2GFUA

Nmr solution structure of the pwwp domain of mismatch repair protein hmsh6
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
134
structure length
134
Chain Sequence
KAKNLNGGLRRSVAPAAPTSSDFSPGDLVWAKMEGYPWWPSLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVSDEPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA mismatch repair protein MSH6
publication title The PWWP domain of Mismatch Repair protein hMSH6 is involved in double stranded and single stranded DNA binding
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 22
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gfuA00
3ASKA 4FL6A 3UWNA 2M0OA 3C4SA 4IKFA 3OMCA 5J26A 4QQ6A 1SSFA 2RI5A 4BE2A 3OYGA 3H8ZA 5KE3A 2RHUA 3OQ5A 3OS2A 3OYIA 3L2UA 2NLUA 4IUTA 2EQKA 3LGLA 5CIUA 5IN1A 1OI1A 3MP6A 3FDRA 2BKDN 3OYBA 4PLLA 3OS0A 2F5KA 2EKOA 2FHDA 1OZ2A 2GFAA 4E7HA 1MHNA 2GFUA 3MEUA 4HCZA 4B9XA 1KHCA 2LTOA 3GOXA 5C0MA 2R5MA 2RJCA 4BD3A 2BIVA 2L89A 4C5EA 3LYIA 4IUUA 3OYCA 3OYHA 5KCHA 2RHYA 1WJQA 3OYDA 2BUDA 2RJEA 3NTHA 1RI0A 3CEYA 2K3XA 3MO8A 4EDUA 5J39A 2X4YA 4E7LA 3LH0A 4A4EA 3MP1A 2X35A 2M1HA 3H6ZA 3MP8A 5C6SA 3S3OA 2DIQA 2G3RA 2JTFA 2YRVA 2EQUA 2QQSA 1WJRA 2P0KA 3QBYA 3L2QA 3QJ6A 2HQEA 2RI3A 3OYFA 3OA6A 2LDMA 4A4GA 4BE0A 2EQMA 2RJFA 3DB3A 3OYLA 5KCOA 1N27A 4E7IA 3FLGA 2CKKA 2LRQA 3LX7A 3PMIA 3PNWC 4OVAA 3P8DA 3KUFA 4QW2A 3L42A 4ZTJA 2RI2A 3QKJA 4IUPA 4BDYA 4IUVA 3FC3A 3DB4A 2O4XB 4IUQA 3OY9A 1G5VA 3QIIA 3L2VA 2GF7A 1WJSA 2LVMA 2R5AA 4E7JA 4ZTFA 2X4WA 2K3YA 4II1A 2PQWA 1XNIA 2M16A 3EAEA 4RG2A 4CRIA 4LD6A 3OB9A 2B8AA 2XDPA 4A4HA 2RHXA 2WACA 2EFIA 3S3NA 2QQRA 5FROA 2EQJA 4GY5A 4A4FA 4QVZA 5FRMA 3LLRA 5D6YA 1OYXA 2VYTA 4FU6A 2DIGA 3PMTA 4IURA 2D9TA 2DAQA 4BE1A 2RHZA 3OMGA 4B9WA 3L2RA 4X34A 5M9OA 2RJDA 4N4IA 2MWPA 3M9QA 4PLIA 4C5IA 2O4XA 2E5QA 2IG0A 2E6NA 3OS1A 3F70A 4C5HA 2L8DA 1WGSA 2XK0A 3OYKA 2R58A 3BDLA 3NTKA 3NTIA 4L59A 5D6WA 3UT1A 5KE2A 3PFSA 3MEVA 4N4HA 3Q1JA 5D6XA 4BACA 2HQXA 4E7KA 3O8VA 2R57A 4N4GA 3OYJA 5FRNA 2RO0A 3E9GA 3L2WA 4Z02A 3P8HA 4NS5A 3FEOA 2JZ2A 3LGFA 3OYEA 2MWOA 4UC4A 3OYAA 5IAYA 3DLMA 3E9FA 3S3MA 2LCCA 2RHIA 3S6WA 3ME9A 3MEAA 4QQGA 3SD4A 4BDZA 3META 2X4XA 4C5GA 4PL6A 4QQDA 2L3RA 3MEWA 4Q5WA 3ZEHA 1OZ3A 5KH6A 3OYMA 3OYNA 1H3ZA
chains in the Genus database with same CATH superfamily
5A0DA 2YHTA 2COYA 1G3TA 3OYGA 1SF9A 3FJ5A 4M7AD 4RKUE 1MMDA 1OZ2A 1WXTA 3V8JA 1TU0B 3QSUA 1PNJA 4F04B 1VQ6Q 2MK5A 2CZ1B 2JN0A 2RQWA 1WJQA 3OYDA 3CC4Q 3CEYA 1BI3A 2GNCA 3A8GB 4DOVA 3FB9A 3GBQA 1QWFA 1RUWA 1TOVA 2AT1B 4R56A 1OU9A 3BDUA 2DEQA 4OMFB 1FXXA 2DTOA 5GANh 5CK9A 4M75A 3JCMh 3PNWC 2AKKA 1K1ZA 2ROTA 3V7CA 4QVCA 2DTIA 2DXCA 3JCMQ 2ZAEA 1K8AR 4IUVA 1W2BP 1LCKA 3DB4A 4R55A 5CKHA 1G5VA 1H8KA 2RMOA 4CRIA 5GAN3 1M1FA 2OTLA 5FRMA 1X6BA 3LLRA 2LQWA 2E3IA 5J3BA 4K11A 3QDRB 1M2VA 4A4KA 1NEBA 3CCLQ 5LJ5f 3CC2T 3M4GA 1ZSZA 5GAMe 1YITQ 4C8QE 2F2XA 4C0DB 2ABLA 3PFSA 2HEQA 2PZ1A 1I4K1 2X9HA 2PNIA 5GAOr 1HK9A 1CSKA 1OULA 2HD0A 1JU5C 4ORZA 3OYAA 4PK4A 3R6OA 2L5QA 1W4SA 1G3YA 4ATOA 4ESRA 3ASKA 2YWWA 1BB9A 4OGEA 2Y4YA 2P0QA 1VQNQ 3OS2A 3C0CA 3VU3C 3CCUQ 2J6FA 4IUTA 1RACB 3CMEA 4LN2A 1QQJA 3MP6A 2BKDN 2KGTA 1RI9A 2O01E 1KD1C 4RTUA 2YUQA 2CP6A 1BKBA 2EJFA 1UUEA 5FWBA 3WVDB 1K9MC 2QA4Q 2YT6A 1NYFA 2BIVA 4C0DC 1VQ9Q 1K9AA 2KXDA 2O31A 1RI0A 2E3HA 2QASA 1NJIC 3M4YA 2JTFA 2LNHB 1VOMA 3RUXA 4LE9A 4M77F 2KQWA 2EYWA 2HDAA 1GL5A 2VASA 2LRQA 3LX7A 1IGQA 4LUDA 3RERA 2RPNA 3ZL7C 4DA4A 1YJ9A 3HP9A 1YHQA 4RTXA 1CKAA 2AKLA 1KK7A 5CAIA 1Q7YU 2V26A 3I9QA 1WQ7A 4J9IA 3L2VA 2CS7A 4ZTFA 1WJSA 2C0OA 1QP3A 2XG8D 2OTJA 3IQLA 2K2VA 1K0SA 1NLOC 1FWZA 2CZ7B 2YUOA 2O2OA 1BK2A 1IHVA 1KC8C 1OQKA 2EQIA 2QXFA 4C92D 1RAAB 3PTAA 4DBQA 1D0YA 1VQ7Q 1T0HA 4C8QA 3HFOA 2HMAA 1S72A 2H3JA 4L59A 2F2VA 2DPPB 5DM7R 2BE9B 4EPCA 2FG0A 5LJ3j 5GMKh 1OEBA 4LD9K 1WLPB 4HT9A 2KEAA 3R6NA 1VQPQ 2K3BA 2LCCA 1H3HA 1VQOA 3I5RA 3JCMW 1TUCA 2D0NA 2HBWA 4C8QG 1NE8A 2X3XD 4IKFA 1GRIA 4LDUA 4QQ6A 5I2SA 1N8RR 2G6FX 3H8ZA 4MZMA 1VIFA 3JSCA 4M7AE 2CGHA 5GANg 3G7ZA 3L2UA 3JCMg 3LGLA 3DLLA 5IN1A 3G4ST 4PLLA 4P5NA 2EKOA 1YIJT 3UATA 2ZZDA 2GFUA 3JV3A 1X43A 4HCZA 3X26B 5A2QE 1UE9A 1X6GA 1VQLA 5HK3A 2PUOB 5C0MA 1MNDA 3HL8A 2OX7A 3TQ7P 4J7FA 2A0FB 3OS5A 2QYZA 3VV0A 2CYZB 4F7UE 1QVGS 1KG1A 3MP8A 4FYVB 4M78A 2LQKA 4ZGEB 1T3SA 3CBOA 4BB7A 2L3QA 3CCQT 2CZ6B 4EIKA 1BI2A 1E6HA 2JVVA 4JRIA 5LJ5d 1M8MA 3L42A 1G83A 2A7YA 4BDYA 1AVZC 1VQ4A 2GQIA 1OPLA 2LX7A 1VQ8T 5FU6B 3RMQA 2V8KA 1AEYA 1YBYA 1TUDA 1VYVA 1S1NA 2V8IA 3CMAA 4M78G 2M16A 3OB9A 1X2KA 2HAXA 5GAMf 1V76A 5LL6S 4XTXA 4OMMA 2LQ8A 2LMJA 1BIAA 1CKBA 2DE0X 4GBQA 4M4ZA 2EGEA 2FZGB 2E1HA 1N5ZA 4N4IA 3M9QA 2LZ6B 5GJVB 4M75D 2V8JA 4M77B 1Y96B 1ZUYA 4LDYA 1Q86C 4OP0A 1SSHA 1KFZA 3O8VA 4N4GA 3GNGA 3TU4K 1QVGP 3I35A 4RCCA 2P84A 4KUDK 3M58A 4VUBA 1PM3A 1WHHA 2IPOB 5GMKj 2OAUA 1OZ3A 2JOYA 3RBBB 1K73R 4CC4B 4FL6A 3CCSQ 5FU6C 1UB4A 2I2LA 1VQ5A 4M7DA 1NBEB 2O9VA 1M90R 3X24B 4FYWB 2RF0A 4D8DA 1YJWT 1NEGA 1NLPC 2MAMA 4XU2A 1ZUUA 1E7OA 2DFUA 3OW2S 3EFOA 4KUIA 2QEXT 4N0AC 4B9XA 2QTXA 4OMNA 3H0IA 3CC7T 1EZZB 4M77C 1K8AC 1TXQA 5KCHA 1R0BG 4M7AG 1JXMA 1Y0MA 2K3XA 2EGCA 2QK0A 4AFUC 2XKOC 2X35A 2COWA 4CC3A 1HXDA 1YJNT 1RLPC 3QJ6A 3CCRA 3I56A 3VS4A 2CDTA 2SRCA 3QZ9B 3M0TA 2QQ9A 4F7UG 2O4XB 2QAZA 2E41A 2MIOA 4J9GA 2DZ9A 3SFMA 2EBPA 2X4WA 2PTKA 2B86A 2WACA 3S3NA 2VGMA 1VA7A 1OX8A 2EQJA 4QKUA 4ANJA 4C92E 2IIMA 5IHKA 3OW2P 4J9DA 1XJWB 3H41A 3QWYA 4PJOA 4XK8E 1QVPA 5I21A 2L3PA 1ACMB 3C94A 4RTWA 1KQ2A 4ELZC 3JRZA 3OS1A 3EG3A 5L8RE 4ZGDB 2XK0A 1X69A 3BDLA 3VS7A 4N4HA 3Q1JA 1PD1A 3QYHB 3JB9H 1LOJA 2CP2A 1JJ2A 2CSQA 1PKTA 2GTJA 2NUTB 3CC4T 1QVFS 5GJWB 1PC0A 3C95A 1ARKA 4PL6A 2DL5A 3OYNA 2CH4A 4YTLA 1Q82R 2XI9A 3PT9A 2XDDA 1TSFA 3VRYA 3EG0A 1PD0A 1I07A 4RG8A 2L2PA 4EMKA 4E7ZA 2OAWA 2F5TX 3RKXA 3OS0A 1I0CA 2GFAA 5AT1B 4AFSC 1I5OB 5LJ5e 3EGDB 5KYXB 2LCSA 2KSSA 4Y91A 3OYHA 3JB9J 4XTVA 1BU1A 4A63B 2RK2A 1N9SA 2KAFA 2X4YA 1JBMA 4A4EA 5EG2A 2VVKA 5GAMd 1Q81R 3CCLT 2E64A 2DMOA 3VUBA 3OA6A 2HQEA 3OYFA 3E2UA 1B3QA 2DYIA 1QVFP 2DNUA 3CC2A 3PMIA 2RQRA 3RIRA 2ZCFB 2QQAA 4FSSA 4Y28E 3I5SA 1MV0B 3X28B 2JXBA 2K3YA 3NMZC 1XNIA 2RHXA 4C92A 1WYXA 2RN8A 1U06A 2DTHA 