2GFNA

Crystal structure of hth-type transcriptional regulator pksa related protein from rhodococcus sp. rha1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
196
structure length
192
Chain Sequence
b'IVDHDERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAALRRAGDIQGDRYRTILDEEGAGPIEKLRNITASILPLDERRLAMTRVFLFFYAEGTARGEIAAFLARWRGVVRESVVAAQREGTVSTDLDADAVTVALVALTDGLALQAILDPVVMKAISAEDAAARCVDAAVRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator pksA related protein
molecule tags Transcription
source organism Rhodococcus sp.
publication title Crystal structure of HTH-type transcriptional regulator pksA related protein from Rhodococcus sp. RHA1
rcsb
total genus 74
structure length 192
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13977 TetR_C_6 BetI-type transcriptional repressor, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2gfnA00
2JJ7A 2DG8A 2VKEA 3ON4A 4I76A 5CXGA 2ID6A 2QOPA 4KWAA 5CXIA 2XGEA 3QPLA 3VOXA 2X6OA 3P9TA 2NP5A 2NX4A 2ID3A 4G12A 2UXIA 2FJ1A 3HE0A 3RH2A 5K7FA 3ANPA 2V57A 5F1JA 1JUMA 4JL3A 1JUPA 1QVTA 5FMPA 2DTZA 3BR0A 3B6AA 3C2BA 4I6ZA 2Y2ZA 5GPCA 3B81A 5FKKA 3HIMA 2ZCNA 3VVXA 2FD5A 2F07A 3HGYA 5C4YA 2PZ9A 2TRTA 3COLA 2XPUA 3BQYA 2NS7A 2FQ4A 3QBMA 3G1LA 1BJZA 4B3AA 3ZQLA 3IH4A 4D5CA 3FIWA 4XK4A 4CGRA 4JYKA 3NXCA 3QPSA 3Q0UA 4AC0A 3E7QA 5IOZA 2XPWA 3KKCA 1JTXA 1SGMA 3BR6A 5FKNA 2Q24A 3KKDA 2EH3A 1UI6A 1Z77A 3B6CA 2OERA 1QVUA 1JTYA 3WHCA 3S5RA 2YVEA 3Q0WA 2G7GA 4B1RA 3HTHA 2REKA 4DW6A 3TP3A 5F27A 2XGDA 3V78A 2OPTA 4GCTA 4AC6A 3T6NA 3MNLA 4ACIA 2YVHA 3BHQA 3VIBA 1ZK8A 5H9TA 2QIBA 4V2GA 2UXOA 2HYJA 2VPRA 5K58A 2QKOA 3VW2A 3LSPA 3FK7A 2WUIA 1A6IA 3O8GA 3BQZA 3SFIA 5FKLA 2RASA 3CWRA 4MK6A 1ORKA 4D7MA 3BR5A 2OI8A 5F04A 3TP0A 2O7OA 3WHBA 2IBDA 4W1UA 4ICHA 3ZQGA 4M3GA 2ZB9A 1JT6A 3IH2A 4GCLA 5K7ZA 3Q0VA 2UXPA 2RAEA 1QPIA 3HTJA 3F1BA 4AUXA 3GEUA 3VP5A 2HKUA 2WV1A 3Q3SA 3O60A 5F0FA 5EYRA 2NP3A 5IPAA 3AQSA 2ZCXA 4GFLA 2HQ5A 3EUPA 5AQCA 2O7TA 4AF5A 3MVPA 5J1UA 4JNNA 4MO7A 2WGBA 3VOKA 4NN1A 2Y30A 2HYTA 3BTIA 4W97A 5IP6A 3CCYA 2FX0A 2QTQA 2GUHA 4M3EA 4ME9A 4GCKA 2QWTA 3LWJA 3NRGA 3G1MA 5GPAA 3VVYA 3BT9A 2XRLA 2FBQA 4JKZA 3LSRA 2W53A 2GENA 5HSZA 3G7RA 3CDLA 2XB5A 3FK6A 5FKMA 3BRUA 2QCOA 3VPRA 3VUQA 5HAWA 5FHPA 1RKWA 3JSJA 3ZQFA 