2GFUA

Nmr solution structure of the pwwp domain of mismatch repair protein hmsh6
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
134
structure length
134
Chain Sequence
KAKNLNGGLRRSVAPAAPTSSDFSPGDLVWAKMEGYPWWPSLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVSDEPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA mismatch repair protein MSH6
publication title The PWWP domain of Mismatch Repair protein hMSH6 is involved in double stranded and single stranded DNA binding
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 22
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gfuA00
4B9XA 4E7HA 4Q5WA 3M9QA 1OI1A 2L3RA 3MP1A 2VYTA 3P8HA 2RHXA 5M9OA 2NLUA 4LD6A 3Q1JA 3LGFA 3OY9A 5IAYA 3L2QA 2RHYA 2E6NA 3L2RA 4L59A 5FROA 2GFUA 3O8VA 3QBYA 5CIUA 3MEVA 4C5HA 5FRMA 2MWPA 1H3ZA 3OYIA 2EQMA 3FDRA 2LCCA 4N4GA 4FL6A 3SD4A 3UT1A 4Z02A 4HCZA 2HQXA 4C5EA 3OS2A 2R5AA 2X4YA 4A4GA 4QW2A 2EQUA 3OS0A 1OZ2A 3F70A 3E9GA 3MEWA 4BE1A 1WJSA 4E7LA 1WGSA 3OYJA 3OA6A 2LVMA 2L8DA 3PMTA 3FEOA 4A4FA 1OYXA 4A4EA 4A4HA 3OYFA 2GFAA 2DIGA 3LLRA 2FHDA 3LX7A 2CKKA 3MP8A 3LYIA 3LGLA 5KCHA 5C6SA 2K3XA 2BUDA 3OYAA 5KE3A 3DB4A 4BD3A 5D6YA 3MEAA 2GF7A 2RO0A 3DLMA 4BDZA 2M0OA 4BE0A 4BDYA 4C5IA 3OYCA 2O4XA 2B8AA 5KH6A 3H6ZA 4E7JA 3C4SA 4OVAA 3OYEA 4EDUA 1KHCA 3P8DA 2XK0A 4QQGA 4ZTFA 4PL6A 2K3YA 1SSFA 4X34A 2PQWA 2M1HA 2R5MA 3UWNA 3NTKA 5C0MA 2P0KA 3QJ6A 4IUTA 2E5QA 3E9FA 3PFSA 4IUUA 2DAQA 2LTOA 2RHZA 1WJRA 2L89A 3FLGA 1G5VA 1WJQA 3EAEA 2WACA 3OYDA 2EQJA 3QIIA 5J39A 4N4HA 3CEYA 4RG2A 3ASKA 3OMCA 4E7KA 4IUQA 3NTIA 2RJDA 2RI2A 2EQKA 3S3OA 3FC3A 4QVZA 2JTFA 3OB9A 3GOXA 5KE2A 1OZ3A 2LRQA 2G3RA 2EKOA 1N27A 2D9TA 4FU6A 3OS1A 2O4XB 4PLIA 2X4WA 3MP6A 2RJEA 4BACA 4NS5A 3L42A 5D6WA 3S6WA 3S3MA 4PLLA 3MO8A 3H8ZA 1MHNA 2F5KA 3ME9A 3MEUA 3ZEHA 4IKFA 3OYKA 3OMGA 2M16A 3DB3A 2R58A 4QQDA 3L2UA 3L2WA 2BIVA 2BKDN 2RI5A 2HQEA 2JZ2A 5D6XA 4QQ6A 3LH0A 2EFIA 4CRIA 5KCOA 3OYLA 2RJFA 4BE2A 4II1A 2X35A 3PMIA 3OYGA 2X4XA 4IUPA 2RHUA 4GY5A 5J26A 4C5GA 3PNWC 3KUFA 1RI0A 2XDPA 4IURA 2MWOA 2QQRA 3OQ5A 3OYBA 2RHIA 2RJCA 3META 2RI3A 4IUVA 3OYNA 2QQSA 4N4IA 4UC4A 4ZTJA 2YRVA 2DIQA 3L2VA 3QKJA 3OYMA 2LDMA 4E7IA 3BDLA 3NTHA 3S3NA 2R57A 5IN1A 2IG0A 5FRNA 3OYHA 1XNIA 4B9WA
chains in the Genus database with same CATH superfamily
1AT1B 2OAWA 5GAMe 4C92D 1I81A 3OY9A 3CPWA 4JS5A 1YJNQ 3TCJA 2XI9A 1RAEB 2HSPA 4BUGA 4DEXA 4FSSA 4J9FA 1H641 2CZ7B 2FZKB 3ER0A 3NHNA 5GAOl 2JTMA 1VQMQ 3EGXB 4M78D 1KC8U 1C0MA 4R56A 3VUBA 2L3SA 2V8JA 2J6KA 2JXBA 1YJ9Q 3EG1A 4D8DA 4MZMA 2DL8A 1UGVA 2LVMA 2D6FA 4FIBA 2E70A 3OW2S 2FYKA 1M1KC 4FT2A 3CXCA 2BUDA 1AVZC 5IHNA 2KRSA 5GJVB 5CQYA 1KJWA 4AFSC 2EW3A 1HYOA 3M4GA 4JRPA 4XK8E 1BKBA 2R5MA 1JO8A 2PVDB 1LPLA 2O9SA 2IPOB 3CC2T 1G2BA 1VIEA 2DL5A 2LTOA 1BBZA 4M75A 1WJQA 1W4SA 3QIIA 2FRYA 3RKYA 1MNDA 2VASA 4MMLA 1AZEA 5GAN5 4M77F 1ZQ1A 2FPFA 3JB9G 3V8JA 4LE9A 4AFUC 4IIMA 3CMEQ 1YIJT 3G6EQ 1VQLT 2HL3A 4QQDA 1K0XA 4RCBA 1VQPA 1X69A 2YUOA 3GNGA 4FW2A 1YI2Q 1G3TA 4GY5A 1M2OA 4YTLA 3CCJT 1QKXA 2YT6A 5GANf 3PE0A 1OX8A 1Y57A 3CCUA 2JM8A 4Z88A 3QHSA 2F1LA 5EG2A 5KYWB 3I9QA 3QKJA 4XU0A 3BDLA 1SRLA 2QYZA 1OU8A 3CCMT 2RQVA 4PJOG 1X6GA 1RUWA 4HXJA 3QUIA 4CC7A 2RHYA 3L2RA 3V8KA 1K9MR 3CCLA 2QTVA 3JCMf 3CCJQ 1PNJA 5GAMd 3GP8A 5GAMj 1Q81C 3I5RA 4OMPA 4C8QF 1VQ8Q 5I22A 4EMHA 3I5SA 1Q86U 3QG1A 1P92A 1O9SA 2DRMA 4JLGA 5KYXA 2YWWA 2PUOB 1UGQB 1M90U 4OMOA 4M77E 3DB4A 2AT1B 1U3OA 5AYFA 3OYCA 2O4XA 3I56T 1KHCA 2OAUA 4HVUA 1SSFA 5FWBA 5FU7C 5KYUB 4EMKB 3GLXA 3CCQA 1RLQC 1H3HA 4C92B 1YCYA 5A2QE 4M7AE 2RA2A 1WJRA 1B3QA 1XJWB 2KVQG 4PK4A 1AZGB 2A3LA 1KD1U 3OB9A 3V7CA 1OZ3A 5KE2A 1HXDA 2KROA 4J6YA 4PLIA 1TOVA 2RQWA 3CPWP 3S6WA 2VXFA 3H8ZA 3MEUA 4IKFA 8ATCB 2LCLA 4M4ZA 2D8JA 5I11A 2RJFA 1SKUB 4FYXB 5HKCA 1VQ6T 3KUFA 1RI0A 4WTOB 2LC4A 2RHIA 4C8QE 1NG2A 1KQ1A 2QDYB 4XTUA 4Y91A 2YRVA 1Z9QA 1F1BB 1I1JA 2FVUA 4AFQC 3INZA 3A8LB 3CXCP 1AEYA 3TVTA 1NYGA 1TUGB 3V7RA 2M51A 2LJ1A 3P8BB 2DL4A 3EH1A 3M4YA 4RTUA 1LVKA 1FMWA 4JJBA 1AOJA 3SD4A 2X3WD 4FSXA 1KHIA 1EX4A 2EVRA 1R8OB 1S1NA 3M58A 4KT0E 2ZPHB 5HCKA 1SHFA 1WJSA 3OYJA 3CC4T 1TUDA 4XTYA 1BI1A 2V8KA 1GRIA 2YRCA 2FHDA 5LJ3h 5KCHA 1VQPQ 1XTDA 1ABQA 4BD3A 3PGGA 3H9NA 1V29B 2K79A 4ZTFA 2QAZA 1BK2A 1KC8R 5LJ3d 4LN2A 5LJ3j 4OMMA 3G71T 3KBGA 5C0MA 2QEXQ 1G3YA 5FU6C 3FJ5A 4XU2A 3EG3A 1VQ4Q 2RHZA 1WYXA 4M78C 1K73U 2M9UA 2F2VA 2EQJA 2Z0WA 5CK9A 5J39A 2P0PA 4OGEA 1UGSB 3A8MB 5CQXA 1ZHIA 3CCLQ 2ESWA 2RJEA 1UDLA 4C8QD 4Y28E 1MHNA 1MMGA 1WHLA 2VKNA 2JN0A 2VVKA 6AT1B 4WCIA 4QQ6A 3MJXA 2KE9A 4LUEA 3CCET 4F04B 3M54A 1YJWA 4XTXA 2QGFB 4PJOA 3X20B 1ZUUA 2HNIA 1ZSZB 1T0HA 2DA9A 4OB3B 3CMAA 2LP5A 4E7IA 3LWIA 1MNEA 4J5YA 3CCQQ 1R0BG 2IVWA 4MDWA 1YBYA 3HPWA 1Y7XA 2E6NA 4B6MA 2DVEA 2RPNA 3CCEQ 2DLPA 3FDRA 1D3BA 1VA7A 3H41A 2JT4A 2DD5A 2E6ZA 5LJ5h 4MDXA 2LX7A 2P84A 1PM3A 2KDSA 2LNVA 2CP6A 3NGPA 2XHCA 3OS5A 2HMAA 2EWNA 1GCQC 1CKAA 2XMFA 5GMKe 1NEBA 3EGDB 4Y92A 1YHQA 4BY6C 4J6XA 4C5IA 3ULRB 2XK0A 4J9GA 2DZCA 2A28A 5LL6S 2CYZB 2JVVA 4ATOA 2BTTA 3CCRA 2DEQA 3RBBB 1KQSS 1VQ5T 2EJ9A 4WF2A 1Q86R 5GAOr 2IIMA 3TREA 4PJOC 2JTEA 2E64A 4M77B 5A0LA 2DPPB 2JJ9A 3RIRA 4F7UF 5GANe 2RQTA 2L2PA 1NEGA 4LXCA 2RF0A 3UDCA 2FZGB 1Y71A 1X43A 3OYKA 5FLXE 1RAAB 1UFFA 2BIVA 2ZPFB 4EIKA 1VQOA 4N0AC 5LJ3f 5ECAA 4M7AB 4C0GA 1VQMA 2ABLA 2KK4A 1Q81U 2FL7A 3M0PA 3TU4K 3QWYA 2DTOA 3JCMe 1YJ9A 4N4IA 4M78F 1IXDA 1KD1R 1PRMC 1XQHA 1WFWA 4FM4B 3L2ZA 4E7HA 1ZX6A 4M75G 3MPUB 2OTLT 2VYTA 2DJZA 1J3TA 1RI9A 5FROA 4M75D 2EJGA 3U23A 3C95A 1MGQA 3E19A 1TH7A 3VS1A 1NPPA 2EGCA 4C8QB 1NM7A 2X4YA 2MPXC 5CR2A 1MMNA 1D1CA 1PD1A 3MP8A 3HRUA 4J8OA 2OTLQ 1BB9A 4F7UE 4ZGJB 1Z9ZA 2SRCA 3VKIA 2PVGB 2LQKA 4LDUA 4OVAA 1TG0A 4QQGA 4OMFB 3JAME 3G6EA 4X34A 1OPLA 2PQWA 3CMAQ 1YI2A 5GMKj 2EYQA 3CC2A 1K4US 2DL3A 2HKQB 4K11A 1X01A 2FEIA 2D0NA 4J9CA 2EAYA 3QJYA 4M78E 5IHIA 1QWFA 2LJ3A 2ZPIB 1NYFA 1W1FA 3CPFA 1BIBA 2ZZDA 2AKLA 1UGPB 2X4WA 4LD9K 5LJ5f 4PLLA 1SG5A 1YIJA 2DM1A 4AFZC 2KYMA 2COZA 2M16A 1VQLA 1WQ7A 5CKDA 3A8GB 1WLPB 4C5GA 2JM9A 2KXCA 3CCJA 1K73R 3OBYA 5KYYA 2CP7A 1VQ8A 3EHQA 4M7DA 2KRMA 3D7SB 3SWNB 1YHQQ 2F2XA 2GTOA 3S3NA 4PNOA 5IN1A 1RAHB 1WQWA 4PFOA 1FYNA 4ORZA 1OI1A 3GNFB 1IGUA 2YDLA 3CCMA 3MP1A 3JCMd 5M9OA 5GAOq 3CCRQ 2RNAA 2QGGA 1K0SA 1BI2A 1IHVA 2DJQA 4RTWA 4J7FA 2HQXA 2OJ2A 3VS4A 1NLOC 4Z8AA 2FZCB 2JUFA 4PFPA 2SEMA 3OYFA 2QDLA 4E6RA 4MZTA 1T3SA 3JCMb 3LX7A 1YITT 3LGLA 3CPWS 1JXMA 1VQOQ 1I0CA 2YXYA 3VUZA 4BE0A 5GAN2 4QT7A 2D8HA 2XD0A 2GBQA 4PFZA 1QP3A 4JJNK 4NOYA 2E5QA 2HAXA 4JRKA 2KI7A 3CXCS 3CEYA 1VQNT 2PNIA 2DFUA 2NUPB 2KAFA 2D9TA 3SFMA 1V1CA 2D0QB 3CD6T 5I2SA 3ZEHA 3J7AF 3EG9B 2K9GA 1OULA 1AD5A 1QVPA 