2GFUA

Nmr solution structure of the pwwp domain of mismatch repair protein hmsh6
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
134
structure length
134
Chain Sequence
KAKNLNGGLRRSVAPAAPTSSDFSPGDLVWAKMEGYPWWPSLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVSDEPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The PWWP domain of Mismatch Repair protein hMSH6 is involved in double stranded and single stranded DNA binding
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA mismatch repair protein MSH6
total genus 22
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gfuA00
4BE1A 2JTFA 1OZ2A 2M16A 2B8AA 2EQKA 4GY5A 4IUQA 5D6XA 3S3NA 3MO8A 3OYFA 4E7HA 2X35A 2DAQA 2K3XA 2O4XA 2BIVA 4QQ6A 2DIQA 3OA6A 4BDZA 2EQJA 2BKDN 3DLMA 3LGFA 5C0MA 4QQDA 1G5VA 4C5IA 4ZTFA 2D9TA 3OB9A 2RO0A 3DB3A 1OZ3A 3DB4A 3FEOA 3H8ZA 3MEWA 3SD4A 5KCOA 4LD6A 4IUTA 4OVAA 4E7JA 5J39A 4A4HA 3M9QA 3OQ5A 4L59A 4A4GA 4Q5WA 2EQUA 5M9OA 5FROA 4BDYA 3LLRA 4NS5A 4X34A 1OI1A 4PL6A 2R58A 3OS0A 3OY9A 3ME9A 2RHXA 3P8DA 3OYBA 2VYTA 1WJQA 2QQRA 2XK0A 2JZ2A 2RHUA 3FLGA 3OMGA 3OYJA 4UC4A 4B9WA 3MEAA 4E7LA 5CIUA 3UT1A 3MEVA 2O4XB 3PNWC 4BD3A 2K3YA 3L2RA 3QBYA 3E9FA 4IUUA 2RHZA 3Q1JA 3L2VA 5FRMA 2EKOA 3ZEHA 2GFUA 4N4HA 2R5AA 3LGLA 1KHCA 2MWOA 1SSFA 4IUVA 3UWNA 2EQMA 3OYMA 3OS2A 3OYKA 2GFAA 3PMIA 3OS1A 3S3MA 2HQXA 3NTHA 2GF7A 3OYDA 2R5MA 3OYCA 2LDMA 4N4IA 4EDUA 3MEUA 2FHDA 2P0KA 1XNIA 4IKFA 1OYXA 3LH0A 2M0OA 2CKKA 3QIIA 2RI2A 4C5EA 5KH6A 4IURA 2NLUA 1WJSA 5IN1A 3PMTA 3MP1A 4II1A 3H6ZA 2BUDA 2RHIA 2WACA 2MWPA 3CEYA 2E6NA 4A4EA 2RJDA 1H3ZA 3FDRA 3OYLA 2RJFA 4QQGA 3OYNA 2IG0A 4IUPA 4PLLA 3O8VA 4A4FA 5IAYA 3OYGA 2DIGA 4E7KA 3L2QA 3OYIA 3S6WA 5KE2A 1WGSA 4B9XA 4ZTJA 3EAEA 5D6WA 1WJRA 3GOXA 4PLIA 4Z02A 2EFIA 4BACA 5C6SA 3F70A 4BE2A 3OYHA 5D6YA 1RI0A 3L42A 2X4YA 2L8DA 2L89A 2X4XA 3OMCA 2LTOA 3E9GA 2LVMA 4BE0A 2QQSA 3QJ6A 2RI5A 4CRIA 2M1HA 4N4GA 4HCZA 3MP6A 4QW2A 2RHYA 2LRQA 2YRVA 2G3RA 3PFSA 2RI3A 3BDLA 3META 2X4WA 5KCHA 3L2WA 3MP8A 3OYEA 3QKJA 3LX7A 3LYIA 3P8HA 4C5GA 5KE3A 3FC3A 4QVZA 4E7IA 1MHNA 3ASKA 4RG2A 5FRNA 2F5KA 2RJCA 2HQEA 3KUFA 2E5QA 2L3RA 2XDPA 3NTKA 2RJEA 3S3OA 5J26A 2PQWA 2R57A 4FL6A 3C4SA 1N27A 3OYAA 3NTIA 3L2UA 2LCCA 4FU6A 4C5HA
chains in the Genus database with same CATH superfamily
2KRNA 5GMKe 4IUQA 1BKBA 2XMFA 1TUDA 1E6GA 2HSEB 4F16A 2KXDA 1T3SA 2DXCA 4OP0A 5GAMh 2QGFB 1RL2A 2X3XD 1M27C 5LL6S 1BI1A 1PRLC 1ZQ1A 3QDFA 3CCMA 2XICA 2PVGB 2YWWA 4FYXB 3HRSA 1M8VA 1CSKA 1OI1A 2A7YA 2P0PA 2R58A 5GANf 1M5Q1 2D0NA 1TXQA 3TSZA 1KD1C 4CC7A 1CKAA 2QI2A 5CVIA 3UT1A 1VYTA 3CBOA 3SEMA 3QBYA 1QCNA 2DBKA 4M77E 2RB6A 4F7UE 1WZOA 1Q7YC 1VQ7Q 3J7AF 4IKFA 2H3EB 5KH6A 2NUPA 1VQ9T 1RAHB 2EYZA 1RAGB 5A0DA 2RHIA 1UTIA 4JJNK 1KFZA 4HCKA 2D6FA 5LJ5e 1IB8A 5LJ3h 2QEXT 4J9BA 3O5ZA 1YN8A 3I56T 1VQ6T 1P92A 1JEGA 1UEBA 3S6WA 2ECZA 1LPLA 4J7IA 4M78A 2OAUA 4M77C 5FU7C 1UJ0A 2CREA 1OQKA 2O9SA 1VQ4A 2BZ8A 2DJZA 1UGRB 1VQLT 4EMHA 3T9NA 3EH1A 2M1HA 2CZ1B 3L1AA 4JZ3A 2VGNA 4XU3A 4ZNXA 3SWNC 3BDLA 3M56A 1IGQA 4N0AA 2DO3A 3CCQQ 2LT4A 3IQLA 2QK0A 3EG1A 4FW1A 4RCBA 1YITQ 1XJWB 4OMOA 1ZUUA 2QXFA 4X9CA 4C92D 1BU1A 3OYAA 2CUBA 4DBFA 2KQWA 1IHVA 1BYMA 1YJ9Q 1OZ2A 2VUBA 1M90U 2EGCA 2VKNA 2EGAA 2KXCA 2BIVA 1MMDA 2EQJA 3HRUA 1IO6A 4C5IA 4OF1A 3RERA 1GCPA 1VQPQ 4OVAA 2FB7A 3VJPA 4XQ3A 3FRNA 3JRZA 4MZTA 4DOVA 3G4SQ 4M77D 3QUIA 3JCMh 4KH1B 4XU2A 3LW5E 2IVWA 2QQRA 3CXCP 2JZ2A 1KQ2A 5GAN6 1YI2A 2XI9A 3E9FA 3I55A 1MV0B 2A08A 4CC4B 3OYKA 1QVGP 2EW3A 4M78F 1FWZA 1K8AR 2NUZA 3CXCA 3PGGA 2FYKA 4M7DD 4FW2A 2CKKA 2CP5A 3QZ5B 4C92G 2F1LA 4TVRA 1D0YA 1VUBA 2FEIA 3G6ET 2GNCA 2C0TA 2HKNA 3G4SA 2JN0A 3M54A 2CGHA 3GIBA 8AT1B 1D1AA 2DERA 1WJRA 3M57A 5C6SA 3OYHA 4ANJA 1K0SA 4JJDA 4RG8A 4GLKA 1ZLMA 3QZ9B 3EGXB 5KYXA 2FG0A 5LJ5h 1ACMB 3KBGA 3EGUA 3AHUA 4F7UG 2DLPA 4E7IA 5FLXE 2RJCA 2E5QA 2JS2A 2D8HA 5L8RE 4A63B 1ABOA 1N27A 2W10A 3NTIA 1Y07A 5GAOn 3X26B 1MMAA 4C5HA 1HXDA 2JXBA 3MHXA 3EFRA 4HCBA 4R56A 2IPOB 1Q81C 4KGVB 5ECAA 4DOWA 2J7IA 3SWNB 3UATA 1W1FA 4PJNA 4QQDA 3M4GA 4ZTFA 3SD4A 5DY9A 3MEWA 4V2SA 1WYXA 4Y28E 5LJ3d 4O6JA 4OMLA 1K0XA 2CP3A 1OPLA 3G71Q 1JU5C 3CCSA 4M7AB 5GMKh 3N5BB 2KMTA 2W0ZA 1ZX6A 2RHUA 2ENMA 1NEBA 4RUGA 3L2RA 3PNWC 4BD3A 1OOTA 3CMEA 4IUUA 1Q81R 1GXIE 4AFSC 1FX7A 1YHQA 3CMAQ 2GFUA 1QKXA 2RMOA 3CC7Q 4LD9K 1H3HA 1PNJA 1U3OA 4M75C 2JJ9A 4J7FA 3LH0A 1U1SA 2JTMA 4M7AA 3H6ZA 1S72Q 3I55Q 2PZ1A 2KDSA 5AYFA 1NE8A 2QA4Q 5KYYA 3OYIA 3I35A 4M75D 3KXTA 4EMKC 7AT1B 4CI0C 3F70A 1AWWA 4BE2A 1IXDA 2K4YA 1AVZC 1RABB 2E5KA 4PKCC 4BE0A 2P84A 2KBTA 4IIMA 4ME7A 4M75E 4HCZA 2DE0X 2G3RA 1WHLA 1HJDA 2JUFA 4OGEA 3LWIA 1JBMA 1X69A 3L2WA 3H9NA 3CCJT 2H8HA 2KY9A 4J9DA 1LNXA 2HSPA 2FRYA 5GAMe 2R57A 2XDDA 2RA2A 3M58A 4FU6A 2CP2A 2EQKA 4GY5A 1TWBA 3A8MB 3OA6A 4BDZA 2CT3A 3VU3C 1R77A 2DRMA 2GGRA 1OZ3A 1TOVA 2X9HA 3RUXA 2LQNA 4Z89A 3JCMe 1TSFA 5J39A 2QTXA 3M9QA 3OQ5A 4CC2A 1SHGA 4BDYA 3LLRA 4NS5A 1N9SA 1E6HA 1HSQA 2V8IA 4DEYA 1K76A 2M51A 1VQ8T 1UGSB 2CZ7B 2FVUA 3VV0A 4WCIA 1NM7A 3OMGA 4JRKA 4F04B 4LXCA 1I8FA 2P4RA 3Q1JA 2IIMA 1ZSGA 2F69A 2NUTA 1QKWA 5GAN3 3TVTA 4E7ZA 1QCOA 4M78B 5FU6C 3SDZA 3PVLA 1QMCA 5IXFA 3QIIA 4RTVA 2V8JA 3I9QA 4OMPA 2C06A 4LDVA 3V8KA 3OYNA 4HT8A 2HBWA 2LCLA 2DIGA 4J9GA 1Q81U 3CCET 4PJOC 2EIFA 5CQYA 1RAAB 3G4ST 3JCMW 2JNGA 4ESRA 2LP5A 3JAME 1OV3A 4J9CA 2QQSA 2JOYA 2QDLA 4J8OA 4QW2A 1IRXA 2VB6A 5CKHA 2RI3A 2DXBA 2K5LA 1UECA 2EYWA 1GCQC 4C92A 4LDYA 3R6OA 3LX7A 5KE3A 2HQEA 1UB4A 1GCQA 3WXMB 1K8AC 3THKA 3EG2A 3P8BB 1RACB 3CCVQ 2DXTA 3HFOA 4KT0E 2GTOA 4RCCA 4MMKA 1HD3A 1GL5A 1X6GA 4RMOA 2BZXA 4PNOA 1PWTA 3V8JA 1PC0A 3M59A 3CCQT 5CR2A 2D1XA 2KVQG 3M4YA 1B7TA 4FSXA 1M8MA 4C0ZA 2OTJA 4YTLA 4M78G 1NJIC 1FMVA 1T0JA 1CKBA 4X34A 1Q86U 1M4ZA 4JJCA 1SPKA 3OYBA 4EMKA 3MEAA 1MMNA 1VQOQ 1RLQC 2G6FX 5FRMA 2JW4A 5I2SA 6AT1B 1ABQA 3RKXA 4C8QD 3NTHA 2GF7A 2ESWA 4PJMA 2C0IA 1AWXA 4LDWA 2P0KA 2J05A 2HQHA 2JMAA 3A8OB 1OPKA 3HSBA 3FDRA 1SSHA 3VS3A 3GPLA 2CH4W 1IREB 3O8VA 1D3BA 4Y92A 1YJWA 2XDBA 5GAOr 1K73U 5KE2A 5A0GA 1M1FA 1G8XA 3AT1B 4PLIA 1M1KR 2CZ0B 2CDTA 2MF2A 4AG2C 4M7AF 4PK4A 1BBZA 3M0TA 4XTYA 2LJ3A 1QVFA 1BCMA 1HYOA 1OULA 3NGPA 3OYEA 1LCKA 2JS0A 3M0SA 1X75C 3ASKA 4M7DG 3FJPA 1BI0A 2DZ9A 3OS5A 4BI3A 2YLCA 2KEAA 2M9UA 1VQKQ 2DXUA 1VQ5T 4JRIA 1TUCA 1ZSZB 2K3XA 3JB9G 1G5VA 5KYYB 2LZ6B 1WQWA 4DA4A 1YFNA 1PM3A 3CPFA 4LD6A 3I5RA 1PG5B 4AFQC 4PFOA 5GANh 5KYWB 2DYBA 3QPHA 2OTLQ 2CP0A 2OTLT 3CC2T 2OAWA 2YT6A 4MZMA 3OW2P 1QP3A 1WJQA 2QTVA 1HK9A 2HL5C 2J6KA 5GAOq 3OYJA 1VQ9Q 5GAN8 2QEXA 3EG9A 2X3WD 3G6EA 2RHZA 1VQPA 2YXYA 2QDYB 2SEMA 2HEQA 3RMSA 4Y91A 3LGLA 4N4HA 4NOYA 5HKCA 4ZN3A 1VQNT 2ZPGB 1VQNQ 3PMIA 3CCUQ 