2GFNA

Crystal structure of hth-type transcriptional regulator pksa related protein from rhodococcus sp. rha1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
196
structure length
192
Chain Sequence
IVDHDERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAALRRAGDIQGDRYRTILDEEGAGPIEKLRNITASILPLDERRLAMTRVFLFFYAEGTARGEIAAFLARWRGVVRESVVAAQREGTVSTDLDADAVTVALVALTDGLALQAILDPVVMKAISAEDAAARCVDAAVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HTH-type transcriptional regulator pksA related protein from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator pksA related protein
total genus 74
structure length 192
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13977 TetR_C_6 BetI-type transcriptional repressor, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2gfnA00
5F27A 1RKTA 3BR5A 1RKWA 2XPVA 2X9DA 3G56A 3ZQIA 4V2GA 3SFIA 1A6IA 4D7MA 3LSPA 3CDLA 5EZHA 3P9TA 5HBUA 2ZCMA 3ZQLA 5CXIA 4X1EA 5F0CA 2QTQA 4M3EA 3FK7A 4ACIA 4ICHA 2D6YA 2FBQA 4MXMA 3GEUA 2I10A 2WV1A 1QPIA 3T6NA 4AUXA 3F1BA 3O8GA 3Q0UA 3ZQHA 4M3FA 2HYJA 3SDGA 1JT6A 2DG8A 2XGCA 3NXCA 1JT0A 3VW0A 3VPRA 1ZKGA 3BQYA 5J3LA 3BT9A 2F07A 5K58A 3IUVA 2DG7A 4UDSA 3TP3A 2HYTA 3IH4A 4V2FA 2QCOA 4M3GA 2ZCNA 3F0CA 4B3AA 5EFYA 2ZB9A 2QOPA 2IEKA 3VP5A 3BNIA 3QKXA 2JK3A 3VVYA 1T56A 3G1MA 2YVEA 2HQ5A 3VOXA 3ON4A 3WHCA 3FRQA 3CCYA 3QPLA 4W1UA 2Y30A 3PM1A 3FIWA 3O8HA 2PBXA 5K7HA 2HKUA 2IAIA 2IU5A 2TRTA 5J1YA 3KKDA 4GCLA 3HGYA 4M3DA 4W97A 2Q24A 2UXUA 3LOCA 5GPCA 3BJBA 2W53A 5FKOA 4GFKA 3VUQA 3B6AA 1RPWA 2DTZA 2XPUA 3PPBA 4AF5A 2NP3A 2XGDA 5K7FA 3B81A 3JSJA 3QPSA 1JTXA 4PXIA 3WHBA 2OI8A 4JKZA 5GPAA 1VI0A 3ON2A 4JL3A 5D18A 2PZ9A 3RD3A 3O60A 5HAWA 5J1RA 5DAJA 1ZK8A 4I6ZA 2NS7A 1JUMA 3RH2A 1UI5A 2Y31A 5IOZA 5FKNA 1UI6A 4JNNA 3QQAA 1JUSA 3V78A 3ANPA 3BR2A 5IPAA 3ANGA 2O7TA 3CWRA 2UXOA 2FD5A 2NX4A 5F04A 1QVTA 5CW8A 3HTIA 4CGRA 4GFLA 3VVXA 2G7LA 3AQTA 3HTJA 3LSJA 1QVUA 3DEWA 3BRUA 3HGGA 2FQ4A 3HTHA 3AQSA 2UXIA 2GBYA 3MVPA 2ZOZA 3TP0A 4XK4A 5FKKA 4NELA 5IP6A 4D5FA 3BR1A 4HKUA 3ZQFA 4L62A 3COLA 2WGBA 1U9OA 3BTJA 1T33A 2ZCXA 2QIBA 3VW2A 4G12A 2VPRA 4AC6A 3BQZA 5FKLA 2XGEA 2X6OA 3BTLA 3BTCA 2IBDA 2REKA 1Z0XA 2UXHA 4KWAA 3PASA 3BR3A 5D19A 3V6GA 4GCKA 3VW1A 2OERA 3ZQGA 2JJ7A 1SGMA 2G0EA 5FHPA 3BCGA 