3REBB 3EGXA 2LX9A 3QWXX 3OYBA 2E65A 3META 3REAB 2RQUA 1GFCA 3CBMA 2DZ9A 4AMCA 1KFZA 2GGRA 4OGCA 2LT4A 5DLQE 5I21A 3JB9D 5GMKm 2RHXA 4CC2A 3CC2Q 1UHCA 4AT1B 3MEVA 3OSSC 8AT1B 4N4GA 1Q81R 3JRZA 1K76A 3QYGB 4ME7A 1X6OA 2DXBA 3HRSA 2QEXA 1QCNA 3E9GA 3I35A 1VQ4A 4HA8A 3CC4A 1N9SA 1GL5A 3PVLA 2KXDA 1YIJQ 2ECZA 1YWOA 2DNUA 2O88A 1VQLQ 1WIEA 1RADB 3ZFJA 3ZL7C 1JRIA 5D6YA 2RO0A 2M0OA 1VQ9T 2XIDA 3X24B 2OTJT 3H6ZA 1K1ZA 4PJOD 2K3YA 2NYSA 1Y96B 2A0FB 2GQIA 7AT1B 3G71A 1CSKA 3M0SA 3I55T 2P0KA 2EJFA 3PFSA 4M75C 1M2VB 1BYMA 5LJ3e 4JDSA 2FPEA 3CCMQ 2FG0A 1JEGA 4F7UB 4TVRA 2CDTA 5KYWA 2EYYA 1ZSGA 3A8OB 3DLLA 1UJYA 2OTJQ 2RM4A 3S3MA 2KY9A 3ME9A 2WSCE 5GAN7 3OMGA 3DB3A 2L5QA 4F14A 4XTVA 3QYHB 4C0ZA 1C6VX 2DVJA 4II1A 3CCEA 2F5TX 1Q7YC 4HCKA 5FU6B 2V1RA 2XDPA 4IURA 3VRYA 1GBQA 2MWOA 3OSVA 2QQRA 4M78B 2H8HA 1ZA1B 4KH0B 3FRNA 1ABOA 1PSEA 1IO6A 2LQWA 3I56Q 2QI2A 1B34B 1YNZA 3RMSA 4QKUA 2JS2A 4Q5WA 4A53A 3A8HB 1HJDA 1FWZA 4CI0C 3V8LA 3BE3A 2B86A 1PRLC 2FRWA 3O8VA 2X3XD 2CP5A 2W10A 2YSQA 3E1SA 2EKHA 4FL6A 2YRDA 3QO3A 5KYUA 4EMKA 1NJIR 3HL8A 4E7SA 1UB4A 4C92A 3M0RA 4P5NA 1MMDA 3DKMA 1N5ZA 2L8DA 1WXUA 3JCMV 2QA4T 3QDFA 4DQ2A 2MK5A 1KSWA 5A0DA 1QCOA 1WHGA 3DLMA 1Y0MA 1CKBA 1VQ6Q 2BE7D 3HRTA 4E7JA 1NE8A 4HKEA 2XU8A 3P8DA 1Q82C 1IHWA 2COYA 2YHTA 4DOVA 3FIFA 5LJ5e 1N8RC 2BZ8A 4M77G 1VQ5A 2ZPGB 3M59A 1BCMA 1WXBA 3OYDA 2HBPA 1UJ0A 4N4HA 3ASKA 1NPRA 1PD0A 3M53A 3PT9A 3CCUT 3RERA 4PJNA 2EKOA 1M5Q1 3GF5A 3GBQA 2E12A 3MP6A 3M57A 4M7AG 3C0CA 3R6OA 2RI5A 4RG8A 4CRIA 2DTHA 2E1HA 3UF4A 3PMIA 2X4XA 3CC4Q 2FB7A 3MCAB 1O75A 1I4K1 1LOJA 2MI6A 4M75F 4IIOA 2RJCA 1UEBA 4EMKC 1AWXA 9ATCB 4NL3A 1KG1A 3RKXA 1U06A 4B9XA 1BI3A 2MAMA 1JXOA 1B07A 2OTLA 3G71Q 2YLCA 3Q1JA 3HFNA 4X1VA 5GAMg 2DMOA 3QBYA 3QZ5B 4V2SA 4C5HA 2YUNA 2LCCA 3PIPA 3JSCA 4C5EA 4HT8A 1FMVA 4QW2A 2DO3A 2ATCB 1M1KU 1TTHB 4A4EA 3CCVT 2CH4W 4RUGA 1X2QA 1VQ7T 5GMKi 1KQ2A 2K3XA 4M7DG 3JCMc 4BDYA 2ZPBB 2HBWA 4VUBA 5CAIA 1D1BA 1ZA2B 4JJCA 2M1HA 3L1AA 1TSFA 2E4HA 4NL2A 4F17A 1SRMA 1B7TA 4M75E 4PJLA 2DBMA 3HP9A 1HD3A 1M30A 3CCVQ 3BDUA 1ZSZA 3G4ST 1G3WA 1OV3A 5LJ5d 1OQKA 5LJ5j 4R55A 1YP5A 3THKA 2COWA 4KGVB 2DRKA 1M4ZA 2LZ6B 4NS5A 5D6WA 2KYBA 2X9HA 2VUBA 1PSFA 1AWJA 5FRMA 1XOVA 2EFIA 4GBQA 4PJJA 3PNWC 4OMLA 1LCKA 2CP3A 3VS3A 4FW1A 3JCMJ 2CT3A 1M90R 2CZ1B 1ZLMA 3J81E 3NMZC 4JRIA 1HSQA 5DM7R 3NTHA 2RB6A 5CVIA 3UA6A 2DBKA 5FWCA 1FMKA 3P8HA 2RN8A 1H92A 2RK1A 3EGDA 1VQ5Q 4RTTA 4DBQA 1PG5B 1JJ2A 3CCST 4GLKA 4XTZA 4Z02A 4ANJA 1WX6A 4BE1A 3OA6A 2OI3A 2DXUA 1Q95G 2WSFE 3FEOA 1OYXA 2DIGA 1Q86C 4KUDK 1ZSZC 1BIAA 1YITA 2MMPA 2J7IA 4M77A 2NUTA 1I8FA 4OMNA 2AIRB 4Z89A 3HHTB 3VS6A 3NFCA 4KBMB 1ACMB 1QW1A 1U1TA 2C06A 3QDRB 3JB9H 2DEUA 1H8KA 4J9IA 3UWNA 2M0YA 1VYVA 1Q7YU 4IUTA 4OB1B 2CH4A 2M02A 4M7AA 4FYWB 2H3JA 4QVCA 1W2BA 3FLGA 3H0IA 1YJWT 4X9DA 5IXFA 1QVFA 1UE9A 5GAOm 2DYIA 3FC3A 1U8RA 2GNCA 2EYXA 2RD1A 1SHGA 3AT1B 5IHKA 3EFOB 4BACA 2KGTA 1KD1C 1T0JA 3A5ZB 3CD6A 3R6NA 1E6GA 1X6BA 5IT9E 5KCOA 3LH0A 1JU5C 3JB9F 4BE2A 1AWWA 5J26A 5CKBA 2W0ZA 2GTJA 3BY7A 3PTAA 1PKSA 4XU3A 2DKGA 2R57A 1UUEA 2KBTA 2LCSA 5GAN6 1S72T 3VYHB 2CUBA 3QZ9B 1Q82U 4JRQA 1K8AC 2J6FA 2HCKA 2V26A 2EGEA 2EQMA 1N8RU 4PJOF 3OS0A 3MEWA 4M7AC 1WGSA 2ZPEB 2LNHB 1GBRA 5CCAA 3RMQA 3M0UA 1WHJA 2RMOA 4KGXB 4A54A 1VIFA 2HL5C 3FB9A 2K5LA 3O5ZA 4C0DC 4E47A 1AWOA 2QQ9A 2E3HA 3T9NA 2MIOA 2OTJA 5L8RE 3CC7T 2KSSA 1IRXA 4O5VA 1QVGA 2ZCFB 4J7IA 2XDBA 2EPDA 3PIOA 1YJNT 1UGRB 2DTIA 3I55A 3QJ6A 2CREA 1UECA 4F7UG 4DOWA 1M1KR 1VQMT 3SEMA 2I2LA 3KXTA 1YJ9T 2RJDA 1K73C 3SWNA 2EQKA 3I56A 4C92G 3QPHA 4XU1A 3JCMX 2ED0A 1RL2A 2WSEE 2HD0A 1BU1A 3L2UA 2BKDN 2O9VA 2BZXA 2JZ2A 4M78G 5HK3A 3OYLA 1JJ2P 4EMGA 3UA7A 2V1QA 2P4RA 5FW9A 3VS7A 1QCFA 4M75B 3CQTA 2K6DA 4PJOE 1YITQ 3VRZA 4M7DC 2QQBA 1WNLA 2A37A 3RESA 1BCOA 1WHMA 4RTZA 3SHWA 5FRNA 2IG0A 4LDVA 5DLOA 1QLYA 3WVDB 1ZBXA 5FU7B 3EH2A 4LD6A 3VJPA 5L23A 5GAN4 3OW2A 5IAYA 3L2QA 3KFVA 2J05A 4L59A 2J06A 4RTVA 3LWHA 1VQ6A 2K3BA 1OPKA 3CMET 5J3BA 2MWPA 4JZ4A 4BI8B 3TSZA 4HCBA 2PZ1A 3UT1A 3G6ET 1D0XA 1VQNQ 1I07A 3CBPA 1W2BP 2KMTA 1WZOA 1YI2T 4LDXA 4E7LA 2CZ0B 1QVFP 1QP2A 2QA4A 4J9HA 3CD6Q 1GFDA 1M27C 3FJPA 2Y4YA 3OYAA 3SWNC 1WA7A 1WHHA 2NUPA 4RTYA 2GF7A 3QXEB 3VYGA 5KH6A 3G7ZA 3C4SA 5CKEA 3N5BB 1WXTA 2E41A 4O6JA 1YWPA 2AZSA 2A08A 1JQQA 5GJWB 2CUDA 3EG9A 1EZZB 2DF6A 4IUUA 2DAQA 4JLIA 5EC7A 2K7AA 2E3IA 2K5IA 4HCCA 2DXCA 5KYXB 4M7AF 4KUIA 4RG2A 1NZ9A 2RI2A 1VQ8T 1U1SA 2JTFA 2HKNA 4JJDA 2O4XB 5GANg 2GQVA 2QXFA 5GAMh 1PC0A 5D6XA 1TWBA 3OYGA 1Q7YR 3RKWA 1M1FA 2CSQA 2C0OA 1VQKT 3MKDA 4XTWA 2RI3A 4IUVA 2QTXA 4ZTJA 2KRNA 1U5SA 4HT9A 1RAIB 1VQ9Q 3L2VA 3JCMg 2CP2A 3RNJA 1T3LA 1W70A 3M9QA 3C12A 2KT1A 2Y4XA 2XICA 3I55Q 4ESRA 1QVGP 1K9MC 1JB0E 2X51A 1VQKQ 1D0YA 1Y96A 2R5AA 3VU3C 1OX9A 1RAGB 2LJ0A 2EQUA 4M7DF 1M2VA 3PMTA 2DILA 4KGZB 1SSHA 2VC8A 4A4FA 4MMKA 2EQIA 3EFRA 3CCVA 2CKKA 2E5KA 2QQAA 4F7UA 5C6SA 1VQ7A 4OF1A 4DBHA 1Q82R 3OYEA 4KH1B 4DEYA 4DA4A 2HQHA 1NBEB 2K5FA 5HY6A 1N8RR 2CGHA 1FXXA 4RKUE 3GIBA 2VWFA 4J9EA 5GMKl 2AHJB 2XKOC 1M9SA 1TXQA 2L89A 1ARKA 1G5VA 4M78A 1AHJB 4E7KA 4RMOA 3G4SA 2V8IA 2CP0A 4J9BA 3S3OA 4QVZA 3WXMB 3OS1A 4FU6A 4MZPA 4JS4A 1B34A 3OW2P 2QASA 3RR6A 3RDVA 2GCXA 2NUZA 1RLPC 3JCMW 5IXBA 1VQPT 2HDAA 2CZ6B 1K8AU 4F16A 4IUPA 1LJOA 1G3SA 1K9AA 2QA4Q 1PHTA 4AG1C 4CC3A 2JMAA 2O31A 4PKCC 5GAN8 3BW1A 3VV0A 4M77D 2KT8A 4JUVA 2F2WA 2DERA 4ZGDB 4M7DE 2DIQA 1E6HA 1RACB 1OU9A 2KNBB 2RK2A 1NJIC 2QEXT 2LDMA 4BY6B 1VQ4T 3OYHA 4B9WA 2DYBA 4KRTA 2K57A 2L3RA 1RAFB 3ZBDA 1YFNA 2VB6A 1LNXA 2LQ8A 2NLUA 5HK0A 2DXTA 2MYSA 4M7AD 3M56A 2NWMA 4OB0B 4J83A 2L3QA 3CCLT 4HVWA 3HKSA 1KK7A 1H3ZA 4PJOB 3CCSA 3LW5E 4ZGEB 3OS2A 2VXEA 4FCYA 4C92C 1I5LA 3CCUQ 3JB9I 1OZ2A 2KR3A 4DBRA 1V76A 5GAMf 3HSBA 2PUKB 1M1GA 4A4HA 3UPUA 2GFAA 2J6OA 1DJ7B 2DX1A 2XG8D 4C8QG 1SPKA 3JB9J 1GCQA 4BDZA 2B8AA 3TEEA 2X4JA 2YUQA 2LT1A 3IQLA 2DK3A 3SDZA 2Y90A 1N9RA 1UG1A 2EIFA 1D3BB 3CCQT 1KC8C 2YLBA 1UTIA 2KQWA 1M3AA 1WHKA 3EHRA 1VYUA 3EAEA 2WACA 5CKFA 1YN8A 2PU9B 1D0ZA 3NTIA 1MV3A 2EYZA 3MHXA 3HTRA 1N6AA 4ELYC 1IZ6A 4OMQA 3OBWA 2DE0X 2A7YA 5DY9A 2ZGWA 3MO8A 4C0FA 5AT1B 4M7DD 4JPBW 5A0GA 2PVOB 2K2MA 2R58A 4J6WA 2DD4A 3PVQA 1IB8A 4N0AA 1R0CB 2RH2A 1PCXA 2ENMA 4EPCA 3OQ5A 1YCSB 4FYYB 4ELZC 1IREB 1VQ7Q 1KIKA 1TUCA 2C0IA 1G83A 4LDYA 3G1JA 2ROTA 2JMCA 2VGMA 2HSEB 2CT4A 4HVVA 1XNIA 2F69A 1MMAA 2VV5A 1WPYA 4OB2B 3LGFA 1OEBA 5GAN3 3EG2A 2DL7A 2E10A 2FPDA 1S72A 1X75C 3OYYA 4D6WA 2GFUA 4KULA 1SF9A 2MF2A 3OYIA 2OX7A 3X28B 4L5GA 1MV0B 3G4SQ 4A4GA 3F70A 1VYTA 1KQSA 2K4YA 1W6XA 3BFMA 3TSWA 2JNGA 3EGUA 3LLRA 3LYIA 2D1XA 2O01E 3VS0A 5KE3A 4BB7A 4ZN3A 2L0AA 3MEAA 3EG0A 5GAOp 2NUTB 1M3BA 1JJ2S 1E7OA 