1M90R 1D0ZA 1NLPC 1R0BG 2K57A 1VQ5Q 3RMQA 1FYNA 3GNGA 1NYGA 4OB0B 2WSFE 2HCKA 2GQVA 1Q82C 1VQMA 1K9MU 4JDSA 4DBHA 1WXTA 1KK7A 2KROA 4J9IA 1M2VB 4ZTJA 5LJ5j 1PCXA 1UHFA 4OMFB 3E9GA 3LWHA 1VQ4Q 1RAEB 3QWXX 4C0DB 4ZN1A 3JB9J 4HVVA 1YJNT 2GCXA 1QWEA 4VUBA 4NL3A 3X20B 3RIRA 4XTXA 1BIBA 3HFNA 4RG2A 2VGMA 3S3OA 3NTKA 2KT8A 2KR3A 1N8RR 1O75A 2OX7A 2J6OA 2RQTA 4BUGA 2PUKB 1W2BA 2KYBA 2A3LA 2DETA 1M1GA 4C0DC 3OYFA 1PKSA 1UJYA 1M3BA 1VQ6Q 4R55A 4C92F 4OB2B 2EYXA 2FZGB 2ZPFB 5IT9E 2HZYA 1Y71A 2O01E 1K8AU 4XU0A 2RF0A 1Z9QA 5FROA 2DK3A 1QVFS 1N8RC 4FYWB 3OY9A 2F2VA 1VQ8Q 3SFMA 4HKEA 2XIDA 5FW9A 4UC4A 1OEBA 1ZSZA 2DILA 4RTUA 1X6OA 2NYSA 3L2VA 2K3YA 2HDAA 4DBRA 2L2PA 2MWOA 2O9VA 2Y90A 3OYMA 1KIKA 3CC4T 3OYDA 3OYCA 3CPWS 2XU8A 3JCMP 1I07A 5GAMf 2BUDA 2KRMA 1M2VA 2MWPA 2V1RA 2DBMA 1PSFA 2RQUA 4QQGA 1G83A 2IG0A 1JJ2A 2ED0A 1M90C 5IAYA 1D1BA 1UE9A 5L23A 1TU0B 2B86A 1WGSA 1V76A 5D6WA 3CC2A 1NPPA 3OBYA 2JT4A 2LVMA 1D3BB 1W2BP 3NHNA 2K6DA 1YNZA 2LRQA 4JPBW 4XTVA 4FT2A 3QO3A 3CCSQ 2DF6A 1BB9A 1AT1B 1BCOA 3P8HA 1JO8A 5D7UA 1N8RU 3X28B 1PD1A 4C8QC 2BZYA 2YDLA 1PSEA 2PU9B 3REBB 3SWNA 1E7OA 4E7KA 2HD0A 3CMET 3REAB 1IHWA 3G71T 1QQJA 4BY6C 2MYSA 4OGCA 2DL4A 5C0MA 1KD1R 1M30A 4R0KA 1SG5A 3PE0A 3PT9A 1X6BA 1NPRA 2CP6A 3QYHB 2ED1A 3SB2A 2QG9B 3OB9A 4AT1B 5GMKj 2FPFA 4QT7A 1Y0MA 2MAMA 2ZCFB 5KYUB 1NZ9A 2RH2A 2HNIA 1LVKA 3M0UA 4JUVA 3EFSA 2E41A 5CK9A 4C8QE 1VQ7T 1YCSB 2EAYA 1YWOA 1QCFA 4D6WA 4ZGDB 2YUOA 2D0QB 3VUZA 5CKBA 1N5ZA 3G6EQ 4PJJA 5GJVB 4PJLA 2KI7A 4LDUA 4C8QA 3E19A 3VYGA 3CMAA 2QQAA 4M77F 3CCLT 2H3JA 4FM4B 3CCRQ 3RNJA 4KUDK 3OBWA 2EVRA 2NLUA 3A8HB 4II1A 2DEQA 1AEYA 2E64A 4A4EA 1RI9A 3VUBA 5LJ5g 4B6MA 1YIJA 2JM8A 3A8GB 4RTXA 1OX8A 5LJ3e 1LOJA 2ROLA 1Y7XA 1SEMA 4C8QB 1TTHB 1KG1A 1RADB 2FPDA 1KQSS 3I56A 2HAXA 3FIFA 1PKTA 3CC7A 2EFIA 2K2MA 1I5LA 2ABLA 4M77G 3VS5A 4ELZC 2V26A 3VS0A 1YHQQ 2LX9A 2DYIA 3NFCA 4PJOD 3JB9F 2CSQA 5LJ3g 3R6NA 2QQ9A 2XG8D 1NLOC 2GBQA 3HL8A 5GANj 1ZSZC 4XAXB 4FL6A 4XTUA 4JZ4A 3QDRB 1MV3A 4PJOE 4MDWA 4GBQA 2JTFA 4L6V5 1K9AA 4OMNA 1WA7A 3NPFA 4E7HA 1WHKA 2EGEA 3G7ZA 1Q82R 2A0FB 1VQ7A 2DKGA 4E7SA 3VRZA 2DL7A 2OTJT 2F2WA 4A4KA 2FZCB 2LQKA 4M77A 1JQQA 4JLGA 3JCMQ 4L59A 2QA4T 3ZL7C 3FJ5A 4M7AG 2ZZDA 1SRMA 3HTRA 2EYQA 2LC4A 2X4JA 1UGVA 3TU4K 4N0AC 3OW2S 1SHFA 4M75B 4M7DF 3D7SB 1T3LA 5EG2A 1M3AA 3EG9B 4IUVA 4BB7A 1VQ9A 1BK2A 4EDUA 2FHDA 3CCMQ 4X9DA 2COWA 1KQSA 4C92C 3PMTA 1YP5A 3ULRB 1QVGA 4J83A 1B07A 1H3ZA 1K9MC 2RJFA 8ATCB 4PLLA 2COYA 1W6XA 3OYGA 3OYYA 4J5YA 2ATCB 1ZBJA 3CCEA 3CCEQ 2ROTA 4KULA 1RI0A 5GAN2 3CXCS 4D8KA 4C0GA 1AZEA 1NYFA 5FWBA 4J9EA 3MP6A 1FMWA 3M0QA 1I0CA 3NMZC 4C92E 1FMKA 1MHNA 5FWCA 4NL2A 2FZKB 1YHQT 3SHWA 3JCMd 3BE3A 2DL5A 2O2OA 3A1PA 2QQBA 2LT1A 2DX1A 1EZZB 4QQ6A 1UG1A 4WF2A 3JCMb 3EGDA 2LNHB 4M75G 2RK1A 2LQ8A 5KCOA 4IUTA 2I2LA 4E7JA 2EJFA 4A4HA 3JCMf 4EMKB 2EPDA 1NJIU 4JS4A 3CCQA 1Q86C 2NUTB 3OS0A 3P8DA 3V7SA 1VQ5A 2DMOA 2HKQB 2EQIA 5GJWB 4P5NA 2QYZA 2NUPB 3WVEB 2JM9A 2DEUA 4PJOG 2R5AA 1SSFA 4FCYA 1C0MA 1M2OA 2MMPA 4EPCA 3GP8A 3CCJA 2DD5A 3OSSC 1XNIA 3CD6A 2M0OA 4C5EA 1IZ6A 4J6WA 1YJ9T 2MCNA 2WACA 1K9MR 1WPYA 3UPUA 2EJ9A 1VQPT 4M4ZA 4C8QF 2FL7A 2WSEE 5I2MA 4D8DA 3L2QA 2E70A 2PVOB 2DVJA 1RLPC 4RTZA 4IIOA 2AKLA 2BE7D 1WHGA 2RM4A 2P0QA 2X4YA 3ZFJA 2L8DA 2X4XA 3OMCA 2LTOA 3C94A 1XOVA 4MMLA 3TREA 2CP7A 2QASA 2CSIA 1A0NB 2QEXQ 2KAFA 2MIOA 5GAN5 2AT1B 3QHSA 4KUIA 2J06A 1SF9A 1JJ2P 4HCCA 2LX7A 3VS4A 2L3PA 3CPWP 2F5KA 4C8QG 2XHCA 3CMEQ 3OSVA 4M7DE 1W70A 2O88A 5CCAA 1WX6A 2PNIA 4QKUA 2WSCE 2DTOA 1S72T 3H8ZA 1X27A 1JXOA 4CC3A 2HBPA 4RTWA 2JTEA 4A4GA 5M9OA 3JV3A 4GLMA 2GQIA 4JJBA 3VKIA 4XTWA 2VYTA 4KGZB 3A98A 1KD1U 5IHNA 1KHIA 1TH7A 3FLGA 2L5QA 4AMCA 4AFZC 3DKMA 5GMKi 1YIJT 1YBYA 3ZBDA 1WDXA 1ZA1B 5HCKA 4C0FA 3A5ZB 3BY7A 2R5MA 1FXXA 2VXEA 1F1BB 3EG0A 1ZUKA 3TCJA 4FIBA 5IN1A 1VQLA 1AWOA 2E6NA 2EBPA 3V8LA 4M7DA 3BW1A 2RJDA 1K73R 1KQ1A 2YHTA 1YI2T 4A4FA 2EJGA 2HL3A 2C0OA 5KYWA 2Y4YA 2K7AA 2OTJQ 3EAEA 5CKDA 2Z0WA 4Z02A 1M9SA 2ZAEA 1KQSP 3JB9I 1BI2A 1RAFB 1Z9ZA 4ZGEB 5CO7A 3J81E 1VQOA 1JJ2S 1WIEA 3G1JA 3U23A 2XD0A 1YIJQ 1Q7YR 4KH0B 1ZBXA 2J6FA 3GNFB 4C92B 4M7AE 1B34B 2KK4A 1H8KA 5J3BA 4FT4A 2KGTA 1X2QA 2MK5A 2DAQA 2OJ2A 1VIEA 3DLMA 3I56Q 1WFWA 1UHCA 1YJNA 2M02A 2DM1A 1I81A 1NBEB 3H0IA 5LJ3f 2EQUA 1G2BA 4ELYC 4M7AC 2KRSA 3QWYA 2K5IA 2VWFA 3QYGB 3J80E 3X24B 1K73C 2XK0A 1ZA2B 4LE9A 4F7UB 2KE9A 2YUPA 4OB3B 3PIPA 4WTOB 4O5VA 5KYNA 2RQRA 1ZUYA 1XTDA 5KYUA 2DL8A 4ATOA 2AKKA 1H92A 4N4IA 3MKDA 5LJ3j 3OW2A 1V1CA 2RI2A 3CCLA 3MP1A 2DVEA 4PFPA 3FB9A 1BIAA 2DFUA 2LCSA 1MUZA 4PFZA 4IUPA 2RQWA 2F2XA 4M7AD 1U06A 5HK0A 1U1TA 1YJWT 2LJ0A 1UFFA 1VQMT 1VQMQ 4L5GA 9ATCB 1X01A 2L89A 1X2KA 1U5SA 3QJ6A 2KYMA 4OMQA 4M75A 4HVWA 2A36A 3M0RA 4FYYB 1QVPA 3PFSA 2MI6A 3BDUA 1Y96A 3CQTA 5CKFA 1QLYA 2ZPBB 3LYIA 3FC3A 4QVZA 1VQNA 3JCMX 5IXBA 1UDLA 3KUFA 2K79A 2L3RA 4HVUA 1YCYA 5GAMg 3MPUB 4FYVB 3C4SA 4LUEA 1VYVA 3L2UA 2DTHA 1H641 2FO0A 2M16A 1WHMA 4J9FA 2QGGA 2DRKA 2E3HA 3RDVA 2DIQA 3LGFA 4Z8AA 3JCMV 1WHHA 2I0NA 1NG2A 2MOXA 3RKYA 2D9TA 1PRMC 3M0PA 4MDXA 2RO0A 2QA4A 3JCMg 4J9HA 3V7RA 4JLIA 3PIOA 2DJQA 1S72A 3GBQA 1K4US 1VA7A 3V7CA 1WXUA 2LQWA 4XK8E 4F7UA 3CCVA 1JRIA 4XU1A 2A37A 2CYZB 3JSCA 3PVQA 4KGXB 4RKUE 3WVDB 1VQ6A 5CIUA 4X1VA 2O4XB 2E6ZA 3EFOA 1SKUB 2DZCA 3I5SA 5GAOm 3OS1A 3VS1A 4JRPA 1YI2Q 2HQXA 1WHJA 2YUNA 1JB0E 1I1JA 1QVGS 2L0AA 1WLPB 1D0XA 4XTZA 4M75F 3VRYA 1GRIA 3CEYA 3DLLA 1KC8C 3CC4Q 4A53A 3C0CA 2DTIA 3EFOB 4B9XA 1QW1A 4BI8B 3GOXA 3QJYA 4BACA 1DJ7B 1G3YA 3CCMT 2KSSA 3RESA 5GMKm 2E65A 4DQ2A 2XKOC 1I4K1 2RHYA 4J6XA 3RBBB 5GAOp 1Y57A 3CD6T 3GLXA 4M77B 5FU7B 5KCHA 3MJXA 5AT1B 1KSWA 1N9RA 2V8KA 3UA6A 5FU6B 3KFVA 3G71A 2RJEA 3RKWA 1UGPB 2PQWA 2PUOB 2BE9B 3H0FA 2FPEA 5LJ5f 3HKSA 3TSWA 2K9GA 5GANe 2QAZA 3DB3A 1VYUA 1X43A 1RUWA 4DEXA 3UDCA 3CCLQ 5EC7A 3MCAB 4KRTA 1Q86R 4QVDA 2DA9A 4HA8A 3CC2Q 2ZPEB 4HXJA 2OI3A 1GFDA 4MZPA 5GANg 1OX9A 2VASA 5CQXA 4E7LA 2EYYA 5I21A 5CKEA 5IH2A 2AHJB 1VQKA 2CS7A 1K1ZA 2O31A 1YWPA 1EX4A 2L3QA 1N6AA 3CCUA 3CCRT 2RPNA 3VS2A 4RTYA 3VS6A 4LDXA 1MNEA 2FRWA 4KBMB 2LNVA 5I22A 1MGQA 4M78C 1RAIB 3CMAT 1AWJA 3CBPA 3OYLA 3CC7T 3M53A 4F17A 4E6RA 2KT1A 1QP2A 1T0HA 2DD4A 4OMMA 3VS7A 1B34A 1OU9A 1QVFP 3VYHB 2RK2A 4EIKA 4Z88A 2AIRB 2E3IA 1M1KU 4AG1C 1YJ9A 2RI5A 4M78D 4CRIA 3C95A 4N4GA 2YRVA 1W2BS 2Y4XA 2YLBA 4LUDA 1YJNQ 3QG1A 2ZGWA 3CCRA 1IGUA 4M78E 2E10A 3CBMA 5FRNA 4ORZA 1YITT 3L2ZA 4EMGA 2ZPHB 2YRDA 4PJOF 3JB9D 5D6XA 5DLOA 2B8AA 4DBQA 3CD6Q 5HY6A 1MNDA 3BFMA 2X35A 3HP9A 3M5AA 3CCJQ 3CCST 2PVDB 2X51A 1Q7YU 1VQOT 2AZSA 1SRLA 1B3QA 1VQ4T 1VIFA 3URGA 4QVCA 3C12A 5GANd 1AD5A 1YJWQ 4HT9A 1D1CA 1TUGB 4M7DC 1UGQB 3TQ7P 3HPWA 