3LHQA 3PASA 1JUSA 1RPWA 2IAIA 1RKTA 3CJDA 2JK3A 3G56A 3BTLA 2I10A 3NPIA 5EZGA 4D5FA 3ZQIA 2DG7A 3HTAA 3DEWA 5D19A 3DPJA 5GP9A 4M3DA 4D7NA 3F0CA 2G3BA 3ON2A 5DAJA 3NI7A 5D1RA 2PBXA 4L62A 3LOCA 4M3BA 3RD3A 1U9NA 3IUVA 2NS8A 2G0EA 3IH3A 5F0CA 3BNIA 2G7LA 2D6YA 3CRJA 1T33A 3O8HA 3G1OA 2ZCMA 5J1RA 3VW0A 4GFKA 3BR2A 5J3LA 3KZ9A 2UXHA 3BR1A 5FKOA 2ZOZA 1VI0A 2ZOYA 5EFYA 3BTCA 3DCFA 5F08A 3V6GA 2GFNA 4M3FA 5FGLA 2UXUA 3AQTA 2G7SA 3PM1A 4UDSA 2RHAA 3EGQA 4HKUA 5J1YA 1U9OA 3BTJA 3KNWA 5CW8A 4V2FA 3BJBA 2X9DA 3PPBA 2HXIA 3HGGA 2XGCA 1Z0XA 1UI5A 3GZIA 2VKVA 5EZHA 4ABZA 3LJLA 4YZEA 1JT0A 2GBYA 5F0HA 3VW1A 4NELA 3QKXA 3LSJA 5D18A 2IEKA 2HXOA 3C07A 4X1EA 1ZKGA 3ANGA 1T56A 5IOYA 2Y31A 3BR3A 3VVZA 3BCGA 3FRQA 4PXIA 5HBUA 4MXMA 3QQAA 2IU5A 2OF7A 2XPVA 3SDGA 5K7HA 3ZQHA 3NNRA 2TCTA 3HTIA 2XDNA
chains in the Genus database with same CATH superfamily
2JJ7A 2DG8A 3KYLA 2VKEA 3ON4A 4I76A 5CXGA 2ID6A 2QOPA 4KWAA 5CXIA 2XGEA 3QPLA 3VOXA 2X6OA 3P9TA 2NP5A 2NX4A 2ID3A 4G12A 2UXIA 2FJ1A 3HE0A 3RH2A 4U9LA 5K7FA 3ANPA 4OD5A 2V57A 5F1JA 1JUMA 4JL3A 1JUPA 1QVTA 5FMPA 2DTZA 3BR0A 3B6AA 3C2BA 4I6ZA 2Y2ZA 5GPCA 3B81A 5FKKA 3HIMA 2ZCNA 3VVXA 2FD5A 2F07A 2A2FX 3HGYA 5C4YA 2PZ9A 2TRTA 3COLA 2XPUA 3BQYA 2NS7A 2FQ4A 3QBMA 3G1LA 1BJZA 4B3AA 3ZQLA 3IH4A 4D5CA 3FIWA 4XK4A 4CGRA 4JYKA 3NXCA 3QPSA 3Q0UA 4AC0A 3E7QA 5IOZA 2XPWA 3KKCA 1JTXA 1SGMA 3BR6A 5FKNA 2Q24A 3KKDA 2EH3A 1UI6A 1Z77A 3B6CA 2OERA 1QVUA 1JTYA 3WHCA 3S5RA 2YVEA 3FHNA 3Q0WA 2G7GA 4B1RA 3HTHA 2REKA 4DW6A 3TP3A 5F27A 2XGDA 3V78A 2OPTA 4GCTA 4AC6A 3T6NA 3MNLA 4ACIA 2YVHA 3BHQA 3VIBA 1ZK8A 5H9TA 2ZY9A 2QIBA 4V2GA 2UXOA 2HYJA 2VPRA 5K58A 2QKOA 3VW2A 3LSPA 3FK7A 2R7SA 2WUIA 1A6IA 3O8GA 3BQZA 3SFIA 5FKLA 2RASA 3CWRA 4MK6A 1ORKA 2B1EA 4D7MA 3BR5A 2FJI1 2OI8A 5F04A 3TP0A 2O7OA 3WHBA 2IBDA 4W1UA 4ICHA 3ZQGA 4M3GA 2ZB9A 1JT6A 3IH2A 4GCLA 5K7ZA 3Q0VA 2UXPA 2RAEA 1QPIA 3HTJA 3F1BA 4AUXA 3GEUA 3VP5A 2HKUA 2WV1A 3Q3SA 4IRVA 3O60A 5F0FA 5EYRA 2NP3A 5IPAA 2R7XA 3AQSA 2ZCXA 2R7QA 4GFLA 2HQ5A 3EUPA 5AQCA 2O7TA 4AF5A 3MVPA 5J1UA 4WIBA 4JNNA 3SWHA 3K8PC 4MO7A 2WGBA 3VOKA 4NN1A 2Y30A 2HYTA 3BTIA 4W97A 5IP6A 4U9NA 3CCYA 2FX0A 2QTQA 2GUHA 4M3EA 4ME9A 4GCKA 2QWTA 3LWJA 4C2MA 3NRGA 3G1MA 5GPAA 3VVYA 3BT9A 2XRLA 2FBQA 4JKZA 3LSRA 2W53A 2GENA 5HSZA 