1QQJA 4EDUA 3VS2A 3CC7A 4D8KA 4LUDA 1BI0A 2JOYA 3C94A 1VOMA 2C0TA 1YJNA 4A63B 3E9FA 4C92F 2AZVA 4R0KA 1QWEA 3H0FA 2FO0A 4QVDA 2JW4A 4E2FB 3J80E 2EBPA 1PKTA 2I0NA 5LJ3g 1QKWA 3GOXA 1M90C 2AKKA 2EGAA 3TQ7P 4C0DB 2EYWA 1I5OB 2BE9B 3CCSQ 5KYNA 3M5AA 3L2WA 3H0HA 2PTKA 1K9MU 1W2BS 1QMCA 1R77A 1GXIE 3URGA 2JS0A 4AG2C 1ZBJA 3HFOA 1VQNA 1QVFS 3OYNA 2QQSA 4UC4A 2AK5A 2DETA 3CMAT 3A98A 2KEAA 1M8VA 1RABB 2ROLA 5CKHA 3EFSA 3V7SA 4OP0A 1X2KA 3GPLA 2P0QA 1ZUYA 5I2MA 4DBFA 4PJMA 4GLMA 4J9DA 2LMJA 2QG9B 4FYVB 4L6V5 1K8AR 1M8MA 2HEQA 5GMKh 3LH5A 1TU0B 1GCPA 2O2OA 5CIUA 2G6FX 1YJWQ 1FX7A 3X26B 3RUXA 4FT4A 3CMEA 4C8QA 1G8XA 1ZUKA 1EFNA 2H3EB 1A0NB 1PWTA 4HCZA 5KYYB 3AHUA 4M7DB 4E7ZA 2XDDA 4XAXB 4ZNXA 4C92E 1JBMA 2L3PA 5D7UA 4M77C 1EIFA 2P4TA 5GAOn 1YHQT 3NPFA 4LNPA 3A1PA 5GANh 5CO7A 2A36A 4A4KA 3EFOA 2LQNA 1D1AA 4PL6A 4RTXA 4CC4B 3CCRT 1C1AA 4BI3A 3VS5A 3JV3A 3NTKA 1MUZA 1VUBA 1WDXA 5GANd 5GANj 5LJ5g 3JCMQ 1TS9A 2MOXA 4LDWA 3UATA 4RCCA 3OMCA 4IUQA 1NJIU 3JCMh 3JCMP 3QSUA 1D09B 3M0TA 1S72Q 1VQ9A 2LRQA 2G3RA 5IH2A 4BI4A 1N27A 2VGNA 3L42A 1Y07A 1M3CA 4XQ3A 1QVGS 2F5KA 2K2VA 2MCNA 2HQEA 1VQOT 2BZYA 3M0QA 2HZYA 2YUPA 3SB2A 2X35A 4JZ3A 2RHUA 1UHFA 3X25B 4ZN1A 3M55A 3CBOA 2ZAEA 2CSIA 2RQRA 4C8QC 1VQKA 1HK9A 1IGQA 1NLPC 1WI7A 1X27A 1KQSP 1OOTA 2CS7A 3WVEB 4X9CA 3E2UA 2ED1A 1SEMA 2QK0A 3OYMA 3CC7Q
chains in the Genus database with same CATH topology
4B9XA 4E7HA 1BI3A 3M9QA 4M75G 2MAMA 5GAMe 3C12A 2OTLT 4C92D 2VYTA 2DJZA 2Y4XA 2OTLA 1I81A 2YLCA 3Q1JA 2XICA 3OY9A 3CPWA 4JS5A 3HFNA 3TCJA 2XI9A 4BUGA 5GAMg 5FROA 1H641 2CZ7B 3ER0A 2EJGA 3QBYA 4M75D 5GAOl 3QZ5B 2JTMA 1K9MC 4C5HA 4V2SA 1JB0E 4M78D 3C95A 1KC8U 1MGQA 3E19A 2LCCA 3PIPA 1TH7A 4R56A 1NPPA 3JSCA 1Y96A 4C8QB 3VUBA 2V8JA 4C5EA 2R5AA 2X4YA 3VU3C 4HT8A 4QW2A 2DO3A 2EQUA 4MZMA 4M7DF 5CR2A 2LVMA 3PMTA 1M1KU 3CD6T 2D6FA 2VC8A 4A4FA 4A4EA 4FIBA 4MMKA 3EFRA 3CCVT 2E70A 3CCVA 3MP8A 2CKKA 3HRUA 4J8OA 3OW2S 2FYKA 2QQAA 1M1KC 4FT2A 4F7UA 5C6SA 5GMKi 4F7UE 2K3XA 2BUDA 3CXCA 1VQ7T 4ZGJB 1VQ7A 1KQ2A 4OF1A 3VKIA 4M7DG 2PVGB 3JCMc 4BDYA 2ZPBB 4VUBA 2LQKA 4LDUA 4OVAA 5CAIA 3OYEA 5CQYA 4QQGA 4OMFB 4DA4A 3JAME 3G6EA 3M4GA 5HY6A 2K5FA 4X34A 4JRPA 4XK8E 2CGHA 1FXXA 2PQWA 2M1HA 1BKBA 2R5MA 2PVDB 3L1AA 4RKUE 3GIBA 1YI2A 5GMKj 5GMKl 3CC2T 2EYQA 3CC2A 1VIEA 2AHJB 2XKOC 2LTOA 1M9SA 1X01A 4NL2A 2L89A 4M75A 1G5VA 1WJQA 4M75E 3HP9A 1W4SA 4M78A 1AHJB 3BDUA 2EAYA 3QIIA 3QJYA 4M78E 3RKYA 4MMLA 3G4ST 4E7KA 4RMOA 3G4SA 1G3WA 5LJ5d 5LJ5j 4R55A 2V8IA 3S3OA 4QVZA 5GAN5 4M77F 3WXMB 1ZQ1A 2ZPIB 3CPFA 3JB9G 1BIBA 4FU6A 2ZZDA 4MZPA 1B34A 1UGPB 3V8JA 2X4WA 3OS1A 4JS4A 1M4ZA 4NS5A 5D6WA 4LD9K 5LJ5f 4PLLA 2VUBA 1YIJT 2GCXA 1YIJA 1PSFA 1VQLT 2M16A 3JCMW 1VQLA 4QQDA 1VQPT 5FRMA 1WQ7A 4RCBA 1VQPA 2CZ6B 1XOVA 2EFIA 5CKDA 1K8AU 3A8GB 3GNGA 4IUPA 1G3TA 4GY5A 4C5GA 1LJOA 1G3SA 3PNWC 4YTLA 3CCJT 4PKCC 3CCJA 5GAN8 3JCMJ 3OBYA 3BW1A 3VV0A 4M77D 5GANf 4JUVA 2CZ1B 1VQ8A 4ZGDB 4M7DA 3J81E 4M7DE 3CCUA 4JRIA 2DIQA 3SWNB 3QHSA 5EG2A 1NJIC 2RK2A 2QEXT 3QKJA 4XU0A 2LDMA 4BY6B 3BDLA 3NTHA 4PNOA 5DM7R 5IN1A 3S3NA 1VQ4T 3OYHA 1WQWA 2RB6A 5CVIA 4B9WA 2K57A 1OI1A 2L3RA 3GNFB 3ZBDA 3CCMT 3CCMA 3MP1A 3P8HA 3JCMd 5M9OA 5GAOq 1LNXA 2LQ8A 2NLUA 4PJOG 5HK0A 2DXTA 2RK1A 3QUIA 2RHYA 3L2RA 3M56A 4M7AD 3V8KA 4OB0B 4J83A 3CCLT 3CCLA 3HKSA 1BI2A 3JCMf 4J7FA 1H3ZA 1JJ2A 4PJOB 3CCST 3CCSA 4GLKA 4XTZA 4Z02A 5GAMd 2HQXA 3LW5E 4ZGEB 5GAMj 2VXEA 3OS2A 4C92C 3GP8A 1Q81C 1I5LA 4C8QF 3JB9I 1OZ2A 1Q86U 4EMHA 4BE1A 3QG1A 1P92A 1O9SA 3OA6A 2DXUA 2WSFE 2JUFA 5GAMf 3HSBA 2PUKB 3FEOA 1OYXA 1M1GA 4A4HA 3OYFA 2GFAA 2DIGA 4JLGA 4MZTA 3JCMb 3UPUA 3LX7A 1Q86C 4KUDK 1YITT 2PUOB 1YITA 1BIAA 3LGLA 3CPWS 1DJ7B 1UGQB 2MMPA 1M90U 2XG8D 4M77A 4C8QG 4M77E 3DB4A 1I8FA 3VUZA 3JB9J 3HHTB 5AYFA 5GAN2 4BDZA 4BE0A 3OYCA 2O4XA 3I56T 2B8AA 3NFCA 3TEEA 2X4JA 2LT1A 4KBMB 2DK3A 3SDZA 1KHCA 1QW1A 2Y90A 1N9RA 2OAUA 1U1TA 2C06A 2EIFA 1D3BB 1SSFA 3QDRB 5FU7C 2XD0A 3JB9H 3CCQT 4EMKB 3GLXA 1KC8C 3CCQA 2YLBA 1QP3A 3UWNA 4JJNK 4C92B 2KQWA 1Q7YU 4NOYA 4IUTA 1YCYA 4OB1B 2E5QA 4M7AA 5A2QE 2H3JA 4M7AE 4QVCA 2RA2A 1WJRA 3FLGA 1YJWT 4JRKA 1W2BA 2HAXA 3EAEA 2WACA 2KVQG 5CKFA 3CXCS 4X9DA 3CEYA 1VQNT 2PU9B 3NTIA 1QVFA 5GAOm 3MHXA 3FC3A 2A3LA 1N6AA 3OB9A 1U8RA 1KD1U 3V7CA 1OZ3A 5KE2A 2RD1A 1HXDA 2KAFA 4ELYC 1IZ6A 2D9TA 4J6YA 3SFMA 4PLIA 3OBWA 4BACA 2D0QB 3S6WA 2VXFA 5I2SA 2A7YA 5DY9A 2ZGWA 3A5ZB 3H8ZA 3MO8A 4C0FA 3MEUA 1KD1C 3ZEHA 4IKFA 3CD6A 4M7DD 5A0GA 2LCLA 2PVOB 5IT9E 2R58A 4J6WA 3J7AF 2DD4A 5KCOA 3LH0A 3JB9F 2RJFA 4BE2A 4N0AA 5J26A 5HKCA 1VQ6T 1QVPA 3KUFA 1RI0A 5CKBA 2LX9A 2RH2A 3BY7A 2LC4A 3OQ5A 4EPCA 3OYBA 2RHIA 2E65A 3META 3PTAA 4C8QE 4ELZC 1IREB 2QDYB 1KQ1A 4XTUA 4Y91A 2YRVA 4LDYA 2FVUA 3CBMA 2VGMA 4XU3A 2DKGA 3INZA 2R57A 2DZ9A 3A8LB 1XNIA 2F69A 4OGCA 2LT4A 2VV5A 3V7RA 5DLQE 5I21A 3JB9D 1WPYA 5GMKm 2RHXA 5GAN6 4OB2B 3LGFA 5GAN3 3P8BB 1S72T 2E10A 3VYHB 1S72A 1X75C 3OYYA 3QZ9B 4D6WA 1Q82U 4JRQA 2GFUA 3M4YA 1K8AC 4KULA 3MEVA 2MF2A 3OSSC 3OYIA 2EQMA 4N4GA 3JRZA 3SD4A 3X28B 4ME7A 3QYGB 4L5GA 4PJOF 1N8RU 4FSXA 1X6OA 4A4GA 1KHIA 2DXBA 3HRSA 1R8OB 3M58A 4KT0E 3OS0A 2ZPHB 2QEXA 3F70A 3E9GA 3MEWA 1WJSA 1VQ4A 1WGSA 4HA8A 3OYJA 3CC4T 1KQSA 3CC4A 2K4YA 2ZPEB 4M7AC 3BFMA 4XTYA 1N9SA 1BI1A 2V8KA 5CCAA 3RMQA 2JNGA 3LLRA 2FHDA 5LJ3h 3LYIA 2O01E 5KCHA 1XTDA 5KE3A 4BB7A 4ZN3A 4A54A 3ZFJA 3PGGA 1JRIA 5D6YA 3MEAA 4BD3A 1VIFA 2RO0A 3FB9A 2K5LA 4E47A 2M0OA 4C0DC 5GAOp 1V29B 2QQ9A 2XIDA 1VQ9T 3T9NA 3X24B 2OTJT 3H6ZA 1JJ2S 2OTJA 4PJOD 5L8RE 4EDUA 2KSSA 3CC7T 3CC7A 4ZTFA 4O5VA 2K3YA 5LJ3d 2ZCFB 5LJ3j 4J7IA 1QVGA 1Y96B 2XDBA 1BI0A 3G71T 3G71A 2JOYA 3PIOA 3KBGA 3C94A 3I55T 1YJNT 1UGRB 2DTIA 5C0MA 2P0KA 3QJ6A 3I55A 1YJNA 1G3YA 5FU6C 4F7UG 2EJFA 3E9FA 3PFSA 4M75C 4XU2A 4C92F 4DOWA 2RHZA 1BYMA 4M78C 1VQMT 1K73U 5LJ3e 2I2LA 4QVDA 2M9UA 4JDSA 3KXTA 2EQJA 5CK9A 5J39A 2P0PA 3J80E 4F7UB 2RJDA 4OGEA 1YJ9T 1K73C 1UGSB 3SWNA 4TVRA 3A8MB 2EQKA 5LJ3g 5CQXA 3GOXA 1M90C 3A8OB 1ZHIA 4C92G 3I56A 3DLLA 4C0DB 2RJEA 4C8QD 3QPHA 2RM4A 4XU1A 2KY9A 4Y28E 3JCMX 3S3MA 1RL2A 1MHNA 2WSCE 3ME9A 2JN0A 5GAN7 3OMGA 3DB3A 2L5QA 2HD0A 2WSEE 3M5AA 3L2UA 3L2WA 2BKDN 3OYLA 2JZ2A 4M78G 4QQ6A 5HK3A 4XTVA 3QYHB 4C0ZA 4EMGA 1K9MU 3CCET 4II1A 3CCEA 3M54A 1W2BS 1GXIE 3URGA 1YJWA 4XTXA 2F5TX 1Q7YC 5FU6B 2XDPA 4IURA 4M75B 3HFOA 4PJOA 2MWOA 4PJOE 3X20B 3OSVA 2QQRA 4M78B 1VQNA 4M7DC 1QVFS 2QQBA 2HNIA 3OYNA 2QQSA 1WNLA 4UC4A 3FRNA 3RESA 1PSEA 3CMAT 4OB3B 3CMAA 1M8VA 5CKHA 3V7SA 3EFSA 4E7IA 4OP0A 2QI2A 5FRNA 2IG0A 3LWIA 1B34B 3GPLA 2P0QA 3RMSA 5I2MA 4Q5WA 4A53A 4J5YA 4LDVA 5DLOA 3WVDB 3A8HB 1ZBXA 2IVWA 5FU7B 4LD6A 1FWZA 3VJPA 4MDWA 4CI0C 5GAN4 1YBYA 5IAYA 3OW2A 3HPWA 3L2QA 