2D8JA 2P4TA 4B9WA 1O9SA 3LH5A 3MEVA 3TEEA 4BI4A 4RTTA 2EKOA 3JB9H 1KHCA 2DL3A 2EWNA 2E1HA 1NJIR 3S3MA 4ZGJB 1PHTA 4E2FB 1BI3A 4J6YA 4JS5A 2LDMA 4F7UF 3RR6A 3CC4A 2K3BA 1I5OB 4BY6B 2BTTA 1J3TA 1ARKA 4LNPA 1AHJB 1G3WA 2E12A 1EFNA 3CPWA 2ZPIB 3M55A 1G3SA 1D09B 2K5FA 3JCMJ 2NWMA 2A28A 1OU8A 3EGDB 2CH4A 2M0YA 1VQ8A 3EGXA 2CZ6B 1LJOA 2L3SA 2OTLA 5D6YA 4PJOA 3H41A 5GAN4 2HMAA 2RQVA 3EG3A 4PJOB 1C1AA 3INZA 2YSQA 1KC8R 5GAMj 2AZVA 1U8RA 2EKHA 2X4WA 2AK5A 1WNLA 3JCMc 2VV5A 1Q95G 2VVKA 2LCCA 3A8LB 4BE1A 1W4SA 1KC8U 1QWFA 4A54A 1EIFA 5LJ5d 3S3NA 2COZA 3MO8A 1NEGA 2O4XA 2KNBB 2BKDN 2YRCA 2F5TX 1M1KC 3DB4A 1WQ7A 3FEOA 4AFUC 3QSUA 5IHKA 2K2VA 2SRCA 2V1QA 3HRTA 4Q5WA 4F14A 5GAN7 1TS9A 1G3TA 3EH2A 1M3CA 4PL6A 1C6VX 1ZHIA 5A0LA 5GAOl 3H0HA 3ME9A 4K11A 2E4HA 2RHXA 1VOMA 2JVVA 5GAMd 2JMCA 2CUDA 5KYXB 3EHRA 2RD1A 1GBRA 3UF4A 5A2QE 2PTKA 3ZEHA 2LJ1A 1YITA 5HK3A 2VC8A 1AZGB 3UWNA 1WXBA 2EQMA 3OS2A 2GFAA 2GTJA 3QXEB 3EHQA 3MEUA 1TG0A 3E1SA 1OYXA 5IHIA 4IURA 4M7DB 1WJSA 3E2UA 1Y96B 5DLQE 1VQKT 1VQLQ 1R8OB 3I55T 1UUEA 1Q82U 1WI7A 4FSSA 1XQHA 2CT4A 5I11A 1JXMA 2MPXC 2LMJA 3X25B 1GBQA 2DPPB 1R0CB 3GF5A 3CCVT 1GFCA 3PTAA 4JRQA 3L42A 5CAIA 4OB1B 3HHTB 2RNAA 2DNUA 4LN2A 3META 4E47A 2YUQA 3MP8A 3UA7A 3QKJA 1KJWA 4C5GA 3CCUT 1PD0A 1AOJA 2VXFA 2XDPA 1S1NA 1V29B 5DM7R 5J26A 2RN8A 5GMKl 1MMGA 3ER0A
chains in the Genus database with same CATH topology
4MMKA 1H641 2JTFA 2M16A 4L6V5 5GMKe 4IUQA 1BKBA 4RMOA 4PNOA 4E7HA 3V8JA 3G7ZA 3M59A 2DIQA 3CCQT 3LGFA 2DXCA 5CR2A 1VQ7A 4OP0A 2DKGA 3JCMV 5GAMh 4MDXA 3RKYA 2D9TA 2RO0A 2QA4A 2OTJT 1RL2A 2KVQG 3M4YA 3JCMg 4A4KA 2LQKA 4FSXA 1BI1A 5LL6S 3V7RA 4M77A 4JLGA 4PJOE 3JCMQ 4JLIA 4C0ZA 1ZQ1A 4L59A 3PIOA 2QA4T 1S72A 2OTJA 3CCMA 4YTLA 4M78G 2XICA 3V7CA 4M7AG 2PVGB 1NJIC 4XK8E 2ZZDA 4F7UA 3HRSA 1M8VA 4X34A 3CCVA 1OI1A 2A7YA 1JRIA 1M4ZA 2EYQA 2LC4A 2R58A 2P0PA 4XU1A 2X4JA 5GANf 1M5Q1 3OYBA 3TU4K 2CYZB 1KD1C 3JSCA 4RKUE 4N0AC 3WVDB 1VQ6A 4EMKA 3OW2S 3MEAA 2QI2A 5CIUA 4M75B 5CVIA 3UT1A 4M7DF 2O4XB 2E6ZA 3CBOA 5FRMA 3QBYA 2DZCA 5I2SA 5EG2A 4IUVA 4M77E 2RB6A 3RKXA 4BB7A 5GAOm 3OS1A 5GMKm 4JRPA 1VQ9A 1Q86U 2HQXA 4C8QD 3NTHA 2GF7A 4F7UE 1JB0E 4EDUA 1Q7YC 2FHDA 4LDWA 2P0KA 1QVGS 4X9DA 4IKFA 3J7AF 1VQ9T 5KH6A 1KQSA 3A8OB 4XTZA 4M75F 4C92C 1VQ8T 3PMTA 5A0DA 2RHIA 4JJNK 1QVGA 3CEYA 4J83A 3DLLA 5LJ5e 2D6FA 3HSBA 1H3ZA 1K9MC 3FDRA 5LJ3h 2RJFA 2QEXT 4PLLA 3GPLA 1KC8C 1IREB 3O8VA 1D3BA 4A53A 3I56T 3OYGA 3OYYA 1YJWA 1P92A 1VQ6T 2XDBA 4J5YA 1UEBA 3CCEA 5GAOr 1K73U 3S6WA 2DTIA 5A0GA 1M1FA 4B9XA 5KE2A 4J7IA 4M78A 1QW1A 4PLIA 4BI8B 3GOXA 2OAUA 3QJYA 4M77C 5FU7C 4BACA 1DJ7B 1RI0A 1G3YA 2CZ0B 4KULA 5GAN2 3CXCS 4C0GA 3CCMT 1VQ4A 2DJZA 2MF2A 1UGRB 1VQLT 4EMHA 3T9NA 2KSSA 3RESA 2M1HA 2E65A 4DQ2A 2XKOC 3MP6A 1I4K1 2CZ1B 2RHYA 3L1AA 4J6XA 5GAOp 4M7AF 2VGNA 4XU3A 3CD6T 4XTYA 1QVFA 3GLXA 3BDLA 3M56A 4M77B 5FU7B 3SWNC 4C92E 5KCHA 4N0AA 3OYEA 1N9RA 2DO3A 2LT4A 2V8KA 1X75C 1MHNA 3ASKA 4RCBA 5FU6B 4M7DG 3G71A 2RJEA 3FJPA 2QXFA 4NL2A 1BI0A 2DZ9A 1UGPB 2PQWA 4X9CA 3RKWA 2PUOB 4C92D 1YHQT 3OYAA 3OS5A 3JCMd 2KQWA 1BYMA 4BI3A 2YLCA 1OZ2A 2VUBA 1M90U 2M9UA 5LJ5f 2DXUA 3HKSA 2QQBA 1VQ5T 2LT1A 4JRIA 2K3XA 5GANe 2BIVA 4QQ6A 3JB9G 2EQJA 4WF2A 3HRUA 1G5VA 4C5IA 4OF1A 3JCMb 3RERA 1WQWA 4DA4A 4M75G 3DB3A 2RK1A 2LQ8A 3CPFA 4LD6A 5KCOA 4IUTA 4OVAA 3UDCA 2FB7A 2I2LA 3VJPA 4E7JA 2EJFA 3MCAB 4XQ3A 4A4HA 3FRNA 3JCMf 5GANh 3JRZA 3QPHA 4EMKB 4QVDA 4MZTA 4HA8A 2OTLT 1NJIU 3CC2T 4JS4A 2ZPEB 4MZMA 4DOVA 4M77D 1QP3A 3QUIA 3CCQA 3OS0A 3JCMh 1Q86C 3P8DA 4XU2A 3V7SA 3LW5E 1VQ5A 1WJQA 2IVWA 2QQRA 4MZPA 1HK9A 2JZ2A 5GANg 1KQ2A 5GAOq 5GAN6 3OYJA 1YI2A 5GAN8 5CQXA 2XI9A 2QEXA 4E7LA 5I21A 5CKEA 3G6EA 3E9FA 2AHJB 2RHZA 3I55A 1VQPA 2QDYB 4P5NA 1VQKA 3WVEB 2CS7A 3RMSA 4N4HA 2R5AA 3LGLA 4NOYA 4PJOG 4Y91A 1SSFA 4ZN3A 5HKCA 2ZPGB 1VQNT 2MMPA 4EPCA 3OYKA 3PMIA 3GP8A 4M78F 3CCUA 1N6AA 3CCJA 1FWZA 2DD5A 3CCRT 3CXCA 3PGGA 2K57A 3OSSC 2FYKA 4M7DD 1XNIA 3CD6A 3RMQA 4LDXA 2M0OA 2CKKA 3GNGA 4C5EA 3QZ5B 4C92G 4OB0B 1IZ6A 4KBMB 4TVRA 2LNVA 4J6WA 1YJ9T 1MGQA 2WSFE 1VUBA 2GQVA 4M78C 3CMAT 2WACA 1WPYA 3UPUA 1Q82C 2EJ9A 3CBPA 1VQPT 3G6ET 4C8QF 3OYLA 1VQMA 1K9MU 3CC7T 4JDSA 3M53A 3G4SA 2JN0A 2FL7A 3M54A 2CGHA 2WSEE 5I2MA 3GIBA 1QP2A 2DD4A 3L2QA 2E70A 1B34A 2PVOB 4ZTJA 1WJRA 5LJ5j 3M57A 3VYHB 2RK2A 5C6SA 3OYHA 2RM4A 2P0QA 2X4YA 4OMFB 3ZFJA 1M1KU 2L8DA 2X4XA 3OMCA 2LTOA 3C94A 3E9GA 1XOVA 4MMLA 3TREA 3LWHA 4RG8A 1YJ9A 4GLKA 4C0DB 2RI5A 4M78D 4CRIA 3C95A 4N4GA 3QZ9B 4ZN1A 3JB9J 2YRVA 2KAFA 1W2BS 1YJNT 2GCXA 2Y4XA 5GAN5 2YLBA 5LJ5h 4VUBA 3QG1A 3QHSA 4NL3A 2ZGWA 3CCRA 3KBGA 4KUIA 3X20B 3RIRA 4M78E 4XTXA 2E10A 4HCCA 3AHUA 1BIBA 4F7UG 3CBMA 3HFNA 4E7IA 4RG2A 5FRNA 2VGMA 2RJCA 2F5KA 5FLXE 4C8QG 2E5QA 3NTKA 3S3OA 1YITT 3L2ZA 2XHCA 5L8RE 4EMGA 1N27A 3NTIA 1Y07A 2ZPHB 3X26B 3OSVA 1O75A 4C5HA 5GAOn 4M7DE 1HXDA 4PJOF 4BUGA 2PUKB 3JB9D 5D6XA 3MHXA 5DLOA 2B8AA 1W2BA 3EFRA 2A3LA 5HY6A 4HCBA 5CCAA 4R56A 3BFMA 1M1GA 1Q81C 4C0DC 3HFOA 4KT0E 3OYFA 2X35A 3HP9A 4DOWA 3M5AA 3SWNB 4QQDA 4R55A 3M4GA 3CCST 2PVDB 4C92F 4OB2B 4ZTFA 1Q7YU 2WSCE 2DTOA 1S72T 1VQOT 3SD4A 3H8ZA 2ZPFB 3MEWA 5DY9A 5IT9E 1Y71A 4V2SA 2O01E 4Y28E 1K8AU 2HBPA 5LJ3d 4O6JA 4A4GA 4XU0A 1VQ4T 5M9OA 5FROA 2DK3A 3CCSA 4M7AB 1VIFA 5GMKh 3URGA 4QVCA 3C12A 5GANd 3N5BB 2KMTA 1QVFS 3VKIA 1N8RC 4HT9A 3OY9A 4XTWA 2VYTA 3SFMA 4M7DC 4HKEA 1UGQB 1KD1U 2XIDA 1KHIA 1TH7A 2RHUA 2L5QA 3FLGA 3HPWA 2P4TA 4UC4A 4B9WA 3DKMA 1O9SA 5GMKi 1X6OA 1YIJT 3MEVA 3L2RA 3PNWC 4BD3A 2K3YA 3L2VA 4IUUA 3CMEA 1GXIE 1YBYA 1FX7A 3TEEA 4BI4A 1YHQA 2EKOA 2GFUA 3ZBDA 3JB9H 1KHCA 2MWOA 2EWNA 2E1HA 2Y90A 3OYMA 4LD9K 3S3MA 4ZGJB 3CC4T 4C0FA 1BI3A 3A5ZB 4J6YA 3BY7A 3OYDA 2R5MA 3OYCA 2LDMA 3CPWS 2XU8A 4M75C 4JS5A 4F7UF 3JCMP 1FXXA 2VXEA 4J7FA 3CC4A 3LH0A 1U1SA 5GAMf 2JTMA 3TCJA 4FIBA 4BY6B 5IN1A 4M7AA 3H6ZA 2BUDA 1VQLA 1AHJB 1G3WA 2E12A 2MWPA 2E6NA 3V8LA 4M7DA 1PSFA 3BW1A 3CPWA 2ZPIB 3M55A 2RJDA 1G3SA 2K5FA 1KQ1A 3JCMJ 4QQGA 2IG0A 2KDSA 5AYFA 2YHTA 1JJ2A 1YI2T 4A4FA 1NE8A 1M90C 5IAYA 2EJGA 3OYIA 1VQ8A 1WGSA 2Y4YA 2CZ6B 4M75D 3EAEA 5D6WA 4EMKC 5CKDA 3KXTA 4Z02A 4CI0C 1M9SA 1NPPA 1LJOA 3F70A 3OBYA 5D6YA 4BE2A 2OTLA 3CC2A 4PJOA 2K4YA 5GAN4 4PKCC 4BE0A 2LVMA 1D3BB 3JB9I 4ME7A 4M75E 1BI2A 4PJOB 4HCZA 2LRQA 3INZA 2G3RA 4XTVA 4FT2A 5CO7A 4ZGEB 3J81E 1VQOA 1JJ2S 5GAMj 2JUFA 4OGEA 3LWIA 1JBMA 1U8RA 3QO3A 2X4WA 3L2WA 1WNLA 2XD0A 3CCJT 3P8HA 1N8RU 2KY9A 3X28B 4C8QC 1ZBXA 3GNFB 3JCMc 1LNXA 4C92B 1PSEA 2PU9B 4M7AE 2VV5A 1B34B 2KK4A 5GAMe 3SWNA 2R57A 2XDDA 2RA2A 3M58A 2LCCA 4FU6A 2HD0A 3A8LB 5J3BA 3CMET 4E7KA 4FT4A 4BE1A 1W4SA 1KC8U 2EQKA 4GY5A 4A54A 1EIFA 3G71T 4BY6C 5LJ5d 3S3NA 3A8MB 3MO8A 2DAQA 2O4XA 