1WA7A 3GNFB 4M78D 3CCJQ 1VQNT 4M75E 1LVKA 3CCUT 4RTZA 1W1FA 1GCQA 3TSWA 3FJPA 5DLOA 3ER0A 1N8RC 2V1QA 3CBPA 2KYMA 2F69A 2D0QB 4C92G 4LDXA 2CZ0B 3VS6A 4KH1B 3SB2A 4F17A 3CPWS 2QA4T 5KYYA 1NYGA 1M5Q1 1U1TA 1NM7A 3CQTA 4C8QF 4HKEA 1R0CB 1I5LA 1SEMA 3TEEA 4HCCA 2DRKA 1Y71A 4Y92A 2AZSA 2X4XA 1TTHB 4LUEA 3M0UA 1RAIB 3GP8A 4HCKA 1ZA1B 1JRIA 2OTJQ 1JO8A 5LJ5h 3OMCA 2DD4A 1WFWA 1FMWA 1KD1U 3E19A 1VQKT 4OB0B 5KE3A 2DKGA 2FRWA 1K9MU 2J7IA 3EH1A 4D6WA 2LJ1A 4CI0C 1MHNA 3LWHA 1M1KR 1BIBA 5KYNA 2XICA 3EHRA 2COZA 1NJIU 1QMCA 2JUFA 2RHYA 1ZSZB 2J6KA 2V1RA 1W2BS 2KT8A 3G1JA 1U1SA 1MMNA 2HSPA 4E47A 4J9CA 4QVDA 1ZX6A 2K4YA 1VQ7T 4AFQC 2YRVA 3CPWP 4JPBW 4M7DD 2P0KA 2CUDA 4BE0A 4M75C 2FB7A 2EQMA 1G2BA 3VS3A 1SRLA 1YFNA 1NG2A 2PVOB 3CD6Q 1VQPT 4F14A 4JDSA 3EG2A 1M9SA 2GF7A 1KC8U 3CPFA 1Q7YR 3VJPA 4DEYA 4OMOA 2EIFA 3M0PA 2AHJB 2LNVA 2ZPFB 2D9TA 3BW1A 4JRKA 5CKDA 1AWWA 1ZSZC 1K73C 2KNBB 2EGAA 2MWPA 3J7AF 3M57A 1D3BA 3QHSA 2KBTA 1M90C 3G4SA 2KYBA 5FRNA 2EYYA 1BBZA 1YIJA 1X75C 1WHGA 3L2WA 4J9FA 1XOVA 2JZ2A 3X25B 1VQ4Q 4M75G 4DEXA 4PNOA 3SD4A 4BDZA 2RA2A 2FYKA 5LJ3h 2K79A 1SKUB 4GLKA 4PJOD 2RH2A 1U8RA 3U23A 1SRMA 1UDLA 2MPXC 3JCMV 4DQ2A 3CCQA 5CIUA 4PJJA 1X6OA 3M0QA 5LJ5j 5DLQE 3QZ5B 4M7AF 3OSSC 4HXJA 4DOWA 4AG2C 3I55Q 3VKIA 1VQ8A 2CP3A 4FW1A 2DBKA 1QCOA 4C8QB 3NTHA 5GAN4 3CCVT 2FRYA 3P8BB 3QDFA 2RQVA 3SEMA 2XDBA 2YRDA 2E5KA 1ABOA 4OB1B 1I8FA 4F7UF 5CO7A 1KJWA 1VQ5Q 2EJ9A 4KRTA 1OPKA 2Y90A 1Y07A 2A28A 1UHCA 2QI2A 1TWBA 2A37A 4IUQA 1D09B 4J6XA 2A08A 1AZEA 2QG9B 3EG9B 4RMOA 3H9NA 4A4FA 4QVZA 1UJ0A 4M78E 2M0YA 1OYXA 4FYYB 3H0HA 4IURA 5GAN8 5IT9E 4RUGA 3JB9D 1Q86U 5IXFA 4C8QC 1IO6A 5GAOm 2KVQG 4HVUA 5GAOl 1Q82C 3UDCA 1UECA 1EFNA 1XQHA 2PVDB 2W0ZA 2R58A 3CXCA 5FW9A 3CCRQ 1YJWA 3EGXB 3UF4A 1RAEB 4BACA 1T3LA 4M78B 2QEXA 4NS5A 5GANf 5GAMh 3JCMf 4NL3A 5IHNA 4XU1A 1F1BB 2JTEA 3TSZA 3LW5E 3ULRB 3MEWA 4Q5WA 4E7SA 2Y4XA 1Q95G 1YI2T 1LJOA 1KQSA 2LX9A 5IHIA 4MDXA 4MZPA 2FEIA 2LT1A 5J26A 1Y7XA 1UGQB 2YLBA 1HJDA 1YJNA 1TUGB 3UA7A 1AWOA 1Q81C 1BI1A 4XTYA 4AFZC 3FDRA 1U5SA 3VUZA 3D7SB 1K8AU 4HCBA 1N6AA 3CCMQ 2PUKB 2LC4A 1KHCA 1KIKA 2E70A 4PKCC 3LYIA 2FPFA 5HY6A 2VKNA 2E10A 2HNIA 1J3TA 2O88A 4M78C 5C6SA 4M7DE 1UG1A 3MKDA 3L2QA 5KYWA 4A4GA 2HL5C 1MUZA 3G71T 1W6XA 4KULA 4Z88A 2WSEE 4ZGJB 2DL3A 2K9GA 3HFNA 4C0ZA 4ZTJA 2RI2A 2D8JA 4GLMA 3RKYA 1GBQA 2QDYB 2ZPEB 1TG0A 2JW4A 2AIRB 4M7AB 2RD1A 2JMCA 2PQWA 2NUPA 3CC4A 1ZQ1A 5LJ3g 5IH2A 2O9SA 3LWIA 3FIFA 4PFZA 1QW1A 4D8KA 4RTTA 2VYTA 1HYOA 3EFOB 4B6MA 2J06A 2I0NA 1OX9A 2BTTA 3JCMJ 2HBPA 3EFRA 4C92F 2DXUA 2QTVA 1VQMT 3MHXA 3CCEQ 3TREA 3A1PA 4F7UB 1M3AA 2QQBA 2DXTA 3JAME 4J9BA 4PFPA 2VWFA 2ED1A 2J05A 4QQGA 1M1KC 4J9HA 2QGFB 2HL3A 4KBMB 4PJOE 2XMFA 1AWJA 2K2MA 1PWTA 5GAMj 4M7AC 4OB2B 1R8OB 3CCLA 3SHWA 3M55A 3MCAB 4LXCA 3G6EQ 2FHDA 1M8VA 3A8LB 1BCOA 3PVQA 3HPWA 1AWXA 3QUIA 2P4RA 2NYSA 1RABB 3SWNA 3V7SA 2CP7A 1WPYA 4WTOB 1KSWA 2KY9A 4MZTA 1MMGA 2KDSA 3CCJT 2G3RA 1WJRA 4XU3A 1VQNA 1QKXA 3DB3A 4V2SA 1PSFA 5HCKA 1JB0E 3CCUA 4E7IA 3FLGA 2IVWA 5KYUA 1UHFA 4IUPA 3L2ZA 2FPDA 3SDZA 4M7DG 4WF2A 2DBMA 1K76A 2QA4A 3RR6A 4II1A 9ATCB 4OGCA 2DEUA 1GXIE 4EMKB 5GANd 3JCMd 4RCBA 4PJOC 2PVGB 3PMTA 1VUBA 4O6JA 1N8RU 4BE1A 4LDVA 1H641 1YWPA 1FYNA 5I22A 1VQKA 1G8XA 1PKSA 2ECZA 2Z0WA 5FU7B 5KE2A 2M9UA 4JZ4A 3GF5A 2CH4W 3M59A 4M75F 4E7KA 3A5ZB 5GAOp 1AD5A 2RO0A 1LNXA 4KH0B 2YRCA 3P8HA 1WXBA 2DERA 2BZXA 1H92A 2ATCB 2A3LA 2VUBA 4J9EA 3HSBA 2GTOA 4C5GA 3WVEB 4N0AA 4JLIA 3GIBA 1Y96A 2FO0A 1FX7A 2ESWA 1U3OA 2K5IA 1I1JA 4EMKC 3M0SA 2NLUA 1AZGB 4C92B 4NOYA 1VQ6T 3CD6T 4PJOG 2DL4A 1NPRA 3RESA 2ZPGB 2ENMA 3NFCA 1VQPA 1RL2A 3G4SQ 5HK0A 5GMKm 5GMKl 1YIJQ 5FU7C 3RKWA 2BUDA 2MF2A 2OTLQ 4O5VA 1YP5A 3LH0A 4HT8A 3H6ZA 1N9RA 4HA8A 5ECAA 1DJ7B 2EQUA 2KRNA 8AT1B 2RI3A 4JS4A 2RJFA 2ROLA 2EWNA 1RLQC 2CKKA 3OSVA 2EKHA 2JJ9A 1B07A 3P8DA 5A0LA 3CCQQ 2D6FA 1UEBA 3JCMc 4JRPA 4NL2A 6AT1B 2R5AA 4C92C 4BY6B 2KROA 3E1SA 1K73U 3VYGA 4GY5A 1UGVA 2DF6A 2DA9A 4C0FA 1AT1B 4ELYC 2HZYA 2YXYA 4DBRA 1YITT 2RHZA 1M90U 1GCQC 1XTDA 2EPDA 3QYGB 3HKSA 2O4XA 2IG0A 2M02A 3CMEQ 1SG5A 1WGSA 2L8DA 3NTIA 4JJCA 1LPLA 3JB9G 1C1AA 1MMAA 3I55T 1ZBXA 2ED0A 2HQHA 3FEOA 1B34A 4JJBA 4UC4A 4ZN1A 3S3MA 4JZ3A 1TS9A 1C6VX 3META 1BYMA 4KT0E 1V1CA 1JJ2S 3EFSA 4IIMA 4OB3B 1WHKA 2KK4A 2RK1A 4Z89A 3VS1A 3CCVA 1IB8A 5CR2A 1WDXA 4BY6C 1OI1A 1IHWA 3OYBA 1YJ9Q 1YHQQ 4AMCA 2OI3A 1MV3A 1VQ9T 1RADB 2ZPIB 4M75B 1AOJA 2W10A 2JS2A 2HCKA 2XU8A 4ZN3A 4IUUA 3QPHA 5CKEA 1IZ6A 3QO3A 3HRTA 1SHGA 2RB6A 2EAYA 1K0XA 5GANe 3GPLA 2LJ0A 3JCMe 3OYYA 1RAGB 2FVUA 3PIPA 3URGA 1M4ZA 1QKWA 4FYXB 2DK3A 2YUNA 2JNGA 5KYXA 3MJXA 1S72Q 1WQWA 2LT4A 1M2VB 4OMPA 2OJ2A 1YJNQ 1JJ2P 3PIOA 4HVVA 1T0JA 3FC3A 1UFFA 3PE0A 2K57A 5GAN7 2CP0A 2LVMA 4X1VA 1WIEA 4JJNK 1YN8A 1OOTA 4KGXB 2B8AA 2XDPA 4A4HA 1VQOQ 3VS2A 4JUVA 5FROA 2L0AA 1UGSB 1Q82U 1YI2A 4FT4A 2DAQA 1EIFA 2M51A 2RQTA 3QG1A 3TVTA 4M78F 2EJGA 3F70A 4C5HA 1BCMA 1M27C 1Q86R 4FT2A 3CCMT 2DL7A 2K6DA 5CKFA 1VQLQ 1Z9QA 3OYEA 3UA6A 4DBHA 3E9FA 2RQUA 2L3RA 2GCXA 1IGUA 3VS0A 1VYTA 1Q81U 2M0OA 5GAN6 1SSFA 3HTRA 4AT1B 2D1XA 1Z9ZA 5I2MA 1NZ9A 3G71A 2YDLA 3C12A 3M56A 2KI7A 3M5AA 1EX4A 3HHTB 3VRZA 1Y57A 2X51A 3CMAQ 4C5EA 2L89A 1D1BA 3M0RA 1UGPB 2J6OA 4BI4A 1D0ZA 4E7LA 4E2FB 1D0XA 4M77D 3S3OA 1C0MA 1SHFA 1RAHB 3INZA 2CT3A 1PCXA 3CCET 1PRMC 1K4US 1HSQA 1N27A 2NWMA 2CREA 4PJNA 4M7DF 3EGUA 5AYFA 1WNLA 5GAOq 1VQMA 4AG1C 3OY9A 1QCFA 4F16A 2KRMA 3EAEA 1V29B 4MMKA 2DETA 1IXDA 2QQRA 4IIOA 4OMQA 1GFDA 2AZVA 2CT4A 1R77A 5GMKe 3PGGA 3L1AA 4LNPA 1A0NB 1QLYA 3G6ET 5D6WA 3ZBDA 1QWEA 2CSIA 5CCAA 2HQXA 3OYJA 2FPEA 1M1KU 2QDLA 1AHJB 3EG1A 5CQXA 1KQ1A 5KYWB 5IAYA 3CCST 3VYHB 2PU9B 3ME9A 3MEAA 5LJ5g 4J83A 1E6GA 2EYQA 4QQDA 3OYMA 3JB9I 3QXEB 4J8OA 2JM8A 3UWNA 3C4SA 3TCJA 3RMSA 3CCJA 2RHUA 3I56Q 4PJOF 1ZBJA 2NUPB 5GMKi 2E4HA 3BE3A 4TVRA 2XIDA 1VQKQ 3CC7A 2GBQA 1P92A 2DXBA 1MGQA 1G3SA 3DKMA 4BD3A 1QVGA 1BI0A 1PSEA 2X3WD 1WI7A 5GANj 3MO8A 3RNJA 2VB6A 2MI6A 7AT1B 3KBGA 4XU0A 5I11A 1GCPA 5LJ3f 3OYLA 4ME7A 2MYSA 2RNAA 4X9DA 4J5YA 2JMAA 2DYBA 3O5ZA 2YLCA 1YNZA 3QIIA 4MDWA 3REAB 2L3SA 3A98A 2VXFA 3BY7A 3HRSA 2HKNA 1VYUA 1D1CA 3J80E 3OMGA 5M9OA 2RJDA 4XAXB 3T9NA 4PLIA 