4L6V5 1Y7XA 3V8LA 2E6NA 4L59A 5GMKh 3LWHA 1VQ6A 2DVEA 3O8VA 5CIUA 1FX7A 5J3BA 3X26B 3CMET 3RUXA 2MWPA 4FT4A 3CMEA 3E1SA 4C8QA 4BI8B 3FDRA 1D3BA 4FL6A 4HCBA 3G6ET 3UT1A 3QO3A 4HCZA 4EMKA 2DD5A 3AHUA 3CBPA 3HL8A 4M7DB 2KMTA 1UB4A 2E6ZA 4NL3A 2XDDA 5LJ5h 4C92A 4MDXA 4XAXB 4C92E 2KDSA 4P5NA 1YI2T 2LNVA 4LDXA 4E7LA 3DKMA 1JBMA 3JCMV 2L8DA 2XHCA 2QA4T 2CZ0B 1QP2A 2QA4A 4DQ2A 3OS5A 4M77C 3FJPA 2Y4YA 2EWNA 1EIFA 5A0DA 2P4TA 3OYAA 3SWNC 5GAOn 5GMKe 2GF7A 3DLMA 1YHQT 1YHQA 3QXEB 3VYGA 4BY6C 4J6XA 4C5IA 5GANh 5CO7A 3HRTA 5KH6A 4E7JA 1NE8A 3C4SA 3G7ZA 5CKEA 4HKEA 4A4KA 2XU8A 3N5BB 3P8DA 2XK0A 1Q82C 2E41A 4PL6A 2YHTA 2DZCA 4O6JA 4DOVA 5LL6S 2CYZB 3FIFA 2JVVA 4ATOA 3CCRT 5LJ5e 3CCRA 2DEQA 4BI3A 1N8RC 3NTKA 1VUBA 1KQSS 1VQ5T 2EJ9A 4M77G 1VQ5A 4IUUA 4WF2A 2DAQA 4JLIA 5GANd 2ZPGB 3M59A 5LJ5g 3JCMQ 5GAOr 5GANj 4LDWA 3TREA 2K5IA 4RCCA 4PJOC 4HCCA 2DXCA 3OYDA 4M7AF 2E64A 2HBPA 4N4HA 4KUIA 4RG2A 3ASKA 3OMCA 1NPRA 4IUQA 1NJIU 1NZ9A 4M77B 2RI2A 3M53A 3JCMh 3JCMP 1VQ8T 5A0LA 3QSUA 2DPPB 3PT9A 3RIRA 1U1SA 2JTFA 4F7UF 5GANe 3CCUT 1VQ9A 3RERA 2LRQA 2G3RA 2EKOA 4BI4A 1N27A 1M5Q1 2O4XB 3GF5A 3MP6A 2E12A 2VGNA 3L42A 3UDCA 1Y07A 3M57A 1Y71A 4XQ3A 5GANg 1QVGS 4M7AG 2F5KA 2GQVA 3OYKA 2K2VA 2QXFA 5FLXE 5GAMh 3R6OA 2BIVA 2RI5A 2ZPFB 2HQEA 5D6XA 1VQOT 4RG8A 4CRIA 1VQOA 4N0AC 2DTHA 2E1HA 3SB2A 2X35A 3PMIA 5LJ3f 2X4XA 3RKWA 2RHUA 3OYGA 1M1FA 4M7AB 2FB7A 3X25B 4C0GA 3M55A 3CBOA 4ZN1A 3MCAB 1VQMA 2KK4A 1Q81U 1O75A 1I4K1 1LOJA 2FL7A 4C8QC 1VQKT 1VQKA 3TU4K 1HK9A 2MI6A 4M75F 4XTWA 2RJCA 2RI3A 1UEBA 2DTOA 4IUVA 4EMKC 2QTXA 4N4IA 2CS7A 4M78F 3WVEB 3JCMe 1YJ9A 4X9CA 4ZTJA 4HT9A 1KG1A 3L2VA 3OYMA 1XQHA 3JCMg 3RKXA 4FM4B 3L2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9X A;  4E7H A;  4Q5W A;  3M9Q A;  1OI1 A;  2L3R A;  3MP1 A;  2VYT A;  3P8H A;  2RHX A;  5M9O A;  2NLU A;  4LD6 A;  3Q1J A;  3LGF A;  3OY9 A;  5IAY A;  3L2Q A;  2RHY A;  2E6N A;  3L2R A;  4L59 A;  5FRO A;  2GFU A;  3O8V A;  3QBY A;  5CIU A;  3MEV A;  4C5H A;  5FRM A;  2MWP A;  1H3Z A;  3OYI A;  2EQM A;  3FDR A;  2LCC A;  4N4G A;  4FL6 A;  3SD4 A;  3UT1 A;  4Z02 A;  4HCZ A;  2HQX A;  4C5E A;  3OS2 A;  2R5A A;  2X4Y A;  4A4G A;  4QW2 A;  2EQU A;  3OS0 A;  1OZ2 A;  3F70 A;  3E9G A;  3MEW A;  4BE1 A;  1WJS A;  4E7L A;  1WGS A;  3OYJ A;  3OA6 A;  2LVM A;  2L8D A;  3PMT A;  3FEO A;  4A4F A;  1OYX A;  4A4E A;  4A4H A;  3OYF A;  2GFA A;  2DIG A;  3LLR A;  2FHD A;  3LX7 A;  2CKK A;  3MP8 A;  3LYI A;  3LGL A;  5KCH A;  5C6S A;  2K3X A;  2BUD A;  3OYA A;  5KE3 A;  3DB4 A;  4BD3 A;  5D6Y A;  3MEA A;  2GF7 A;  2RO0 A;  3DLM A;  4BDZ A;  2M0O A;  4BE0 A;  4BDY A;  4C5I A;  3OYC A;  2O4X A;  2B8A A;  5KH6 A;  3H6Z A;  4E7J A;  3C4S A;  4OVA A;  3OYE A;  4EDU A;  1KHC A;  3P8D A;  2XK0 A;  4QQG A;  4ZTF A;  4PL6 A;  2K3Y A;  1SSF A;  4X34 A;  2PQW A;  2M1H A;  2R5M A;  3UWN A;  3NTK A;  5C0M A;  2P0K A;  3QJ6 A;  4IUT A;  2E5Q A;  3E9F A;  3PFS A;  4IUU A;  2DAQ A;  2LTO A;  2RHZ A;  1WJR A;  2L89 A;  3FLG A;  1G5V A;  1WJQ A;  3EAE A;  2WAC A;  3OYD A;  2EQJ A;  3QII A;  5J39 A;  4N4H A;  3CEY A;  4RG2 A;  3ASK A;  3OMC A;  4E7K A;  4IUQ A;  3NTI A;  2RJD A;  2RI2 A;  2EQK A;  3S3O A;  3FC3 A;  4QVZ A;  2JTF A;  3OB9 A;  3GOX A;  5KE2 A;  1OZ3 A;  2LRQ A;  2G3R A;  2EKO A;  1N27 A;  2D9T A;  4FU6 A;  3OS1 A;  2O4X B;  4PLI A;  2X4W A;  3MP6 A;  2RJE A;  4BAC A;  4NS5 A;  3L42 A;  5D6W A;  3S6W A;  3S3M A;  4PLL A;  3MO8 A;  3H8Z A;  1MHN A;  2F5K A;  3ME9 A;  3MEU A;  3ZEH A;  4IKF A;  3OYK A;  3OMG A;  2M16 A;  3DB3 A;  2R58 A;  4QQD A;  3L2U A;  3L2W A;  2BIV A;  2BKD N;  2RI5 A;  2HQE A;  2JZ2 A;  5D6X A;  4QQ6 A;  3LH0 A;  2EFI A;  4CRI A;  5KCO A;  3OYL A;  2RJF A;  4BE2 A;  4II1 A;  2X35 A;  3PMI A;  3OYG A;  2X4X A;  4IUP A;  2RHU A;  4GY5 A;  5J26 A;  4C5G A;  3PNW C;  3KUF A;  1RI0 A;  2XDP A;  4IUR A;  2MWO A;  2QQR A;  3OQ5 A;  3OYB A;  2RHI A;  2RJC A;  3MET A;  2RI3 A;  4IUV A;  3OYN A;  2QQS A;  4N4I A;  4UC4 A;  4ZTJ A;  2YRV A;  2DIQ A;  3L2V A;  3QKJ A;  3OYM A;  2LDM A;  4E7I A;  3BDL A;  3NTH A;  3S3N A;  2R57 A;  5IN1 A;  2IG0 A;  5FRN A;  3OYH A;  1XNI A;  4B9W A; 
#chains in the Genus database with same CATH topology
 1AT1 B;  2OAW A;  5GAM e;  4C92 D;  1I81 A;  3OY9 A;  3CPW A;  4JS5 A;  1YJN Q;  3TCJ A;  2XI9 A;  1RAE B;  2HSP A;  4BUG A;  4DEX A;  4FSS A;  4J9F A;  1H64 1;  2CZ7 B;  2FZK B;  3ER0 A;  3NHN A;  5GAO l;  2JTM A;  1VQM Q;  3EGX B;  4M78 D;  1KC8 U;  1C0M A;  4R56 A;  3VUB A;  2L3S A;  2V8J A;  2J6K A;  2JXB A;  1YJ9 Q;  3EG1 A;  4D8D A;  4MZM A;  2DL8 A;  1UGV A;  2LVM A;  2D6F A;  4FIB A;  2E70 A;  3OW2 S;  2FYK A;  1M1K C;  4FT2 A;  3CXC A;  2BUD A;  1AVZ C;  5IHN A;  2KRS A;  5GJV B;  5CQY A;  1KJW A;  4AFS C;  2EW3 A;  1HYO A;  3M4G A;  4JRP A;  4XK8 E;  1BKB A;  2R5M A;  1JO8 A;  2PVD B;  1LPL A;  2O9S A;  2IPO B;  3CC2 T;  1G2B A;  1VIE A;  2DL5 A;  2LTO A;  1BBZ A;  4M75 A;  1WJQ A;  1W4S A;  3QII A;  2FRY A;  3RKY A;  1MND A;  2VAS A;  4MML A;  1AZE A;  5GAN 5;  4M77 F;  1ZQ1 A;  2FPF A;  3JB9 G;  3V8J A;  4LE9 A;  4AFU C;  4IIM A;  3CME Q;  1YIJ T;  3G6E Q;  1VQL T;  2HL3 A;  4QQD A;  1K0X A;  4RCB A;  1VQP A;  1X69 A;  2YUO A;  3GNG A;  4FW2 A;  1YI2 Q;  1G3T A;  4GY5 A;  1M2O A;  4YTL A;  3CCJ T;  1QKX A;  2YT6 A;  5GAN f;  3PE0 A;  1OX8 A;  1Y57 A;  3CCU A;  2JM8 A;  4Z88 A;  3QHS A;  2F1L A;  5EG2 A;  5KYW B;  3I9Q A;  3QKJ A;  4XU0 A;  3BDL A;  1SRL A;  2QYZ A;  1OU8 A;  3CCM T;  2RQV A;  4PJO G;  1X6G A;  1RUW A;  4HXJ A;  3QUI A;  4CC7 A;  2RHY A;  3L2R A;  3V8K A;  1K9M R;  3CCL A;  2QTV A;  3JCM f;  3CCJ Q;  1PNJ A;  5GAM d;  3GP8 A;  5GAM j;  1Q81 C;  3I5R A;  4OMP A;  4C8Q F;  1VQ8 Q;  5I22 A;  4EMH A;  3I5S A;  1Q86 U;  3QG1 A;  1P92 A;  1O9S A;  2DRM A;  4JLG A;  5KYX A;  2YWW A;  2PUO B;  1UGQ B;  1M90 U;  4OMO A;  4M77 E;  3DB4 A;  2AT1 B;  1U3O A;  5AYF A;  3OYC A;  2O4X A;  3I56 T;  1KHC A;  2OAU A;  4HVU A;  1SSF A;  5FWB A;  5FU7 C;  5KYU B;  4EMK B;  3GLX A;  3CCQ A;  1RLQ C;  1H3H A;  4C92 B;  1YCY A;  5A2Q E;  4M7A E;  2RA2 A;  1WJR A;  1B3Q A;  1XJW B;  2KVQ G;  4PK4 A;  1AZG B;  2A3L A;  1KD1 U;  3OB9 A;  3V7C A;  1OZ3 A;  5KE2 A;  1HXD A;  2KRO A;  4J6Y A;  4PLI A;  1TOV A;  2RQW A;  3CPW P;  3S6W A;  2VXF A;  3H8Z A;  3MEU A;  4IKF A;  8ATC B;  2LCL A;  4M4Z A;  2D8J A;  5I11 A;  2RJF A;  1SKU B;  4FYX B;  5HKC A;  1VQ6 T;  3KUF A;  1RI0 A;  4WTO B;  2LC4 A;  2RHI A;  4C8Q E;  1NG2 A;  1KQ1 A;  2QDY B;  4XTU A;  4Y91 A;  2YRV A;  1Z9Q A;  1F1B B;  1I1J A;  2FVU A;  4AFQ C;  3INZ A;  3A8L B;  3CXC P;  1AEY A;  3TVT