4OGCA 1VIEA 3OA6A 4BDZA 3DLMA 2BKDN 5C0MA 3VU3C 3PT9A 2F5TX 1NPRA 3OB9A 3QYHB 3SB2A 5GMKj 1YJNA 1M1KC 1OZ3A 3DB4A 1WQ7A 3FEOA 3QSUA 3RUXA 3JCMe 2ZCFB 2MAMA 2K2VA 1NZ9A 5J39A 2QTXA 1I81A 2RH2A 2HNIA 3HRTA 3M9QA 3OQ5A 5LJ3f 4JUVA 2EQUA 4Q5WA 3EFSA 2E41A 5CK9A 4ELYC 4C8QE 5GAN7 4BDYA 3LLRA 4NS5A 1N9SA 1VQ7T 1G3TA 4M7AC 2EAYA 2V8IA 4PL6A 1ZHIA 5A0LA 5GAOl 4D6WA 2K5IA 3ME9A 2RHXA 4ZGDB 1UGSB 2CZ7B 3QYGB 2D0QB 2FVUA 3VV0A 3X24B 2JVVA 2XK0A 3J80E 4F7UB 1K73C 3OMGA 4JRKA 5GAMd 3VUZA 5CKBA 1K8AC 4OB3B 1I8FA 2RD1A 3PIPA 4C8QA 4LDUA 3Q1JA 3E19A 3VYGA 3CMAA 2QQAA 5A2QE 2F69A 3ZEHA 4O5VA 1YITA 5HK3A 2VC8A 4M77F 3UWNA 3CCLT 5GAN3 2EQMA 2H3JA 3OS2A 4M78B 2GFAA 5FU6C 4FM4B 1XTDA 3SDZA 4ATOA 4N4IA 3QXEB 3MEUA 5LJ3j 3E1SA 1OYXA 3OW2A 4KUDK 3OBWA 3QIIA 2RI2A 2V8JA 4M7DB 4IURA 2NLUA 3A8HB 2C06A 1WJSA 3CCLA 4II1A 3MP1A 2DVEA 4LDVA 1Y96B 5DLQE 1VQKT 3FB9A 1R8OB 2DEQA 2E64A 1BIAA 4A4EA 3I55T 3VUBA 1Q82U 5LJ5g 3V8KA 1YIJA 3A8GB 1XQHA 5LJ3e 3OYNA 1LOJA 4IUPA 4HT8A 1Y7XA 4C8QB 4M7AD 2LCLA 2DIGA 3X25B 1Q81U 3CCET 4PJOC 1KG1A 2DPPB 5HK0A 1U1TA 1KQSS 3I56A 1YJWT 2EIFA 5CQYA 3FIFA 3G4ST 2HAXA 3GF5A 3CCVT 3CC7A 3JCMW 1VQMT 2EFIA 3PTAA 1I5LA 2JNGA 4L5GA 4JRQA 4M77G 3L42A 4ELZC 1X01A 2L89A 5CAIA 3JAME 2QQSA 4OB1B 2LX9A 3HHTB 3QJ6A 4M75A 2JOYA 4J8OA 4QW2A 1QVPA 3PFSA 2MI6A 3NFCA 3BDUA 5CKHA 4PJOD 2RI3A 2DXBA 2K5LA 3JB9F 3META 1Y96A 5CKFA 4E47A 3MP8A 4C92A 4LDYA 5LJ3g 2ZPBB 3R6OA 3QKJA 3LX7A 2QQ9A 3LYIA 4C5GA 3CCUT 5KE3A 3FC3A 4QVZA 2XG8D 1VQNA 3JCMX 3KUFA 2HQEA 2VXFA 1UB4A 1YCYA 2XDPA 1V29B 2L3RA 3HL8A 3WXMB 3P8BB 5DM7R 5J26A 5GAMg 5GANj 4XAXB 4FL6A 5GMKl 3C4SA 3ER0A 4XTUA 3QDRB 2DXTA 3L2UA 4MDWA 2DTHA 4RCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BE1 A;  2JTF A;  1OZ2 A;  2M16 A;  2B8A A;  2EQK A;  4GY5 A;  4IUQ A;  5D6X A;  3S3N A;  3MO8 A;  3OYF A;  4E7H A;  2X35 A;  2DAQ A;  2K3X A;  2O4X A;  2BIV A;  4QQ6 A;  2DIQ A;  3OA6 A;  4BDZ A;  2EQJ A;  2BKD N;  3DLM A;  3LGF A;  5C0M A;  4QQD A;  1G5V A;  4C5I A;  4ZTF A;  2D9T A;  3OB9 A;  2RO0 A;  3DB3 A;  1OZ3 A;  3DB4 A;  3FEO A;  3H8Z A;  3MEW A;  3SD4 A;  5KCO A;  4LD6 A;  4IUT A;  4OVA A;  4E7J A;  5J39 A;  4A4H A;  3M9Q A;  3OQ5 A;  4L59 A;  4A4G A;  4Q5W A;  2EQU A;  5M9O A;  5FRO A;  4BDY A;  3LLR A;  4NS5 A;  4X34 A;  1OI1 A;  4PL6 A;  2R58 A;  3OS0 A;  3OY9 A;  3ME9 A;  2RHX A;  3P8D A;  3OYB A;  2VYT A;  1WJQ A;  2QQR A;  2XK0 A;  2JZ2 A;  2RHU A;  3FLG A;  3OMG A;  3OYJ A;  4UC4 A;  4B9W A;  3MEA A;  4E7L A;  5CIU A;  3UT1 A;  3MEV A;  2O4X B;  3PNW C;  4BD3 A;  2K3Y A;  3L2R A;  3QBY A;  3E9F A;  4IUU A;  2RHZ A;  3Q1J A;  3L2V A;  5FRM A;  2EKO A;  3ZEH A;  2GFU A;  4N4H A;  2R5A A;  3LGL A;  1KHC A;  2MWO A;  1SSF A;  4IUV A;  3UWN A;  2EQM A;  3OYM A;  3OS2 A;  3OYK A;  2GFA A;  3PMI A;  3OS1 A;  3S3M A;  2HQX A;  3NTH A;  2GF7 A;  3OYD A;  2R5M A;  3OYC A;  2LDM A;  4N4I A;  4EDU A;  3MEU A;  2FHD A;  2P0K A;  1XNI A;  4IKF A;  1OYX A;  3LH0 A;  2M0O A;  2CKK A;  3QII A;  2RI2 A;  4C5E A;  5KH6 A;  4IUR A;  2NLU A;  1WJS A;  5IN1 A;  3PMT A;  3MP1 A;  4II1 A;  3H6Z A;  2BUD A;  2RHI A;  2WAC A;  2MWP A;  3CEY A;  2E6N A;  4A4E A;  2RJD A;  1H3Z A;  3FDR A;  3OYL A;  2RJF A;  4QQG A;  3OYN A;  2IG0 A;  4IUP A;  4PLL A;  3O8V A;  4A4F A;  5IAY A;  3OYG A;  2DIG A;  4E7K A;  3L2Q A;  3OYI A;  3S6W A;  5KE2 A;  1WGS A;  4B9X A;  4ZTJ A;  3EAE A;  5D6W A;  1WJR A;  3GOX A;  4PLI A;  4Z02 A;  2EFI A;  4BAC A;  5C6S A;  3F70 A;  4BE2 A;  3OYH A;  5D6Y A;  1RI0 A;  3L42 A;  2X4Y A;  2L8D A;  2L89 A;  2X4X A;  3OMC A;  2LTO A;  3E9G A;  2LVM A;  4BE0 A;  2QQS A;  3QJ6 A;  2RI5 A;  4CRI A;  2M1H A;  4N4G A;  4HCZ A;  3MP6 A;  4QW2 A;  2RHY A;  2LRQ A;  2YRV A;  2G3R A;  3PFS A;  2RI3 A;  3BDL A;  3MET A;  2X4W A;  5KCH A;  3L2W A;  3MP8 A;  3OYE A;  3QKJ A;  3LX7 A;  3LYI A;  3P8H A;  4C5G A;  5KE3 A;  3FC3 A;  4QVZ A;  4E7I A;  1MHN A;  3ASK A;  4RG2 A;  5FRN A;  2F5K A;  2RJC A;  2HQE A;  3KUF A;  2E5Q A;  2L3R A;  2XDP A;  3NTK A;  2RJE A;  3S3O A;  5J26 A;  2PQW A;  2R57 A;  4FL6 A;  3C4S A;  1N27 A;  3OYA A;  3NTI A;  3L2U A;  2LCC A;  4FU6 A;  4C5H A; 
#chains in the Genus database with same CATH topology
 2KRN A;  5GMK e;  4IUQ A;  1BKB A;  2XMF A;  1TUD A;  1E6G A;  2HSE B;  4F16 A;  2KXD A;  1T3S A;  2DXC A;  4OP0 A;  5GAM h;  2QGF B;  1RL2 A;  2X3X D;  1M27 C;  5LL6 S;  1BI1 A;  1PRL C;  1ZQ1 A;  3QDF A;  3CCM A;  2XIC A;  2PVG B;  2YWW A;  4FYX B;  3HRS A;  1M8V A;  1CSK A;  1OI1 A;  2A7Y A;  2P0P A;  2R58 A;  5GAN f;  1M5Q 1;  2D0N A;  1TXQ A;  3TSZ A;  1KD1 C;  4CC7 A;  1CKA A;  2QI2 A;  5CVI A;  3UT1 A;  1VYT A;  3CBO A;  3SEM A;  3QBY A;  1QCN A;  2DBK A;  4M77 E;  2RB6 A;  4F7U E;  1WZO A;  1Q7Y C;  1VQ7 Q;  3J7A F;  4IKF A;  2H3E B;  5KH6 A;  2NUP A;  1VQ9 T;  1RAH B;  2EYZ A;  1RAG B;  5A0D A;  2RHI A;  1UTI A;  4JJN K;  1KFZ A;  4HCK A;  2D6F A;  5LJ5 e;  1IB8 A;  5LJ3 h;  2QEX T;  4J9B A;  3O5Z A;  1YN8 A;  3I56 T;  1VQ6 T;  1P92 A;  1JEG A;  1UEB A;  3S6W A;  2ECZ A;  1LPL A;  4J7I A;  4M78 A;  2OAU A;  4M77 C;  5FU7 C;  1UJ0 A;  2CRE A;  1OQK A;  2O9S A;  1VQ4 A;  2BZ8 A;  2DJZ A;  1UGR B;  1VQL T;  4EMH A;  3T9N A;  3EH1 A;  2M1H A;  2CZ1 B;  3L1A A;  4JZ3 A;  2VGN A;  4XU3 A;  4ZNX A;  3SWN C;  3BDL A;  3M56 A;  1IGQ A;  4N0A A;  2DO3 A;  3CCQ Q;  2LT4 A;  3IQL A;  2QK0 A;  3EG1 A;  4FW1 A;  4RCB A;  1YIT Q;  1XJW B;  4OMO A;  1ZUU A;  2QXF A;  4X9C A;  4C92 D;  1BU1 A;  3OYA A;  2CUB A;  4DBF A;  2KQW A;  1IHV A;  1BYM A;  1YJ9 Q;  1OZ2 A;  2VUB A;  1M90 U;  2EGC A;  2VKN A;  2EGA A;  2KXC A;  2BIV A;  1MMD A;  2EQJ A;  3HRU A;  1IO6 A;  4C5I A;  4OF1 A;  3RER A;  1GCP A;  1VQP Q;  4OVA A;  2FB7 A;  3VJP A;  4XQ3 A;  3FRN A;  3JRZ A;  4MZT A;  4DOV A;  3G4S Q;  4M77 D;  3QUI A;  3JCM h;  4KH1 B;  4XU2 A;  3LW5 E;  2IVW A;  2QQR A;  3CXC P;  2JZ2 A;  1KQ2 A;  5GAN 6;  1YI2 A;  2XI9 A;  3E9F A;  3I55 A;  1MV0 B;  2A08 A;  4CC4 B;  3OYK A;  1QVG P;  2EW3 A;  4M78 F;  1FWZ A;  1K8A R;  2NUZ A;  3CXC A;  3PGG A;  2FYK A;  4M7D D;  4FW2 A;  2CKK A;  2CP5 A;  3QZ5 B;  4C92 G;  2F1L A;  4TVR A;  1D0Y A;  1VUB A;  2FEI A;  3G6E T;  2GNC A;  2C0T A;  2HKN A;  3G4S A;  2JN0 A;  3M54 A;  2CGH A;  3GIB A;  8AT1 B;  1D1A A;  2DER A;  1WJR A;  3M57 A;  5C6S A;  3OYH A;  4ANJ A;  1K0S A;  4JJD A;  4RG8 A;  4GLK A;  1ZLM A;  3QZ9 B;  3EGX B;  5KYX A;  2FG0 A;  5LJ5 h;  1ACM B;  3KBG A;  3EGU A;  3AHU A;  4F7U G;  2DLP A;  4E7I A;  5FLX E;  2RJC A;  2E5Q A;  2JS2 A;  2D8H A;  5L8R E;  4A63 B;  1ABO A;  1N27 A;  2W10 A;  3NTI A;  1Y07 A;  5GAO n;  3X26 