3G7RA 3CDLA 2XB5A 3FK6A 5FKMA 3BRUA 4DVYP 2QCOA 3VPRA 3VUQA 5HAWA 5FHPA 1RKWA 3JSJA 3ZQFA 2R7TA 3LHQA 3PASA 2B3WA 1JUSA 1RPWA 2IAIA 1RKTA 3CJDA 5CQGA 2JK3A 3G56A 3BTLA 2I10A 3NPIA 5EZGA 4D5FA 3ZQIA 2DG7A 3HTAA 3VTIA 3DEWA 5D19A 3DPJA 5GP9A 4OD4A 4M3DA 4D7NA 3F0CA 2G3BA 3ON2A 5DAJA 3NI7A 5D1RA 2PBXA 4L62A 3LOCA 4M3BA 3RD3A 1U9NA 3IUVA 2NS8A 2G0EA 3IH3A 5F0CA 3BNIA 2G7LA 2D6YA 3CRJA 1T33A 3O8HA 3G1OA 2ZCMA 5J1RA 3VW0A 4GFKA 3BR2A 5J3LA 3KZ9A 2UXHA 3DU5A 3BR1A 5FKOA 2ZOZA 1VI0A 2ZOYA 5EFYA 2R7UA 2R7RA 3BTCA 3DCFA 5F08A 3V6GA 2GFNA 4M3FA 5FGLA 2UXUA 3AQTA 2G7SA 3NS4A 3PM1A 4UDSA 2RHAA 3EGQA 4HKUA 5J1YA 1U9OA 3BTJA 3KNWA 5CW8A 4V2FA 3BJBA 2X9DA 3DU6A 3PPBA 2HXIA 2YVXA 3HGGA 2XGCA 1Z0XA 1UI5A 3GZIA 2VKVA 5EZHA 4ABZA 3LJLA 4YZEA 1JT0A 2GBYA 5F0HA 2R7WA 3VW1A 4NELA 3QKXA 3LSJA 5D18A 2IEKA 2HXOA 3C07A 4X1EA 1ZKGA 3ANGA 2R7VA 1T56A 5IOYA 2Y31A 3BR3A 3VVZA 3BCGA 3FRQA 4PXIA 5HBUA 4MXMA 3QQAA 2IU5A 2OF7A 2XPVA 3SDGA 2PFVA 5K7HA 2R7OA 3ZQHA 3NNRA 2TCTA 3HTIA 2XDNA
chains in the Genus database with same CATH topology
2JJ7A 2DG8A 2VKEA 3ON4A 4I76A 5CXGA 2ID6A 2QOPA 4KWAA 5CXIA 2XGEA 3QPLA 3VOXA 2X6OA 3P9TA 2NP5A 2NX4A 2ID3A 4G12A 2UXIA 2FJ1A 3HE0A 3RH2A 5K7FA 3ANPA 2V57A 5F1JA 1JUMA 4JL3A 1JUPA 1QVTA 5FMPA 2DTZA 3BR0A 3B6AA 3C2BA 4I6ZA 2Y2ZA 5GPCA 3B81A 5FKKA 3HIMA 2ZCNA 3VVXA 2FD5A 2F07A 3HGYA 5C4YA 2PZ9A 2TRTA 3COLA 2XPUA 3BQYA 2NS7A 2FQ4A 3QBMA 3G1LA 1BJZA 4B3AA 3ZQLA 3IH4A 4D5CA 3FIWA 4XK4A 4CGRA 4JYKA 3NXCA 3QPSA 3Q0UA 4AC0A 3E7QA 5IOZA 2XPWA 3KKCA 1JTXA 1SGMA 3BR6A 5FKNA 2Q24A 3KKDA 2EH3A 1UI6A 1Z77A 3B6CA 2OERA 1QVUA 1JTYA 3WHCA 3S5RA 2YVEA 3Q0WA 2G7GA 4B1RA 3HTHA 2REKA 4DW6A 3TP3A 5F27A 2XGDA 3V78A 2OPTA 4GCTA 4AC6A 3T6NA 3MNLA 4ACIA 2YVHA 3BHQA 3VIBA 1ZK8A 5H9TA 2QIBA 4V2GA 2UXOA 2HYJA 2VPRA 5K58A 2QKOA 3VW2A 3LSPA 3FK7A 2WUIA 1A6IA 3O8GA 3BQZA 3SFIA 5FKLA 2RASA 3CWRA 4MK6A 1ORKA 4D7MA 3BR5A 2OI8A 5F04A 3TP0A 2O7OA 3WHBA 2IBDA 4W1UA 4ICHA 3ZQGA 4M3GA 2ZB9A 1JT6A 3IH2A 4GCLA 5K7ZA 3Q0VA 2UXPA 2RAEA 1QPIA 3HTJA 3F1BA 4AUXA 3GEUA 3VP5A 2HKUA 2WV1A 3Q3SA 3O60A 5F0FA 5EYRA 2NP3A 5IPAA 3AQSA 2ZCXA 4GFLA 2HQ5A 3EUPA 5AQCA 2O7TA 4AF5A 3MVPA 5J1UA 4JNNA 4MO7A 2WGBA 3VOKA 4NN1A 2Y30A 2HYTA 3BTIA 4W97A 5IP6A 3CCYA 2FX0A 2QTQA 2GUHA 4M3EA 4ME9A 4GCKA 2QWTA 3LWJA 