCA 4W97A 2UXIA 3VW2A 3B81A 3BTIA 2FJ1A 3DEWA 5J1YA 5K7FA 5EFYA 2Y2ZA 2HXIA 1RKWA 3SDGA 2GBYA 3Q3SA 5FGLA 3NI7A 2HYJA 3Q0VA 4HKUA 1JT6A 3PM1A 3BQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ9 A;  3BHQ A;  1QVT A;  5F0C A;  2RHA A;  4V2F A;  5AQC A;  4B1R A;  3LJL A;  4JKZ A;  1RKT A;  3BR3 A;  4M3E A;  1JUM A;  3Q0W A;  3Q0U A;  2DG7 A;  5J1U A;  3BQY A;  5FMP A;  1ZK8 A;  4G12 A;  4D7M A;  3O8G A;  3AQT A;  3E7Q A;  3ZQH A;  2V57 A;  3CCY A;  4M3D A;  5FKM A;  3BR1 A;  5EYR A;  2NP3 A;  4NN1 A;  2G0E A;  3NRG A;  5GP9 A;  3RH2 A;  3G56 A;  2XRL A;  2Y31 A;  2WUI A;  3O60 A;  4X1E A;  3LHQ A;  5EZG A;  1ZKG A;  3FK6 A;  2QOP A;  3G1O A;  3HTA A;  3PPB A;  2FX0 A;  3ANP A;  1SGM A;  4KWA A;  3C2B A;  3IH4 A;  2QKO A;  2RAS A;  3B6A A;  2D6Y A;  4V2G A;  2DG8 A;  4CGR A;  2ZCN A;  1Z0X A;  2NP5 A;  3CDL A;  2XGD A;  3HIM A;  3F1B A;  2XGC A;  2IEK A;  3T6N A;  2OF7 A;  2DTZ A;  3G1M A;  1QPI A;  3JSJ A;  3O8H A;  2HYT A;  2YVE A;  3P9T A;  5FKO A;  5F0H A;  3CJD A;  3DCF A;  3WHB A;  5HAW A;  5HSZ A;  2HXO A;  4UDS A;  3VIB A;  5FKN A;  2VPR A;  2I10 A;  3VOK A;  5C4Y A;  1UI5 A;  2HKU A;  2ZCM A;  3NPI A;  4NEL A;  2XB5 A;  3BR0 A;  4MK6 A;  3ZQL A;  2WGB A;  2JJ7 A;  2WV1 A;  2IAI A;  4D5F A;  4JYK A;  3VVZ A;  4PXI A;  5J3L A;  4GFL A;  2QWT A;  2XGE A;  3RD3 A;  3ZQG A;  5K7H A;  3QPS A;  3KKD A;  5EZH A;  2NX4 A;  2IBD A;  1ORK A;  2NS8 A;  3BR5 A;  5FHP A;  3VVX A;  2X9D A;  5F1J A;  5D18 A;  5D19 A;  2ID6 A;  4W1U A;  2W53 A;  2RAE A;  2GEN A;  4I6Z A;  3KKC A;  4I76 A;  1Z77 A;  2PBX A;  3QQA A;  2XDN A;  5DAJ A;  5K58 A;  5IPA A;  4JNN A;  3EUP A;  4XK4 A;  5FKK A;  4ABZ A;  5CXI A;  2NS7 A;  4D5C A;  5CXG A;  3GEU A;  5IOZ A;  3CRJ A;  1QVU A;  5GPC A;  3LOC A;  1U9O A;  4M3B A;  3FRQ A;  3V78 A;  5CW8 A;  2G7G A;  2ZCX A;  4B3A A;  4GCL A;  4M3F A;  5D1R A;  2FQ4 A;  1T56 A;  3BTL A;  3NXC A;  3VVY A;  4ACI A;  3LSJ A;  2ID3 A;  5F08 A;  3HTH A;  4AUX A;  3BRU A;  3VW0 A;  2Q24 A;  3BTJ A;  2O7O A;  3VOX A;  3V6G A;  1BJZ A;  2REK A;  3VPR A;  5J1R A;  5IOY A;  2G3B A;  1JTY