A;  1NYG A;  1TUG B;  3V7R A;  2M51 A;  2LJ1 A;  3P8B B;  2DL4 A;  3EH1 A;  3M4Y A;  4RTU A;  1LVK A;  1FMW A;  4JJB A;  1AOJ A;  3SD4 A;  2X3W D;  4FSX A;  1KHI A;  1EX4 A;  2EVR A;  1R8O B;  1S1N A;  3M58 A;  4KT0 E;  2ZPH B;  5HCK A;  1SHF A;  1WJS A;  3OYJ A;  3CC4 T;  1TUD A;  4XTY A;  1BI1 A;  2V8K A;  1GRI A;  2YRC A;  2FHD A;  5LJ3 h;  5KCH A;  1VQP Q;  1XTD A;  1ABQ A;  4BD3 A;  3PGG A;  3H9N A;  1V29 B;  2K79 A;  4ZTF A;  2QAZ A;  1BK2 A;  1KC8 R;  5LJ3 d;  4LN2 A;  5LJ3 j;  4OMM A;  3G71 T;  3KBG A;  5C0M A;  2QEX Q;  1G3Y A;  5FU6 C;  3FJ5 A;  4XU2 A;  3EG3 A;  1VQ4 Q;  2RHZ A;  1WYX A;  4M78 C;  1K73 U;  2M9U A;  2F2V A;  2EQJ A;  2Z0W A;  5CK9 A;  5J39 A;  2P0P A;  4OGE A;  1UGS B;  3A8M B;  5CQX A;  1ZHI A;  3CCL Q;  2ESW A;  2RJE A;  1UDL A;  4C8Q D;  4Y28 E;  1MHN A;  1MMG A;  1WHL A;  2VKN A;  2JN0 A;  2VVK A;  6AT1 B;  4WCI A;  4QQ6 A;  3MJX A;  2KE9 A;  4LUE A;  3CCE T;  4F04 B;  3M54 A;  1YJW A;  4XTX A;  2QGF B;  4PJO A;  3X20 B;  1ZUU A;  2HNI A;  1ZSZ B;  1T0H A;  2DA9 A;  4OB3 B;  3CMA A;  2LP5 A;  4E7I A;  3LWI A;  1MNE A;  4J5Y A;  3CCQ Q;  1R0B G;  2IVW A;  4MDW A;  1YBY A;  3HPW A;  1Y7X A;  2E6N A;  4B6M A;  2DVE A;  2RPN A;  3CCE Q;  2DLP A;  3FDR A;  1D3B A;  1VA7 A;  3H41 A;  2JT4 A;  2DD5 A;  2E6Z A;  5LJ5 h;  4MDX A;  2LX7 A;  2P84 A;  1PM3 A;  2KDS A;  2LNV A;  2CP6 A;  3NGP A;  2XHC A;  3OS5 A;  2HMA A;  2EWN A;  1GCQ C;  1CKA A;  2XMF A;  5GMK e;  1NEB A;  3EGD B;  4Y92 A;  1YHQ A;  4BY6 C;  4J6X A;  4C5I A;  3ULR B;  2XK0 A;  4J9G A;  2DZC A;  2A28 A;  5LL6 S;  2CYZ B;  2JVV A;  4ATO A;  2BTT A;  3CCR A;  2DEQ A;  3RBB B;  1KQS S;  1VQ5 T;  2EJ9 A;  4WF2 A;  1Q86 R;  5GAO r;  2IIM A;  3TRE A;  4PJO C;  2JTE A;  2E64 A;  4M77 B;  5A0L A;  2DPP B;  2JJ9 A;  3RIR A;  4F7U F;  5GAN e;  2RQT A;  2L2P A;  1NEG A;  4LXC A;  2RF0 A;  3UDC A;  2FZG B;  1Y71 A;  1X43 A;  3OYK A;  5FLX E;  1RAA B;  1UFF A;  2BIV A;  2ZPF B;  4EIK A;  1VQO A;  4N0A C;  5LJ3 f;  5ECA A;  4M7A B;  4C0G A;  1VQM A;  2ABL A;  2KK4 A;  1Q81 U;  2FL7 A;  3M0P A;  3TU4 K;  3QWY A;  2DTO A;  3JCM e;  1YJ9 A;  4N4I A;  4M78 F;  1IXD A;  1KD1 R;  1PRM C;  1XQH A;  1WFW A;  4FM4 B;  3L2Z A;  4E7H A;  1ZX6 A;  4M75 G;  3MPU B;  2OTL T;  2VYT A;  2DJZ A;  1J3T A;  1RI9 A;  5FRO A;  4M75 D;  2EJG A;  3U23 A;  3C95 A;  1MGQ A;  3E19 A;  1TH7 A;  3VS1 A;  1NPP A;  2EGC A;  4C8Q B;  1NM7 A;  2X4Y A;  2MPX C;  5CR2 A;  1MMN A;  1D1C A;  1PD1 A;  3MP8 A;  3HRU A;  4J8O A;  2OTL Q;  1BB9 A;  4F7U E;  4ZGJ B;  1Z9Z A;  2SRC A;  3VKI A;  2PVG B;  2LQK A;  4LDU A;  4OVA A;  1TG0 A;  4QQG A;  4OMF B;  3JAM E;  3G6E A;  4X34 A;  1OPL A;  2PQW A;  3CMA Q;  1YI2 A;  5GMK j;  2EYQ A;  3CC2 A;  1K4U S;  2DL3 A;  2HKQ B;  4K11 A;  1X01 A;  2FEI A;  2D0N A;  4J9C A;  2EAY A;  3QJY A;  4M78 E;  5IHI A;  1QWF A;  2LJ3 A;  2ZPI B;  1NYF A;  1W1F A;  3CPF A;  1BIB A;  2ZZD A;  2AKL A;  1UGP B;  2X4W A;  4LD9 K;  5LJ5 f;  4PLL A;  1SG5 A;  1YIJ A;  2DM1 A;  4AFZ C;  2KYM A;  2COZ A;  2M16 A;  1VQL A;  1WQ7 A;  5CKD A;  3A8G B;  1WLP B;  4C5G A;  2JM9 A;  2KXC A;  3CCJ A;  1K73 R;  3OBY A;  5KYY A;  2CP7 A;  1VQ8 A;  3EHQ A;  4M7D A;  2KRM A;  3D7S B;  3SWN B;  1YHQ Q;  2F2X A;  2GTO A;  3S3N A;  4PNO A;  5IN1 A;  1RAH B;  1WQW A;  4PFO A;  1FYN A;  4ORZ A;  1OI1 A;  3GNF B;  1IGU A;  2YDL A;  3CCM A;  3MP1 A;  3JCM d;  5M9O A;  5GAO q;  3CCR Q;  2RNA A;  2QGG A;  1K0S A;  1BI2 A;  1IHV A;  2DJQ A;  4RTW A;  4J7F A;  2HQX A;  2OJ2 A;  3VS4 A;  1NLO C;  4Z8A A;  2FZC B;  2JUF A;  4PFP A;  2SEM A;  3OYF A;  2QDL A;  4E6R A;  4MZT A;  1T3S A;  3JCM b;  3LX7 A;  1YIT T;  3LGL A;  3CPW S;  1JXM A;  1VQO Q;  1I0C A;  2YXY A;  3VUZ A;  4BE0 A;  5GAN 2;  4QT7 A;  2D8H A;  2XD0 A;  2GBQ A;  4PFZ A;  1QP3 A;  4JJN K;  4NOY A;  2E5Q A;  2HAX A;  4JRK A;  2KI7 A;  3CXC S;  3CEY A;  1VQN T;  2PNI A;  2DFU A;  2NUP B;  2KAF A;  2D9T A;  3SFM A;  1V1C A;  2D0Q B;  3CD6 T;  5I2S A;  3ZEH A;  3J7A F;  3EG9 B;  2K9G A;  1OUL A;  1AD5 A;  1QVP A;  3REB B;  3EGX A;  2LX9 A;  3QWX X;  3OYB A;  2E65 A;  3MET A;  3REA B;  2RQU A;  1GFC A;  3CBM A;  2DZ9 A;  4AMC A;  1KFZ A;  2GGR A;  4OGC A;  2LT4 A;  5DLQ E;  5I21 A;  3JB9 D;  5GMK m;  2RHX A;  4CC2 A;  3CC2 Q;  1UHC A;  4AT1 B;  3MEV A;  3OSS C;  8AT1 B;  4N4G A;  1Q81 R;  3JRZ A;  1K76 A;  3QYG B;  4ME7 A;  1X6O A;  2DXB A;  3HRS A;  2QEX A;  1QCN A;  3E9G A;  3I35 A;  1VQ4 A;  4HA8 A;  3CC4 A;  1N9S A;  1GL5 A;  3PVL A;  2KXD A;  1YIJ Q;  2ECZ A;  1YWO A;  2DNU A;  2O88 A;  1VQL Q;  1WIE A;  1RAD B;  3ZFJ A;  3ZL7 C;  1JRI A;  5D6Y A;  2RO0 A;  2M0O A;  1VQ9 T;  2XID A;  3X24 B;  2OTJ T;  3H6Z A;  1K1Z A;  4PJO D;  2K3Y A;  2NYS A;  1Y96 B;  2A0F B;  2GQI A;  7AT1 B;  3G71 A;  1CSK A;  3M0S A;  3I55 T;  2P0K A;  2EJF A;  3PFS A;  4M75 C;  1M2V B;  1BYM A;  5LJ3 e;  4JDS A;  2FPE A;  3CCM Q;  2FG0 A;  1JEG A;  4F7U B;  4TVR A;  2CDT A;  5KYW A;  2EYY A;  1ZSG A;  3A8O B;  3DLL A;  1UJY A;  2OTJ Q;  2RM4 A;  3S3M A;  2KY9 A;  3ME9 A;  2WSC E;  5GAN 7;  3OMG A;  3DB3 A;  2L5Q A;  4F14 A;  4XTV A;  3QYH B;  4C0Z A;  1C6V X;  2DVJ A;  4II1 A;  3CCE A;  2F5T X;  1Q7Y C;  4HCK A;  5FU6 B;  2V1R A;  2XDP A;  4IUR A;  3VRY A;  1GBQ A;  2MWO A;  3OSV A;  2QQR A;  4M78 B;  2H8H A;  1ZA1 B;  4KH0 B;  3FRN A;  1ABO A;  1PSE A;  1IO6 A;  2LQW A;  3I56 Q;  2QI2 A;  1B34 B;  1YNZ A;  3RMS A;  4QKU A;  2JS2 A;  4Q5W A;  4A53 A;  3A8H B;  1HJD A;  1FWZ A;  4CI0 C;  3V8L A;  3BE3 A;  2B86 A;  1PRL C;  2FRW A;  3O8V A;  2X3X D;  2CP5 A;  2W10 A;  2YSQ A;  3E1S A;  2EKH A;  4FL6 A;  2YRD A;  3QO3 A;  5KYU A;  4EMK A;  1NJI R;  3HL8 A;  4E7S A;  1UB4 A;  4C92 A;  3M0R A;  4P5N A;  1MMD A;  3DKM A;  1N5Z A;  2L8D A;  1WXU A;  3JCM V;  2QA4 T;  3QDF A;  4DQ2 A;  2MK5 A;  1KSW A;  5A0D A;  1QCO A;  1WHG A;  3DLM A;  1Y0M A;  1CKB A;  1VQ6 Q;  2BE7 D;  3HRT A;  4E7J A;  1NE8 A;  4HKE A;  2XU8 A;  3P8D A;  1Q82 C;  1IHW A;  2COY A;  2YHT A;  4DOV A;  3FIF A;  5LJ5 e;  1N8R C;  2BZ8 A;  4M77 G;  1VQ5 A;  2ZPG B;  3M59 A;  1BCM A;  1WXB A;  3OYD A;  2HBP A;  1UJ0 A;  4N4H A;  3ASK A;  1NPR A;  1PD0 A;  3M53 A;  3PT9 A;  3CCU T;  3RER A;  4PJN A;  2EKO A;  1M5Q 1;  3GF5 A;  3GBQ A;  2E12 A;  3MP6 A;  3M57 A;  4M7A G;  3C0C A;  3R6O A;  2RI5 A;  4RG8 A;  4CRI A;  2DTH A;  2E1H A;  3UF4 A;  3PMI A;  2X4X A;  3CC4 Q;  2FB7 A;  3MCA B;  1O75 A;  1I4K 1;  1LOJ A;  2MI6 A;  4M75 F;  4IIO A;  2RJC A;  1UEB A;  4EMK C;  1AWX A;  9ATC B;  4NL3 A;  1KG1 A;  3RKX A;  1U06 A;  4B9X A;  1BI3 A;  2MAM A;  1JXO A;  1B07 A;  2OTL A;  