3NRGA 3G1MA 5GPAA 3VVYA 3BT9A 2XRLA 2FBQA 4JKZA 3LSRA 2W53A 2GENA 5HSZA 3G7RA 3CDLA 2XB5A 3FK6A 5FKMA 3BRUA 2QCOA 3VPRA 3VUQA 5HAWA 5FHPA 1RKWA 3JSJA 3ZQFA 3LHQA 3PASA 1JUSA 1RPWA 2IAIA 1RKTA 3CJDA 2JK3A 3G56A 3BTLA 2I10A 3NPIA 5EZGA 4D5FA 3ZQIA 2DG7A 3HTAA 3DEWA 5D19A 3DPJA 5GP9A 4M3DA 4D7NA 3F0CA 2G3BA 3ON2A 5DAJA 3NI7A 5D1RA 2PBXA 4L62A 3LOCA 4M3BA 3RD3A 1U9NA 3IUVA 2NS8A 2G0EA 3IH3A 5F0CA 3BNIA 2G7LA 2D6YA 3CRJA 1T33A 3O8HA 3G1OA 2ZCMA 5J1RA 3VW0A 4GFKA 3BR2A 5J3LA 3KZ9A 2UXHA 3BR1A 5FKOA 2ZOZA 1VI0A 2ZOYA 5EFYA 3BTCA 3DCFA 5F08A 3V6GA 2GFNA 4M3FA 5FGLA 2UXUA 3AQTA 2G7SA 3PM1A 4UDSA 2RHAA 3EGQA 4HKUA 5J1YA 1U9OA 3BTJA 3KNWA 5CW8A 4V2FA 3BJBA 2X9DA 3PPBA 2HXIA 3HGGA 2XGCA 1Z0XA 1UI5A 3GZIA 2VKVA 5EZHA 4ABZA 3LJLA 4YZEA 1JT0A 2GBYA 5F0HA 3VW1A 4NELA 3QKXA 3LSJA 5D18A 2IEKA 2HXOA 3C07A 4X1EA 1ZKGA 3ANGA 1T56A 5IOYA 2Y31A 3BR3A 3VVZA 3BCGA 3FRQA 4PXIA 5HBUA 4MXMA 3QQAA 2IU5A 2OF7A 2XPVA 3SDGA 5K7HA 3ZQHA 3NNRA 2TCTA 3HTIA 2XDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJ7 A;  2DG8 A;  2VKE A;  3ON4 A;  4I76 A;  5CXG A;  2ID6 A;  2QOP A;  4KWA A;  5CXI A;  2XGE A;  3QPL A;  3VOX A;  2X6O A;  3P9T A;  2NP5 A;  2NX4 A;  2ID3 A;  4G12 A;  2UXI A;  2FJ1 A;  3HE0 A;  3RH2 A;  5K7F A;  3ANP A;  2V57 A;  5F1J A;  1JUM A;  4JL3 A;  1JUP A;  1QVT A;  5FMP A;  2DTZ A;  3BR0 A;  3B6A A;  3C2B A;  4I6Z A;  2Y2Z A;  5GPC A;  3B81 A;  5FKK A;  3HIM A;  2ZCN A;  3VVX A;  2FD5 A;  2F07 A;  3HGY A;  5C4Y A;  2PZ9 A;  2TRT A;  3COL A;  2XPU A;  3BQY A;  2NS7 A;  2FQ4 A;  3QBM A;  3G1L A;  1BJZ A;  4B3A A;  3ZQL A;  3IH4 A;  4D5C A;  3FIW A;  4XK4 A;  4CGR A;  4JYK A;  3NXC A;  3QPS A;  3Q0U A;  4AC0 A;  3E7Q A;  5IOZ A;  2XPW A;  3KKC A;  1JTX A;  1SGM A;  3BR6 A;  5FKN A;  2Q24 A;  3KKD A;  2EH3 A;  1UI6 A;  1Z77 A;  3B6C A;  2OER A;  1QVU A;  1JTY A;  3WHC A;  3S5R A;  2YVE A;  3Q0W A;  2G7G A;  4B1R A;  3HTH A;  2REK A;  4DW6 A;  3TP3 A;  5F27 A;  2XGD A;  3V78 A;  2OPT A;  4GCT A;  4AC6 A;  3T6N A;  3MNL A;  4ACI A;  2YVH A;  3BHQ A;  3VIB A;  1ZK8 A;  5H9T A;  2QIB A;  4V2G A;  2UXO A;  2HYJ A;  2VPR A;  5K58 A;  2QKO A;  3VW2 A;  3LSP A;  3FK7 A;  2WUI A;  1A6I A;  3O8G A;  3BQZ A;  3SFI A;  5FKL A;  2RAS A;  3CWR A;  4MK6 A;  1ORK A;  4D7M A;  3BR5 A;  