B;  1MMA A;  4C5H A;  1HXD A;  2JXB A;  3MHX A;  3EFR A;  4HCB A;  4R56 A;  2IPO B;  1Q81 C;  4KGV B;  5ECA A;  4DOW A;  2J7I A;  3SWN B;  3UAT A;  1W1F A;  4PJN A;  4QQD A;  3M4G A;  4ZTF A;  3SD4 A;  5DY9 A;  3MEW A;  4V2S A;  1WYX A;  4Y28 E;  5LJ3 d;  4O6J A;  4OML A;  1K0X A;  2CP3 A;  1OPL A;  3G71 Q;  1JU5 C;  3CCS A;  4M7A B;  5GMK h;  3N5B B;  2KMT A;  2W0Z A;  1ZX6 A;  2RHU A;  2ENM A;  1NEB A;  4RUG A;  3L2R A;  3PNW C;  4BD3 A;  1OOT A;  3CME A;  4IUU A;  1Q81 R;  1GXI E;  4AFS C;  1FX7 A;  1YHQ A;  3CMA Q;  2GFU A;  1QKX A;  2RMO A;  3CC7 Q;  4LD9 K;  1H3H A;  1PNJ A;  1U3O A;  4M75 C;  2JJ9 A;  4J7F A;  3LH0 A;  1U1S A;  2JTM A;  4M7A A;  3H6Z A;  1S72 Q;  3I55 Q;  2PZ1 A;  2KDS A;  5AYF A;  1NE8 A;  2QA4 Q;  5KYY A;  3OYI A;  3I35 A;  4M75 D;  3KXT A;  4EMK C;  7AT1 B;  4CI0 C;  3F70 A;  1AWW A;  4BE2 A;  1IXD A;  2K4Y A;  1AVZ C;  1RAB B;  2E5K A;  4PKC C;  4BE0 A;  2P84 A;  2KBT A;  4IIM A;  4ME7 A;  4M75 E;  4HCZ A;  2DE0 X;  2G3R A;  1WHL A;  1HJD A;  2JUF A;  4OGE A;  3LWI A;  1JBM A;  1X69 A;  3L2W A;  3H9N A;  3CCJ T;  2H8H A;  2KY9 A;  4J9D A;  1LNX A;  2HSP A;  2FRY A;  5GAM e;  2R57 A;  2XDD A;  2RA2 A;  3M58 A;  4FU6 A;  2CP2 A;  2EQK A;  4GY5 A;  1TWB A;  3A8M B;  3OA6 A;  4BDZ A;  2CT3 A;  3VU3 C;  1R77 A;  2DRM A;  2GGR A;  1OZ3 A;  1TOV A;  2X9H A;  3RUX A;  2LQN A;  4Z89 A;  3JCM e;  1TSF A;  5J39 A;  2QTX A;  3M9Q A;  3OQ5 A;  4CC2 A;  1SHG A;  4BDY A;  3LLR A;  4NS5 A;  1N9S A;  1E6H A;  1HSQ A;  2V8I A;  4DEY A;  1K76 A;  2M51 A;  1VQ8 T;  1UGS B;  2CZ7 B;  2FVU A;  3VV0 A;  4WCI A;  1NM7 A;  3OMG A;  4JRK A;  4F04 B;  4LXC A;  1I8F A;  2P4R A;  3Q1J A;  2IIM A;  1ZSG A;  2F69 A;  2NUT A;  1QKW A;  5GAN 3;  3TVT A;  4E7Z A;  1QCO A;  4M78 B;  5FU6 C;  3SDZ A;  3PVL A;  1QMC A;  5IXF A;  3QII A;  4RTV A;  2V8J A;  3I9Q A;  4OMP A;  2C06 A;  4LDV A;  3V8K A;  3OYN A;  4HT8 A;  2HBW A;  2LCL A;  2DIG A;  4J9G A;  1Q81 U;  3CCE T;  4PJO C;  2EIF A;  5CQY A;  1RAA B;  3G4S T;  3JCM W;  2JNG A;  4ESR A;  2LP5 A;  3JAM E;  1OV3 A;  4J9C A;  2QQS A;  2JOY A;  2QDL A;  4J8O A;  4QW2 A;  1IRX A;  2VB6 A;  5CKH A;  2RI3 A;  2DXB A;  2K5L A;  1UEC A;  2EYW A;  1GCQ C;  4C92 A;  4LDY A;  3R6O A;  3LX7 A;  5KE3 A;  2HQE A;  1UB4 A;  1GCQ A;  3WXM B;  1K8A C;  3THK A;  3EG2 A;  3P8B B;  1RAC B;  3CCV Q;  2DXT A;  3HFO A;  4KT0 E;  2GTO A;  4RCC A;  4MMK A;  1HD3 A;  1GL5 A;  1X6G A;  4RMO A;  2BZX A;  4PNO A;  1PWT A;  3V8J A;  1PC0 A;  3M59 A;  3CCQ T;  5CR2 A;  2D1X A;  2KVQ G;  3M4Y A;  1B7T A;  4FSX A;  1M8M A;  4C0Z A;  2OTJ A;  4YTL A;  4M78 G;  1NJI C;  1FMV A;  1T0J A;  1CKB A;  4X34 A;  1Q86 U;  1M4Z A;  4JJC A;  1SPK A;  3OYB A;  4EMK A;  3MEA A;  1MMN A;  1VQO Q;  1RLQ C;  2G6F X;  5FRM A;  2JW4 A;  5I2S A;  6AT1 B;  1ABQ A;  3RKX A;  4C8Q D;  3NTH A;  2GF7 A;  2ESW A;  4PJM A;  2C0I A;  1AWX A;  4LDW A;  2P0K A;  2J05 A;  2HQH A;  2JMA A;  3A8O B;  1OPK A;  3HSB A;  3FDR A;  1SSH A;  3VS3 A;  3GPL A;  2CH4 W;  1IRE B;  3O8V A;  1D3B A;  4Y92 A;  1YJW A;  2XDB A;  5GAO r;  1K73 U;  5KE2 A;  5A0G A;  1M1F A;  1G8X A;  3AT1 B;  4PLI A;  1M1K R;  2CZ0 B;  2CDT A;  2MF2 A;  4AG2 C;  4M7A F;  4PK4 A;  1BBZ A;  3M0T A;  4XTY A;  2LJ3 A;  1QVF A;  1BCM A;  1HYO A;  1OUL A;  3NGP A;  3OYE A;  1LCK A;  2JS0 A;  3M0S A;  1X75 C;  3ASK A;  4M7D G;  3FJP A;  1BI0 A;  2DZ9 A;  3OS5 A;  4BI3 A;  2YLC A;  2KEA A;  2M9U A;  1VQK Q;  2DXU A;  1VQ5 T;  4JRI A;  1TUC A;  1ZSZ B;  2K3X A;  3JB9 G;  1G5V A;  5KYY B;  2LZ6 B;  1WQW A;  4DA4 A;  1YFN A;  1PM3 A;  3CPF A;  4LD6 A;  3I5R A;  1PG5 B;  4AFQ C;  4PFO A;  5GAN h;  5KYW B;  2DYB A;  3QPH A;  2OTL Q;  2CP0 A;  2OTL T;  3CC2 T;  2OAW A;  2YT6 A;  4MZM A;  3OW2 P;  1QP3 A;  1WJQ A;  2QTV A;  1HK9 A;  2HL5 C;  2J6K A;  5GAO q;  3OYJ A;  1VQ9 Q;  5GAN 8;  2QEX A;  3EG9 A;  2X3W D;  3G6E A;  2RHZ A;  1VQP A;  2YXY A;  2QDY B;  2SEM A;  2HEQ A;  3RMS A;  4Y91 A;  3LGL A;  4N4H A;  4NOY A;  5HKC A;  4ZN3 A;  1VQN T;  2ZPG B;  1VQN Q;  3PMI A;  3CCU Q;  1M90 R;  1D0Z A;  1NLP C;  1R0B G;  2K57 A;  1VQ5 Q;  3RMQ A;  1FYN A;  3GNG A;  1NYG A;  4OB0 B;  2WSF E;  2HCK A;  2GQV A;  1Q82 C;  1VQM A;  1K9M U;  4JDS A;  4DBH A;  1WXT A;  1KK7 A;  2KRO A;  4J9I A;  1M2V B;  4ZTJ A;  5LJ5 j;  1PCX A;  1UHF A;  4OMF B;  3E9G A;  3LWH A;  1VQ4 Q;  1RAE B;  3QWX X;  4C0D B;  4ZN1 A;  3JB9 J;  4HVV A;  1YJN T;  2GCX A;  1QWE A;  4VUB A;  4NL3 A;  3X20 B;  3RIR A;  4XTX A;  1BIB A;  3HFN A;  4RG2 A;  2VGM A;  3S3O A;  3NTK A;  2KT8 A;  2KR3 A;  1N8R R;  1O75 A;  2OX7 A;  2J6O A;  2RQT A;  4BUG A;  2PUK B;  1W2B A;  2KYB A;  2A3L A;  2DET A;  1M1G A;  4C0D C;  3OYF A;  1PKS A;  1UJY A;  1M3B A;  1VQ6 Q;  4R55 A;  4C92 F;  4OB2 B;  2EYX A;  2FZG B;  2ZPF B;  5IT9 E;  2HZY A;  1Y71 A;  2O01 E;  1K8A U;  4XU0 A;  2RF0 A;  1Z9Q A;  5FRO A;  2DK3 A;  1QVF S;  1N8R C;  4FYW B;  3OY9 A;  2F2V A;  1VQ8 Q;  3SFM A;  4HKE A;  2XID A;  5FW9 A;  4UC4 A;  1OEB A;  1ZSZ A;  2DIL A;  4RTU A;  1X6O A;  2NYS A;  3L2V A;  2K3Y A;  2HDA A;  4DBR A;  2L2P A;  2MWO A;  2O9V A;  2Y90 A;  3OYM A;  1KIK A;  3CC4 T;  3OYD A;  3OYC A;  3CPW S;  2XU8 A;  3JCM P;  1I07 A;  5GAM f;  2BUD A;  2KRM A;  1M2V A;  2MWP A;  2V1R A;  2DBM A;  1PSF A;  2RQU A;  4QQG A;  1G83 A;  2IG0 A;  1JJ2 A;  2ED0 A;  1M90 C;  5IAY A;  1D1B A;  1UE9 A;  5L23 A;  1TU0 B;  2B86 A;  1WGS A;  1V76 A;  5D6W A;  3CC2 A;  1NPP A;  3OBY A;  2JT4 A;  2LVM A;  1D3B B;  1W2B P;  3NHN A;  2K6D A;  1YNZ A;  2LRQ A;  4JPB W;  4XTV A;  4FT2 A;  3QO3 A;  3CCS Q;  2DF6 A;  1BB9 A;  1AT1 B;  1BCO A;  3P8H A;  1JO8 A;  5D7U A;  1N8R U;  3X28 B;  1PD1 A;  4C8Q C;  2BZY A;  2YDL A;  1PSE A;  2PU9 B;  3REB B;  3SWN A;  1E7O A;  4E7K A;  2HD0 A;  3CME T;  3REA B;  1IHW A;  3G71 T;  1QQJ A;  4BY6 C;  2MYS A;  4OGC A;  2DL4 A;  5C0M A;  1KD1 R;  1M30 A;  4R0K A;  1SG5 A;  3PE0 A;  3PT9 A;  1X6B A;  1NPR A;  2CP6 A;  3QYH B;  2ED1 A;  3SB2 A;  2QG9 B;  3OB9 A;  4AT1 B;  5GMK j;  2FPF A;  4QT7 A;  1Y0M A;  2MAM A;  2ZCF B;  5KYU B;  1NZ9 A;  2RH2 A;  2HNI A;  1LVK A;  3M0U A;  4JUV A;  3EFS A;  2E41 A;  5CK9 A;  4C8Q E;  1VQ7 T;  1YCS B;  2EAY A;  1YWO A;  1QCF A;  4D6W A;  4ZGD B;  2YUO A;  2D0Q B;  3VUZ A;  5CKB A;  1N5Z A;  3G6E Q;  4PJJ A;  5GJV B;  4PJL A;  2KI7 A;  4LDU A;  4C8Q A;  3E19 A;  3VYG A;  3CMA A;  2QQA A;  4M77 F;  3CCL T;  2H3J A;  4FM4 B;  3CCR Q;  3RNJ A;  4KUD K;  3OBW A;  2EVR A;  2NLU A;  3A8H B;  4II1 A;  2DEQ A;  1AEY A;  2E64 A;  4A4E A;  1RI9 A;  3VUB A;  5LJ5 g;  4B6M A;  1YIJ A;  2JM8 A;  3A8G B;  