3G71 Q;  2YLC A;  3Q1J A;  3HFN A;  4X1V A;  5GAM g;  2DMO A;  3QBY A;  3QZ5 B;  4V2S A;  4C5H A;  2YUN A;  2LCC A;  3PIP A;  3JSC A;  4C5E A;  4HT8 A;  1FMV A;  4QW2 A;  2DO3 A;  2ATC B;  1M1K U;  1TTH B;  4A4E A;  3CCV T;  2CH4 W;  4RUG A;  1X2Q A;  1VQ7 T;  5GMK i;  1KQ2 A;  2K3X A;  4M7D G;  3JCM c;  4BDY A;  2ZPB B;  2HBW A;  4VUB A;  5CAI A;  1D1B A;  1ZA2 B;  4JJC A;  2M1H A;  3L1A A;  1TSF A;  2E4H A;  4NL2 A;  4F17 A;  1SRM A;  1B7T A;  4M75 E;  4PJL A;  2DBM A;  3HP9 A;  1HD3 A;  1M30 A;  3CCV Q;  3BDU A;  1ZSZ A;  3G4S T;  1G3W A;  1OV3 A;  5LJ5 d;  1OQK A;  5LJ5 j;  4R55 A;  1YP5 A;  3THK A;  2COW A;  4KGV B;  2DRK A;  1M4Z A;  2LZ6 B;  4NS5 A;  5D6W A;  2KYB A;  2X9H A;  2VUB A;  1PSF A;  1AWJ A;  5FRM A;  1XOV A;  2EFI A;  4GBQ A;  4PJJ A;  3PNW C;  4OML A;  1LCK A;  2CP3 A;  3VS3 A;  4FW1 A;  3JCM J;  2CT3 A;  1M90 R;  2CZ1 B;  1ZLM A;  3J81 E;  3NMZ C;  4JRI A;  1HSQ A;  5DM7 R;  3NTH A;  2RB6 A;  5CVI A;  3UA6 A;  2DBK A;  5FWC A;  1FMK A;  3P8H A;  2RN8 A;  1H92 A;  2RK1 A;  3EGD A;  1VQ5 Q;  4RTT A;  4DBQ A;  1PG5 B;  1JJ2 A;  3CCS T;  4GLK A;  4XTZ A;  4Z02 A;  4ANJ A;  1WX6 A;  4BE1 A;  3OA6 A;  2OI3 A;  2DXU A;  1Q95 G;  2WSF E;  3FEO A;  1OYX A;  2DIG A;  1Q86 C;  4KUD K;  1ZSZ C;  1BIA A;  1YIT A;  2MMP A;  2J7I A;  4M77 A;  2NUT A;  1I8F A;  4OMN A;  2AIR B;  4Z89 A;  3HHT B;  3VS6 A;  3NFC A;  4KBM B;  1ACM B;  1QW1 A;  1U1T A;  2C06 A;  3QDR B;  3JB9 H;  2DEU A;  1H8K A;  4J9I A;  3UWN A;  2M0Y A;  1VYV A;  1Q7Y U;  4IUT A;  4OB1 B;  2CH4 A;  2M02 A;  4M7A A;  4FYW B;  2H3J A;  4QVC A;  1W2B A;  3FLG A;  3H0I A;  1YJW T;  4X9D A;  5IXF A;  1QVF A;  1UE9 A;  5GAO m;  2DYI A;  3FC3 A;  1U8R A;  2GNC A;  2EYX A;  2RD1 A;  1SHG A;  3AT1 B;  5IHK A;  3EFO B;  4BAC A;  2KGT A;  1KD1 C;  1T0J A;  3A5Z B;  3CD6 A;  3R6N A;  1E6G A;  1X6B A;  5IT9 E;  5KCO A;  3LH0 A;  1JU5 C;  3JB9 F;  4BE2 A;  1AWW A;  5J26 A;  5CKB A;  2W0Z A;  2GTJ A;  3BY7 A;  3PTA A;  1PKS A;  4XU3 A;  2DKG A;  2R57 A;  1UUE A;  2KBT A;  2LCS A;  5GAN 6;  1S72 T;  3VYH B;  2CUB A;  3QZ9 B;  1Q82 U;  4JRQ A;  1K8A C;  2J6F A;  2HCK A;  2V26 A;  2EGE A;  2EQM A;  1N8R U;  4PJO F;  3OS0 A;  3MEW A;  4M7A C;  1WGS A;  2ZPE B;  2LNH B;  1GBR A;  5CCA A;  3RMQ A;  3M0U A;  1WHJ A;  2RMO A;  4KGX B;  4A54 A;  1VIF A;  2HL5 C;  3FB9 A;  2K5L A;  3O5Z A;  4C0D C;  4E47 A;  1AWO A;  2QQ9 A;  2E3H A;  3T9N A;  2MIO A;  2OTJ A;  5L8R E;  3CC7 T;  2KSS A;  1IRX A;  4O5V A;  1QVG A;  2ZCF B;  4J7I A;  2XDB A;  2EPD A;  3PIO A;  1YJN T;  1UGR B;  2DTI A;  3I55 A;  3QJ6 A;  2CRE A;  1UEC A;  4F7U G;  4DOW A;  1M1K R;  1VQM T;  3SEM A;  2I2L A;  3KXT A;  1YJ9 T;  2RJD A;  1K73 C;  3SWN A;  2EQK A;  3I56 A;  4C92 G;  3QPH A;  4XU1 A;  3JCM X;  2ED0 A;  1RL2 A;  2WSE E;  2HD0 A;  1BU1 A;  3L2U A;  2BKD N;  2O9V A;  2BZX A;  2JZ2 A;  4M78 G;  5HK3 A;  3OYL A;  1JJ2 P;  4EMG A;  3UA7 A;  2V1Q A;  2P4R A;  5FW9 A;  3VS7 A;  1QCF A;  4M75 B;  3CQT A;  2K6D A;  4PJO E;  1YIT Q;  3VRZ A;  4M7D C;  2QQB A;  1WNL A;  2A37 A;  3RES A;  1BCO A;  1WHM A;  4RTZ A;  3SHW A;  5FRN A;  2IG0 A;  4LDV A;  5DLO A;  1QLY A;  3WVD B;  1ZBX A;  5FU7 B;  3EH2 A;  4LD6 A;  3VJP A;  5L23 A;  5GAN 4;  3OW2 A;  5IAY A;  3L2Q A;  3KFV A;  2J05 A;  4L59 A;  2J06 A;  4RTV A;  3LWH A;  1VQ6 A;  2K3B A;  1OPK A;  3CME T;  5J3B A;  2MWP A;  4JZ4 A;  4BI8 B;  3TSZ A;  4HCB A;  2PZ1 A;  3UT1 A;  3G6E T;  1D0X A;  1VQN Q;  1I07 A;  3CBP A;  1W2B P;  2KMT A;  1WZO A;  1YI2 T;  4LDX A;  4E7L A;  2CZ0 B;  1QVF P;  1QP2 A;  2QA4 A;  4J9H A;  3CD6 Q;  1GFD A;  1M27 C;  3FJP A;  2Y4Y A;  3OYA A;  3SWN C;  1WA7 A;  1WHH A;  2NUP A;  4RTY A;  2GF7 A;  3QXE B;  3VYG A;  5KH6 A;  3G7Z A;  3C4S A;  5CKE A;  3N5B B;  1WXT A;  2E41 A;  4O6J A;  1YWP A;  2AZS A;  2A08 A;  1JQQ A;  5GJW B;  2CUD A;  3EG9 A;  1EZZ B;  2DF6 A;  4IUU A;  2DAQ A;  4JLI A;  5EC7 A;  2K7A A;  2E3I A;  2K5I A;  4HCC A;  2DXC A;  5KYX B;  4M7A F;  4KUI A;  4RG2 A;  1NZ9 A;  2RI2 A;  1VQ8 T;  1U1S A;  2JTF A;  2HKN A;  4JJD A;  2O4X B;  5GAN g;  2GQV A;  2QXF A;  5GAM h;  1PC0 A;  5D6X A;  1TWB A;  3OYG A;  1Q7Y R;  3RKW A;  1M1F A;  2CSQ A;  2C0O A;  1VQK T;  3MKD A;  4XTW A;  2RI3 A;  4IUV A;  2QTX A;  4ZTJ A;  2KRN A;  1U5S A;  4HT9 A;  1RAI B;  1VQ9 Q;  3L2V A;  3JCM g;  2CP2 A;  3RNJ A;  1T3L A;  1W70 A;  3M9Q A;  3C12 A;  2KT1 A;  2Y4X A;  2XIC A;  3I55 Q;  4ESR A;  1QVG P;  1K9M C;  1JB0 E;  2X51 A;  1VQK Q;  1D0Y A;  1Y96 A;  2R5A A;  3VU3 C;  1OX9 A;  1RAG B;  2LJ0 A;  2EQU A;  4M7D F;  1M2V A;  3PMT A;  2DIL A;  4KGZ B;  1SSH A;  2VC8 A;  4A4F A;  4MMK A;  2EQI A;  3EFR A;  3CCV A;  2CKK A;  2E5K A;  2QQA A;  4F7U A;  5C6S A;  1VQ7 A;  4OF1 A;  4DBH A;  1Q82 R;  3OYE A;  4KH1 B;  4DEY A;  4DA4 A;  2HQH A;  1NBE B;  2K5F A;  5HY6 A;  1N8R R;  2CGH A;  1FXX A;  4RKU E;  3GIB A;  2VWF A;  4J9E A;  5GMK l;  2AHJ B;  2XKO C;  1M9S A;  1TXQ A;  2L89 A;  1ARK A;  1G5V A;  4M78 A;  1AHJ B;  4E7K A;  4RMO A;  3G4S A;  2V8I A;  2CP0 A;  4J9B A;  3S3O A;  4QVZ A;  3WXM B;  3OS1 A;  4FU6 A;  4MZP A;  4JS4 A;  1B34 A;  3OW2 P;  2QAS A;  3RR6 A;  3RDV A;  2GCX A;  2NUZ A;  1RLP C;  3JCM W;  5IXB A;  1VQP T;  2HDA A;  2CZ6 B;  1K8A U;  4F16 A;  4IUP A;  1LJO A;  1G3S A;  1K9A A;  2QA4 Q;  1PHT A;  4AG1 C;  4CC3 A;  2JMA A;  2O31 A;  4PKC C;  5GAN 8;  3BW1 A;  3VV0 A;  4M77 D;  2KT8 A;  4JUV A;  2F2W A;  2DER A;  4ZGD B;  4M7D E;  2DIQ A;  1E6H A;  1RAC B;  1OU9 A;  2KNB B;  2RK2 A;  1NJI C;  2QEX T;  2LDM A;  4BY6 B;  1VQ4 T;  3OYH A;  4B9W A;  2DYB A;  4KRT A;  2K57 A;  2L3R A;  1RAF B;  3ZBD A;  1YFN A;  2VB6 A;  1LNX A;  2LQ8 A;  2NLU A;  5HK0 A;  2DXT A;  2MYS A;  4M7A D;  3M56 A;  2NWM A;  4OB0 B;  4J83 A;  2L3Q A;  3CCL T;  4HVW A;  3HKS A;  1KK7 A;  1H3Z A;  4PJO B;  3CCS A;  3LW5 E;  4ZGE B;  3OS2 A;  2VXE A;  4FCY A;  4C92 C;  1I5L A;  3CCU Q;  3JB9 I;  1OZ2 A;  2KR3 A;  4DBR A;  1V76 A;  5GAM f;  3HSB A;  2PUK B;  1M1G A;  4A4H A;  3UPU A;  2GFA A;  2J6O A;  1DJ7 B;  2DX1 A;  2XG8 D;  4C8Q G;  1SPK A;  3JB9 J;  1GCQ A;  4BDZ A;  2B8A A;  3TEE A;  2X4J A;  2YUQ A;  2LT1 A;  3IQL A;  2DK3 A;  3SDZ A;  2Y90 A;  1N9R A;  1UG1 A;  2EIF A;  1D3B B;  3CCQ T;  1KC8 C;  2YLB A;  1UTI A;  2KQW A;  1M3A A;  1WHK A;  3EHR A;  1VYU A;  3EAE A;  2WAC A;  5CKF A;  1YN8 A;  2PU9 B;  1D0Z A;  3NTI A;  1MV3 A;  2EYZ A;  3MHX A;  3HTR A;  1N6A A;  4ELY C;  1IZ6 A;  4OMQ A;  3OBW A;  2DE0 X;  2A7Y A;  5DY9 A;  2ZGW A;  3MO8 A;  4C0F A;  5AT1 B;  4M7D D;  4JPB W;  5A0G A;  2PVO B;  2K2M A;  2R58 A;  4J6W A;  2DD4 