A;  4M3G A;  4GCT A;  3C07 A;  2QCO A;  2UXO A;  3VW1 A;  3VUQ A;  3MVP A;  2QTQ A;  2GFN A;  2Y30 A;  3HTJ A;  2YVH A;  3KZ9 A;  3ON4 A;  3IH3 A;  3HGG A;  2XPW A;  3BJB A;  3TP3 A;  2TRT A;  4AC0 A;  4AF5 A;  4GFK A;  4GCK A;  3DPJ A;  3BT9 A;  2OPT A;  3ZQF A;  4MO7 A;  4DW6 A;  3LSR A;  2UXU A;  2GUH A;  3NNR A;  1VI0 A;  2UXP A;  3LWJ A;  2F07 A;  5GPA A;  2G7L A;  2X6O A;  2ZOY A;  2XPU A;  3BNI A;  2OI8 A;  2XPV A;  5F0F A;  1JUP A;  2UXH A;  1JT0 A;  3FIW A;  5H9T A;  1RPW A;  3QBM A;  4D7N A;  1UI6 A;  2ZB9 A;  3TP0 A;  2OER A;  4ME9 A;  3HGY A;  4YZE A;  3VP5 A;  3IH2 A;  3MNL A;  3B6C A;  3AQS A;  3ZQI A;  2ZOZ A;  3GZI A;  4JL3 A;  4MXM A;  3PAS A;  2O7T A;  2IU5 A;  5F04 A;  3FK7 A;  4AC6 A;  3BCG A;  5FKL A;  3F0C A;  3BR2 A;  3LSP A;  3ANG A;  2FD5 A;  2G7S A;  3QKX A;  3COL A;  3SFI A;  5K7Z A;  3IUV A;  2QIB A;  2HQ5 A;  1T33 A;  3HTI A;  3G1L A;  3QPL A;  1U9N A;  5HBU A;  2VKE A;  3S5R A;  1A6I A;  1JUS A;  3HE0 A;  3WHC A;  3ON2 A;  3CWR A;  4ICH A;  2EH3 A;  4L62 A;  3KNW A;  3G7R A;  1JTX A;  3EGQ A;  2TCT A;  2VKV A;  2JK3 A;  3BR6 A;  5IP6 A;  5F27 A;  2FBQ A;  3BTC A;  4W97 A;  2UXI A;  3VW2 A;  3B81 A;  3BTI A;  2FJ1 A;  3DEW A;  5J1Y A;  5K7F A;  5EFY A;  2Y2Z A;  2HXI A;  1RKW A;  3SDG A;  2GBY A;  3Q3S A;  5FGL A;  3NI7 A;  2HYJ A;  3Q0V A;  4HKU A;  1JT6 A;  3PM1 A;  3BQZ A; 
#chains in the Genus database with same CATH topology
 2PZ9 A;  3BHQ A;  1QVT A;  5F0C A;  2RHA A;  4V2F A;  5AQC A;  3VTI A;  2ZY9 A;  4B1R A;  3LJL A;  4JKZ A;  1RKT A;  3BR3 A;  4M3E A;  1JUM A;  3Q0W A;  3Q0U A;  2R7T A;  2DG7 A;  5J1U A;  3BQY A;  5FMP A;  1ZK8 A;  4G12 A;  4D7M A;  3O8G A;  3AQT A;  3E7Q A;  3ZQH A;  2V57 A;  3CCY A;  4M3D A;  5FKM A;  3BR1 A;  5EYR A;  2NP3 A;  4NN1 A;  2G0E A;  3NRG A;  2R7Q A;  5GP9 A;  3RH2 A;  3G56 A;  2XRL A;  2Y31 A;  2WUI A;  3O60 A;  4X1E A;  3LHQ A;  5EZG A;  1ZKG A;  3FK6 A;  2QOP A;  3G1O A;  3HTA A;  3PPB A;  2FX0 A;  3ANP A;  1SGM A;  4KWA A;  3C2B A;  3IH4 A;  2QKO A;  2RAS A;  2YVX A;  3B6A A;  2D6Y A;  4V2G A;  2DG8 A;  4CGR A;  2ZCN