2OI8 A;  5F04 A;  3TP0 A;  2O7O A;  3WHB A;  2IBD A;  4W1U A;  4ICH A;  3ZQG A;  4M3G A;  2ZB9 A;  1JT6 A;  3IH2 A;  4GCL A;  5K7Z A;  3Q0V A;  2UXP A;  2RAE A;  1QPI A;  3HTJ A;  3F1B A;  4AUX A;  3GEU A;  3VP5 A;  2HKU A;  2WV1 A;  3Q3S A;  3O60 A;  5F0F A;  5EYR A;  2NP3 A;  5IPA A;  3AQS A;  2ZCX A;  4GFL A;  2HQ5 A;  3EUP A;  5AQC A;  2O7T A;  4AF5 A;  3MVP A;  5J1U A;  4JNN A;  4MO7 A;  2WGB A;  3VOK A;  4NN1 A;  2Y30 A;  2HYT A;  3BTI A;  4W97 A;  5IP6 A;  3CCY A;  2FX0 A;  2QTQ A;  2GUH A;  4M3E A;  4ME9 A;  4GCK A;  2QWT A;  3LWJ A;  3NRG A;  3G1M A;  5GPA A;  3VVY A;  3BT9 A;  2XRL A;  2FBQ A;  4JKZ A;  3LSR A;  2W53 A;  2GEN A;  5HSZ A;  3G7R A;  3CDL A;  2XB5 A;  3FK6 A;  5FKM A;  3BRU A;  2QCO A;  3VPR A;  3VUQ A;  5HAW A;  5FHP A;  1RKW A;  3JSJ A;  3ZQF A;  3LHQ A;  3PAS A;  1JUS A;  1RPW A;  2IAI A;  1RKT A;  3CJD A;  2JK3 A;  3G56 A;  3BTL A;  2I10 A;  3NPI A;  5EZG A;  4D5F A;  3ZQI A;  2DG7 A;  3HTA A;  3DEW A;  5D19 A;  3DPJ A;  5GP9 A;  4M3D A;  4D7N A;  3F0C A;  2G3B A;  3ON2 A;  5DAJ A;  3NI7 A;  5D1R A;  2PBX A;  4L62 A;  3LOC A;  4M3B A;  3RD3 A;  1U9N A;  3IUV A;  2NS8 A;  2G0E A;  3IH3 A;  5F0C A;  3BNI A;  2G7L A;  2D6Y A;  3CRJ A;  1T33 A;  3O8H A;  3G1O A;  2ZCM A;  5J1R A;  3VW0 A;  4GFK A;  3BR2 A;  5J3L A;  3KZ9 A;  2UXH A;  3BR1 A;  5FKO A;  2ZOZ A;  1VI0 A;  2ZOY A;  5EFY A;  3BTC A;  3DCF A;  5F08 A;  3V6G A;  2GFN A;  4M3F A;  5FGL A;  2UXU A;  3AQT A;  2G7S A;  3PM1 A;  4UDS A;  2RHA A;  3EGQ A;  4HKU A;  5J1Y A;  1U9O A;  3BTJ A;  3KNW A;  5CW8 A;  4V2F A;  3BJB A;  2X9D A;  3PPB A;  2HXI A;  3HGG A;  2XGC A;  1Z0X A;  1UI5 A;  3GZI A;  2VKV A;  5EZH A;  4ABZ A;  3LJL A;  4YZE A;  1JT0 A;  2GBY A;  5F0H A;  3VW1 A;  4NEL A;  3QKX A;  3LSJ A;  5D18 A;  2IEK A;  2HXO A;  3C07 A;  4X1E A;  1ZKG A;  3ANG A;  1T56 A;  5IOY A;  2Y31 A;  3BR3 A;  3VVZ A;  3BCG A;  3FRQ A;  4PXI A;  5HBU A;  4MXM A;  3QQA A;  2IU5 A;  2OF7 A;  2XPV A;  3SDG A;  5K7H A;  3ZQH A;  3NNR A;  2TCT A;  3HTI A;  2XDN A; 
#chains in the Genus database with same CATH topology