5HSZA 5F08A 4YZEA 2VKVA 3CJDA 3BR6A 1JTYA 3HE0A 4ABZA 1Z77A 2GFNA 2XB5A 5F0FA 2OF7A 3LSRA 1JUPA 2EH3A 2XRLA 4M3BA 3B6CA 4MK6A 4ME9A 2YVHA 3QBMA 3G7RA 3NI7A 3KZ9A 3S5RA 3VOKA 5F1JA 3LHQA 2HXOA 3DPJA 2RHAA 2VKEA 4NN1A 2V57A 2UXPA 4B1RA 3VVZA 3KKCA 4I76A 2RASA 1BJZA 2OPTA 4MO7A 3Q0VA 2GUHA 2QWTA 3HIMA 3G1OA 4D5CA 5CXGA 3MNLA 4D7NA 3HTAA 5C4YA 5EYRA 3G1LA 2NS8A 5J1UA 5H9TA 5D1RA 3BR0A 2ID6A 4AC0A 3IH2A 4JYKA 2NP5A 5K7ZA 3LWJA 5EZGA 2TCTA 3Q3SA 2XDNA 5GP9A 3EGQA 3NNRA 3CRJA 2HXIA 3KNWA 3FK6A 2FX0A 2O7OA 3VIBA 3C07A 3BHQA 5F0HA 5FGLA 2GENA 4GCTA 3Q0WA 3IH3A 5IOYA 5AQCA 3NRGA 2ZOYA 2G3BA 2QKOA 3DCFA 2RAEA 4DW6A 3LJLA 2XPWA 5FMPA 3E7QA 1U9NA 3EUPA 2FJ1A 3C2BA 3NPIA 2ID3A 2WUIA 3GZIA 2G7SA 3BTIA 2Y2ZA 1ORKA 2G7GA 5FKMA
chains in the Genus database with same CATH superfamily
3NS4A 5F27A 1RKTA 3BR5A 1RKWA 2R7RA 2XPVA 2X9DA 3G56A 3ZQIA 4V2GA 3SFIA 1A6IA 4D7MA 3LSPA 3CDLA 5EZHA 3P9TA 5HBUA 2ZCMA 3ZQLA 5CXIA 4X1EA 5F0CA 2QTQA 4M3EA 3FK7A 4ACIA 4ICHA 2D6YA 2FBQA 4MXMA 3GEUA 2I10A 2WV1A 1QPIA 3T6NA 4AUXA 3F1BA 3O8GA 3Q0UA 3ZQHA 4M3FA 2HYJA 3SDGA 1JT6A 2DG8A 2XGCA 3NXCA 1JT0A 3VW0A 3VPRA 1ZKGA 3BQYA 5J3LA 4C2MA 3BT9A 2R7SA 2F07A 5K58A 3IUVA 2DG7A 4UDSA 3TP3A 2HYTA 3IH4A 4V2FA 3VTIA 2QCOA 4M3GA 2ZCNA 3F0CA 4WIBA 4B3AA 5EFYA 2ZB9A 2QOPA 2IEKA 3VP5A 3FHNA 3BNIA 3QKXA 2JK3A 3VVYA 1T56A 2B3WA 3G1MA 2YVEA 2HQ5A 3VOXA 3ON4A 3WHCA 3FRQA 3CCYA 3QPLA 4W1UA 2Y30A 3PM1A 3FIWA 3O8HA 2PBXA 2R7WA 5K7HA 2HKUA 2IAIA 2IU5A 2TRTA 5J1YA 3KKDA 4GCLA 3HGYA 4M3DA 4W97A 2Q24A 2UXUA 3LOCA 5GPCA 3BJBA 2W53A 5FKOA 4GFKA 3VUQA 3B6AA 2R7OA 1RPWA 2DTZA 2XPUA 3PPBA 4AF5A 2NP3A 2XGDA 5K7FA 3B81A 3JSJA 3QPSA 1JTXA 4PXIA 3WHBA 2OI8A 3KYLA 4JKZA 5GPAA 1VI0A 3ON2A 4JL3A 5D18A 2PZ9A 3RD3A 3O60A 5HAWA 5J1RA 5DAJA 1ZK8A 4IRVA 4I6ZA 2NS7A 1JUMA 3RH2A 1UI5A 2Y31A 5IOZA 5FKNA 1UI6A 4JNNA 3QQAA 1JUSA 3V78A 3ANPA 3BR2A 5IPAA 2PFVA 3ANGA 3K8PC 2O7TA 3CWRA 2UXOA 2FD5A 4U9LA 2NX4A 5F04A 1QVTA 5CW8A 3HTIA 4CGRA 4GFLA 3VVXA 2G7LA 3AQTA 3HTJA 3LSJA 3SWHA 1QVUA 3DEWA 3BRUA 2R7XA 3HGGA 2FQ4A 3HTHA 3AQSA 2UXIA 2R7UA 2GBYA 3MVPA 2ZOZA 3TP0A 4XK4A 5FKKA 4NELA 5IP6A 4D5FA 3BR1A 4HKUA 3ZQFA 4L62A 3COLA 2WGBA 1U9OA 3BTJA 1T33A 2ZCXA 2QIBA 3VW2A 4G12A 2VPRA 4AC6A 3BQZA 5FKLA 3DU5A 2XGEA 2X6OA 3BTLA 3BTCA 2IBDA 