4RTX A;  1OX8 A;  5LJ3 e;  1LOJ A;  2ROL A;  1Y7X A;  1SEM A;  4C8Q B;  1TTH B;  1KG1 A;  1RAD B;  2FPD A;  1KQS S;  3I56 A;  2HAX A;  3FIF A;  1PKT A;  3CC7 A;  2EFI A;  2K2M A;  1I5L A;  2ABL A;  4M77 G;  3VS5 A;  4ELZ C;  2V26 A;  3VS0 A;  1YHQ Q;  2LX9 A;  2DYI A;  3NFC A;  4PJO D;  3JB9 F;  2CSQ A;  5LJ3 g;  3R6N A;  2QQ9 A;  2XG8 D;  1NLO C;  2GBQ A;  3HL8 A;  5GAN j;  1ZSZ C;  4XAX B;  4FL6 A;  4XTU A;  4JZ4 A;  3QDR B;  1MV3 A;  4PJO E;  4MDW A;  4GBQ A;  2JTF A;  4L6V 5;  1K9A A;  4OMN A;  1WA7 A;  3NPF A;  4E7H A;  1WHK A;  2EGE A;  3G7Z A;  1Q82 R;  2A0F B;  1VQ7 A;  2DKG A;  4E7S A;  3VRZ A;  2DL7 A;  2OTJ T;  2F2W A;  4A4K A;  2FZC B;  2LQK A;  4M77 A;  1JQQ A;  4JLG A;  3JCM Q;  4L59 A;  2QA4 T;  3ZL7 C;  3FJ5 A;  4M7A G;  2ZZD A;  1SRM A;  3HTR A;  2EYQ A;  2LC4 A;  2X4J A;  1UGV A;  3TU4 K;  4N0A C;  3OW2 S;  1SHF A;  4M75 B;  4M7D F;  3D7S B;  1T3L A;  5EG2 A;  1M3A A;  3EG9 B;  4IUV A;  4BB7 A;  1VQ9 A;  1BK2 A;  4EDU A;  2FHD A;  3CCM Q;  4X9D A;  2COW A;  1KQS A;  4C92 C;  3PMT A;  1YP5 A;  3ULR B;  1QVG A;  4J83 A;  1B07 A;  1H3Z A;  1K9M C;  2RJF A;  8ATC B;  4PLL A;  2COY A;  1W6X A;  3OYG A;  3OYY A;  4J5Y A;  2ATC B;  1ZBJ A;  3CCE A;  3CCE Q;  2ROT A;  4KUL A;  1RI0 A;  5GAN 2;  3CXC S;  4D8K A;  4C0G A;  1AZE A;  1NYF A;  5FWB A;  4J9E A;  3MP6 A;  1FMW A;  3M0Q A;  1I0C A;  3NMZ C;  4C92 E;  1FMK A;  1MHN A;  5FWC A;  4NL2 A;  2FZK B;  1YHQ T;  3SHW A;  3JCM d;  3BE3 A;  2DL5 A;  2O2O A;  3A1P A;  2QQB A;  2LT1 A;  2DX1 A;  1EZZ B;  4QQ6 A;  1UG1 A;  4WF2 A;  3JCM b;  3EGD A;  2LNH B;  4M75 G;  2RK1 A;  2LQ8 A;  5KCO A;  4IUT A;  2I2L A;  4E7J A;  2EJF A;  4A4H A;  3JCM f;  4EMK B;  2EPD A;  1NJI U;  4JS4 A;  3CCQ A;  1Q86 C;  2NUT B;  3OS0 A;  3P8D A;  3V7S A;  1VQ5 A;  2DMO A;  2HKQ B;  2EQI A;  5GJW B;  4P5N A;  2QYZ A;  2NUP B;  3WVE B;  2JM9 A;  2DEU A;  4PJO G;  2R5A A;  1SSF A;  4FCY A;  1C0M A;  1M2O A;  2MMP A;  4EPC A;  3GP8 A;  3CCJ A;  2DD5 A;  3OSS C;  1XNI A;  3CD6 A;  2M0O A;  4C5E A;  1IZ6 A;  4J6W A;  1YJ9 T;  2MCN A;  2WAC A;  1K9M R;  1WPY A;  3UPU A;  2EJ9 A;  1VQP T;  4M4Z A;  4C8Q F;  2FL7 A;  2WSE E;  5I2M A;  4D8D A;  3L2Q A;  2E70 A;  2PVO B;  2DVJ A;  1RLP C;  4RTZ A;  4IIO A;  2AKL A;  2BE7 D;  1WHG A;  2RM4 A;  2P0Q A;  2X4Y A;  3ZFJ A;  2L8D A;  2X4X A;  3OMC A;  2LTO A;  3C94 A;  1XOV A;  4MML A;  3TRE A;  2CP7 A;  2QAS A;  2CSI A;  1A0N B;  2QEX Q;  2KAF A;  2MIO A;  5GAN 5;  2AT1 B;  3QHS A;  4KUI A;  2J06 A;  1SF9 A;  1JJ2 P;  4HCC A;  2LX7 A;  3VS4 A;  2L3P A;  3CPW P;  2F5K A;  4C8Q G;  2XHC A;  3CME Q;  3OSV A;  4M7D E;  1W70 A;  2O88 A;  5CCA A;  1WX6 A;  2PNI A;  4QKU A;  2WSC E;  2DTO A;  1S72 T;  3H8Z A;  1X27 A;  1JXO A;  4CC3 A;  2HBP A;  4RTW A;  2JTE A;  4A4G A;  5M9O A;  3JV3 A;  4GLM A;  2GQI A;  4JJB A;  3VKI A;  4XTW A;  2VYT A;  4KGZ B;  3A98 A;  1KD1 U;  5IHN A;  1KHI A;  1TH7 A;  3FLG A;  2L5Q A;  4AMC A;  4AFZ C;  3DKM A;  5GMK i;  1YIJ T;  1YBY A;  3ZBD A;  1WDX A;  1ZA1 B;  5HCK A;  4C0F A;  3A5Z B;  3BY7 A;  2R5M A;  1FXX A;  2VXE A;  1F1B B;  3EG0 A;  1ZUK A;  3TCJ A;  4FIB A;  5IN1 A;  1VQL A;  1AWO A;  2E6N A;  2EBP A;  3V8L A;  4M7D A;  3BW1 A;  2RJD A;  1K73 R;  1KQ1 A;  2YHT A;  1YI2 T;  4A4F A;  2EJG A;  2HL3 A;  2C0O A;  5KYW A;  2Y4Y A;  2K7A A;  2OTJ Q;  3EAE A;  5CKD A;  2Z0W A;  4Z02 A;  1M9S A;  2ZAE A;  1KQS P;  3JB9 I;  1BI2 A;  1RAF B;  1Z9Z A;  4ZGE B;  5CO7 A;  3J81 E;  1VQO A;  1JJ2 S;  1WIE A;  3G1J A;  3U23 A;  2XD0 A;  1YIJ Q;  1Q7Y R;  4KH0 B;  1ZBX A;  2J6F A;  3GNF B;  4C92 B;  4M7A E;  1B34 B;  2KK4 A;  1H8K A;  5J3B A;  4FT4 A;  2KGT A;  1X2Q A;  2MK5 A;  2DAQ A;  2OJ2 A;  1VIE A;  3DLM A;  3I56 Q;  1WFW A;  1UHC A;  1YJN A;  2M02 A;  2DM1 A;  1I81 A;  1NBE B;  3H0I A;  5LJ3 f;  2EQU A;  1G2B A;  4ELY C;  4M7A C;  2KRS A;  3QWY A;  2K5I A;  2VWF A;  3QYG B;  3J80 E;  3X24 B;  1K73 C;  2XK0 A;  1ZA2 B;  4LE9 A;  4F7U B;  2KE9 A;  2YUP A;  4OB3 B;  3PIP A;  4WTO B;  4O5V A;  5KYN A;  2RQR A;  1ZUY A;  1XTD A;  5KYU A;  2DL8 A;  4ATO A;  2AKK A;  1H92 A;  4N4I A;  3MKD A;  5LJ3 j;  3OW2 A;  1V1C A;  2RI2 A;  3CCL A;  3MP1 A;  2DVE A;  4PFP A;  3FB9 A;  1BIA A;  2DFU A;  2LCS A;  1MUZ A;  4PFZ A;  4IUP A;  2RQW A;  2F2X A;  4M7A D;  1U06 A;  5HK0 A;  1U1T A;  1YJW T;  2LJ0 A;  1UFF A;  1VQM T;  1VQM Q;  4L5G A;  9ATC B;  1X01 A;  2L89 A;  1X2K A;  1U5S A;  3QJ6 A;  2KYM A;  4OMQ A;  4M75 A;  4HVW A;  2A36 A;  3M0R A;  4FYY B;  1QVP A;  3PFS A;  2MI6 A;  3BDU A;  1Y96 A;  3CQT A;  5CKF A;  1QLY A;  2ZPB B;  3LYI A;  3FC3 A;  4QVZ A;  1VQN A;  3JCM X;  5IXB A;  1UDL A;  3KUF A;  2K79 A;  2L3R A;  4HVU A;  1YCY A;  5GAM g;  3MPU B;  4FYV B;  3C4S A;  4LUE A;  1VYV A;  3L2U A;  2DTH A;  1H64 1;  2FO0 A;  2M16 A;  1WHM A;  4J9F A;  2QGG A;  2DRK A;  2E3H A;  3RDV A;  2DIQ A;  3LGF A;  4Z8A A;  3JCM V;  1WHH A;  2I0N A;  1NG2 A;  2MOX A;  3RKY A;  2D9T A;  1PRM C;  3M0P A;  4MDX A;  2RO0 A;  2QA4 A;  3JCM g;  4J9H A;  3V7R A;  4JLI A;  3PIO A;  2DJQ A;  1S72 A;  3GBQ A;  1K4U S;  1VA7 A;  3V7C A;  1WXU A;  2LQW A;  4XK8 E;  4F7U A;  3CCV A;  1JRI A;  4XU1 A;  2A37 A;  2CYZ B;  3JSC A;  3PVQ A;  4KGX B;  4RKU E;  3WVD B;  1VQ6 A;  5CIU A;  4X1V A;  2O4X B;  2E6Z A;  3EFO A;  1SKU B;  2DZC A;  3I5S A;  5GAO m;  3OS1 A;  3VS1 A;  4JRP A;  1YI2 Q;  2HQX A;  1WHJ A;  2YUN A;  1JB0 E;  1I1J A;  1QVG S;  2L0A A;  1WLP B;  1D0X A;  4XTZ A;  4M75 F;  3VRY A;  1GRI A;  3CEY A;  3DLL A;  1KC8 C;  3CC4 Q;  4A53 A;  3C0C A;  2DTI A;  3EFO B;  4B9X A;  1QW1 A;  4BI8 B;  3GOX A;  3QJY A;  4BAC A;  1DJ7 B;  1G3Y A;  3CCM T;  2KSS A;  3RES A;  5GMK m;  2E65 A;  4DQ2 A;  2XKO C;  1I4K 1;  2RHY A;  4J6X A;  3RBB B;  5GAO p;  1Y57 A;  3CD6 T;  3GLX A;  4M77 B;  5FU7 B;  5KCH A;  3MJX A;  5AT1 B;  1KSW A;  1N9R A;  2V8K A;  3UA6 A;  5FU6 B;  3KFV A;  3G71 A;  2RJE A;  3RKW A;  1UGP B;  2PQW A;  2PUO B;  2BE9 B;  3H0F A;  2FPE A;  5LJ5 f;  3HKS A;  3TSW A;  2K9G A;  5GAN e;  2QAZ A;  3DB3 A;  1VYU A;  1X43 A;  1RUW A;  4DEX A;  3UDC A;  3CCL Q;  5EC7 A;  3MCA B;  4KRT A;  1Q86 R;  4QVD A;  2DA9 A;  4HA8 A;  3CC2 Q;  2ZPE B;  4HXJ A;  2OI3 A;  1GFD A;  4MZP A;  5GAN g;  1OX9 A;  2VAS A;  5CQX A;  4E7L A;  2EYY A;  5I21 A;  5CKE A;  5IH2 A;  2AHJ B;  1VQK A;  2CS7 A;  1K1Z A;  2O31 A;  1YWP A;  1EX4 A;  2L3Q A;  1N6A A;  3CCU A;  3CCR T;  2RPN A;  3VS2 A;  4RTY A;  3VS6 A;  4LDX A;  1MNE A;  2FRW A;  4KBM B;  2LNV A;  5I22 A;  1MGQ A;  4M78 C;  1RAI B;  3CMA T;  1AWJ A;  3CBP A;  3OYL A;  3CC7 T;  3M53 A;  4F17 A;  4E6R