4C5IA 2E6NA 3JB9F 4JS5A 1M1GA 3SWNB 4A54A 5D6XA 4DBFA 4M7DB 3EG9A 1VQ6A 2ZPBB 3CD6A 2CP5A 4ZNXA 2CUBA 3CXCS 2MWOA 3QWXX 2P4TA 2K5LA 3S6WA 2WSCE 1WXUA 2OTLT 2XD0A 2RM4A 2DO3A 1ZUKA 3ZEHA 5KYUB 2RI5A 1FMVA 2KRSA 2MMPA 3OBYA 5HKCA 4BE2A 3EGXA 2MOXA 4XTWA 5GAOn 3OW2A 1KQSS 3OQ5A 3OYIA 3CC2Q 2H3EB 2EQKA 4PJLA 1B7TA 2YSQA 5FLXE 1UTIA 2LTOA 3GOXA 2R5MA 3REBB 3V8KA 3SWNC 2RJEA 4M7DC 4M77E 5J39A 1QCNA 4J6YA 5EC7A 3MP1A 5CKBA 4CC7A 2JTMA 2DIQA 2DVJA 4XTUA 1YITA 1M3CA 4E6RA 3QBYA 3CXCP 1IRXA 3CMET 3CCVQ 2DM1A 4X9CA 3RDVA 1IREB 1ZSGA 1GFCA 2NUZA 3M53A 4PJOB 3AT1B 2JT4A 3KUFA 4QW2A 2XHCA 1PRLC 3QKJA 1WHMA 1M30A 2DVEA 4XQ3A 4RG2A 3I55A 1KQSP 4LD6A 1Q7YC 4Z8AA 2MCNA 1WZOA 1UGRB 5D6YA 4A53A 4KGVB 4FU6A 2DIGA 2SEMA 4B9WA 2F1LA 3VS5A 2EYXA 2DJZA 3JCMX 2E5QA 4BUGA 3A8OB 1YJ9T 1YHQT 3OYKA 2JM9A 1M2OA 4M7AA 1UJYA 3MEVA 1QVFA 1D1AA 5GAMg 3AHUA 2LCLA 1QP2A 3E9GA 3HRUA 1VQ9A 3LGFA 2LP5A 2BE7D 2OTJT 1ABQA 4JJDA 5D7UA 1ZA2B 3X20B 2HSEB 2E6ZA 2D8HA 4F7UA 5GAN2 1YI2Q 2FZCB 1S72T 5GAN5 2KT1A 2C0TA 4KGZB 4FSXA 5L23A 2F5KA 5LJ3d 2VGNA 1O9SA 4E7HA 3MEUA 3KFVA 4C0GA 1PG5B 1JQQA 2RJCA 4BI8B 1VQOT 2HKQB 4M77A 1VIEA 2ZPHB 4JRQA 1VQ7A 5A0GA 1X2QA 2KE9A 2VXEA 2M1HA 2KXCA 4EMGA 2QQSA 1WX6A 1B34B 4PFOA 1KD1R 3LH5A 3H0FA 3JCMP 2VV5A 1K9MR 2FZKB 1PHTA 2ZGWA 3OBWA 1NPPA 1W70A 4M77G 5IXBA 3NHNA 3G71Q 1VQLT 2VC8A 3CCMA 2GQVA 2DX1A 3J81E 4E7JA 1HD3A 1NJIR 1OU8A 1ZLMA 2EFIA 1YWOA 3GLXA 4WCIA 5KYYB 1MNEA 2KMTA 2BZYA 2LQNA 3A8HB 1JXOA 2EW3A 2DLPA 4FIBA 2DD5A 2DRMA 3L2RA 2FL7A 1O75A 2DL8A 4PJMA 3CPWA 4QT7A 2H8HA 5CQYA 2C0IA 2QGGA 3NPFA 5DY9A 1VQ4T 4C8QD 3EHQA 3FRNA 8ATCB 4J7IA 3ZFJA 4Z02A 1ZHIA 4OF1A 1KHIA 1VQMQ 1M3BA 3CMAT 1VQ8Q 2YUPA 4L6V5 5FWCA 2E12A 1RAFB 1WHLA 1KC8R 3CBMA 2GGRA 5KH6A 3WXMB 4OMLA 1SPKA 3A8MB 1GBRA 1TH7A 1YCYA 3M54A 2EVRA 4BI3A 3CCEA 4FCYA 1W2BA 2DJQA 2F2WA 3BFMA 3OYCA 3UPUA 3EH2A 1X27A 4EDUA 2WSFE 4XTZA 1VQ5T 2KR3A 1WHJA 1H3ZA 2NUTA 3V8LA 2LDMA 4R0KA 5KCOA 3PVLA 1YJWQ 4RTVA 4OVAA 3G6EA 4MMLA 2QEXQ 1D3BB 2C06A 2AK5A 3CC7Q 1I81A 3V7RA 4FW2A 3CCSA 3JCMb 1X01A 2A36A 3EGDA 5CVIA 4J6WA 4EMHA 2DZCA 3CCRT 4L5GA 4X34A 3I56T 4RTYA 2K7AA 2LJ3A 4HVWA 2EYZA 1JEGA 2E65A 3NGPA 3MPUB 2DILA 3NTKA 4JLGA 3UT1A 3QJYA 2K5FA 4CC2A 1OV3A 4FM4B 2R57A 5LJ3e 3THKA 1YCSB 4LDWA 2P0PA 1G3WA 3KXTA 2BZ8A 2X4JA 3DLMA 2RHIA 2JS0A 1FMKA 3N5BB
chains in the Genus database with same CATH topology
4YTLA 5A0DA 2YHTA 3UWNA 3C4SA 3TCJA 2XI9A 3PT9A 5GAMj 2XDDA 4M7AC 4OB2B 3RMSA 1R8OB 3CCJA 1G3TA 3CCLA 3OYGA 4RG8A 2RHUA 4PJOF 3M55A 4EMKA 5GMKi 2F5TX 4TVRA 4M7AD 3RKXA 2XIDA 3MCAB 4RKUE 3OS0A 2FHDA 1OZ2A 2GFAA 1M8VA 3V8JA 5LJ5e 3A8LB 3QSUA 3CC7A 1P92A 2DXBA 3HPWA 1MGQA 2CZ1B 2KSSA 1G3SA 2JN0A 3DKMA 4Y91A 4BD3A 1QVGA 3QUIA 3OYHA 3JB9J 1BI0A 1PSEA 1WJQA 4XTVA 3OYDA 3CEYA 2RK2A 1N9SA 3V7SA 3MO8A 3SWNA 5GANj 1BI3A 2KAFA 2X4YA 3A8GB 1JBMA 1WPYA 4A4EA 3FB9A 4DOVA 2KY9A 4MZTA 5EG2A 2KDSA 5GAMd 3CCJT 2G3RA 3CCLT 2E64A 2MI6A 4R56A 3KBGA 1WJRA 4XU3A 3VUBA 3BDUA 3OA6A 2HQEA 2DEQA 4XU0A 3OYFA 1VQNA 4OMFB 1FXXA 5LJ3f 2DTOA 5GANh 3DB3A 5CK9A 3OYLA 4V2SA 1PSFA 4ME7A 4M75A 3JCMh 1JB0E 3CCUA 4E7IA 3CC2A 3FLGA 3PNWC 3PMIA 2IVWA 4X9DA 3V7CA 3RIRA 2DTIA 2DXCA 4J5YA 2ZCFB 4IUPA 4QVCA 3JCMQ 2QQAA 3L2ZA 4IUVA 3DB4A 4Y28E 3SDZA 4R55A 4M7DG 5CKHA 4WF2A 2YLCA 1G5VA 3QIIA 4MDWA 2QA4A 3X28B 2K3YA 4II1A 4CRIA 1XNIA 4OGCA 1GXIE 4EMKB 2RHXA 2VXFA 4C92A 3BY7A 5GANd 5GAN3 1M1FA 2OTLA 3JCMd 3HRSA 4RCBA 5FRMA 3LLRA 2DTHA 4PJOC 2PVGB 3PMTA 1VUBA 4O6JA 5J3BA 1N8RU 3QDRB 3GNFB 4M78D 4A4KA 3J80E 4BE1A 3OMGA 4LDVA 1VQNT 4M75E 1H641 5M9OA 2RJDA 4XAXB 5LJ5f 3T9NA 3CCUT 4PLIA 4C5IA 3CC2T 3M4GA 2E6NA 3JB9F 1VQKA 3FJPA 5DLOA 3ER0A 5GAMe 4C8QE 4JS5A 1N8RC 3CBPA 5FU7B 5KE2A 4C0DB 1M1GA 2F69A 3SWNB 4A54A 3PFSA 2D0QB 5D6XA 2M9UA 4C92G 1I4K1 4LDXA 1VQ6A 2ZPBB 2CZ0B 3GF5A 3M59A 4M75F 3A5ZB 5GAOp 4E7KA 3CD6A 3SB2A 2RO0A 1LNXA 3CPWS 5GAOr 1HK9A 2QA4T 3P8HA 3CXCS 1M5Q1 1U1TA 4C8QF 2HD0A 4HKEA 2MWOA 3OYAA 1I5LA 2A3LA 2VUBA 2P4TA 3TEEA 2K5LA 4HCCA 3S6WA 1Y71A 2WSCE 3R6OA 2L5QA 2OTLT 2XD0A 3HSBA 1W4SA 2RM4A 2X4XA 1G3YA 3WVEB 2DO3A 4C5GA 4ATOA 4N0AA 3ZEHA 4JLIA 3GP8A 3GIBA 3ASKA 1JRIA 1Y96A 5LJ5h 1FX7A 2DD4A 3OMCA 2RI5A 4OGEA 2MMPA 3OBYA 5HKCA 2Y4YA 2P0QA 4BE2A 1KD1U 2K5IA 4XTWA 5GAOn 3E19A 4EMKC 3OW2A 4OB0B 1KQSS 5KE3A 3OQ5A 3OS2A 1VQKT 3OYIA 3VU3C 2DKGA 2NLUA 4IUTA 3CMEA 2EQKA 4C92B 3MP6A 1K9MU 2BKDN 4NOYA 1VQ6T 3CD6T 2O01E 4D6WA 1KD1C 4PJOG 4CI0C 1MHNA 3LWHA 5FLXE 1NPRA 3RESA 2ZPGB 1BIBA 1BKBA 2EJFA 3NFCA 1VQPA 1RL2A 3WVDB 2LTOA 5HK0A 3GOXA 2XICA 5GMKm 1K9MC 2R5MA 2BIVA 1NJIU 5GMKl 2JUFA 5FU7C 3V8KA 2RHYA 4C0DC 3SWNC 3RKWA 2BUDA 2RJEA 1W2BS 1RI0A 2MF2A 4M7DC 4O5VA 1U1SA 4M77E 4E47A 5J39A 3LH0A 4QVDA 4J6YA 4HT8A 3MP1A 5CKBA 3H6ZA 1NJIC 2K4YA 1N9RA 4HA8A 2JTMA 1DJ7B 2DIQA 2JTFA 3M4YA 1VQ7T 2YRVA 2EQUA 4XTUA 1YITA 4M7DD 2P0KA 3QBYA 4BE0A 2RI3A 4M75C 2FB7A 4M77F 3RUXA 3CMET 2EQMA 2KQWA 2RJFA 4JS4A 4X9CA 1IREB 2EWNA 3M53A 4PJOB 2CKKA 2LRQA 3LX7A 3OSVA 3RERA 4DA4A 1YJ9A 1YHQA 3HP9A 3P8DA 3KUFA 4QW2A 2PVOB 5A0LA 2XHCA 3QKJA 5CAIA 1Q7YU 1VQPT 2D6FA 1UEBA 2DVEA 3JCMc 1WQ7A 4JDSA 4JRPA 4XQ3A 4NL2A 1M9SA 2CS7A 2GF7A 1WJSA 2R5AA 3L2VA 4ZTFA 1KC8U 3CPFA 4RG2A 3I55A 4C92C 4LD6A 3VJPA 4BY6B 1QP3A 2XG8D 1Q7YC 3E1SA 2OTJA 1K73U 3VYGA 2K2VA 4GY5A 1FWZA 2CZ7B 4C0FA 4ELYC 2EIFA 1UGRB 5D6YA 4A53A 1KC8C 2AHJB 2LNVA 4FU6A 2DIGA 2QXFA 2ZPFB 4C92D 1YITT 2D9TA 3PTAA 3BW1A 4JRKA 2RHZA 5CKDA 4B9WA 2DJZA 1K73C 1M90U 1XTDA 3QYGB 3JCMX 2MWPA 3HKSA 3J7AF 2O4XA 2E5QA 2IG0A 4BUGA 3A8OB 4C8QA 3HFOA 1S72A 3M57A 1YJ9T 2L8DA 1WGSA 2H3JA 1D3BA 3OYKA 1YHQT 3NTIA 4L59A 4M7AA 2DPPB 3QHSA 3MEVA 5DM7R 1QVFA 5GAMg 4EPCA 5LJ3j 3G4SA 1M90C 5GMKh 5FRNA 2LCLA 3AHUA 3JB9G 4LD9K 1QP2A 4HT9A 1YIJA 3E9GA 1X75C 3L2WA 3HRUA 1VQ9A 3I55T 1ZBXA 3FEOA 1XOVA 2JZ2A 1B34A 3LGFA 3X25B 4UC4A 4ZN1A 4M75G 4PNOA 3S3MA 2LCCA 2OTJT 3SD4A 1VQOA 4BDZA 1BYMA 3META 2RA2A 3JCMW 2FYKA 5LJ3h 4KT0E 1JJ2S 3EFSA 4C8QG 4OB3B 1NE8A 3X20B 2KK4A 2RK1A 4IKFA 4GLKA 4LDUA 3CCVA 2RH2A 2E6ZA 4QQ6A 5I2SA 4PJOD 4F7UA 1U8RA 5CR2A 5GAN2 4BY6C 4M7DB 3H8ZA 4MZMA 1VIFA 3JSCA 3JCMV 4DQ2A 5GAN5 2CGHA 5GANg 1S72T 4M7AE 3G7ZA 3L2UA 3JCMg 3CCQA 5CIUA 3LGLA 3DLLA 