2REKA 1Z0XA 2UXHA 4KWAA 3PASA 3BR3A 5D19A 2FJI1 3V6GA 4GCKA 3VW1A 2OERA 3ZQGA 2JJ7A 1SGMA 2G0EA 5FHPA 3BCGA 5HSZA 5F08A 4YZEA 2VKVA 3CJDA 3BR6A 1JTYA 3HE0A 4ABZA 2R7VA 1Z77A 2GFNA 2XB5A 5F0FA 2OF7A 3LSRA 1JUPA 2EH3A 2XRLA 4M3BA 3B6CA 4U9NA 4MK6A 4ME9A 2YVHA 3QBMA 3G7RA 3NI7A 3KZ9A 3S5RA 3VOKA 2YVXA 5F1JA 3LHQA 2HXOA 3DPJA 2RHAA 2VKEA 4NN1A 2V57A 2UXPA 4B1RA 3VVZA 3KKCA 4I76A 2RASA 1BJZA 2OPTA 4MO7A 3Q0VA 2GUHA 2QWTA 3HIMA 3G1OA 4OD4A 4D5CA 5CXGA 3MNLA 4D7NA 3HTAA 5C4YA 5EYRA 2A2FX 3G1LA 2NS8A 5J1UA 5H9TA 5D1RA 3BR0A 2ID6A 4AC0A 3IH2A 4JYKA 2NP5A 5K7ZA 3LWJA 5EZGA 2TCTA 3Q3SA 2XDNA 5GP9A 4DVYP 3EGQA 3NNRA 3CRJA 2HXIA 2ZY9A 2R7TA 3KNWA 3FK6A 2FX0A 2O7OA 4OD5A 3VIBA 3C07A 3BHQA 5F0HA 5FGLA 2GENA 2B1EA 4GCTA 3Q0WA 3IH3A 5IOYA 5AQCA 3NRGA 2ZOYA 2G3BA 5CQGA 2QKOA 3DCFA 2RAEA 4DW6A 3LJLA 2XPWA 5FMPA 3E7QA 1U9NA 3EUPA 2FJ1A 3C2BA 3NPIA 2ID3A 2WUIA 3GZIA 2G7SA 3BTIA 2Y2ZA 1ORKA 3DU6A 2R7QA 2G7GA 5FKMA
chains in the Genus database with same CATH topology
5F27A 1RKTA 3BR5A 1RKWA 2XPVA 2X9DA 3G56A 3ZQIA 4V2GA 3SFIA 1A6IA 4D7MA 3LSPA 3CDLA 5EZHA 3P9TA 5HBUA 2ZCMA 3ZQLA 5CXIA 4X1EA 5F0CA 2QTQA 4M3EA 3FK7A 4ACIA 4ICHA 2D6YA 2FBQA 4MXMA 3GEUA 2I10A 2WV1A 1QPIA 3T6NA 4AUXA 3F1BA 3O8GA 3Q0UA 3ZQHA 4M3FA 2HYJA 3SDGA 1JT6A 2DG8A 2XGCA 3NXCA 1JT0A 3VW0A 3VPRA 1ZKGA 3BQYA 5J3LA 3BT9A 2F07A 5K58A 3IUVA 2DG7A 4UDSA 3TP3A 2HYTA 3IH4A 4V2FA 2QCOA 4M3GA 2ZCNA 3F0CA 4B3AA 5EFYA 2ZB9A 2QOPA 2IEKA 3VP5A 3BNIA 3QKXA 2JK3A 3VVYA 1T56A 3G1MA 2YVEA 2HQ5A 3VOXA 3ON4A 3WHCA 3FRQA 3CCYA 3QPLA 4W1UA 2Y30A 3PM1A 3FIWA 3O8HA 2PBXA 5K7HA 2HKUA 2IAIA 2IU5A 2TRTA 5J1YA 3KKDA 4GCLA 3HGYA 4M3DA 4W97A 2Q24A 2UXUA 3LOCA 5GPCA 3BJBA 2W53A 5FKOA 4GFKA 3VUQA 3B6AA 1RPWA 2DTZA 2XPUA 3PPBA 4AF5A 2NP3A 2XGDA 5K7FA 3B81A 3JSJA 3QPSA 1JTXA 4PXIA 3WHBA 2OI8A 4JKZA 5GPAA 1VI0A 3ON2A 4JL3A 5D18A 2PZ9A 3RD3A 3O60A 5HAWA 5J1RA 5DAJA 1ZK8A 4I6ZA 2NS7A 1JUMA 3RH2A 1UI5A 2Y31A 5IOZA 5FKNA 1UI6A 4JNNA 3QQAA 1JUSA 3V78A 3ANPA 3BR2A 5IPAA 3ANGA 2O7TA 3CWRA 2UXOA 2FD5A 2NX4A 5F04A 1QVTA 5CW8A 3HTIA 4CGRA 4GFLA 3VVXA 2G7LA 3AQTA 3HTJA 3LSJA 1QVUA 3DEWA 3BRUA 3HGGA 2FQ4A 3HTHA 3AQSA 2UXIA 2GBYA 3MVPA 2ZOZA 3TP0A 4XK4A 5FKKA 4NELA 5IP6A 4D5FA 3BR1A 4HKUA 3ZQFA 4L62A 3COLA 2WGBA 1U9OA 3BTJA 1T33A 2ZCXA 