A;  2KT1 A;  1QP2 A;  1T0H A;  2DD4 A;  4OMM A;  3VS7 A;  1B34 A;  1OU9 A;  1QVF P;  3VYH B;  2RK2 A;  4EIK A;  4Z88 A;  2AIR B;  2E3I A;  1M1K U;  4AG1 C;  1YJ9 A;  2RI5 A;  4M78 D;  4CRI A;  3C95 A;  4N4G A;  2YRV A;  1W2B S;  2Y4X A;  2YLB A;  4LUD A;  1YJN Q;  3QG1 A;  2ZGW A;  3CCR A;  1IGU A;  4M78 E;  2E10 A;  3CBM A;  5FRN A;  4ORZ A;  1YIT T;  3L2Z A;  4EMG A;  2ZPH B;  2YRD A;  4PJO F;  3JB9 D;  5D6X A;  5DLO A;  2B8A A;  4DBQ A;  3CD6 Q;  5HY6 A;  1MND A;  3BFM A;  2X35 A;  3HP9 A;  3M5A A;  3CCJ Q;  3CCS T;  2PVD B;  2X51 A;  1Q7Y U;  1VQO T;  2AZS A;  1SRL A;  1B3Q A;  1VQ4 T;  1VIF A;  3URG A;  4QVC A;  3C12 A;  5GAN d;  1AD5 A;  1YJW Q;  4HT9 A;  1D1C A;  1TUG B;  4M7D C;  1UGQ B;  3TQ7 P;  3HPW A;  2D8J A;  2P4T A;  4B9W A;  1O9S A;  3LH5 A;  3MEV A;  3TEE A;  4BI4 A;  4RTT A;  2EKO A;  3JB9 H;  1KHC A;  2DL3 A;  2EWN A;  2E1H A;  1NJI R;  3S3M A;  4ZGJ B;  1PHT A;  4E2F B;  1BI3 A;  4J6Y A;  4JS5 A;  2LDM A;  4F7U F;  3RR6 A;  3CC4 A;  2K3B A;  1I5O B;  4BY6 B;  2BTT A;  1J3T A;  1ARK A;  4LNP A;  1AHJ B;  1G3W A;  2E12 A;  1EFN A;  3CPW A;  2ZPI B;  3M55 A;  1G3S A;  1D09 B;  2K5F A;  3JCM J;  2NWM A;  2A28 A;  1OU8 A;  3EGD B;  2CH4 A;  2M0Y A;  1VQ8 A;  3EGX A;  2CZ6 B;  1LJO A;  2L3S A;  2OTL A;  5D6Y A;  4PJO A;  3H41 A;  5GAN 4;  2HMA A;  2RQV A;  3EG3 A;  4PJO B;  1C1A A;  3INZ A;  2YSQ A;  1KC8 R;  5GAM j;  2AZV A;  1U8R A;  2EKH A;  2X4W A;  2AK5 A;  1WNL A;  3JCM c;  2VV5 A;  1Q95 G;  2VVK A;  2LCC A;  3A8L B;  4BE1 A;  1W4S A;  1KC8 U;  1QWF A;  4A54 A;  1EIF A;  5LJ5 d;  3S3N A;  2COZ A;  3MO8 A;  1NEG A;  2O4X A;  2KNB B;  2BKD N;  2YRC A;  2F5T X;  1M1K C;  3DB4 A;  1WQ7 A;  3FEO A;  4AFU C;  3QSU A;  5IHK A;  2K2V A;  2SRC A;  2V1Q A;  3HRT A;  4Q5W A;  4F14 A;  5GAN 7;  1TS9 A;  1G3T A;  3EH2 A;  1M3C A;  4PL6 A;  1C6V X;  1ZHI A;  5A0L A;  5GAO l;  3H0H A;  3ME9 A;  4K11 A;  2E4H A;  2RHX A;  1VOM A;  2JVV A;  5GAM d;  2JMC A;  2CUD A;  5KYX B;  3EHR A;  2RD1 A;  1GBR A;  3UF4 A;  5A2Q E;  2PTK A;  3ZEH A;  2LJ1 A;  1YIT A;  5HK3 A;  2VC8 A;  1AZG B;  3UWN A;  1WXB A;  2EQM A;  3OS2 A;  2GFA A;  2GTJ A;  3QXE B;  3EHQ A;  3MEU A;  1TG0 A;  3E1S A;  1OYX A;  5IHI A;  4IUR A;  4M7D B;  1WJS A;  3E2U A;  1Y96 B;  5DLQ E;  1VQK T;  1VQL Q;  1R8O B;  3I55 T;  1UUE A;  1Q82 U;  1WI7 A;  4FSS A;  1XQH A;  2CT4 A;  5I11 A;  1JXM A;  2MPX C;  2LMJ A;  3X25 B;  1GBQ A;  2DPP B;  1R0C B;  3GF5 A;  3CCV T;  1GFC A;  3PTA A;  4JRQ A;  3L42 A;  5CAI A;  4OB1 B;  3HHT B;  2RNA A;  2DNU A;  4LN2 A;  3MET A;  4E47 A;  2YUQ A;  3MP8 A;  3UA7 A;  3QKJ A;  1KJW A;  4C5G A;  3CCU T;  1PD0 A;  1AOJ A;  2VXF A;  2XDP A;  1S1N A;  1V29 B;  5DM7 R;  5J26 A;  2RN8 A;  5GMK l;  1MMG A;  3ER0 A; 
#chains in the Genus database with same CATH homology
 4MMK A;  1H64 1;  2JTF A;  2M16 A;  4L6V 5;  5GMK e;  4IUQ A;  1BKB A;  4RMO A;  4PNO A;  4E7H A;  3V8J A;  3G7Z A;  3M59 A;  2DIQ A;  3CCQ T;  3LGF A;  2DXC A;  5CR2 A;  1VQ7 A;  4OP0 A;  2DKG A;  3JCM V;  5GAM h;  4MDX A;  3RKY A;  2D9T A;  2RO0 A;  2QA4 A;  2OTJ T;  1RL2 A;  2KVQ G;  3M4Y A;  3JCM g;  4A4K A;  2LQK A;  4FSX A;  1BI1 A;  5LL6 S;  3V7R A;  4M77 A;  4JLG A;  4PJO E;  3JCM Q;  4JLI A;  4C0Z A;  1ZQ1 A;  4L59 A;  3PIO A;  2QA4 T;  1S72 A;  2OTJ A;  3CCM A;  4YTL A;  4M78 G;  2XIC A;  3V7C A;  4M7A G;  2PVG B;  1NJI C;  4XK8 E;  2ZZD A;  4F7U A;  3HRS A;  1M8V A;  4X34 A;  3CCV A;  1OI1 A;  2A7Y A;  1JRI A;  1M4Z A;  2EYQ A;  2LC4 A;  2R58 A;  2P0P A;  4XU1 A;  2X4J A;  5GAN f;  1M5Q 1;  3OYB A;  3TU4 K;  2CYZ B;  1KD1 C;  3JSC A;  4RKU E;  4N0A C;  3WVD B;  1VQ6 A;  4EMK A;  3OW2 S;  3MEA A;  2QI2 A;  5CIU A;  4M75 B;  5CVI A;  3UT1 A;  4M7D F;  2O4X B;  2E6Z A;  3CBO A;  5FRM A;  3QBY A;  2DZC A;  5I2S A;  5EG2 A;  4IUV A;  4M77 E;  2RB6 A;  3RKX A;  4BB7 A;  5GAO m;  3OS1 A;  5GMK m;  4JRP A;  1VQ9 A;  1Q86 U;  2HQX A;  4C8Q D;  3NTH A;  2GF7 A;  4F7U E;  1JB0 E;  4EDU A;  1Q7Y C;  2FHD A;  4LDW A;  2P0K A;  1QVG S;  4X9D A;  4IKF A;  3J7A F;  1VQ9 T;  5KH6 A;  1KQS A;  3A8O B;  4XTZ A;  4M75 F;  4C92 C;  1VQ8 T;  3PMT A;  5A0D A;  2RHI A;  4JJN K;  1QVG A;  3CEY A;  4J83 A;  3DLL A;  5LJ5 e;  2D6F A;  3HSB A;  1H3Z A;  1K9M C;  3FDR A;  5LJ3 h;  2RJF A;  2QEX T;  4PLL A;  3GPL A;  1KC8 C;  1IRE B;  3O8V A;  1D3B A;  4A53 A;  3I56 T;  3OYG A;  3OYY A;  1YJW A;  1P92 A;  1VQ6 T;  2XDB A;  4J5Y A;  1UEB A;  3CCE A;  5GAO r;  1K73 U;  3S6W A;  2DTI A;  5A0G A;  1M1F A;  4B9X A;  5KE2 A;  4J7I A;  4M78 A;  1QW1 A;  4PLI A;  4BI8 B;  3GOX A;  2OAU A;  3QJY A;  4M77 C;  5FU7 C;  4BAC A;  1DJ7 B;  1RI0 A;  1G3Y A;  2CZ0 B;  4KUL A;  5GAN 2;  3CXC S;  4C0G A;  3CCM T;  1VQ4 A;  2DJZ A;  2MF2 A;  1UGR B;  1VQL T;  4EMH A;  3T9N A;  2KSS A;  3RES A;  2M1H A;  2E65 A;  4DQ2 A;  2XKO C;  3MP6 A;  1I4K 1;  2CZ1 B;  2RHY A;  3L1A A;  4J6X A;  5GAO p;  4M7A F;  2VGN A;  4XU3 A;  3CD6 T;  4XTY A;  1QVF A;  3GLX A;  3BDL A;  3M56 A;  4M77 B;  5FU7 B;  3SWN C;  4C92 E;  5KCH A;  4N0A A;  3OYE A;  1N9R A;  2DO3 A;  2LT4 A;  2V8K A;  1X75 C;  1MHN A;  3ASK A;  4RCB A;  5FU6 B;  4M7D G;  3G71 A;  2RJE A;  3FJP A;  2QXF A;  4NL2 A;  1BI0 A;  2DZ9 A;  1UGP B;  2PQW A;  4X9C A;  3RKW A;  2PUO B;  4C92 D;  1YHQ T;  3OYA A;  3OS5 A;  3JCM d;  2KQW A;  1BYM A;  4BI3 A;  2YLC A;  1OZ2 A;  2VUB A;  1M90 U;  2M9U A;  5LJ5 f;  2DXU A;  3HKS A;  2QQB A;  1VQ5 T;  2LT1 A;  4JRI A;  2K3X A;  5GAN e;  2BIV A;  4QQ6 A;  3JB9 G;  2EQJ A;  4WF2 A;  3HRU A;  1G5V A;  4C5I A;  4OF1 A;  3JCM b;  3RER A;  1WQW A;  4DA4 A;  4M75 G;  3DB3 A;  2RK1 A;  2LQ8 A;  3CPF A;  4LD6 A;  5KCO A;  4IUT A;  4OVA A;  3UDC A;  2FB7 A;  2I2L A;  3VJP A;  4E7J A;  2EJF A;  3MCA B;  4XQ3 A;  4A4H A;  3FRN A;  3JCM f;  5GAN h;  3JRZ A;  3QPH A;  4EMK B;  4QVD A;  4MZT A;  4HA8 A;  2OTL T;  1NJI U;  3CC2 T;  4JS4 A;  2ZPE B;  4MZM A;  4DOV A;  4M77 D;  1QP3 A;  3QUI A;  3CCQ A;  3OS0 A;  3JCM h;  1Q86 C;  3P8D A;  4XU2 A;  3V7S A;  3LW5 E;  1VQ5 A;  1WJQ A;  2IVW A;  2QQR A;  4MZP A;  1HK9 A;  2JZ2 A;  5GAN g;  1KQ2 A;  5GAO q;  5GAN 6;  3OYJ A;  1YI2 A;  5GAN 8;  5CQX A;  2XI9 A;  2QEX A;  4E7L A;  5I21 A;  5CKE A;  3G6E A;  3E9F A;  2AHJ B;  2RHZ A;  3I55 A;  1VQP A;  2QDY B;  4P5N A;  1VQK A;  3WVE B;  2CS7 A;  3RMS A;  4N4H A;  2R5A A;  3LGL A;  4NOY A;  4PJO G;  4Y91 A;  1SSF A;  4ZN3 A;  5HKC A;  2ZPG B;  1VQN T;  2MMP A;  4EPC A;  3OYK A;  3PMI A;  3GP8 A;  4M78 F;  3CCU A;  1N6A A;  3CCJ A;  1FWZ A;  2DD5 A;  3CCR T;  3CXC A;  3PGG A;  2K57 A;  3OSS C;  2FYK A;  4M7D D;  1XNI A;  