A;  1Z0X A;  2NP5 A;  3CDL A;  2XGD A;  3HIM A;  3F1B A;  2XGC A;  2IEK A;  4WIB A;  3T6N A;  2OF7 A;  2DTZ A;  3G1M A;  1QPI A;  3JSJ A;  4U9N A;  2R7S A;  3O8H A;  2HYT A;  2YVE A;  3P9T A;  5FKO A;  5F0H A;  3CJD A;  3DCF A;  3WHB A;  5HAW A;  5HSZ A;  2HXO A;  4UDS A;  3VIB A;  5FKN A;  2VPR A;  2R7R A;  2R7X A;  2I10 A;  3VOK A;  5C4Y A;  1UI5 A;  2HKU A;  2ZCM A;  3NPI A;  4NEL A;  2XB5 A;  3BR0 A;  4MK6 A;  3ZQL A;  2WGB A;  2JJ7 A;  2WV1 A;  2IAI A;  4D5F A;  3FHN A;  4JYK A;  3VVZ A;  4PXI A;  5J3L A;  4GFL A;  2QWT A;  2XGE A;  3RD3 A;  3ZQG A;  5K7H A;  3QPS A;  3KKD A;  5EZH A;  2NX4 A;  2IBD A;  2R7V A;  1ORK A;  2NS8 A;  3BR5 A;  3SWH A;  5FHP A;  3DU5 A;  3VVX A;  2X9D A;  5F1J A;  5D18 A;  5D19 A;  2ID6 A;  4W1U A;  2W53 A;  2RAE A;  2GEN A;  4I6Z A;  3KKC A;  4I76 A;  1Z77 A;  2PBX A;  3QQA A;  2XDN A;  5DAJ A;  5K58 A;  5IPA A;  4JNN A;  3EUP A;  4XK4 A;  5FKK A;  4ABZ A;  5CXI A;  2NS7 A;  4D5C A;  5CXG A;  3GEU A;  5IOZ A;  3CRJ A;  1QVU A;  5GPC A;  3LOC A;  1U9O A;  4M3B A;  3FRQ A;  3V78 A;  5CW8 A;  2G7G A;  4U9L A;  2ZCX A;  4B3A A;  4GCL A;  4M3F A;  5D1R A;  2FQ4 A;  1T56 A;  3BTL A;  3NXC A;  3VVY A;  4ACI A;  3LSJ A;  2ID3 A;  5F08 A;  3HTH A;  4AUX A;  3BRU A;  3VW0 A;  2Q24 A;  3BTJ A;  2R7O A;  2O7O A;  3VOX A;  3V6G A;  1BJZ A;  2PFV A;  2REK A;  3VPR A;  5J1R A;  5IOY A;  2G3B A;  1JTY A;  4M3G A;  4GCT A;  3C07 A;  2QCO A;  2UXO A;  3VW1 A;  3VUQ A;  3MVP A;  2QTQ A;  2GFN A;  2Y30 A;  3HTJ A;  2YVH A;  3KZ9 A;  3ON4 A;  3IH3 A;  3HGG A;  2XPW A;  3BJB A;  3TP3 A;  2TRT A;  4AC0 A;  4AF5 A;  4GFK A;  4GCK A;  3DPJ A;  3BT9 A;  2OPT A;  3ZQF A;  4IRV A;  4MO7 A;  4DW6 A;  3LSR A;  2UXU A;  2GUH A;  3NNR A;  1VI0 A;  2UXP A;  3LWJ A;  2F07 A;  5GPA A;  2R7W A;  2G7L A;  2X6O A;  2ZOY A;  2XPU A;  3BNI A;  2OI8 A;  2XPV A;  5F0F A;  1JUP A;  5CQG A;  2UXH A;  1JT0 A;  3FIW A;  5H9T A;  1RPW A;  3QBM A;  4D7N A;  1UI6 A;  2ZB9 A;  3TP0 A;  4OD4 A;  2OER A;  4ME9 A;  3HGY A;  4YZE A;  3VP5 A;  2FJI 1;  3IH2 A;  3MNL A;  3B6C A;  3AQS A;  3ZQI A;  2ZOZ A;  3GZI