2QIBA 3VW2A 4G12A 2VPRA 4AC6A 3BQZA 5FKLA 2XGEA 2X6OA 3BTLA 3BTCA 2IBDA 2REKA 1Z0XA 2UXHA 4KWAA 3PASA 3BR3A 5D19A 3V6GA 4GCKA 3VW1A 2OERA 3ZQGA 2JJ7A 1SGMA 2G0EA 5FHPA 3BCGA 5HSZA 5F08A 4YZEA 2VKVA 3CJDA 3BR6A 1JTYA 3HE0A 4ABZA 1Z77A 2GFNA 2XB5A 5F0FA 2OF7A 3LSRA 1JUPA 2EH3A 2XRLA 4M3BA 3B6CA 4MK6A 4ME9A 2YVHA 3QBMA 3G7RA 3NI7A 3KZ9A 3S5RA 3VOKA 5F1JA 3LHQA 2HXOA 3DPJA 2RHAA 2VKEA 4NN1A 2V57A 2UXPA 4B1RA 3VVZA 3KKCA 4I76A 2RASA 1BJZA 2OPTA 4MO7A 3Q0VA 2GUHA 2QWTA 3HIMA 3G1OA 4D5CA 5CXGA 3MNLA 4D7NA 3HTAA 5C4YA 5EYRA 3G1LA 2NS8A 5J1UA 5H9TA 5D1RA 3BR0A 2ID6A 4AC0A 3IH2A 4JYKA 2NP5A 5K7ZA 3LWJA 5EZGA 2TCTA 3Q3SA 2XDNA 5GP9A 3EGQA 3NNRA 3CRJA 2HXIA 3KNWA 3FK6A 2FX0A 2O7OA 3VIBA 3C07A 3BHQA 5F0HA 5FGLA 2GENA 4GCTA 3Q0WA 3IH3A 5IOYA 5AQCA 3NRGA 2ZOYA 2G3BA 2QKOA 3DCFA 2RAEA 4DW6A 3LJLA 2XPWA 5FMPA 3E7QA 1U9NA 3EUPA 2FJ1A 3C2BA 3NPIA 2ID3A 2WUIA 3GZIA 2G7SA 3BTIA 2Y2ZA 1ORKA 2G7GA 5FKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F27 A;  1RKT A;  3BR5 A;  1RKW A;  2XPV A;  2X9D A;  3G56 A;  3ZQI A;  4V2G A;  3SFI A;  1A6I A;  4D7M A;  3LSP A;  3CDL A;  5EZH A;  3P9T A;  5HBU A;  2ZCM A;  3ZQL A;  5CXI A;  4X1E A;  5F0C A;  2QTQ A;  4M3E A;  3FK7 A;  4ACI A;  4ICH A;  2D6Y A;  2FBQ A;  4MXM A;  3GEU A;  2I10 A;  2WV1 A;  1QPI A;  3T6N A;  4AUX A;  3F1B A;  3O8G A;  3Q0U A;  3ZQH A;  4M3F A;  2HYJ A;  3SDG A;  1JT6 A;  2DG8 A;  2XGC A;  3NXC A;  1JT0 A;  3VW0 A;  3VPR A;  1ZKG A;  3BQY A;  5J3L A;  3BT9 A;  2F07 A;  5K58 A;  3IUV A;  2DG7 A;  4UDS A;  3TP3 A;  2HYT A;  3IH4 A;  4V2F A;  2QCO A;  4M3G A;  2ZCN A;  3F0C A;  4B3A A;  5EFY A;  2ZB9 A;  2QOP A;  2IEK A;  3VP5 A;  3BNI A;  3QKX A;  2JK3 A;  3VVY A;  1T56 A;  3G1M A;  2YVE A;  2HQ5 A;  3VOX A;  3ON4 A;  3WHC A;  3FRQ A;  3CCY A;  3QPL A;  4W1U A;  2Y30 A;  3PM1 A;  3FIW A;  3O8H A;  2PBX A;  5K7H A;  2HKU A;  2IAI A;  2IU5 A;  2TRT A;  5J1Y A;  3KKD A;  4GCL A;  3HGY A;  4M3D A;  4W97 A;  2Q24 A;  2UXU A;  3LOC A;  5GPC A;  3BJB A;  2W53 A;  5FKO A;  4GFK A;  3VUQ A;  3B6A A;  1RPW A;  2DTZ A;  2XPU A;  3PPB A;  4AF5 A;  2NP3 A;  2XGD A;  5K7F A;  3B81 A;  3JSJ A;  3QPS A;  1JTX A;  4PXI A;  3WHB A;  2OI8 A;  4JKZ A;  5GPA A;  1VI0 A;  3ON2 A;  4JL3 A;  5D18 A;  2PZ9 A;  3RD3 A;  