5IN1A 1OI1A 4FSXA 3OYBA 3G4ST 4PLLA 4P5NA 2F5KA 2EKOA 1X6OA 5LJ3d 2VGNA 5LJ5j 5DLQE 1YIJT 1O9SA 4E7HA 2ZZDA 2GFUA 3MEUA 4HCZA 5A2QE 3QZ5B 3X26B 1VQ9T 1VQMT 4M7AF 3OSSC 2ZPIB 4M75B 4DOWA 1VQLA 5HK3A 4C0GA 2PUOB 5C0MA 2XU8A 2RJCA 3VKIA 3HL8A 4BI8B 4ZN3A 4IUUA 1VQOT 3QPHA 1VQ8A 5CKEA 4J7FA 3OS5A 1IZ6A 3QO3A 3HRTA 3NTHA 4C8QB 4M77A 3VV0A 2RB6A 1VIEA 2CYZB 2EAYA 2ZPHB 5GANe 5GAN4 3GPLA 4JRQA 1VQ7A 4F7UE 5A0GA 3JCMe 3CCVT 3OYYA 3P8BB 1QVGS 2VXEA 1KG1A 2M1HA 3MP8A 2FVUA 2XDBA 3PIPA 3URGA 1M4ZA 4M78A 2LQKA 4EMGA 4ZGEB 2DK3A 2QQSA 3CBOA 2JNGA 1B34B 4OB1B 1I8FA 4BB7A 3CCQT 2CZ6B 4F7UF 5CO7A 2VV5A 1BI2A 1WQWA 3JCMP 2LT4A 2EJ9A 2JVVA 4JRIA 5LJ5d 2ZGWA 3OBWA 1NPPA 3L42A 4M77G 3PIOA 2Y90A 2A7YA 4BDYA 1Y07A 3FC3A 2QI2A 2VC8A 3CCMA 1VQ4A 1VQLT 2GQVA 2K57A 1VQ8T 5GAN7 4IUQA 5FU6B 3RMQA 4J6XA 3J81E 4E7JA 2LVMA 2V8KA 1YBYA 2V8IA 3CMAA 4M78G 2M16A 4JJNK 3OB9A 2B8AA 2XDPA 4A4HA 2HAXA 4RMOA 5GAMf 2EFIA 4JUVA 5FROA 3GLXA 5LL6S 4A4FA 4QVZA 4XTXA 2LQ8A 4M78E 1UGSB 1OYXA 2KMTA 1YI2A 4FT4A 1Q82U 4IURA 5GAN8 3A8HB 5IT9E 1BIAA 2DAQA 3JB9D 1Q86U 4FIBA 2DD5A 3L2RA 4C8QC 2FL7A 5GAOm 1EIFA 2E1HA 4N4IA 2KVQG 5GAOl 3M9QA 1O75A 3QG1A 1Q82C 4M75D 4M78F 2EJGA 2V8JA 1XQHA 2PVDB 3F70A 1Y96B 4M77B 3UDCA 4C5HA 3CPWA 2R58A 5CQYA 3CXCA 4FT2A 4LDYA 1Q86C 1YJWA 4OP0A 5DY9A 3CCMT 1VQ4T 4C8QD 4BACA 3FRNA 3O8VA 4N4GA 3GNGA 3TU4K 4RCCA 5CKFA 4J7IA 3ZFJA 4KUDK 4Z02A 4M78B 1ZHIA 4OF1A 1KHIA 4NS5A 5GANf 2QEXA 3CMAT 4L6V5 5GAMh 3JCMf 3OYEA 3M58A 4VUBA 4NL3A 2E12A 3E9FA 4XU1A 3CBMA 3LW5E 2L3RA 3MEWA 4Q5WA 2OAUA 1OZ3A 2JOYA 2Y4XA 5KH6A 5GMKj 1YI2T 1LJOA 2GCXA 3WXMB 2LX9A 1KQSA 4MDXA 4FL6A 4MZPA 1Q81U 2M0OA 5FU6C 2LT1A 5J26A 5GAN6 1SSFA 1Y7XA 1UB4A 1UGQB 2I2LA 1VQ5A 2YLBA 4M7DA 3A8MB 3X24B 1YJNA 5I2MA 1TH7A 1NZ9A 1YCYA 3M54A 4BI3A 1Q81C 1BI1A 1YJWT 4XTYA 3G71A 3FDRA 2MAMA 4XU2A 3VUZA 3CCEA 3C12A 3M56A 1K8AU 4HCBA 3OW2S 1N6AA 3M5AA 4KUIA 2QEXT 1W2BA 2PUKB 2LC4A 4N0AC 2QTXA 3HHTB 4B9XA 1KHCA 3CC7T 2E70A 3BFMA 4PKCC 4M77C 2L89A 4C5EA 3LYIA 3OYCA 1K8AC 5KCHA 3UPUA 5HY6A 4M7AG 1UGPB 2E10A 2K3XA 4EDUA 2HNIA 4BI4A 4E7LA 2WSFE 2XKOC 4XTZA 4M78C 2X35A 4M77D 5C6SA 3S3OA 4M7DE 1HXDA 1VQ5T 3INZA 1YJNT 1H3ZA 3L2QA 3QJ6A 3V8LA 2LDMA 4A4GA 3CCRA 3I56A 3G71T 4KULA 3CCET 5KCOA 2WSEE 1N27A 4ZGJB 4M7DF 4OVAA 1WNLA 3HFNA 5AYFA 3QZ9B 4C0ZA 5GAOq 3G6EA 4ZTJA 1VQMA 2RI2A 2QQ9A 3RKYA 4F7UG 2O4XB 4MMLA 2QDYB 2E41A 2ZPEB 2DZ9A 3SFMA 3OY9A 1D3BB 4M7AB 2RD1A 2C06A 2X4WA 2PQWA 3EAEA 1V29B 4MMKA 1I81A 3V7RA 3CC4A 2WACA 3S3NA 3CCSA 1ZQ1A 2QQRA 5LJ3g 3JCMb 2VGMA 2EQJA 4C92E 3FIFA 3LWIA 1X01A 1QW1A 2VYTA 5CVIA 4PJOA 4J6WA 4EMHA 2DZCA 4XK8E 5GMKe 1QVPA 3L1AA 3PGGA 4L5GA 4X34A 5I21A 3I56T 2HBPA 3CCRT 3C94A 3JCMJ 3EFRA 4C92F 2E65A 1KQ2A 4ELZC 3JRZA 3OS1A 2DXUA 5L8RE 4ZGDB 2XK0A 3G6ET 3MHXA 3NTKA 3BDLA 4JLGA 5D6WA 3UT1A 3QJYA 3ZBDA 2K5FA 3TREA 4F7UB 4N4HA 3Q1JA 2QQBA 5CCAA 2HQXA 3QYHB 4FM4B 2R57A 5LJ3e 2DXTA 3JAME 3OYJA 1M1KU 3JB9H 4LDWA 1LOJA 2P0PA 1G3WA 3KXTA 1AHJB 2X4JA 1JJ2A 5CQXA 1KQ1A 1QVFS 5IAYA 3CC4T 3DLMA 3CCST 2RHIA 2PU9B 3VYHB 3ME9A 3C95A 3MEAA 4QQGA 1M1KC 5LJ5g 4J83A 4PL6A 2EYQA 4QQDA 4KBMB 3N5BB 3OYMA 3JB9I 4PJOE 3OYNA 3QXEB 4J8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASK A;  4FL6 A;  3UWN A;  2M0O A;  3C4S A;  4IKF A;  3OMC A;  5J26 A;  4QQ6 A;  1SSF A;  2RI5 A;  4BE2 A;  3OYG A;  3H8Z A;  5KE3 A;  2RHU A;  3OQ5 A;  3OS2 A;  3OYI A;  3L2U A;  2NLU A;  4IUT A;  2EQK A;  3LGL A;  5CIU A;  5IN1 A;  1OI1 A;  3MP6 A;  3FDR A;  2BKD N;  3OYB A;  4PLL A;  3OS0 A;  2F5K A;  2EKO A;  2FHD A;  1OZ2 A;  2GFA A;  4E7H A;  1MHN A;  2GFU A;  3MEU A;  4HCZ A;  4B9X A;  1KHC A;  2LTO A;  3GOX A;  5C0M A;  2R5M A;  2RJC A;  4BD3 A;  2BIV A;  2L89 A;  4C5E A;  3LYI A;  4IUU A;  3OYC A;  3OYH A;  5KCH A;  2RHY A;  1WJQ A;  3OYD A;  2BUD A;  2RJE A;  3NTH A;  1RI0 A;  3CEY A;  2K3X A;  3MO8 A;  4EDU A;  5J39 A;  2X4Y A;  4E7L A;  3LH0 A;  4A4E A;  3MP1 A;  2X35 A;  2M1H A;  3H6Z A;  3MP8 A;  5C6S A;  3S3O A;  2DIQ A;  2G3R A;  2JTF A;  2YRV A;  2EQU A;  2QQS A;  1WJR A;  2P0K A;  3QBY A;  3L2Q A;  3QJ6 A;  2HQE A;  2RI3 A;  3OYF A;  3OA6 A;  2LDM A;  4A4G A;  4BE0 A;  2EQM A;  2RJF A;  3DB3 A;  3OYL A;  5KCO A;  1N27 A;  4E7I A;  3FLG A;  2CKK A;  2LRQ A;  3LX7 A;  3PMI A;  3PNW C;  4OVA A;  3P8D A;  3KUF A;  4QW2 A;  3L42 A;  4ZTJ A;  2RI2 A;  3QKJ A;  4IUP A;  4BDY A;  4IUV A;  3FC3 A;  3DB4 A;  2O4X B;  4IUQ A;  3OY9 A;  1G5V A;  3QII A;  3L2V A;  2GF7 A;  1WJS A;  2LVM A;  2R5A A;  4E7J A;  4ZTF A;  2X4W A;  2K3Y A;  4II1 A;  2PQW A;  1XNI A;  2M16 A;  3EAE A;  4RG2 A;  4CRI A;  4LD6 A;  3OB9 A;  2B8A A;  2XDP A;  4A4H A;  2RHX A;  2WAC A;  2EFI A;  3S3N A;  2QQR A;  5FRO A;  2EQJ A;  4GY5 A;  4A4F A;  4QVZ A;  5FRM A;  3LLR A;  5D6Y A;  1OYX A;  2VYT A;  4FU6 A;  2DIG A;  3PMT A;  4IUR A;  2D9T A;  2DAQ A;  4BE1 A;  2RHZ A;  3OMG A;  4B9W A;  3L2R A;  4X34 A;  5M9O A;  2RJD A;  4N4I A;  2MWP A;  3M9Q A;  4PLI A;  4C5I A;  2O4X A;  2E5Q A;  2IG0 A;  2E6N A;  3OS1 A;  3F70 A;  4C5H A;  2L8D A;  1WGS A;  2XK0 A;  3OYK A;  2R58 A;  3BDL A;  3NTK A;  3NTI A;  4L59 A;  5D6W A;  3UT1 A;  5KE2 A;  3PFS A;  3MEV A;  4N4H A;  3Q1J A;  5D6X A;  4BAC A;  2HQX A;  4E7K A;  3O8V A;  2R57 A;  4N4G A;  3OYJ A;  5FRN A;  2RO0 A;  3E9G A;  3L2W A;  4Z02 A;  3P8H A;  4NS5 A;  3FEO A;  2JZ2 A;  3LGF A;  3OYE A;  2MWO A;  4UC4 A;  3OYA A;  5IAY A;  3DLM A;  3E9F A;  3S3M A;  2LCC A;  2RHI A;  3S6W A;  3ME9 A;  3MEA A;  4QQG A;  3SD4 A;  4BDZ A;  3MET A;  2X4X A;  4C5G A;  4PL6 A;  4QQD A;  2L3R A;  3MEW A;  4Q5W A;  3ZEH A;  1OZ3 A;  5KH6 A;  3OYM A;  3OYN A;  1H3Z A; 
#chains in the Genus database with same CATH topology