 2JJ7 A;  2DG8 A;  3KYL A;  2VKE A;  3ON4 A;  4I76 A;  5CXG A;  2ID6 A;  2QOP A;  4KWA A;  5CXI A;  2XGE A;  3QPL A;  3VOX A;  2X6O A;  3P9T A;  2NP5 A;  2NX4 A;  2ID3 A;  4G12 A;  2UXI A;  2FJ1 A;  3HE0 A;  3RH2 A;  4U9L A;  5K7F A;  3ANP A;  4OD5 A;  2V57 A;  5F1J A;  1JUM A;  4JL3 A;  1JUP A;  1QVT A;  5FMP A;  2DTZ A;  3BR0 A;  3B6A A;  3C2B A;  4I6Z A;  2Y2Z A;  5GPC A;  3B81 A;  5FKK A;  3HIM A;  2ZCN A;  3VVX A;  2FD5 A;  2F07 A;  2A2F X;  3HGY A;  5C4Y A;  2PZ9 A;  2TRT A;  3COL A;  2XPU A;  3BQY A;  2NS7 A;  2FQ4 A;  3QBM A;  3G1L A;  1BJZ A;  4B3A A;  3ZQL A;  3IH4 A;  4D5C A;  3FIW A;  4XK4 A;  4CGR A;  4JYK A;  3NXC A;  3QPS A;  3Q0U A;  4AC0 A;  3E7Q A;  5IOZ A;  2XPW A;  3KKC A;  1JTX A;  1SGM A;  3BR6 A;  5FKN A;  2Q24 A;  3KKD A;  2EH3 A;  1UI6 A;  1Z77 A;  3B6C A;  2OER A;  1QVU A;  1JTY A;  3WHC A;  3S5R A;  2YVE A;  3FHN A;  3Q0W A;  2G7G A;  4B1R A;  3HTH A;  2REK A;  4DW6 A;  3TP3 A;  5F27 A;  2XGD A;  3V78 A;  2OPT A;  4GCT A;  4AC6 A;  3T6N A;  3MNL A;  4ACI A;  2YVH A;  3BHQ A;  3VIB A;  1ZK8 A;  5H9T A;  2ZY9 A;  2QIB A;  4V2G A;  2UXO A;  2HYJ A;  2VPR A;  5K58 A;  2QKO A;  3VW2 A;  3LSP A;  3FK7 A;  2R7S A;  2WUI A;  1A6I A;  3O8G A;  3BQZ A;  3SFI A;  5FKL A;  2RAS A;  3CWR A;  4MK6 A;  1ORK A;  2B1E A;  4D7M A;  3BR5 A;  2FJI 1;  2OI8 A;  5F04 A;  3TP0 A;  2O7O A;  3WHB A;  2IBD A;  4W1U A;  4ICH A;  3ZQG A;  4M3G A;  2ZB9 A;  1JT6 A;  3IH2 A;  4GCL A;  5K7Z A;  3Q0V A;  2UXP A;  2RAE A;  1QPI A;  3HTJ A;  3F1B A;  4AUX A;  3GEU A;  3VP5 A;  2HKU A;  2WV1 A;  3Q3S A;  4IRV A;  3O60 A;  5F0F A;  5EYR A;  2NP3 A;  5IPA A;  2R7X A;  3AQS A;  2ZCX A;  2R7Q A;  4GFL A;  2HQ5 A;  3EUP A;  5AQC A;  2O7T A;  4AF5 A;  3MVP A;  5J1U A;  4WIB A;  4JNN A;  3SWH A;  3K8P C;  4MO7 A;  2WGB A;  3VOK A;  4NN1 A;  2Y30 A;  2HYT A;  3BTI A;  4W97 A;  5IP6 A;  4U9N A;  3CCY A;  2FX0 A;  2QTQ A;  2GUH A;  4M3E A;  4ME9 A;  4GCK A;  2QWT A;  3LWJ A;  4C2M A;  3NRG A;  3G1M A;  5GPA A;  3VVY A;  3BT9 A;  2XRL A;  2FBQ A;  4JKZ A;  3LSR A;  2W53 A;  2GEN A;  5HSZ A;  3G7R A;  3CDL A;  2XB5 A;  3FK6 A;  5FKM A;  3BRU A;  4DVY P;  2QCO A;  3VPR A;  3VUQ A;  5HAW A;  5FHP A;  1RKW A;  3JSJ A;  3ZQF A;  2R7T A;  3LHQ A;  3PAS A;  2B3W A;  1JUS A;  1RPW A;  2IAI A;  1RKT A;  3CJD A;  5CQG A;  2JK3 A;  3G56 A;  3BTL A;  2I10 A;  3NPI A;  5EZG A;  4D5F A;  3ZQI A;  2DG7 A;  3HTA A;  3VTI A;  3DEW A;  5D19 A;  