3O60 A;  5HAW A;  5J1R A;  5DAJ A;  1ZK8 A;  4I6Z A;  2NS7 A;  1JUM A;  3RH2 A;  1UI5 A;  2Y31 A;  5IOZ A;  5FKN A;  1UI6 A;  4JNN A;  3QQA A;  1JUS A;  3V78 A;  3ANP A;  3BR2 A;  5IPA A;  3ANG A;  2O7T A;  3CWR A;  2UXO A;  2FD5 A;  2NX4 A;  5F04 A;  1QVT A;  5CW8 A;  3HTI A;  4CGR A;  4GFL A;  3VVX A;  2G7L A;  3AQT A;  3HTJ A;  3LSJ A;  1QVU A;  3DEW A;  3BRU A;  3HGG A;  2FQ4 A;  3HTH A;  3AQS A;  2UXI A;  2GBY A;  3MVP A;  2ZOZ A;  3TP0 A;  4XK4 A;  5FKK A;  4NEL A;  5IP6 A;  4D5F A;  3BR1 A;  4HKU A;  3ZQF A;  4L62 A;  3COL A;  2WGB A;  1U9O A;  3BTJ A;  1T33 A;  2ZCX A;  2QIB A;  3VW2 A;  4G12 A;  2VPR A;  4AC6 A;  3BQZ A;  5FKL A;  2XGE A;  2X6O A;  3BTL A;  3BTC A;  2IBD A;  2REK A;  1Z0X A;  2UXH A;  4KWA A;  3PAS A;  3BR3 A;  5D19 A;  3V6G A;  4GCK A;  3VW1 A;  2OER A;  3ZQG A;  2JJ7 A;  1SGM A;  2G0E A;  5FHP A;  3BCG A;  5HSZ A;  5F08 A;  4YZE A;  2VKV A;  3CJD A;  3BR6 A;  1JTY A;  3HE0 A;  4ABZ A;  1Z77 A;  2GFN A;  2XB5 A;  5F0F A;  2OF7 A;  3LSR A;  1JUP A;  2EH3 A;  2XRL A;  4M3B A;  3B6C A;  4MK6 A;  4ME9 A;  2YVH A;  3QBM A;  3G7R A;  3NI7 A;  3KZ9 A;  3S5R A;  3VOK A;  5F1J A;  3LHQ A;  2HXO A;  3DPJ A;  2RHA A;  2VKE A;  4NN1 A;  2V57 A;  2UXP A;  4B1R A;  3VVZ A;  3KKC A;  4I76 A;  2RAS A;  1BJZ A;  2OPT A;  4MO7 A;  3Q0V A;  2GUH A;  2QWT A;  3HIM A;  3G1O A;  4D5C A;  5CXG A;  3MNL A;  4D7N A;  3HTA A;  5C4Y A;  5EYR A;  3G1L A;  2NS8 A;  5J1U A;  5H9T A;  5D1R A;  3BR0 A;  2ID6 A;  4AC0 A;  3IH2 A;  4JYK A;  2NP5 A;  5K7Z A;  3LWJ A;  5EZG A;  2TCT A;  3Q3S A;  2XDN A;  5GP9 A;  3EGQ A;  3NNR A;  3CRJ A;  2HXI A;  3KNW A;  3FK6 A;  2FX0 A;  2O7O A;  3VIB A;  3C07 A;  3BHQ A;  5F0H A;  5FGL A;  2GEN A;  4GCT A;  3Q0W A;  3IH3 A;  5IOY A;  5AQC A;  3NRG A;  2ZOY A;  2G3B A;  2QKO A;  3DCF A;  2RAE A;  4DW6 A;  3LJL A;  2XPW A;  5FMP A;  3E7Q A;  1U9N A;  3EUP A;  2FJ1 A;  3C2B A;  3NPI A;  2ID3 A;  2WUI A;  3GZI A;  2G7S A;  3BTI A;  2Y2Z A;  1ORK A;  2G7G A;  5FKM A; 
#chains in the Genus database with same CATH topology