 5A0D A;  2YHT A;  2COY A;  1G3T A;  3OYG A;  1SF9 A;  3FJ5 A;  4M7A D;  4RKU E;  1MMD A;  1OZ2 A;  1WXT A;  3V8J A;  1TU0 B;  3QSU A;  1PNJ A;  4F04 B;  1VQ6 Q;  2MK5 A;  2CZ1 B;  2JN0 A;  2RQW A;  1WJQ A;  3OYD A;  3CC4 Q;  3CEY A;  1BI3 A;  2GNC A;  3A8G B;  4DOV A;  3FB9 A;  3GBQ A;  1QWF A;  1RUW A;  1TOV A;  2AT1 B;  4R56 A;  1OU9 A;  3BDU A;  2DEQ A;  4OMF B;  1FXX A;  2DTO A;  5GAN h;  5CK9 A;  4M75 A;  3JCM h;  3PNW C;  2AKK A;  1K1Z A;  2ROT A;  3V7C A;  4QVC A;  2DTI A;  2DXC A;  3JCM Q;  2ZAE A;  1K8A R;  4IUV A;  1W2B P;  1LCK A;  3DB4 A;  4R55 A;  5CKH A;  1G5V A;  1H8K A;  2RMO A;  4CRI A;  5GAN 3;  1M1F A;  2OTL A;  5FRM A;  1X6B A;  3LLR A;  2LQW A;  2E3I A;  5J3B A;  4K11 A;  3QDR B;  1M2V A;  4A4K A;  1NEB A;  3CCL Q;  5LJ5 f;  3CC2 T;  3M4G A;  1ZSZ A;  5GAM e;  1YIT Q;  4C8Q E;  2F2X A;  4C0D B;  2ABL A;  3PFS A;  2HEQ A;  2PZ1 A;  1I4K 1;  2X9H A;  2PNI A;  5GAO r;  1HK9 A;  1CSK A;  1OUL A;  2HD0 A;  1JU5 C;  4ORZ A;  3OYA A;  4PK4 A;  3R6O A;  2L5Q A;  1W4S A;  1G3Y A;  4ATO A;  4ESR A;  3ASK A;  2YWW A;  1BB9 A;  4OGE A;  2Y4Y A;  2P0Q A;  1VQN Q;  3OS2 A;  3C0C A;  3VU3 C;  3CCU Q;  2J6F A;  4IUT A;  1RAC B;  3CME A;  4LN2 A;  1QQJ A;  3MP6 A;  2BKD N;  2KGT A;  1RI9 A;  2O01 E;  1KD1 C;  4RTU A;  2YUQ A;  2CP6 A;  1BKB A;  2EJF A;  1UUE A;  5FWB A;  3WVD B;  1K9M C;  2QA4 Q;  2YT6 A;  1NYF A;  2BIV A;  4C0D C;  1VQ9 Q;  1K9A A;  2KXD A;  2O31 A;  1RI0 A;  2E3H A;  2QAS A;  1NJI C;  3M4Y A;  2JTF A;  2LNH B;  1VOM A;  3RUX A;  4LE9 A;  4M77 F;  2KQW A;  2EYW A;  2HDA A;  1GL5 A;  2VAS A;  2LRQ A;  3LX7 A;  1IGQ A;  4LUD A;  3RER A;  2RPN A;  3ZL7 C;  4DA4 A;  1YJ9 A;  3HP9 A;  1YHQ A;  4RTX A;  1CKA A;  2AKL A;  1KK7 A;  5CAI A;  1Q7Y U;  2V26 A;  3I9Q A;  1WQ7 A;  4J9I A;  3L2V A;  2CS7 A;  4ZTF A;  1WJS A;  2C0O A;  1QP3 A;  2XG8 D;  2OTJ A;  3IQL A;  2K2V A;  1K0S A;  1NLO C;  1FWZ A;  2CZ7 B;  2YUO A;  2O2O A;  1BK2 A;  1IHV A;  1KC8 C;  1OQK A;  2EQI A;  2QXF A;  4C92 D;  1RAA B;  3PTA A;  4DBQ A;  1D0Y A;  1VQ7 Q;  1T0H A;  4C8Q A;  3HFO A;  2HMA A;  1S72 A;  2H3J A;  4L59 A;  2F2V A;  2DPP B;  5DM7 R;  2BE9 B;  4EPC A;  2FG0 A;  5LJ3 j;  5GMK h;  1OEB A;  4LD9 K;  1WLP B;  4HT9 A;  2KEA A;  3R6N A;  1VQP Q;  2K3B A;  2LCC A;  1H3H A;  1VQO A;  3I5R A;  3JCM W;  1TUC A;  2D0N A;  2HBW A;  4C8Q G;  1NE8 A;  2X3X D;  4IKF A;  1GRI A;  4LDU A;  4QQ6 A;  5I2S A;  1N8R R;  2G6F X;  3H8Z A;  4MZM A;  1VIF A;  3JSC A;  4M7A E;  2CGH A;  5GAN g;  3G7Z A;  3L2U A;  3JCM g;  3LGL A;  3DLL A;  5IN1 A;  3G4S T;  4PLL A;  4P5N A;  2EKO A;  1YIJ T;  3UAT A;  2ZZD A;  2GFU A;  3JV3 A;  1X43 A;  4HCZ A;  3X26 B;  5A2Q E;  1UE9 A;  1X6G A;  1VQL A;  5HK3 A;  2PUO B;  5C0M A;  1MND A;  3HL8 A;  2OX7 A;  3TQ7 P;  4J7F A;  2A0F B;  3OS5 A;  2QYZ A;  3VV0 A;  2CYZ B;  4F7U E;  1QVG S;  1KG1 A;  3MP8 A;  4FYV B;  4M78 A;  2LQK A;  4ZGE B;  1T3S A;  3CBO A;  4BB7 A;  2L3Q A;  3CCQ T;  2CZ6 B;  4EIK A;  1BI2 A;  1E6H A;  2JVV A;  4JRI A;  5LJ5 d;  1M8M A;  3L42 A;  1G83 A;  2A7Y A;  4BDY A;  1AVZ C;  1VQ4 A;  2GQI A;  1OPL A;  2LX7 A;  1VQ8 T;  5FU6 B;  3RMQ A;  2V8K A;  1AEY A;  1YBY A;  1TUD A;  1VYV A;  1S1N A;  2V8I A;  3CMA A;  4M78 G;  2M16 A;  3OB9 A;  1X2K A;  2HAX A;  5GAM f;  1V76 A;  5LL6 S;  4XTX A;  4OMM A;  2LQ8 A;  2LMJ A;  1BIA A;  1CKB A;  2DE0 X;  4GBQ A;  4M4Z A;  2EGE A;  2FZG B;  2E1H A;  1N5Z A;  4N4I A;  3M9Q A;  2LZ6 B;  5GJV B;  4M75 D;  2V8J A;  4M77 B;  1Y96 B;  1ZUY A;  4LDY A;  1Q86 C;  4OP0 A;  1SSH A;  1KFZ A;  3O8V A;  4N4G A;  3GNG A;  3TU4 K;  1QVG P;  3I35 A;  4RCC A;  2P84 A;  4KUD K;  3M58 A;  4VUB A;  1PM3 A;  1WHH A;  2IPO B;  5GMK j;  2OAU A;  1OZ3 A;  2JOY A;  3RBB B;  1K73 R;  4CC4 B;  4FL6 A;  3CCS Q;  5FU6 C;  1UB4 A;  2I2L A;  1VQ5 A;  4M7D A;  1NBE B;  2O9V A;  1M90 R;  3X24 B;  4FYW B;  2RF0 A;  4D8D A;  1YJW T;  1NEG A;  1NLP C;  2MAM A;  4XU2 A;  1ZUU A;  1E7O A;  2DFU A;  3OW2 S;  3EFO A;  4KUI A;  2QEX T;  4N0A C;  4B9X A;  2QTX A;  4OMN A;  3H0I A;  3CC7 T;  1EZZ B;  4M77 C;  1K8A C;  1TXQ A;  5KCH A;  1R0B G;  4M7A G;  1JXM A;  1Y0M A;  2K3X A;  2EGC A;  2QK0 A;  4AFU C;  2XKO C;  2X35 A;  2COW A;  4CC3 A;  1HXD A;  1YJN T;  1RLP C;  3QJ6 A;  3CCR A;  3I56 A;  3VS4 A;  2CDT A;  2SRC A;  3QZ9 B;  3M0T A;  2QQ9 A;  4F7U G;  2O4X B;  2QAZ A;  2E41 A;  2MIO A;  4J9G A;  2DZ9 A;  3SFM A;  2EBP A;  2X4W A;  2PTK A;  2B86 A;  2WAC A;  3S3N A;  2VGM A;  1VA7 A;  1OX8 A;  2EQJ A;  4QKU A;  4ANJ A;  4C92 E;  2IIM A;  5IHK A;  3OW2 P;  4J9D A;  1XJW B;  3H41 A;  3QWY A;  4PJO A;  4XK8 E;  1QVP A;  5I21 A;  2L3P A;  1ACM B;  3C94 A;  4RTW A;  1KQ2 A;  4ELZ C;  3JRZ A;  3OS1 A;  3EG3 A;  5L8R E;  4ZGD B;  2XK0 A;  1X69 A;  3BDL A;  3VS7 A;  4N4H A;  3Q1J A;  1PD1 A;  3QYH B;  3JB9 H;  1LOJ A;  2CP2 A;  1JJ2 A;  2CSQ A;  1PKT A;  2GTJ A;  2NUT B;  3CC4 T;  1QVF S;  5GJW B;  1PC0 A;  3C95 A;  1ARK A;  4PL6 A;  2DL5 A;  3OYN A;  2CH4 A;  4YTL A;  1Q82 R;  2XI9 A;  3PT9 A;  2XDD A;  1TSF A;  3VRY A;  3EG0 A;  1PD0 A;  1I07 A;  4RG8 A;  2L2P A;  4EMK A;  4E7Z A;  2OAW A;  2F5T X;  3RKX A;  3OS0 A;  1I0C A;  2GFA A;  5AT1 B;  4AFS C;  1I5O B;  5LJ5 e;  3EGD B;  5KYX B;  2LCS A;  2KSS A;  4Y91 A;  3OYH A;  3JB9 J;  4XTV A;  1BU1 A;  4A63 B;  2RK2 A;  1N9S A;  2KAF A;  2X4Y A;  1JBM A;  4A4E A;  5EG2 A;  2VVK A;  5GAM d;  1Q81 R;  3CCL T;  2E64 A;  2DMO A;  3VUB A;  3OA6 A;  2HQE A;  3OYF A;  3E2U A;  1B3Q A;  2DYI A;  1QVF P;  2DNU A;  3CC2 A;  3PMI A;  2RQR A;  3RIR A;  2ZCF B;  2QQA A;  4FSS A;  4Y28 E;  3I5S A;  1MV0 B;  3X28 B;  2JXB A;  2K3Y A;  3NMZ C;  1XNI A;  2RHX A;  4C92 A;  1WYX A;  2RN8 A;  1U06 A;  2DTH A;  1WA7 A;  3GNF B;  4M78 D;  3CCJ Q;  1VQN T;  4M75 E;  1LVK A;  3CCU T;  4RTZ A;  1W1F A;  1GCQ A;  3TSW A;  3FJP A;  5DLO A;  3ER0 A;  1N8R C;  2V1Q A;  3CBP A;  2KYM A;  2F69 A;  2D0Q B;  4C92 G;  4LDX A;  2CZ0 B;  3VS6 A;  4KH1 B;  3SB2 A;  4F17 A;  3CPW S;  2QA4 T;  5KYY A;  1NYG A;  1M5Q 1;  1U1T A;  1NM7 A;  3CQT A;  4C8Q F;  4HKE A;  1R0C B;  1I5L A;  1SEM A;  3TEE A;  4HCC A;  2DRK A;  1Y71 A;  4Y92 A;  2AZS A;  2X4X A;  1TTH B;  4LUE A;  3M0U A;  1RAI B;  3GP8 A;  4HCK A;  1ZA1 B;  1JRI A;  2OTJ Q;  1JO8 A;  5LJ5 h;  3OMC A;  2DD4 A;  1WFW A;  1FMW A;  1KD1 U;  3E19 A;  1VQK T;  4OB0 B;  5KE3 A;  2DKG A;  2FRW A;  1K9M U;  2J7I A;  3EH1 A;  4D6W A;  2LJ1 A;  4CI0 C;  1MHN A;  3LWH A;  1M1K R;  1BIB A;  5KYN A;  2XIC A;  3EHR A;  2COZ A;  1NJI U;  1QMC A;  2JUF A;  2RHY A;  1ZSZ B;  2J6K A;  2V1R