3DPJ A;  5GP9 A;  4OD4 A;  4M3D A;  4D7N A;  3F0C A;  2G3B A;  3ON2 A;  5DAJ A;  3NI7 A;  5D1R A;  2PBX A;  4L62 A;  3LOC A;  4M3B A;  3RD3 A;  1U9N A;  3IUV A;  2NS8 A;  2G0E A;  3IH3 A;  5F0C A;  3BNI A;  2G7L A;  2D6Y A;  3CRJ A;  1T33 A;  3O8H A;  3G1O A;  2ZCM A;  5J1R A;  3VW0 A;  4GFK A;  3BR2 A;  5J3L A;  3KZ9 A;  2UXH A;  3DU5 A;  3BR1 A;  5FKO A;  2ZOZ A;  1VI0 A;  2ZOY A;  5EFY A;  2R7U A;  2R7R A;  3BTC A;  3DCF A;  5F08 A;  3V6G A;  2GFN A;  4M3F A;  5FGL A;  2UXU A;  3AQT A;  2G7S A;  3NS4 A;  3PM1 A;  4UDS A;  2RHA A;  3EGQ A;  4HKU A;  5J1Y A;  1U9O A;  3BTJ A;  3KNW A;  5CW8 A;  4V2F A;  3BJB A;  2X9D A;  3DU6 A;  3PPB A;  2HXI A;  2YVX A;  3HGG A;  2XGC A;  1Z0X A;  1UI5 A;  3GZI A;  2VKV A;  5EZH A;  4ABZ A;  3LJL A;  4YZE A;  1JT0 A;  2GBY A;  5F0H A;  2R7W A;  3VW1 A;  4NEL A;  3QKX A;  3LSJ A;  5D18 A;  2IEK A;  2HXO A;  3C07 A;  4X1E A;  1ZKG A;  3ANG A;  2R7V A;  1T56 A;  5IOY A;  2Y31 A;  3BR3 A;  3VVZ A;  3BCG A;  3FRQ A;  4PXI A;  5HBU A;  4MXM A;  3QQA A;  2IU5 A;  2OF7 A;  2XPV A;  3SDG A;  2PFV A;  5K7H A;  2R7O A;  3ZQH A;  3NNR A;  2TCT A;  3HTI A;  2XDN A; 
#chains in the Genus database with same CATH homology
 2JJ7 A;  2DG8 A;  2VKE A;  3ON4 A;  4I76 A;  5CXG A;  2ID6 A;  2QOP A;  4KWA A;  5CXI A;  2XGE A;  3QPL A;  3VOX A;  2X6O A;  3P9T A;  2NP5 A;  2NX4 A;  2ID3 A;  4G12 A;  2UXI A;  2FJ1 A;  3HE0 A;  3RH2 A;  5K7F A;  3ANP A;  2V57 A;  5F1J A;  1JUM A;  4JL3 A;  1JUP A;  1QVT A;  5FMP A;  2DTZ A;  3BR0 A;  3B6A A;  3C2B A;  4I6Z A;  2Y2Z A;  5GPC A;  3B81 A;  5FKK A;  3HIM A;  2ZCN A;  3VVX A;  2FD5 A;  2F07 A;  3HGY A;  5C4Y A;  2PZ9 A;  2TRT A;  3COL A;  2XPU A;  3BQY A;  2NS7 A;  2FQ4 A;  3QBM A;  3G1L A;  1BJZ A;  4B3A A;  3ZQL A;  3IH4 A;  4D5C A;  3FIW A;  4XK4 A;  4CGR A;  4JYK A;  3NXC A;  3QPS A;  3Q0U A;  4AC0 A;  3E7Q A;  5IOZ A;  2XPW A;  3KKC A;  1JTX A;  1SGM A;  3BR6 A;  5FKN A;  2Q24 A;  3KKD A;  2EH3 A;  1UI6 A;  1Z77 A;  3B6C A;  2OER A;  1QVU A;  1JTY A;  3WHC A;  3S5R A;  2YVE A;  3Q0W A;  2G7G A;  4B1R A;  3HTH A;  2REK A;  4DW6 A;  3TP3 A;  5F27 A;  2XGD A;  3V78 A;  2OPT A;  4GCT A;  4AC6 A;  3T6N A;  3MNL A;  4ACI A;  2YVH A;  3BHQ A;  3VIB A;  1ZK8 A;  5H9T A;  2QIB A;  4V2G A;  2UXO A;  