 3NS4 A;  5F27 A;  1RKT A;  3BR5 A;  1RKW A;  2R7R A;  2XPV A;  2X9D A;  3G56 A;  3ZQI A;  4V2G A;  3SFI A;  1A6I A;  4D7M A;  3LSP A;  3CDL A;  5EZH A;  3P9T A;  5HBU A;  2ZCM A;  3ZQL A;  5CXI A;  4X1E A;  5F0C A;  2QTQ A;  4M3E A;  3FK7 A;  4ACI A;  4ICH A;  2D6Y A;  2FBQ A;  4MXM A;  3GEU A;  2I10 A;  2WV1 A;  1QPI A;  3T6N A;  4AUX A;  3F1B A;  3O8G A;  3Q0U A;  3ZQH A;  4M3F A;  2HYJ A;  3SDG A;  1JT6 A;  2DG8 A;  2XGC A;  3NXC A;  1JT0 A;  3VW0 A;  3VPR A;  1ZKG A;  3BQY A;  5J3L A;  4C2M A;  3BT9 A;  2R7S A;  2F07 A;  5K58 A;  3IUV A;  2DG7 A;  4UDS A;  3TP3 A;  2HYT A;  3IH4 A;  4V2F A;  3VTI A;  2QCO A;  4M3G A;  2ZCN A;  3F0C A;  4WIB A;  4B3A A;  5EFY A;  2ZB9 A;  2QOP A;  2IEK A;  3VP5 A;  3FHN A;  3BNI A;  3QKX A;  2JK3 A;  3VVY A;  1T56 A;  2B3W A;  3G1M A;  2YVE A;  2HQ5 A;  3VOX A;  3ON4 A;  3WHC A;  3FRQ A;  3CCY A;  3QPL A;  4W1U A;  2Y30 A;  3PM1 A;  3FIW A;  3O8H A;  2PBX A;  2R7W A;  5K7H A;  2HKU A;  2IAI A;  2IU5 A;  2TRT A;  5J1Y A;  3KKD A;  4GCL A;  3HGY A;  4M3D A;  4W97 A;  2Q24 A;  2UXU A;  3LOC A;  5GPC A;  3BJB A;  2W53 A;  5FKO A;  4GFK A;  3VUQ A;  3B6A A;  2R7O A;  1RPW A;  2DTZ A;  2XPU A;  3PPB A;  4AF5 A;  2NP3 A;  2XGD A;  5K7F A;  3B81 A;  3JSJ A;  3QPS A;  1JTX A;  4PXI A;  3WHB A;  2OI8 A;  3KYL A;  4JKZ A;  5GPA A;  1VI0 A;  3ON2 A;  4JL3 A;  5D18 A;  2PZ9 A;  3RD3 A;  3O60 A;  5HAW A;  5J1R A;  5DAJ A;  1ZK8 A;  4IRV A;  4I6Z A;  2NS7 A;  1JUM A;  3RH2 A;  1UI5 A;  2Y31 A;  5IOZ A;  5FKN A;  1UI6 A;  4JNN A;  3QQA A;  1JUS A;  3V78 A;  3ANP A;  3BR2 A;  5IPA A;  2PFV A;  3ANG A;  3K8P C;  2O7T A;  3CWR A;  2UXO A;  2FD5 A;  4U9L A;  2NX4 A;  5F04 A;  1QVT A;  5CW8 A;  3HTI A;  4CGR A;  4GFL A;  3VVX A;  2G7L A;  3AQT A;  3HTJ A;  3LSJ A;  3SWH A;  1QVU A;  3DEW A;  3BRU A;  2R7X A;  3HGG A;  2FQ4 A;  3HTH A;  3AQS A;  2UXI A;  2R7U A;  2GBY A;  3MVP A;  2ZOZ A;  3TP0 A;  4XK4 A;  5FKK A;  4NEL A;  5IP6 A;  4D5F A;  3BR1 A;  4HKU A;  3ZQF A;  4L62 A;  3COL A;  2WGB A;  1U9O A;  3BTJ A;  1T33 A;  2ZCX A;  2QIB A;  3VW2 A;  4G12 A;  2VPR A;  4AC6 A;  3BQZ A;  5FKL A;  3DU5 A;  2XGE A;  2X6O A;  3BTL A;  3BTC A;  2IBD A;  2REK A;  1Z0X A;  2UXH A;  4KWA A;  3PAS A;  3BR3 A;  5D19 A;  2FJI 1;  3V6G A;  4GCK A;  3VW1 A;  2OER A;  3ZQG A;  2JJ7 A;  1SGM A;  2G0E A;  5FHP A;  3BCG A;  5HSZ A;  5F08 A;  4YZE A;  2VKV A;  3CJD A;  3BR6 A;  1JTY A;  3HE0 A;  4ABZ A;  2R7V A;  1Z77 A;  2GFN A;  2XB5 