A;  4JL3 A;  4DVY P;  3NS4 A;  4MXM A;  3PAS A;  2O7T A;  2IU5 A;  5F04 A;  3FK7 A;  4AC6 A;  3BCG A;  5FKL A;  3F0C A;  3BR2 A;  3LSP A;  3ANG A;  2FD5 A;  2G7S A;  3QKX A;  3DU6 A;  3COL A;  3SFI A;  5K7Z A;  3IUV A;  2QIB A;  2HQ5 A;  1T33 A;  3HTI A;  3G1L A;  3QPL A;  1U9N A;  5HBU A;  2VKE A;  3S5R A;  1A6I A;  1JUS A;  3HE0 A;  3KYL A;  3WHC A;  2A2F X;  3ON2 A;  3CWR A;  4ICH A;  2EH3 A;  3K8P C;  4L62 A;  3KNW A;  2R7U A;  3G7R A;  1JTX A;  3EGQ A;  2TCT A;  2B3W A;  2VKV A;  2JK3 A;  3BR6 A;  5IP6 A;  5F27 A;  2FBQ A;  3BTC A;  4W97 A;  2UXI A;  3VW2 A;  4OD5 A;  4C2M A;  3B81 A;  3BTI A;  2FJ1 A;  3DEW A;  5J1Y A;  5K7F A;  5EFY A;  2Y2Z A;  2HXI A;  1RKW A;  3SDG A;  2GBY A;  3Q3S A;  5FGL A;  3NI7 A;  2HYJ A;  2B1E A;  3Q0V A;  4HKU A;  1JT6 A;  3PM1 A;  3BQZ A; 
#chains in the Genus database with same CATH homology
 2PZ9 A;  3BHQ A;  1QVT A;  5F0C A;  2RHA A;  4V2F A;  5AQC A;  4B1R A;  3LJL A;  4JKZ A;  1RKT A;  3BR3 A;  4M3E A;  1JUM A;  3Q0W A;  3Q0U A;  2DG7 A;  5J1U A;  3BQY A;  5FMP A;  1ZK8 A;  4G12 A;  4D7M A;  3O8G A;  3AQT A;  3E7Q A;  3ZQH A;  2V57 A;  3CCY A;  4M3D A;  5FKM A;  3BR1 A;  5EYR A;  2NP3 A;  4NN1 A;  2G0E A;  3NRG A;  5GP9 A;  3RH2 A;  3G56 A;  2XRL A;  2Y31 A;  2WUI A;  3O60 A;  4X1E A;  3LHQ A;  5EZG A;  1ZKG A;  3FK6 A;  2QOP A;  3G1O A;  3HTA A;  3PPB A;  2FX0 A;  3ANP A;  1SGM A;  4KWA A;  3C2B A;  3IH4 A;  2QKO A;  2RAS A;  3B6A A;  2D6Y A;  4V2G A;  2DG8 A;  4CGR A;  2ZCN A;  1Z0X A;  2NP5 A;  3CDL A;  2XGD A;  3HIM A;  3F1B A;  2XGC A;  2IEK A;  3T6N A;  2OF7 A;  2DTZ A;  3G1M A;  1QPI A;  3JSJ A;  3O8H A;  2HYT A;  2YVE A;  3P9T A;  5FKO A;  5F0H A;  3CJD A;  3DCF A;  3WHB A;  5HAW A;  5HSZ A;  2HXO A;  4UDS A;  3VIB A;  5FKN A;  2VPR A;  2I10 A;  3VOK A;  5C4Y A;  1UI5 A;  2HKU A;  2ZCM A;  3NPI A;  4NEL A;  2XB5 A;  3BR0 A;  4MK6 A;  3ZQL A;  2WGB A;  2JJ7 A;  2WV1 A;  2IAI A;  4D5F A;  4JYK A;  3VVZ A;  4PXI A;  5J3L A;  4GFL A;  2QWT A;  2XGE A;  3RD3 A;  3ZQG A;  5K7H A;  3QPS A;  3KKD A;  5EZH A;  2NX4 A;  2IBD A;  1ORK A;  2NS8 A;  3BR5 