A;  1W2B S;  2KT8 A;  3G1J A;  1U1S A;  1MMN A;  2HSP A;  4E47 A;  4J9C A;  4QVD A;  1ZX6 A;  2K4Y A;  1VQ7 T;  4AFQ C;  2YRV A;  3CPW P;  4JPB W;  4M7D D;  2P0K A;  2CUD A;  4BE0 A;  4M75 C;  2FB7 A;  2EQM A;  1G2B A;  3VS3 A;  1SRL A;  1YFN A;  1NG2 A;  2PVO B;  3CD6 Q;  1VQP T;  4F14 A;  4JDS A;  3EG2 A;  1M9S A;  2GF7 A;  1KC8 U;  3CPF A;  1Q7Y R;  3VJP A;  4DEY A;  4OMO A;  2EIF A;  3M0P A;  2AHJ B;  2LNV A;  2ZPF B;  2D9T A;  3BW1 A;  4JRK A;  5CKD A;  1AWW A;  1ZSZ C;  1K73 C;  2KNB B;  2EGA A;  2MWP A;  3J7A F;  3M57 A;  1D3B A;  3QHS A;  2KBT A;  1M90 C;  3G4S A;  2KYB A;  5FRN A;  2EYY A;  1BBZ A;  1YIJ A;  1X75 C;  1WHG A;  3L2W A;  4J9F A;  1XOV A;  2JZ2 A;  3X25 B;  1VQ4 Q;  4M75 G;  4DEX A;  4PNO A;  3SD4 A;  4BDZ A;  2RA2 A;  2FYK A;  5LJ3 h;  2K79 A;  1SKU B;  4GLK A;  4PJO D;  2RH2 A;  1U8R A;  3U23 A;  1SRM A;  1UDL A;  2MPX C;  3JCM V;  4DQ2 A;  3CCQ A;  5CIU A;  4PJJ A;  1X6O A;  3M0Q A;  5LJ5 j;  5DLQ E;  3QZ5 B;  4M7A F;  3OSS C;  4HXJ A;  4DOW A;  4AG2 C;  3I55 Q;  3VKI A;  1VQ8 A;  2CP3 A;  4FW1 A;  2DBK A;  1QCO A;  4C8Q B;  3NTH A;  5GAN 4;  3CCV T;  2FRY A;  3P8B B;  3QDF A;  2RQV A;  3SEM A;  2XDB A;  2YRD A;  2E5K A;  1ABO A;  4OB1 B;  1I8F A;  4F7U F;  5CO7 A;  1KJW A;  1VQ5 Q;  2EJ9 A;  4KRT A;  1OPK A;  2Y90 A;  1Y07 A;  2A28 A;  1UHC A;  2QI2 A;  1TWB A;  2A37 A;  4IUQ A;  1D09 B;  4J6X A;  2A08 A;  1AZE A;  2QG9 B;  3EG9 B;  4RMO A;  3H9N A;  4A4F A;  4QVZ A;  1UJ0 A;  4M78 E;  2M0Y A;  1OYX A;  4FYY B;  3H0H A;  4IUR A;  5GAN 8;  5IT9 E;  4RUG A;  3JB9 D;  1Q86 U;  5IXF A;  4C8Q C;  1IO6 A;  5GAO m;  2KVQ G;  4HVU A;  5GAO l;  1Q82 C;  3UDC A;  1UEC A;  1EFN A;  1XQH A;  2PVD B;  2W0Z A;  2R58 A;  3CXC A;  5FW9 A;  3CCR Q;  1YJW A;  3EGX B;  3UF4 A;  1RAE B;  4BAC A;  1T3L A;  4M78 B;  2QEX A;  4NS5 A;  5GAN f;  5GAM h;  3JCM f;  4NL3 A;  5IHN A;  4XU1 A;  1F1B B;  2JTE A;  3TSZ A;  3LW5 E;  3ULR B;  3MEW A;  4Q5W A;  4E7S A;  2Y4X A;  1Q95 G;  1YI2 T;  1LJO A;  1KQS A;  2LX9 A;  5IHI A;  4MDX A;  4MZP A;  2FEI A;  2LT1 A;  5J26 A;  1Y7X A;  1UGQ B;  2YLB A;  1HJD A;  1YJN A;  1TUG B;  3UA7 A;  1AWO A;  1Q81 C;  1BI1 A;  4XTY A;  4AFZ C;  3FDR A;  1U5S A;  3VUZ A;  3D7S B;  1K8A U;  4HCB A;  1N6A A;  3CCM Q;  2PUK B;  2LC4 A;  1KHC A;  1KIK A;  2E70 A;  4PKC C;  3LYI A;  2FPF A;  5HY6 A;  2VKN A;  2E10 A;  2HNI A;  1J3T A;  2O88 A;  4M78 C;  5C6S A;  4M7D E;  1UG1 A;  3MKD A;  3L2Q A;  5KYW A;  4A4G A;  2HL5 C;  1MUZ A;  3G71 T;  1W6X A;  4KUL A;  4Z88 A;  2WSE E;  4ZGJ B;  2DL3 A;  2K9G A;  3HFN A;  4C0Z A;  4ZTJ A;  2RI2 A;  2D8J A;  4GLM A;  3RKY A;  1GBQ A;  2QDY B;  2ZPE B;  1TG0 A;  2JW4 A;  2AIR B;  4M7A B;  2RD1 A;  2JMC A;  2PQW A;  2NUP A;  3CC4 A;  1ZQ1 A;  5LJ3 g;  5IH2 A;  2O9S A;  3LWI A;  3FIF A;  4PFZ A;  1QW1 A;  4D8K A;  4RTT A;  2VYT A;  1HYO A;  3EFO B;  4B6M A;  2J06 A;  2I0N A;  1OX9 A;  2BTT A;  3JCM J;  2HBP A;  3EFR A;  4C92 F;  2DXU A;  2QTV A;  1VQM T;  3MHX A;  3CCE Q;  3TRE A;  3A1P A;  4F7U B;  1M3A A;  2QQB A;  2DXT A;  3JAM E;  4J9B A;  4PFP A;  2VWF A;  2ED1 A;  2J05 A;  4QQG A;  1M1K C;  4J9H A;  2QGF B;  2HL3 A;  4KBM B;  4PJO E;  2XMF A;  1AWJ A;  2K2M A;  1PWT A;  5GAM j;  4M7A C;  4OB2 B;  1R8O B;  3CCL A;  3SHW A;  3M55 A;  3MCA B;  4LXC A;  3G6E Q;  2FHD A;  1M8V A;  3A8L B;  1BCO A;  3PVQ A;  3HPW A;  1AWX A;  3QUI A;  2P4R A;  2NYS A;  1RAB B;  3SWN A;  3V7S A;  2CP7 A;  1WPY A;  4WTO B;  1KSW A;  2KY9 A;  4MZT A;  1MMG A;  2KDS A;  3CCJ T;  2G3R A;  1WJR A;  4XU3 A;  1VQN A;  1QKX A;  3DB3 A;  4V2S A;  1PSF A;  5HCK A;  1JB0 E;  3CCU A;  4E7I A;  3FLG A;  2IVW A;  5KYU A;  1UHF A;  4IUP A;  3L2Z A;  2FPD A;  3SDZ A;  4M7D G;  4WF2 A;  2DBM A;  1K76 A;  2QA4 A;  3RR6 A;  4II1 A;  9ATC B;  4OGC A;  2DEU A;  1GXI E;  4EMK B;  5GAN d;  3JCM d;  4RCB A;  4PJO C;  2PVG B;  3PMT A;  1VUB A;  4O6J A;  1N8R U;  4BE1 A;  4LDV A;  1H64 1;  1YWP A;  1FYN A;  5I22 A;  1VQK A;  1G8X A;  1PKS A;  2ECZ A;  2Z0W A;  5FU7 B;  5KE2 A;  2M9U A;  4JZ4 A;  3GF5 A;  2CH4 W;  3M59 A;  4M75 F;  4E7K A;  3A5Z B;  5GAO p;  1AD5 A;  2RO0 A;  1LNX A;  4KH0 B;  2YRC A;  3P8H A;  1WXB A;  2DER A;  2BZX A;  1H92 A;  2ATC B;  2A3L A;  2VUB A;  4J9E A;  3HSB A;  2GTO A;  4C5G A;  3WVE B;  4N0A A;  4JLI A;  3GIB A;  1Y96 A;  2FO0 A;  1FX7 A;  2ESW A;  1U3O A;  2K5I A;  1I1J A;  4EMK C;  3M0S A;  2NLU A;  1AZG B;  4C92 B;  4NOY A;  1VQ6 T;  3CD6 T;  4PJO G;  2DL4 A;  1NPR A;  3RES A;  2ZPG B;  2ENM A;  3NFC A;  1VQP A;  1RL2 A;  3G4S Q;  5HK0 A;  5GMK m;  5GMK l;  1YIJ Q;  5FU7 C;  3RKW A;  2BUD A;  2MF2 A;  2OTL Q;  4O5V A;  1YP5 A;  3LH0 A;  4HT8 A;  3H6Z A;  1N9R A;  4HA8 A;  5ECA A;  1DJ7 B;  2EQU A;  2KRN A;  8AT1 B;  2RI3 A;  4JS4 A;  2RJF A;  2ROL A;  2EWN A;  1RLQ C;  2CKK A;  3OSV A;  2EKH A;  2JJ9 A;  1B07 A;  3P8D A;  5A0L A;  3CCQ Q;  2D6F A;  1UEB A;  3JCM c;  4JRP A;  4NL2 A;  6AT1 B;  2R5A A;  4C92 C;  4BY6 B;  2KRO A;  3E1S A;  1K73 U;  3VYG A;  4GY5 A;  1UGV A;  2DF6 A;  2DA9 A;  4C0F A;  1AT1 B;  4ELY C;  2HZY A;  2YXY A;  4DBR A;  1YIT T;  2RHZ A;  1M90 U;  1GCQ C;  1XTD A;  2EPD A;  3QYG B;  3HKS A;  2O4X A;  2IG0 A;  2M02 A;  3CME Q;  1SG5 A;  1WGS A;  2L8D A;  3NTI A;  4JJC A;  1LPL A;  3JB9 G;  1C1A A;  1MMA A;  3I55 T;  1ZBX A;  2ED0 A;  2HQH A;  3FEO A;  1B34 A;  4JJB A;  4UC4 A;  4ZN1 A;  3S3M A;  4JZ3 A;  1TS9 A;  1C6V X;  3MET A;  1BYM A;  4KT0 E;  1V1C A;  1JJ2 S;  3EFS A;  4IIM A;  4OB3 B;  1WHK A;  2KK4 A;  2RK1 A;  4Z89 A;  3VS1 A;  3CCV A;  1IB8 A;  5CR2 A;  1WDX A;  4BY6 C;  1OI1 A;  1IHW A;  3OYB A;  1YJ9 Q;  1YHQ Q;  4AMC A;  2OI3 A;  1MV3 A;  1VQ9 T;  1RAD B;  2ZPI B;  4M75 B;  1AOJ A;  2W10 A;  2JS2 A;  2HCK A;  2XU8 A;  4ZN3 A;  4IUU A;  3QPH A;  5CKE A;  1IZ6 A;  3QO3 A;  3HRT A;  1SHG A;  2RB6 A;  2EAY A;  1K0X A;  5GAN e;  3GPL A;  2LJ0 A;  3JCM e;  3OYY A;  1RAG B;  2FVU A;  3PIP A;  3URG A;  1M4Z A;  1QKW A;  4FYX B;  2DK3 A;  2YUN A;  2JNG A;  5KYX A;  3MJX A;  1S72 Q;  1WQW A;  2LT4 A;  1M2V B;  4OMP A;  2OJ2 A;  1YJN Q;  1JJ2 P;  3PIO A;  4HVV A;  1T0J