A;  5F0F A;  2OF7 A;  3LSR A;  1JUP A;  2EH3 A;  2XRL A;  4M3B A;  3B6C A;  4U9N A;  4MK6 A;  4ME9 A;  2YVH A;  3QBM A;  3G7R A;  3NI7 A;  3KZ9 A;  3S5R A;  3VOK A;  2YVX A;  5F1J A;  3LHQ A;  2HXO A;  3DPJ A;  2RHA A;  2VKE A;  4NN1 A;  2V57 A;  2UXP A;  4B1R A;  3VVZ A;  3KKC A;  4I76 A;  2RAS A;  1BJZ A;  2OPT A;  4MO7 A;  3Q0V A;  2GUH A;  2QWT A;  3HIM A;  3G1O A;  4OD4 A;  4D5C A;  5CXG A;  3MNL A;  4D7N A;  3HTA A;  5C4Y A;  5EYR A;  2A2F X;  3G1L A;  2NS8 A;  5J1U A;  5H9T A;  5D1R A;  3BR0 A;  2ID6 A;  4AC0 A;  3IH2 A;  4JYK A;  2NP5 A;  5K7Z A;  3LWJ A;  5EZG A;  2TCT A;  3Q3S A;  2XDN A;  5GP9 A;  4DVY P;  3EGQ A;  3NNR A;  3CRJ A;  2HXI A;  2ZY9 A;  2R7T A;  3KNW A;  3FK6 A;  2FX0 A;  2O7O A;  4OD5 A;  3VIB A;  3C07 A;  3BHQ A;  5F0H A;  5FGL A;  2GEN A;  2B1E A;  4GCT A;  3Q0W A;  3IH3 A;  5IOY A;  5AQC A;  3NRG A;  2ZOY A;  2G3B A;  5CQG A;  2QKO A;  3DCF A;  2RAE A;  4DW6 A;  3LJL A;  2XPW A;  5FMP A;  3E7Q A;  1U9N A;  3EUP A;  2FJ1 A;  3C2B A;  3NPI A;  2ID3 A;  2WUI A;  3GZI A;  2G7S A;  3BTI A;  2Y2Z A;  1ORK A;  3DU6 A;  2R7Q A;  2G7G A;  5FKM A; 
#chains in the Genus database with same CATH homology
 5F27 A;  1RKT A;  3BR5 A;  1RKW A;  2XPV A;  2X9D A;  3G56 A;  3ZQI A;  4V2G A;  3SFI A;  1A6I A;  4D7M A;  3LSP A;  3CDL A;  5EZH A;  3P9T A;  5HBU A;  2ZCM A;  3ZQL A;  5CXI A;  4X1E A;  5F0C A;  2QTQ A;  4M3E A;  3FK7 A;  4ACI A;  4ICH A;  2D6Y A;  2FBQ A;  4MXM A;  3GEU A;  2I10 A;  2WV1 A;  1QPI A;  3T6N A;  4AUX A;  3F1B A;  3O8G A;  3Q0U A;  3ZQH A;  4M3F A;  2HYJ A;  3SDG A;  1JT6 A;  2DG8 A;  2XGC A;  3NXC A;  1JT0 A;  3VW0 A;  3VPR A;  1ZKG A;  3BQY A;  5J3L A;  3BT9 A;  2F07 A;  5K58 A;  3IUV A;  2DG7 A;  4UDS A;  3TP3 A;  2HYT A;  3IH4 A;  4V2F A;  2QCO A;  4M3G A;  2ZCN A;  3F0C A;  4B3A A;  5EFY A;  2ZB9 A;  2QOP A;  2IEK A;  3VP5 A;  3BNI A;  3QKX A;  2JK3 A;  3VVY A;  1T56 A;  3G1M A;  2YVE A;  2HQ5 A;  3VOX A;  3ON4 A;  3WHC A;  3FRQ A;  3CCY A;  3QPL A;  4W1U A;  2Y30 A;  3PM1 A;  3FIW A;  3O8H A;  2PBX A;  5K7H A;  2HKU A;  2IAI A;  2IU5 A;  2TRT A;  5J1Y A;  3KKD A;  4GCL A;  3HGY A;  4M3D A;  4W97 A;  2Q24 A;  2UXU A;  3LOC A;  5GPC A;  3BJB A;  2W53 A;  5FKO A;  4GFK A;  3VUQ A;  3B6A A;  1RPW A;  