A;  3PVQ A;  1IB8 A;  4N0A A;  1R0C B;  2RH2 A;  1PCX A;  2ENM A;  4EPC A;  3OQ5 A;  1YCS B;  4FYY B;  4ELZ C;  1IRE B;  1VQ7 Q;  1KIK A;  1TUC A;  2C0I A;  1G83 A;  4LDY A;  3G1J A;  2ROT A;  2JMC A;  2VGM A;  2HSE B;  2CT4 A;  4HVV A;  1XNI A;  2F69 A;  1MMA A;  2VV5 A;  1WPY A;  4OB2 B;  3LGF A;  1OEB A;  5GAN 3;  3EG2 A;  2DL7 A;  2E10 A;  2FPD A;  1S72 A;  1X75 C;  3OYY A;  4D6W A;  2GFU A;  4KUL A;  1SF9 A;  2MF2 A;  3OYI A;  2OX7 A;  3X28 B;  4L5G A;  1MV0 B;  3G4S Q;  4A4G A;  3F70 A;  1VYT A;  1KQS A;  2K4Y A;  1W6X A;  3BFM A;  3TSW A;  2JNG A;  3EGU A;  3LLR A;  3LYI A;  2D1X A;  2O01 E;  3VS0 A;  5KE3 A;  4BB7 A;  4ZN3 A;  2L0A A;  3MEA A;  3EG0 A;  5GAO p;  2NUT B;  1M3B A;  1JJ2 S;  1E7O A;  1QQJ A;  4EDU A;  3VS2 A;  3CC7 A;  4D8K A;  4LUD A;  1BI0 A;  2JOY A;  3C94 A;  1VOM A;  2C0T A;  1YJN A;  4A63 B;  3E9F A;  4C92 F;  2AZV A;  4R0K A;  1QWE A;  3H0F A;  2FO0 A;  4QVD A;  2JW4 A;  4E2F B;  3J80 E;  2EBP A;  1PKT A;  2I0N A;  5LJ3 g;  1QKW A;  3GOX A;  1M90 C;  2AKK A;  2EGA A;  3TQ7 P;  4C0D B;  2EYW A;  1I5O B;  2BE9 B;  3CCS Q;  5KYN A;  3M5A A;  3L2W A;  3H0H A;  2PTK A;  1K9M U;  1W2B S;  1QMC A;  1R77 A;  1GXI E;  3URG A;  2JS0 A;  4AG2 C;  1ZBJ A;  3HFO A;  1VQN A;  1QVF S;  3OYN A;  2QQS A;  4UC4 A;  2AK5 A;  2DET A;  3CMA T;  3A98 A;  2KEA A;  1M8V A;  1RAB B;  2ROL A;  5CKH A;  3EFS A;  3V7S A;  4OP0 A;  1X2K A;  3GPL A;  2P0Q A;  1ZUY A;  5I2M A;  4DBF A;  4PJM A;  4GLM A;  4J9D A;  2LMJ A;  2QG9 B;  4FYV B;  4L6V 5;  1K8A R;  1M8M A;  2HEQ A;  5GMK h;  3LH5 A;  1TU0 B;  1GCP A;  2O2O A;  5CIU A;  2G6F X;  1YJW Q;  1FX7 A;  3X26 B;  3RUX A;  4FT4 A;  3CME A;  4C8Q A;  1G8X A;  1ZUK A;  1EFN A;  2H3E B;  1A0N B;  1PWT A;  4HCZ A;  5KYY B;  3AHU A;  4M7D B;  4E7Z A;  2XDD A;  4XAX B;  4ZNX A;  4C92 E;  1JBM A;  2L3P A;  5D7U A;  4M77 C;  1EIF A;  2P4T A;  5GAO n;  1YHQ T;  3NPF A;  4LNP A;  3A1P A;  5GAN h;  5CO7 A;  2A36 A;  4A4K A;  3EFO A;  2LQN A;  1D1A A;  4PL6 A;  4RTX A;  4CC4 B;  3CCR T;  1C1A A;  4BI3 A;  3VS5 A;  3JV3 A;  3NTK A;  1MUZ A;  1VUB A;  1WDX A;  5GAN d;  5GAN j;  5LJ5 g;  3JCM Q;  1TS9 A;  2MOX A;  4LDW A;  3UAT A;  4RCC A;  3OMC A;  4IUQ A;  1NJI U;  3JCM h;  3JCM P;  3QSU A;  1D09 B;  3M0T A;  1S72 Q;  1VQ9 A;  2LRQ A;  2G3R A;  5IH2 A;  4BI4 A;  1N27 A;  2VGN A;  3L42 A;  1Y07 A;  1M3C A;  4XQ3 A;  1QVG S;  2F5K A;  2K2V A;  2MCN A;  2HQE A;  1VQO T;  2BZY A;  3M0Q A;  2HZY A;  2YUP A;  3SB2 A;  2X35 A;  4JZ3 A;  2RHU A;  1UHF A;  3X25 B;  4ZN1 A;  3M55 A;  3CBO A;  2ZAE A;  2CSI A;  2RQR A;  4C8Q C;  1VQK A;  1HK9 A;  1IGQ A;  1NLP C;  1WI7 A;  1X27 A;  1KQS P;  1OOT A;  2CS7 A;  3WVE B;  4X9C A;  3E2U A;  2ED1 A;  1SEM A;  2QK0 A;  3OYM A;  3CC7 Q; 
#chains in the Genus database with same CATH homology
 4B9X A;  4E7H A;  1BI3 A;  3M9Q A;  4M75 G;  2MAM A;  5GAM e;  3C12 A;  2OTL T;  4C92 D;  2VYT A;  2DJZ A;  2Y4X A;  2OTL A;  1I81 A;  2YLC A;  3Q1J A;  2XIC A;  3OY9 A;  3CPW A;  4JS5 A;  3HFN A;  3TCJ A;  2XI9 A;  4BUG A;  5GAM g;  5FRO A;  1H64 1;  2CZ7 B;  3ER0 A;  2EJG A;  3QBY A;  4M75 D;  5GAO l;  3QZ5 B;  2JTM A;  1K9M C;  4C5H A;  4V2S A;  1JB0 E;  4M78 D;  3C95 A;  1KC8 U;  1MGQ A;  3E19 A;  2LCC A;  3PIP A;  1TH7 A;  4R56 A;  1NPP A;  3JSC A;  1Y96 A;  4C8Q B;  3VUB A;  2V8J A;  4C5E A;  2R5A A;  2X4Y A;  3VU3 C;  4HT8 A;  4QW2 A;  2DO3 A;  2EQU A;  4MZM A;  4M7D F;  5CR2 A;  2LVM A;  3PMT A;  1M1K U;  3CD6 T;  2D6F A;  2VC8 A;  4A4F A;  4A4E A;  4FIB A;  4MMK A;  3EFR A;  3CCV T;  2E70 A;  3CCV A;  3MP8 A;  2CKK A;  3HRU A;  4J8O A;  3OW2 S;  2FYK A;  2QQA A;  1M1K C;  4FT2 A;  4F7U A;  5C6S A;  5GMK i;  4F7U E;  2K3X A;  2BUD A;  3CXC A;  1VQ7 T;  4ZGJ B;  1VQ7 A;  1KQ2 A;  4OF1 A;  3VKI A;  4M7D G;  2PVG B;  3JCM c;  4BDY A;  2ZPB B;  4VUB A;  2LQK A;  4LDU A;  4OVA A;  5CAI A;  3OYE A;  5CQY A;  4QQG A;  4OMF B;  4DA4 A;  3JAM E;  3G6E A;  3M4G A;  5HY6 A;  2K5F A;  4X34 A;  4JRP A;  4XK8 E;  2CGH A;  1FXX A;  2PQW A;  2M1H A;  1BKB A;  2R5M A;  2PVD B;  3L1A A;  4RKU E;  3GIB A;  1YI2 A;  5GMK j;  5GMK l;  3CC2 T;  2EYQ A;  3CC2 A;  1VIE A;  2AHJ B;  2XKO C;  2LTO A;  1M9S A;  1X01 A;  4NL2 A;  2L89 A;  4M75 A;  1G5V A;  1WJQ A;  4M75 E;  3HP9 A;  1W4S A;  4M78 A;  1AHJ B;  3BDU A;  2EAY A;  3QII A;  3QJY A;  4M78 E;  3RKY A;  4MML A;  3G4S T;  4E7K A;  4RMO A;  3G4S A;  1G3W A;  5LJ5 d;  5LJ5 j;  4R55 A;  2V8I A;  3S3O A;  4QVZ A;  5GAN 5;  4M77 F;  3WXM B;  1ZQ1 A;  2ZPI B;  3CPF A;  3JB9 G;  1BIB A;  4FU6 A;  2ZZD A;  4MZP A;  1B34 A;  1UGP B;  3V8J A;  2X4W A;  3OS1 A;  4JS4 A;  1M4Z A;  4NS5 A;  5D6W A;  4LD9 K;  5LJ5 f;  4PLL A;  2VUB A;  1YIJ T;  2GCX A;  1YIJ A;  1PSF A;  1VQL T;  2M16 A;  3JCM W;  1VQL A;  4QQD A;  1VQP T;  5FRM A;  1WQ7 A;  4RCB A;  1VQP A;  2CZ6 B;  1XOV A;  2EFI A;  5CKD A;  1K8A U;  3A8G B;  3GNG A;  4IUP A;  1G3T A;  4GY5 A;  4C5G A;  1LJO A;  1G3S A;  3PNW C;  4YTL A;  3CCJ T;  4PKC C;  3CCJ A;  5GAN 8;  3JCM J;  3OBY A;  3BW1 A;  3VV0 A;  4M77 D;  5GAN f;  4JUV A;  2CZ1 B;  1VQ8 A;  4ZGD B;  4M7D A;  3J81 E;  4M7D E;  3CCU A;  4JRI A;  2DIQ A;  3SWN B;  3QHS A;  5EG2 A;  1NJI C;  2RK2 A;  2QEX T;  3QKJ A;  4XU0 A;  2LDM A;  4BY6 B;  3BDL A;  3NTH A;  4PNO A;  5DM7 R;  5IN1 A;  3S3N A;  1VQ4 T;  3OYH A;  1WQW A;  2RB6 A;  5CVI A;  4B9W A;  2K57 A;  1OI1 A;  2L3R A;  3GNF B;  3ZBD A;  3CCM T;  3CCM A;  3MP1 A;  3P8H A;  3JCM d;  5M9O A;  5GAO q;  1LNX A;  2LQ8 A;  2NLU A;  4PJO G;  5HK0 A;  2DXT A;  2RK1 A;  3QUI A;  2RHY A;  3L2R A;  3M56 A;  4M7A D;  3V8K A;  4OB0 B;  4J83 A;  3CCL T;  3CCL A;  3HKS A;  1BI2 A;  3JCM f;  4J7F A;  1H3Z A;  1JJ2 A;  4PJO B;  3CCS T;  3CCS A;  4GLK A;  4XTZ A;  4Z02 A;  5GAM d;  2HQX A;  3LW5 E;  4ZGE B;  5GAM j;  2VXE A;  3OS2 A;  4C92 C;  3GP8 A;  1Q81 C;  1I5L A;  4C8Q F;  3JB9 I;  1OZ2 A;  1Q86 U;  4EMH A;  4BE1 A;  3QG1 A;  1P92 A;  1O9S A;  3OA6 A;  2DXU A;  2WSF E;  2JUF A;  5GAM f;  3HSB A;  2PUK B;  3FEO A;  1OYX A;  1M1G A;  4A4H A;  3OYF A;  2GFA A;  2DIG A;  4JLG A;  4MZT A;  3JCM b;  3UPU A;  3LX7 A;  1Q86 C;  4KUD K;  1YIT T;  2PUO B;  1YIT A;  1BIA A;  3LGL A;  3CPW S;  1DJ7 B;  1UGQ B;  2MMP A;  1M90 U;  2XG8 D;  4M77 A;  4C8Q G;  4M77 E;  3DB4 A;  1I8F A;  3VUZ A;  3JB9 J;  3HHT B;  5AYF A;  5GAN 2;  4BDZ A;  4BE0 A;  3OYC A;  2O4X A;  3I56 T;  2B8A A;  3NFC A;  3TEE A;  2X4J A;  2LT1 A;  4KBM B;  2DK3 A;  3SDZ A;  1KHC A;  1QW1 A;  2Y90 A;  1N9R A;  2OAU A;  1U1T A;  2C06 A;  2EIF A;  1D3B B;  1SSF A;  3QDR B;  5FU7 C;  2XD0 A;  3JB9 H;  3CCQ T;  