2HYJ A;  2VPR A;  5K58 A;  2QKO A;  3VW2 A;  3LSP A;  3FK7 A;  2WUI A;  1A6I A;  3O8G A;  3BQZ A;  3SFI A;  5FKL A;  2RAS A;  3CWR A;  4MK6 A;  1ORK A;  4D7M A;  3BR5 A;  2OI8 A;  5F04 A;  3TP0 A;  2O7O A;  3WHB A;  2IBD A;  4W1U A;  4ICH A;  3ZQG A;  4M3G A;  2ZB9 A;  1JT6 A;  3IH2 A;  4GCL A;  5K7Z A;  3Q0V A;  2UXP A;  2RAE A;  1QPI A;  3HTJ A;  3F1B A;  4AUX A;  3GEU A;  3VP5 A;  2HKU A;  2WV1 A;  3Q3S A;  3O60 A;  5F0F A;  5EYR A;  2NP3 A;  5IPA A;  3AQS A;  2ZCX A;  4GFL A;  2HQ5 A;  3EUP A;  5AQC A;  2O7T A;  4AF5 A;  3MVP A;  5J1U A;  4JNN A;  4MO7 A;  2WGB A;  3VOK A;  4NN1 A;  2Y30 A;  2HYT A;  3BTI A;  4W97 A;  5IP6 A;  3CCY A;  2FX0 A;  2QTQ A;  2GUH A;  4M3E A;  4ME9 A;  4GCK A;  2QWT A;  3LWJ A;  3NRG A;  3G1M A;  5GPA A;  3VVY A;  3BT9 A;  2XRL A;  2FBQ A;  4JKZ A;  3LSR A;  2W53 A;  2GEN A;  5HSZ A;  3G7R A;  3CDL A;  2XB5 A;  3FK6 A;  5FKM A;  3BRU A;  2QCO A;  3VPR A;  3VUQ A;  5HAW A;  5FHP A;  1RKW A;  3JSJ A;  3ZQF A;  3LHQ A;  3PAS A;  1JUS A;  1RPW A;  2IAI A;  1RKT A;  3CJD A;  2JK3 A;  3G56 A;  3BTL A;  2I10 A;  3NPI A;  5EZG A;  4D5F A;  3ZQI A;  2DG7 A;  3HTA A;  3DEW A;  5D19 A;  3DPJ A;  5GP9 A;  4M3D A;  4D7N A;  3F0C A;  2G3B A;  3ON2 A;  5DAJ A;  3NI7 A;  5D1R A;  2PBX A;  4L62 A;  3LOC A;  4M3B A;  3RD3 A;  1U9N A;  3IUV A;  2NS8 A;  2G0E A;  3IH3 A;  5F0C A;  3BNI A;  2G7L A;  2D6Y A;  3CRJ A;  1T33 A;  3O8H A;  3G1O A;  2ZCM A;  5J1R A;  3VW0 A;  4GFK A;  3BR2 A;  5J3L A;  3KZ9 A;  2UXH A;  3BR1 A;  5FKO A;  2ZOZ A;  1VI0 A;  2ZOY A;  5EFY A;  3BTC A;  3DCF A;  5F08 A;  3V6G A;  2GFN A;  4M3F A;  5FGL A;  2UXU A;  3AQT A;  2G7S A;  3PM1 A;  4UDS A;  2RHA A;  3EGQ A;  4HKU A;  5J1Y A;  1U9O A;  3BTJ A;  3KNW A;  5CW8 A;  4V2F A;  3BJB A;  2X9D A;  3PPB A;  2HXI A;  3HGG A;  2XGC A;  1Z0X A;  1UI5 A;  3GZI A;  2VKV A;  5EZH A;  4ABZ A;  3LJL A;  4YZE A;  1JT0 A;  2GBY A;  5F0H A;  3VW1 A;  4NEL A;  3QKX A;  3LSJ A;  5D18 A;  2IEK A;  2HXO A;  3C07 A;  4X1E A;  1ZKG A;  3ANG A;  1T56 A;  5IOY A;  2Y31 A;  3BR3 A;  3VVZ A;  3BCG A;  3FRQ A;  4PXI A;  5HBU A;  4MXM A;  3QQA A;  2IU5 A;  2OF7 A;  2XPV A;  3SDG A;  5K7H A;  3ZQH A;  3NNR A;  2TCT A;  3HTI A;  2XDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...