3CD6 A;  3RMQ A;  4LDX A;  2M0O A;  2CKK A;  3GNG A;  4C5E A;  3QZ5 B;  4C92 G;  4OB0 B;  1IZ6 A;  4KBM B;  4TVR A;  2LNV A;  4J6W A;  1YJ9 T;  1MGQ A;  2WSF E;  1VUB A;  2GQV A;  4M78 C;  3CMA T;  2WAC A;  1WPY A;  3UPU A;  1Q82 C;  2EJ9 A;  3CBP A;  1VQP T;  3G6E T;  4C8Q F;  3OYL A;  1VQM A;  1K9M U;  3CC7 T;  4JDS A;  3M53 A;  3G4S A;  2JN0 A;  2FL7 A;  3M54 A;  2CGH A;  2WSE E;  5I2M A;  3GIB A;  1QP2 A;  2DD4 A;  3L2Q A;  2E70 A;  1B34 A;  2PVO B;  4ZTJ A;  1WJR A;  5LJ5 j;  3M57 A;  3VYH B;  2RK2 A;  5C6S A;  3OYH A;  2RM4 A;  2P0Q A;  2X4Y A;  4OMF B;  3ZFJ A;  1M1K U;  2L8D A;  2X4X A;  3OMC A;  2LTO A;  3C94 A;  3E9G A;  1XOV A;  4MML A;  3TRE A;  3LWH A;  4RG8 A;  1YJ9 A;  4GLK A;  4C0D B;  2RI5 A;  4M78 D;  4CRI A;  3C95 A;  4N4G A;  3QZ9 B;  4ZN1 A;  3JB9 J;  2YRV A;  2KAF A;  1W2B S;  1YJN T;  2GCX A;  2Y4X A;  5GAN 5;  2YLB A;  5LJ5 h;  4VUB A;  3QG1 A;  3QHS A;  4NL3 A;  2ZGW A;  3CCR A;  3KBG A;  4KUI A;  3X20 B;  3RIR A;  4M78 E;  4XTX A;  2E10 A;  4HCC A;  3AHU A;  1BIB A;  4F7U G;  3CBM A;  3HFN A;  4E7I A;  4RG2 A;  5FRN A;  2VGM A;  2RJC A;  2F5K A;  5FLX E;  4C8Q G;  2E5Q A;  3NTK A;  3S3O A;  1YIT T;  3L2Z A;  2XHC A;  5L8R E;  4EMG A;  1N27 A;  3NTI A;  1Y07 A;  2ZPH B;  3X26 B;  3OSV A;  1O75 A;  4C5H A;  5GAO n;  4M7D E;  1HXD A;  4PJO F;  4BUG A;  2PUK B;  3JB9 D;  5D6X A;  3MHX A;  5DLO A;  2B8A A;  1W2B A;  3EFR A;  2A3L A;  5HY6 A;  4HCB A;  5CCA A;  4R56 A;  3BFM A;  1M1G A;  1Q81 C;  4C0D C;  3HFO A;  4KT0 E;  3OYF A;  2X35 A;  3HP9 A;  4DOW A;  3M5A A;  3SWN B;  4QQD A;  4R55 A;  3M4G A;  3CCS T;  2PVD B;  4C92 F;  4OB2 B;  4ZTF A;  1Q7Y U;  2WSC E;  2DTO A;  1S72 T;  1VQO T;  3SD4 A;  3H8Z A;  2ZPF B;  3MEW A;  5DY9 A;  5IT9 E;  1Y71 A;  4V2S A;  2O01 E;  4Y28 E;  1K8A U;  2HBP A;  5LJ3 d;  4O6J A;  4A4G A;  4XU0 A;  1VQ4 T;  5M9O A;  5FRO A;  2DK3 A;  3CCS A;  4M7A B;  1VIF A;  5GMK h;  3URG A;  4QVC A;  3C12 A;  5GAN d;  3N5B B;  2KMT A;  1QVF S;  3VKI A;  1N8R C;  4HT9 A;  3OY9 A;  4XTW A;  2VYT A;  3SFM A;  4M7D C;  4HKE A;  1UGQ B;  1KD1 U;  2XID A;  1KHI A;  1TH7 A;  2RHU A;  2L5Q A;  3FLG A;  3HPW A;  2P4T A;  4UC4 A;  4B9W A;  3DKM A;  1O9S A;  5GMK i;  1X6O A;  1YIJ T;  3MEV A;  3L2R A;  3PNW C;  4BD3 A;  2K3Y A;  3L2V A;  4IUU A;  3CME A;  1GXI E;  1YBY A;  1FX7 A;  3TEE A;  4BI4 A;  1YHQ A;  2EKO A;  2GFU A;  3ZBD A;  3JB9 H;  1KHC A;  2MWO A;  2EWN A;  2E1H A;  2Y90 A;  3OYM A;  4LD9 K;  3S3M A;  4ZGJ B;  3CC4 T;  4C0F A;  1BI3 A;  3A5Z B;  4J6Y A;  3BY7 A;  3OYD A;  2R5M A;  3OYC A;  2LDM A;  3CPW S;  2XU8 A;  4M75 C;  4JS5 A;  4F7U F;  3JCM P;  1FXX A;  2VXE A;  4J7F A;  3CC4 A;  3LH0 A;  1U1S A;  5GAM f;  2JTM A;  3TCJ A;  4FIB A;  4BY6 B;  5IN1 A;  4M7A A;  3H6Z A;  2BUD A;  1VQL A;  1AHJ B;  1G3W A;  2E12 A;  2MWP A;  2E6N A;  3V8L A;  4M7D A;  1PSF A;  3BW1 A;  3CPW A;  2ZPI B;  3M55 A;  2RJD A;  1G3S A;  2K5F A;  1KQ1 A;  3JCM J;  4QQG A;  2IG0 A;  2KDS A;  5AYF A;  2YHT A;  1JJ2 A;  1YI2 T;  4A4F A;  1NE8 A;  1M90 C;  5IAY A;  2EJG A;  3OYI A;  1VQ8 A;  1WGS A;  2Y4Y A;  2CZ6 B;  4M75 D;  3EAE A;  5D6W A;  4EMK C;  5CKD A;  3KXT A;  4Z02 A;  4CI0 C;  1M9S A;  1NPP A;  1LJO A;  3F70 A;  3OBY A;  5D6Y A;  4BE2 A;  2OTL A;  3CC2 A;  4PJO A;  2K4Y A;  5GAN 4;  4PKC C;  4BE0 A;  2LVM A;  1D3B B;  3JB9 I;  4ME7 A;  4M75 E;  1BI2 A;  4PJO B;  4HCZ A;  2LRQ A;  3INZ A;  2G3R A;  4XTV A;  4FT2 A;  5CO7 A;  4ZGE B;  3J81 E;  1VQO A;  1JJ2 S;  5GAM j;  2JUF A;  4OGE A;  3LWI A;  1JBM A;  1U8R A;  3QO3 A;  2X4W A;  3L2W A;  1WNL A;  2XD0 A;  3CCJ T;  3P8H A;  1N8R U;  2KY9 A;  3X28 B;  4C8Q C;  1ZBX A;  3GNF B;  3JCM c;  1LNX A;  4C92 B;  1PSE A;  2PU9 B;  4M7A E;  2VV5 A;  1B34 B;  2KK4 A;  5GAM e;  3SWN A;  2R57 A;  2XDD A;  2RA2 A;  3M58 A;  2LCC A;  4FU6 A;  2HD0 A;  3A8L B;  5J3B A;  3CME T;  4E7K A;  4FT4 A;  4BE1 A;  1W4S A;  1KC8 U;  2EQK A;  4GY5 A;  4A54 A;  1EIF A;  3G71 T;  4BY6 C;  5LJ5 d;  3S3N A;  3A8M B;  3MO8 A;  2DAQ A;  2O4X A;  4OGC A;  1VIE A;  3OA6 A;  4BDZ A;  3DLM A;  2BKD N;  5C0M A;  3VU3 C;  3PT9 A;  2F5T X;  1NPR A;  3OB9 A;  3QYH B;  3SB2 A;  5GMK j;  1YJN A;  1M1K C;  1OZ3 A;  3DB4 A;  1WQ7 A;  3FEO A;  3QSU A;  3RUX A;  3JCM e;  2ZCF B;  2MAM A;  2K2V A;  1NZ9 A;  5J39 A;  2QTX A;  1I81 A;  2RH2 A;  2HNI A;  3HRT A;  3M9Q A;  3OQ5 A;  5LJ3 f;  4JUV A;  2EQU A;  4Q5W A;  3EFS A;  2E41 A;  5CK9 A;  4ELY C;  4C8Q E;  5GAN 7;  4BDY A;  3LLR A;  4NS5 A;  1N9S A;  1VQ7 T;  1G3T A;  4M7A C;  2EAY A;  2V8I A;  4PL6 A;  1ZHI A;  5A0L A;  5GAO l;  4D6W A;  2K5I A;  3ME9 A;  2RHX A;  4ZGD B;  1UGS B;  2CZ7 B;  3QYG B;  2D0Q B;  2FVU A;  3VV0 A;  3X24 B;  2JVV A;  2XK0 A;  3J80 E;  4F7U B;  1K73 C;  3OMG A;  4JRK A;  5GAM d;  3VUZ A;  5CKB A;  1K8A C;  4OB3 B;  1I8F A;  2RD1 A;  3PIP A;  4C8Q A;  4LDU A;  3Q1J A;  3E19 A;  3VYG A;  3CMA A;  2QQA A;  5A2Q E;  2F69 A;  3ZEH A;  4O5V A;  1YIT A;  5HK3 A;  2VC8 A;  4M77 F;  3UWN A;  3CCL T;  5GAN 3;  2EQM A;  2H3J A;  3OS2 A;  4M78 B;  2GFA A;  5FU6 C;  4FM4 B;  1XTD A;  3SDZ A;  4ATO A;  4N4I A;  3QXE B;  3MEU A;  5LJ3 j;  3E1S A;  1OYX A;  3OW2 A;  4KUD K;  3OBW A;  3QII A;  2RI2 A;  2V8J A;  4M7D B;  4IUR A;  2NLU A;  3A8H B;  2C06 A;  1WJS A;  3CCL A;  4II1 A;  3MP1 A;  2DVE A;  4LDV A;  1Y96 B;  5DLQ E;  1VQK T;  3FB9 A;  1R8O B;  2DEQ A;  2E64 A;  1BIA A;  4A4E A;  3I55 T;  3VUB A;  1Q82 U;  5LJ5 g;  3V8K A;  1YIJ A;  3A8G B;  1XQH A;  5LJ3 e;  3OYN A;  1LOJ A;  4IUP A;  4HT8 A;  1Y7X A;  4C8Q B;  4M7A D;  2LCL A;  2DIG A;  3X25 B;  1Q81 U;  3CCE T;  4PJO C;  1KG1 A;  2DPP B;  5HK0 A;  1U1T A;  1KQS S;  3I56 A;  1YJW T;  2EIF A;  5CQY A;  3FIF A;  3G4S T;  2HAX A;  3GF5 A;  3CCV T;  3CC7 A;  3JCM W;  1VQM T;  2EFI A;  3PTA A;  1I5L A;  2JNG A;  4L5G A;  4JRQ A;  4M77 G;  3L42 A;  4ELZ C;  1X01 A;  2L89 A;  5CAI A;  3JAM E;  2QQS A;  4OB1 B;  2LX9 A;  3HHT B;  3QJ6 A;  4M75 A;  2JOY A;  4J8O A;  4QW2 A;  1QVP A;  3PFS A;  2MI6 A;  3NFC A;  3BDU A;  5CKH A;  4PJO D;  2RI3 A;  2DXB A;  2K5L A;  3JB9 F;  3MET A;  1Y96 A;  5CKF A;  4E47 A;  3MP8 A;  4C92 A;  4LDY A;  5LJ3 g;  2ZPB B;  3R6O A;  3QKJ A;  3LX7 A;  2QQ9 A;  3LYI A;  4C5G A;  3CCU T;  5KE3 A;  3FC3 A;  4QVZ A;  2XG8 D;  1VQN A;  3JCM X;  3KUF A;  2HQE A;  2VXF A;  1UB4 A;  1YCY A;  2XDP A;  1V29 B;  2L3R A;  3HL8 A;  3WXM B;  3P8B B;  5DM7 R;  5J26 A;  5GAM g;  5GAN j;  4XAX B;  4FL6 A;  5GMK l;  3C4S A;  3ER0 A;  4XTU A;  3QDR B;  2DXT A;  3L2U A;  4MDW A;  2DTH A;  4RCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...