4EMK B;  3GLX A;  1KC8 C;  3CCQ A;  2YLB A;  1QP3 A;  3UWN A;  4JJN K;  4C92 B;  2KQW A;  1Q7Y U;  4NOY A;  4IUT A;  1YCY A;  4OB1 B;  2E5Q A;  4M7A A;  5A2Q E;  2H3J A;  4M7A E;  4QVC A;  2RA2 A;  1WJR A;  3FLG A;  1YJW T;  4JRK A;  1W2B A;  2HAX A;  3EAE A;  2WAC A;  2KVQ G;  5CKF A;  3CXC S;  4X9D A;  3CEY A;  1VQN T;  2PU9 B;  3NTI A;  1QVF A;  5GAO m;  3MHX A;  3FC3 A;  2A3L A;  1N6A A;  3OB9 A;  1U8R A;  1KD1 U;  3V7C A;  1OZ3 A;  5KE2 A;  2RD1 A;  1HXD A;  2KAF A;  4ELY C;  1IZ6 A;  2D9T A;  4J6Y A;  3SFM A;  4PLI A;  3OBW A;  4BAC A;  2D0Q B;  3S6W A;  2VXF A;  5I2S A;  2A7Y A;  5DY9 A;  2ZGW A;  3A5Z B;  3H8Z A;  3MO8 A;  4C0F A;  3MEU A;  1KD1 C;  3ZEH A;  4IKF A;  3CD6 A;  4M7D D;  5A0G A;  2LCL A;  2PVO B;  5IT9 E;  2R58 A;  4J6W A;  3J7A F;  2DD4 A;  5KCO A;  3LH0 A;  3JB9 F;  2RJF A;  4BE2 A;  4N0A A;  5J26 A;  5HKC A;  1VQ6 T;  1QVP A;  3KUF A;  1RI0 A;  5CKB A;  2LX9 A;  2RH2 A;  3BY7 A;  2LC4 A;  3OQ5 A;  4EPC A;  3OYB A;  2RHI A;  2E65 A;  3MET A;  3PTA A;  4C8Q E;  4ELZ C;  1IRE B;  2QDY B;  1KQ1 A;  4XTU A;  4Y91 A;  2YRV A;  4LDY A;  2FVU A;  3CBM A;  2VGM A;  4XU3 A;  2DKG A;  3INZ A;  2R57 A;  2DZ9 A;  3A8L B;  1XNI A;  2F69 A;  4OGC A;  2LT4 A;  2VV5 A;  3V7R A;  5DLQ E;  5I21 A;  3JB9 D;  1WPY A;  5GMK m;  2RHX A;  5GAN 6;  4OB2 B;  3LGF A;  5GAN 3;  3P8B B;  1S72 T;  2E10 A;  3VYH B;  1S72 A;  1X75 C;  3OYY A;  3QZ9 B;  4D6W A;  1Q82 U;  4JRQ A;  2GFU A;  3M4Y A;  1K8A C;  4KUL A;  3MEV A;  2MF2 A;  3OSS C;  3OYI A;  2EQM A;  4N4G A;  3JRZ A;  3SD4 A;  3X28 B;  4ME7 A;  3QYG B;  4L5G A;  4PJO F;  1N8R U;  4FSX A;  1X6O A;  4A4G A;  1KHI A;  2DXB A;  3HRS A;  1R8O B;  3M58 A;  4KT0 E;  3OS0 A;  2ZPH B;  2QEX A;  3F70 A;  3E9G A;  3MEW A;  1WJS A;  1VQ4 A;  1WGS A;  4HA8 A;  3OYJ A;  3CC4 T;  1KQS A;  3CC4 A;  2K4Y A;  2ZPE B;  4M7A C;  3BFM A;  4XTY A;  1N9S A;  1BI1 A;  2V8K A;  5CCA A;  3RMQ A;  2JNG A;  3LLR A;  2FHD A;  5LJ3 h;  3LYI A;  2O01 E;  5KCH A;  1XTD A;  5KE3 A;  4BB7 A;  4ZN3 A;  4A54 A;  3ZFJ A;  3PGG A;  1JRI A;  5D6Y A;  3MEA A;  4BD3 A;  1VIF A;  2RO0 A;  3FB9 A;  2K5L A;  4E47 A;  2M0O A;  4C0D C;  5GAO p;  1V29 B;  2QQ9 A;  2XID A;  1VQ9 T;  3T9N A;  3X24 B;  2OTJ T;  3H6Z A;  1JJ2 S;  2OTJ A;  4PJO D;  5L8R E;  4EDU A;  2KSS A;  3CC7 T;  3CC7 A;  4ZTF A;  4O5V A;  2K3Y A;  5LJ3 d;  2ZCF B;  5LJ3 j;  4J7I A;  1QVG A;  1Y96 B;  2XDB A;  1BI0 A;  3G71 T;  3G71 A;  2JOY A;  3PIO A;  3KBG A;  3C94 A;  3I55 T;  1YJN T;  1UGR B;  2DTI A;  5C0M A;  2P0K A;  3QJ6 A;  3I55 A;  1YJN A;  1G3Y A;  5FU6 C;  4F7U G;  2EJF A;  3E9F A;  3PFS A;  4M75 C;  4XU2 A;  4C92 F;  4DOW A;  2RHZ A;  1BYM A;  4M78 C;  1VQM T;  1K73 U;  5LJ3 e;  2I2L A;  4QVD A;  2M9U A;  4JDS A;  3KXT A;  2EQJ A;  5CK9 A;  5J39 A;  2P0P A;  3J80 E;  4F7U B;  2RJD A;  4OGE A;  1YJ9 T;  1K73 C;  1UGS B;  3SWN A;  4TVR A;  3A8M B;  2EQK A;  5LJ3 g;  5CQX A;  3GOX A;  1M90 C;  3A8O B;  1ZHI A;  4C92 G;  3I56 A;  3DLL A;  4C0D B;  2RJE A;  4C8Q D;  3QPH A;  2RM4 A;  4XU1 A;  2KY9 A;  4Y28 E;  3JCM X;  3S3M A;  1RL2 A;  1MHN A;  2WSC E;  3ME9 A;  2JN0 A;  5GAN 7;  3OMG A;  3DB3 A;  2L5Q A;  2HD0 A;  2WSE E;  3M5A A;  3L2U A;  3L2W A;  2BKD N;  3OYL A;  2JZ2 A;  4M78 G;  4QQ6 A;  5HK3 A;  4XTV A;  3QYH B;  4C0Z A;  4EMG A;  1K9M U;  3CCE T;  4II1 A;  3CCE A;  3M54 A;  1W2B S;  1GXI E;  3URG A;  1YJW A;  4XTX A;  2F5T X;  1Q7Y C;  5FU6 B;  2XDP A;  4IUR A;  4M75 B;  3HFO A;  4PJO A;  2MWO A;  4PJO E;  3X20 B;  3OSV A;  2QQR A;  4M78 B;  1VQN A;  4M7D C;  1QVF S;  2QQB A;  2HNI A;  3OYN A;  2QQS A;  1WNL A;  4UC4 A;  3FRN A;  3RES A;  1PSE A;  3CMA T;  4OB3 B;  3CMA A;  1M8V A;  5CKH A;  3V7S A;  3EFS A;  4E7I A;  4OP0 A;  2QI2 A;  5FRN A;  2IG0 A;  3LWI A;  1B34 B;  3GPL A;  2P0Q A;  3RMS A;  5I2M A;  4Q5W A;  4A53 A;  4J5Y A;  4LDV A;  5DLO A;  3WVD B;  3A8H B;  1ZBX A;  2IVW A;  5FU7 B;  4LD6 A;  1FWZ A;  3VJP A;  4MDW A;  4CI0 C;  5GAN 4;  1YBY A;  5IAY A;  3OW2 A;  3HPW A;  3L2Q A;  4L6V 5;  1Y7X A;  3V8L A;  2E6N A;  4L59 A;  5GMK h;  3LWH A;  1VQ6 A;  2DVE A;  3O8V A;  5CIU A;  1FX7 A;  5J3B A;  3X26 B;  3CME T;  3RUX A;  2MWP A;  4FT4 A;  3CME A;  3E1S A;  4C8Q A;  4BI8 B;  3FDR A;  1D3B A;  4FL6 A;  4HCB A;  3G6E T;  3UT1 A;  3QO3 A;  4HCZ A;  4EMK A;  2DD5 A;  3AHU A;  3CBP A;  3HL8 A;  4M7D B;  2KMT A;  1UB4 A;  2E6Z A;  4NL3 A;  2XDD A;  5LJ5 h;  4C92 A;  4MDX A;  4XAX B;  4C92 E;  2KDS A;  4P5N A;  1YI2 T;  2LNV A;  4LDX A;  4E7L A;  3DKM A;  1JBM A;  3JCM V;  2L8D A;  2XHC A;  2QA4 T;  2CZ0 B;  1QP2 A;  2QA4 A;  4DQ2 A;  3OS5 A;  4M77 C;  3FJP A;  2Y4Y A;  2EWN A;  1EIF A;  5A0D A;  2P4T A;  3OYA A;  3SWN C;  5GAO n;  5GMK e;  2GF7 A;  3DLM A;  1YHQ T;  1YHQ A;  3QXE B;  3VYG A;  4BY6 C;  4J6X A;  4C5I A;  5GAN h;  5CO7 A;  3HRT A;  5KH6 A;  4E7J A;  1NE8 A;  3C4S A;  3G7Z A;  5CKE A;  4HKE A;  4A4K A;  2XU8 A;  3N5B B;  3P8D A;  2XK0 A;  1Q82 C;  2E41 A;  4PL6 A;  2YHT A;  2DZC A;  4O6J A;  4DOV A;  5LL6 S;  2CYZ B;  3FIF A;  2JVV A;  4ATO A;  3CCR T;  5LJ5 e;  3CCR A;  2DEQ A;  4BI3 A;  1N8R C;  3NTK A;  1VUB A;  1KQS S;  1VQ5 T;  2EJ9 A;  4M77 G;  1VQ5 A;  4IUU A;  4WF2 A;  2DAQ A;  4JLI A;  5GAN d;  2ZPG B;  3M59 A;  5LJ5 g;  3JCM Q;  5GAO r;  5GAN j;  4LDW A;  3TRE A;  2K5I A;  4RCC A;  4PJO C;  4HCC A;  2DXC A;  3OYD A;  4M7A F;  2E64 A;  2HBP A;  4N4H A;  4KUI A;  4RG2 A;  3ASK A;  3OMC A;  1NPR A;  4IUQ A;  1NJI U;  1NZ9 A;  4M77 B;  2RI2 A;  3M53 A;  3JCM h;  3JCM P;  1VQ8 T;  5A0L A;  3QSU A;  2DPP B;  3PT9 A;  3RIR A;  1U1S A;  2JTF A;  4F7U F;  5GAN e;  3CCU T;  1VQ9 A;  3RER A;  2LRQ A;  2G3R A;  2EKO A;  4BI4 A;  1N27 A;  1M5Q 1;  2O4X B;  3GF5 A;  3MP6 A;  2E12 A;  2VGN A;  3L42 A;  3UDC A;  1Y07 A;  3M57 A;  1Y71 A;  4XQ3 A;  5GAN g;  1QVG S;  4M7A G;  2F5K A;  2GQV A;  3OYK A;  2K2V A;  2QXF A;  5FLX E;  5GAM h;  3R6O A;  2BIV A;  2RI5 A;  2ZPF B;  2HQE A;  5D6X A;  1VQO T;  4RG8 A;  4CRI A;  1VQO A;  4N0A C;  2DTH A;  2E1H A;  3SB2 A;  2X35 A;  3PMI A;  5LJ3 f;  2X4X A;  3RKW A;  2RHU A;  3OYG A;  1M1F A;  4M7A B;  2FB7 A;  3X25 B;  4C0G A;  3M55 A;  3CBO A;  4ZN1 A;  3MCA B;  1VQM A;  2KK4 A;  1Q81 U;  1O75 A;  1I4K 1;  1LOJ A;  2FL7 A;  4C8Q C;  1VQK T;  1VQK A;  3TU4 K;  1HK9 A;  2MI6 A;  4M75 F;  4XTW A;  2RJC A;  2RI3 A;  1UEB A;  2DTO A;  4IUV A;  4EMK C;  2QTX A;  4N4I A;  2CS7 A;  4M78 F;  3WVE B;  3JCM e;  1YJ9 A;  4X9C A;  4ZTJ A;  4HT9 A;  1KG1 A;  3L2V A;  3OYM A;  1XQH A;  3JCM g;  3RKX A;  4FM4 B;  3L2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...