A;  3FC3 A;  1UFF A;  3PE0 A;  2K57 A;  5GAN 7;  2CP0 A;  2LVM A;  4X1V A;  1WIE A;  4JJN K;  1YN8 A;  1OOT A;  4KGX B;  2B8A A;  2XDP A;  4A4H A;  1VQO Q;  3VS2 A;  4JUV A;  5FRO A;  2L0A A;  1UGS B;  1Q82 U;  1YI2 A;  4FT4 A;  2DAQ A;  1EIF A;  2M51 A;  2RQT A;  3QG1 A;  3TVT A;  4M78 F;  2EJG A;  3F70 A;  4C5H A;  1BCM A;  1M27 C;  1Q86 R;  4FT2 A;  3CCM T;  2DL7 A;  2K6D A;  5CKF A;  1VQL Q;  1Z9Q A;  3OYE A;  3UA6 A;  4DBH A;  3E9F A;  2RQU A;  2L3R A;  2GCX A;  1IGU A;  3VS0 A;  1VYT A;  1Q81 U;  2M0O A;  5GAN 6;  1SSF A;  3HTR A;  4AT1 B;  2D1X A;  1Z9Z A;  5I2M A;  1NZ9 A;  3G71 A;  2YDL A;  3C12 A;  3M56 A;  2KI7 A;  3M5A A;  1EX4 A;  3HHT B;  3VRZ A;  1Y57 A;  2X51 A;  3CMA Q;  4C5E A;  2L89 A;  1D1B A;  3M0R A;  1UGP B;  2J6O A;  4BI4 A;  1D0Z A;  4E7L A;  4E2F B;  1D0X A;  4M77 D;  3S3O A;  1C0M A;  1SHF A;  1RAH B;  3INZ A;  2CT3 A;  1PCX A;  3CCE T;  1PRM C;  1K4U S;  1HSQ A;  1N27 A;  2NWM A;  2CRE A;  4PJN A;  4M7D F;  3EGU A;  5AYF A;  1WNL A;  5GAO q;  1VQM A;  4AG1 C;  3OY9 A;  1QCF A;  4F16 A;  2KRM A;  3EAE A;  1V29 B;  4MMK A;  2DET A;  1IXD A;  2QQR A;  4IIO A;  4OMQ A;  1GFD A;  2AZV A;  2CT4 A;  1R77 A;  5GMK e;  3PGG A;  3L1A A;  4LNP A;  1A0N B;  1QLY A;  3G6E T;  5D6W A;  3ZBD A;  1QWE A;  2CSI A;  5CCA A;  2HQX A;  3OYJ A;  2FPE A;  1M1K U;  2QDL A;  1AHJ B;  3EG1 A;  5CQX A;  1KQ1 A;  5KYW B;  5IAY A;  3CCS T;  3VYH B;  2PU9 B;  3ME9 A;  3MEA A;  5LJ5 g;  4J83 A;  1E6G A;  2EYQ A;  4QQD A;  3OYM A;  3JB9 I;  3QXE B;  4J8O A;  2JM8 A;  3UWN A;  3C4S A;  3TCJ A;  3RMS A;  3CCJ A;  2RHU A;  3I56 Q;  4PJO F;  1ZBJ A;  2NUP B;  5GMK i;  2E4H A;  3BE3 A;  4TVR A;  2XID A;  1VQK Q;  3CC7 A;  2GBQ A;  1P92 A;  2DXB A;  1MGQ A;  1G3S A;  3DKM A;  4BD3 A;  1QVG A;  1BI0 A;  1PSE A;  2X3W D;  1WI7 A;  5GAN j;  3MO8 A;  3RNJ A;  2VB6 A;  2MI6 A;  7AT1 B;  3KBG A;  4XU0 A;  5I11 A;  1GCP A;  5LJ3 f;  3OYL A;  4ME7 A;  2MYS A;  2RNA A;  4X9D A;  4J5Y A;  2JMA A;  2DYB A;  3O5Z A;  2YLC A;  1YNZ A;  3QII A;  4MDW A;  3REA B;  2L3S A;  3A98 A;  2VXF A;  3BY7 A;  3HRS A;  2HKN A;  1VYU A;  1D1C A;  3J80 E;  3OMG A;  5M9O A;  2RJD A;  4XAX B;  3T9N A;  4PLI A;  4C5I A;  2E6N A;  3JB9 F;  4JS5 A;  1M1G A;  3SWN B;  4A54 A;  5D6X A;  4DBF A;  4M7D B;  3EG9 A;  1VQ6 A;  2ZPB B;  3CD6 A;  2CP5 A;  4ZNX A;  2CUB A;  3CXC S;  2MWO A;  3QWX X;  2P4T A;  2K5L A;  3S6W A;  2WSC E;  1WXU A;  2OTL T;  2XD0 A;  2RM4 A;  2DO3 A;  1ZUK A;  3ZEH A;  5KYU B;  2RI5 A;  1FMV A;  2KRS A;  2MMP A;  3OBY A;  5HKC A;  4BE2 A;  3EGX A;  2MOX A;  4XTW A;  5GAO n;  3OW2 A;  1KQS S;  3OQ5 A;  3OYI A;  3CC2 Q;  2H3E B;  2EQK A;  4PJL A;  1B7T A;  2YSQ A;  5FLX E;  1UTI A;  2LTO A;  3GOX A;  2R5M A;  3REB B;  3V8K A;  3SWN C;  2RJE A;  4M7D C;  4M77 E;  5J39 A;  1QCN A;  4J6Y A;  5EC7 A;  3MP1 A;  5CKB A;  4CC7 A;  2JTM A;  2DIQ A;  2DVJ A;  4XTU A;  1YIT A;  1M3C A;  4E6R A;  3QBY A;  3CXC P;  1IRX A;  3CME T;  3CCV Q;  2DM1 A;  4X9C A;  3RDV A;  1IRE B;  1ZSG A;  1GFC A;  2NUZ A;  3M53 A;  4PJO B;  3AT1 B;  2JT4 A;  3KUF A;  4QW2 A;  2XHC A;  1PRL C;  3QKJ A;  1WHM A;  1M30 A;  2DVE A;  4XQ3 A;  4RG2 A;  3I55 A;  1KQS P;  4LD6 A;  1Q7Y C;  4Z8A A;  2MCN A;  1WZO A;  1UGR B;  5D6Y A;  4A53 A;  4KGV B;  4FU6 A;  2DIG A;  2SEM A;  4B9W A;  2F1L A;  3VS5 A;  2EYX A;  2DJZ A;  3JCM X;  2E5Q A;  4BUG A;  3A8O B;  1YJ9 T;  1YHQ T;  3OYK A;  2JM9 A;  1M2O A;  4M7A A;  1UJY A;  3MEV A;  1QVF A;  1D1A A;  5GAM g;  3AHU A;  2LCL A;  1QP2 A;  3E9G A;  3HRU A;  1VQ9 A;  3LGF A;  2LP5 A;  2BE7 D;  2OTJ T;  1ABQ A;  4JJD A;  5D7U A;  1ZA2 B;  3X20 B;  2HSE B;  2E6Z A;  2D8H A;  4F7U A;  5GAN 2;  1YI2 Q;  2FZC B;  1S72 T;  5GAN 5;  2KT1 A;  2C0T A;  4KGZ B;  4FSX A;  5L23 A;  2F5K A;  5LJ3 d;  2VGN A;  1O9S A;  4E7H A;  3MEU A;  3KFV A;  4C0G A;  1PG5 B;  1JQQ A;  2RJC A;  4BI8 B;  1VQO T;  2HKQ B;  4M77 A;  1VIE A;  2ZPH B;  4JRQ A;  1VQ7 A;  5A0G A;  1X2Q A;  2KE9 A;  2VXE A;  2M1H A;  2KXC A;  4EMG A;  2QQS A;  1WX6 A;  1B34 B;  4PFO A;  1KD1 R;  3LH5 A;  3H0F A;  3JCM P;  2VV5 A;  1K9M R;  2FZK B;  1PHT A;  2ZGW A;  3OBW A;  1NPP A;  1W70 A;  4M77 G;  5IXB A;  3NHN A;  3G71 Q;  1VQL T;  2VC8 A;  3CCM A;  2GQV A;  2DX1 A;  3J81 E;  4E7J A;  1HD3 A;  1NJI R;  1OU8 A;  1ZLM A;  2EFI A;  1YWO A;  3GLX A;  4WCI A;  5KYY B;  1MNE A;  2KMT A;  2BZY A;  2LQN A;  3A8H B;  1JXO A;  2EW3 A;  2DLP A;  4FIB A;  2DD5 A;  2DRM A;  3L2R A;  2FL7 A;  1O75 A;  2DL8 A;  4PJM A;  3CPW A;  4QT7 A;  2H8H A;  5CQY A;  2C0I A;  2QGG A;  3NPF A;  5DY9 A;  1VQ4 T;  4C8Q D;  3EHQ A;  3FRN A;  8ATC B;  4J7I A;  3ZFJ A;  4Z02 A;  1ZHI A;  4OF1 A;  1KHI A;  1VQM Q;  1M3B A;  3CMA T;  1VQ8 Q;  2YUP A;  4L6V 5;  5FWC A;  2E12 A;  1RAF B;  1WHL A;  1KC8 R;  3CBM A;  2GGR A;  5KH6 A;  3WXM B;  4OML A;  1SPK A;  3A8M B;  1GBR A;  1TH7 A;  1YCY A;  3M54 A;  2EVR A;  4BI3 A;  3CCE A;  4FCY A;  1W2B A;  2DJQ A;  2F2W A;  3BFM A;  3OYC A;  3UPU A;  3EH2 A;  1X27 A;  4EDU A;  2WSF E;  4XTZ A;  1VQ5 T;  2KR3 A;  1WHJ A;  1H3Z A;  2NUT A;  3V8L A;  2LDM A;  4R0K A;  5KCO A;  3PVL A;  1YJW Q;  4RTV A;  4OVA A;  3G6E A;  4MML A;  2QEX Q;  1D3B B;  2C06 A;  2AK5 A;  3CC7 Q;  1I81 A;  3V7R A;  4FW2 A;  3CCS A;  3JCM b;  1X01 A;  2A36 A;  3EGD A;  5CVI A;  4J6W A;  4EMH A;  2DZC A;  3CCR T;  4L5G A;  4X34 A;  3I56 T;  4RTY A;  2K7A A;  2LJ3 A;  4HVW A;  2EYZ A;  1JEG A;  2E65 A;  3NGP A;  3MPU B;  2DIL A;  3NTK A;  4JLG A;  3UT1 A;  3QJY A;  2K5F A;  4CC2 A;  1OV3 A;  4FM4 B;  2R57 A;  5LJ3 e;  3THK A;  1YCS B;  4LDW A;  2P0P A;  1G3W A;  3KXT A;  2BZ8 A;  2X4J A;  3DLM A;  2RHI A;  2JS0 A;  1FMK A;  3N5B B; 
#chains in the Genus database with same CATH homology