2DTZ A;  2XPU A;  3PPB A;  4AF5 A;  2NP3 A;  2XGD A;  5K7F A;  3B81 A;  3JSJ A;  3QPS A;  1JTX A;  4PXI A;  3WHB A;  2OI8 A;  4JKZ A;  5GPA A;  1VI0 A;  3ON2 A;  4JL3 A;  5D18 A;  2PZ9 A;  3RD3 A;  3O60 A;  5HAW A;  5J1R A;  5DAJ A;  1ZK8 A;  4I6Z A;  2NS7 A;  1JUM A;  3RH2 A;  1UI5 A;  2Y31 A;  5IOZ A;  5FKN A;  1UI6 A;  4JNN A;  3QQA A;  1JUS A;  3V78 A;  3ANP A;  3BR2 A;  5IPA A;  3ANG A;  2O7T A;  3CWR A;  2UXO A;  2FD5 A;  2NX4 A;  5F04 A;  1QVT A;  5CW8 A;  3HTI A;  4CGR A;  4GFL A;  3VVX A;  2G7L A;  3AQT A;  3HTJ A;  3LSJ A;  1QVU A;  3DEW A;  3BRU A;  3HGG A;  2FQ4 A;  3HTH A;  3AQS A;  2UXI A;  2GBY A;  3MVP A;  2ZOZ A;  3TP0 A;  4XK4 A;  5FKK A;  4NEL A;  5IP6 A;  4D5F A;  3BR1 A;  4HKU A;  3ZQF A;  4L62 A;  3COL A;  2WGB A;  1U9O A;  3BTJ A;  1T33 A;  2ZCX A;  2QIB A;  3VW2 A;  4G12 A;  2VPR A;  4AC6 A;  3BQZ A;  5FKL A;  2XGE A;  2X6O A;  3BTL A;  3BTC A;  2IBD A;  2REK A;  1Z0X A;  2UXH A;  4KWA A;  3PAS A;  3BR3 A;  5D19 A;  3V6G A;  4GCK A;  3VW1 A;  2OER A;  3ZQG A;  2JJ7 A;  1SGM A;  2G0E A;  5FHP A;  3BCG A;  5HSZ A;  5F08 A;  4YZE A;  2VKV A;  3CJD A;  3BR6 A;  1JTY A;  3HE0 A;  4ABZ A;  1Z77 A;  2GFN A;  2XB5 A;  5F0F A;  2OF7 A;  3LSR A;  1JUP A;  2EH3 A;  2XRL A;  4M3B A;  3B6C A;  4MK6 A;  4ME9 A;  2YVH A;  3QBM A;  3G7R A;  3NI7 A;  3KZ9 A;  3S5R A;  3VOK A;  5F1J A;  3LHQ A;  2HXO A;  3DPJ A;  2RHA A;  2VKE A;  4NN1 A;  2V57 A;  2UXP A;  4B1R A;  3VVZ A;  3KKC A;  4I76 A;  2RAS A;  1BJZ A;  2OPT A;  4MO7 A;  3Q0V A;  2GUH A;  2QWT A;  3HIM A;  3G1O A;  4D5C A;  5CXG A;  3MNL A;  4D7N A;  3HTA A;  5C4Y A;  5EYR A;  3G1L A;  2NS8 A;  5J1U A;  5H9T A;  5D1R A;  3BR0 A;  2ID6 A;  4AC0 A;  3IH2 A;  4JYK A;  2NP5 A;  5K7Z A;  3LWJ A;  5EZG A;  2TCT A;  3Q3S A;  2XDN A;  5GP9 A;  3EGQ A;  3NNR A;  3CRJ A;  2HXI A;  3KNW A;  3FK6 A;  2FX0 A;  2O7O A;  3VIB A;  3C07 A;  3BHQ A;  5F0H A;  5FGL A;  2GEN A;  4GCT A;  3Q0W A;  3IH3 A;  5IOY A;  5AQC A;  3NRG A;  2ZOY A;  2G3B A;  2QKO A;  3DCF A;  2RAE A;  4DW6 A;  3LJL A;  2XPW A;  5FMP A;  3E7Q A;  1U9N A;  3EUP A;  2FJ1 A;  3C2B A;  3NPI A;  2ID3 A;  2WUI A;  3GZI A;  2G7S A;  3BTI A;  2Y2Z A;  1ORK A;  2G7G A;  5FKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...