A;  5FHP A;  3VVX A;  2X9D A;  5F1J A;  5D18 A;  5D19 A;  2ID6 A;  4W1U A;  2W53 A;  2RAE A;  2GEN A;  4I6Z A;  3KKC A;  4I76 A;  1Z77 A;  2PBX A;  3QQA A;  2XDN A;  5DAJ A;  5K58 A;  5IPA A;  4JNN A;  3EUP A;  4XK4 A;  5FKK A;  4ABZ A;  5CXI A;  2NS7 A;  4D5C A;  5CXG A;  3GEU A;  5IOZ A;  3CRJ A;  1QVU A;  5GPC A;  3LOC A;  1U9O A;  4M3B A;  3FRQ A;  3V78 A;  5CW8 A;  2G7G A;  2ZCX A;  4B3A A;  4GCL A;  4M3F A;  5D1R A;  2FQ4 A;  1T56 A;  3BTL A;  3NXC A;  3VVY A;  4ACI A;  3LSJ A;  2ID3 A;  5F08 A;  3HTH A;  4AUX A;  3BRU A;  3VW0 A;  2Q24 A;  3BTJ A;  2O7O A;  3VOX A;  3V6G A;  1BJZ A;  2REK A;  3VPR A;  5J1R A;  5IOY A;  2G3B A;  1JTY A;  4M3G A;  4GCT A;  3C07 A;  2QCO A;  2UXO A;  3VW1 A;  3VUQ A;  3MVP A;  2QTQ A;  2GFN A;  2Y30 A;  3HTJ A;  2YVH A;  3KZ9 A;  3ON4 A;  3IH3 A;  3HGG A;  2XPW A;  3BJB A;  3TP3 A;  2TRT A;  4AC0 A;  4AF5 A;  4GFK A;  4GCK A;  3DPJ A;  3BT9 A;  2OPT A;  3ZQF A;  4MO7 A;  4DW6 A;  3LSR A;  2UXU A;  2GUH A;  3NNR A;  1VI0 A;  2UXP A;  3LWJ A;  2F07 A;  5GPA A;  2G7L A;  2X6O A;  2ZOY A;  2XPU A;  3BNI A;  2OI8 A;  2XPV A;  5F0F A;  1JUP A;  2UXH A;  1JT0 A;  3FIW A;  5H9T A;  1RPW A;  3QBM A;  4D7N A;  1UI6 A;  2ZB9 A;  3TP0 A;  2OER A;  4ME9 A;  3HGY A;  4YZE A;  3VP5 A;  3IH2 A;  3MNL A;  3B6C A;  3AQS A;  3ZQI A;  2ZOZ A;  3GZI A;  4JL3 A;  4MXM A;  3PAS A;  2O7T A;  2IU5 A;  5F04 A;  3FK7 A;  4AC6 A;  3BCG A;  5FKL A;  3F0C A;  3BR2 A;  3LSP A;  3ANG A;  2FD5 A;  2G7S A;  3QKX A;  3COL A;  3SFI A;  5K7Z A;  3IUV A;  2QIB A;  2HQ5 A;  1T33 A;  3HTI A;  3G1L A;  3QPL A;  1U9N A;  5HBU A;  2VKE A;  3S5R A;  1A6I A;  1JUS A;  3HE0 A;  3WHC A;  3ON2 A;  3CWR A;  4ICH A;  2EH3 A;  4L62 A;  3KNW A;  3G7R A;  1JTX A;  3EGQ A;  2TCT A;  2VKV A;  2JK3 A;  3BR6 A;  5IP6 A;  5F27 A;  2FBQ A;  3BTC A;  4W97 A;  2UXI A;  3VW2 A;  3B81 A;  3BTI A;  2FJ1 A;  3DEW A;  5J1Y A;  5K7F A;  5EFY A;  2Y2Z A;  2HXI A;  1RKW A;  3SDG A;  2GBY A;  3Q3S A;  5FGL A;  3NI7 A;  2HYJ A;  3Q0V A;  4HKU A;  1JT6 A;  3PM1 A;  3BQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...