 4YTL A;  5A0D A;  2YHT A;  3UWN A;  3C4S A;  3TCJ A;  2XI9 A;  3PT9 A;  5GAM j;  2XDD A;  4M7A C;  4OB2 B;  3RMS A;  1R8O B;  3CCJ A;  1G3T A;  3CCL A;  3OYG A;  4RG8 A;  2RHU A;  4PJO F;  3M55 A;  4EMK A;  5GMK i;  2F5T X;  4TVR A;  4M7A D;  3RKX A;  2XID A;  3MCA B;  4RKU E;  3OS0 A;  2FHD A;  1OZ2 A;  2GFA A;  1M8V A;  3V8J A;  5LJ5 e;  3A8L B;  3QSU A;  3CC7 A;  1P92 A;  2DXB A;  3HPW A;  1MGQ A;  2CZ1 B;  2KSS A;  1G3S A;  2JN0 A;  3DKM A;  4Y91 A;  4BD3 A;  1QVG A;  3QUI A;  3OYH A;  3JB9 J;  1BI0 A;  1PSE A;  1WJQ A;  4XTV A;  3OYD A;  3CEY A;  2RK2 A;  1N9S A;  3V7S A;  3MO8 A;  3SWN A;  5GAN j;  1BI3 A;  2KAF A;  2X4Y A;  3A8G B;  1JBM A;  1WPY A;  4A4E A;  3FB9 A;  4DOV A;  2KY9 A;  4MZT A;  5EG2 A;  2KDS A;  5GAM d;  3CCJ T;  2G3R A;  3CCL T;  2E64 A;  2MI6 A;  4R56 A;  3KBG A;  1WJR A;  4XU3 A;  3VUB A;  3BDU A;  3OA6 A;  2HQE A;  2DEQ A;  4XU0 A;  3OYF A;  1VQN A;  4OMF B;  1FXX A;  5LJ3 f;  2DTO A;  5GAN h;  3DB3 A;  5CK9 A;  3OYL A;  4V2S A;  1PSF A;  4ME7 A;  4M75 A;  3JCM h;  1JB0 E;  3CCU A;  4E7I A;  3CC2 A;  3FLG A;  3PNW C;  3PMI A;  2IVW A;  4X9D A;  3V7C A;  3RIR A;  2DTI A;  2DXC A;  4J5Y A;  2ZCF B;  4IUP A;  4QVC A;  3JCM Q;  2QQA A;  3L2Z A;  4IUV A;  3DB4 A;  4Y28 E;  3SDZ A;  4R55 A;  4M7D G;  5CKH A;  4WF2 A;  2YLC A;  1G5V A;  3QII A;  4MDW A;  2QA4 A;  3X28 B;  2K3Y A;  4II1 A;  4CRI A;  1XNI A;  4OGC A;  1GXI E;  4EMK B;  2RHX A;  2VXF A;  4C92 A;  3BY7 A;  5GAN d;  5GAN 3;  1M1F A;  2OTL A;  3JCM d;  3HRS A;  4RCB A;  5FRM A;  3LLR A;  2DTH A;  4PJO C;  2PVG B;  3PMT A;  1VUB A;  4O6J A;  5J3B A;  1N8R U;  3QDR B;  3GNF B;  4M78 D;  4A4K A;  3J80 E;  4BE1 A;  3OMG A;  4LDV A;  1VQN T;  4M75 E;  1H64 1;  5M9O A;  2RJD A;  4XAX B;  5LJ5 f;  3T9N A;  3CCU T;  4PLI A;  4C5I A;  3CC2 T;  3M4G A;  2E6N A;  3JB9 F;  1VQK A;  3FJP A;  5DLO A;  3ER0 A;  5GAM e;  4C8Q E;  4JS5 A;  1N8R C;  3CBP A;  5FU7 B;  5KE2 A;  4C0D B;  1M1G A;  2F69 A;  3SWN B;  4A54 A;  3PFS A;  2D0Q B;  5D6X A;  2M9U A;  4C92 G;  1I4K 1;  4LDX A;  1VQ6 A;  2ZPB B;  2CZ0 B;  3GF5 A;  3M59 A;  4M75 F;  3A5Z B;  5GAO p;  4E7K A;  3CD6 A;  3SB2 A;  2RO0 A;  1LNX A;  3CPW S;  5GAO r;  1HK9 A;  2QA4 T;  3P8H A;  3CXC S;  1M5Q 1;  1U1T A;  4C8Q F;  2HD0 A;  4HKE A;  2MWO A;  3OYA A;  1I5L A;  2A3L A;  2VUB A;  2P4T A;  3TEE A;  2K5L A;  4HCC A;  3S6W A;  1Y71 A;  2WSC E;  3R6O A;  2L5Q A;  2OTL T;  2XD0 A;  3HSB A;  1W4S A;  2RM4 A;  2X4X A;  1G3Y A;  3WVE B;  2DO3 A;  4C5G A;  4ATO A;  4N0A A;  3ZEH A;  4JLI A;  3GP8 A;  3GIB A;  3ASK A;  1JRI A;  1Y96 A;  5LJ5 h;  1FX7 A;  2DD4 A;  3OMC A;  2RI5 A;  4OGE A;  2MMP A;  3OBY A;  5HKC A;  2Y4Y A;  2P0Q A;  4BE2 A;  1KD1 U;  2K5I A;  4XTW A;  5GAO n;  3E19 A;  4EMK C;  3OW2 A;  4OB0 B;  1KQS S;  5KE3 A;  3OQ5 A;  3OS2 A;  1VQK T;  3OYI A;  3VU3 C;  2DKG A;  2NLU A;  4IUT A;  3CME A;  2EQK A;  4C92 B;  3MP6 A;  1K9M U;  2BKD N;  4NOY A;  1VQ6 T;  3CD6 T;  2O01 E;  4D6W A;  1KD1 C;  4PJO G;  4CI0 C;  1MHN A;  3LWH A;  5FLX E;  1NPR A;  3RES A;  2ZPG B;  1BIB A;  1BKB A;  2EJF A;  3NFC A;  1VQP A;  1RL2 A;  3WVD B;  2LTO A;  5HK0 A;  3GOX A;  2XIC A;  5GMK m;  1K9M C;  2R5M A;  2BIV A;  1NJI U;  5GMK l;  2JUF A;  5FU7 C;  3V8K A;  2RHY A;  4C0D C;  3SWN C;  3RKW A;  2BUD A;  2RJE A;  1W2B S;  1RI0 A;  2MF2 A;  4M7D C;  4O5V A;  1U1S A;  4M77 E;  4E47 A;  5J39 A;  3LH0 A;  4QVD A;  4J6Y A;  4HT8 A;  3MP1 A;  5CKB A;  3H6Z A;  1NJI C;  2K4Y A;  1N9R A;  4HA8 A;  2JTM A;  1DJ7 B;  2DIQ A;  2JTF A;  3M4Y A;  1VQ7 T;  2YRV A;  2EQU A;  4XTU A;  1YIT A;  4M7D D;  2P0K A;  3QBY A;  4BE0 A;  2RI3 A;  4M75 C;  2FB7 A;  4M77 F;  3RUX A;  3CME T;  2EQM A;  2KQW A;  2RJF A;  4JS4 A;  4X9C A;  1IRE B;  2EWN A;  3M53 A;  4PJO B;  2CKK A;  2LRQ A;  3LX7 A;  3OSV A;  3RER A;  4DA4 A;  1YJ9 A;  1YHQ A;  3HP9 A;  3P8D A;  3KUF A;  4QW2 A;  2PVO B;  5A0L A;  2XHC A;  3QKJ A;  5CAI A;  1Q7Y U;  1VQP T;  2D6F A;  1UEB A;  2DVE A;  3JCM c;  1WQ7 A;  4JDS A;  4JRP A;  4XQ3 A;  4NL2 A;  1M9S A;  2CS7 A;  2GF7 A;  1WJS A;  2R5A A;  3L2V A;  4ZTF A;  1KC8 U;  3CPF A;  4RG2 A;  3I55 A;  4C92 C;  4LD6 A;  3VJP A;  4BY6 B;  1QP3 A;  2XG8 D;  1Q7Y C;  3E1S A;  2OTJ A;  1K73 U;  3VYG A;  2K2V A;  4GY5 A;  1FWZ A;  2CZ7 B;  4C0F A;  4ELY C;  2EIF A;  1UGR B;  5D6Y A;  4A53 A;  1KC8 C;  2AHJ B;  2LNV A;  4FU6 A;  2DIG A;  2QXF A;  2ZPF B;  4C92 D;  1YIT T;  2D9T A;  3PTA A;  3BW1 A;  4JRK A;  2RHZ A;  5CKD A;  4B9W A;  2DJZ A;  1K73 C;  1M90 U;  1XTD A;  3QYG B;  3JCM X;  2MWP A;  3HKS A;  3J7A F;  2O4X A;  2E5Q A;  2IG0 A;  4BUG A;  3A8O B;  4C8Q A;  3HFO A;  1S72 A;  3M57 A;  1YJ9 T;  2L8D A;  1WGS A;  2H3J A;  1D3B A;  3OYK A;  1YHQ T;  3NTI A;  4L59 A;  4M7A A;  2DPP B;  3QHS A;  3MEV A;  5DM7 R;  1QVF A;  5GAM g;  4EPC A;  5LJ3 j;  3G4S A;  1M90 C;  5GMK h;  5FRN A;  2LCL A;  3AHU A;  3JB9 G;  4LD9 K;  1QP2 A;  4HT9 A;  1YIJ A;  3E9G A;  1X75 C;  3L2W A;  3HRU A;  1VQ9 A;  3I55 T;  1ZBX A;  3FEO A;  1XOV A;  2JZ2 A;  1B34 A;  3LGF A;  3X25 B;  4UC4 A;  4ZN1 A;  4M75 G;  4PNO A;  3S3M A;  2LCC A;  2OTJ T;  3SD4 A;  1VQO A;  4BDZ A;  1BYM A;  3MET A;  2RA2 A;  3JCM W;  2FYK A;  5LJ3 h;  4KT0 E;  1JJ2 S;  3EFS A;  4C8Q G;  4OB3 B;  1NE8 A;  3X20 B;  2KK4 A;  2RK1 A;  4IKF A;  4GLK A;  4LDU A;  3CCV A;  2RH2 A;  2E6Z A;  4QQ6 A;  5I2S A;  4PJO D;  4F7U A;  1U8R A;  5CR2 A;  5GAN 2;  4BY6 C;  4M7D B;  3H8Z A;  4MZM A;  1VIF A;  3JSC A;  3JCM V;  4DQ2 A;  5GAN 5;  2CGH A;  5GAN g;  1S72 T;  4M7A E;  3G7Z A;  3L2U A;  3JCM g;  3CCQ A;  5CIU A;  3LGL A;  3DLL A;  5IN1 A;  1OI1 A;  4FSX A;  3OYB A;  3G4S T;  4PLL A;  4P5N A;  2F5K A;  2EKO A;  1X6O A;  5LJ3 d;  2VGN A;  5LJ5 j;  5DLQ E;  1YIJ T;  1O9S A;  4E7H A;  2ZZD A;  2GFU A;  3MEU A;  4HCZ A;  5A2Q E;  3QZ5 B;  3X26 B;  1VQ9 T;  1VQM T;  4M7A F;  3OSS C;  2ZPI B;  4M75 B;  4DOW A;  1VQL A;  5HK3 A;  4C0G A;  2PUO B;  5C0M A;  2XU8 A;  2RJC A;  3VKI A;  3HL8 A;  4BI8 B;  4ZN3 A;  4IUU A;  1VQO T;  3QPH A;  1VQ8 A;  5CKE A;  4J7F A;  3OS5 A;  1IZ6 A;  3QO3 A;  3HRT A;  3NTH A;  4C8Q B;  4M77 A;  3VV0 A;  2RB6 A;  1VIE A;  2CYZ B;  2EAY A;  2ZPH B;  5GAN e;  5GAN 4;  3GPL A;  4JRQ A;  1VQ7 A;  4F7U E;  5A0G A;  3JCM e;  3CCV T;  3OYY A;  3P8B B;  1QVG S;  2VXE A;  1KG1 A;  2M1H A;  3MP8 A;  2FVU A;  2XDB A;  3PIP A;  3URG A;  1M4Z A;  4M78 A;  2LQK A;  4EMG A;  4ZGE B;  2DK3 A;  2QQS A;  3CBO A;  2JNG A;  1B34 B;  4OB1 B;  1I8F A;  4BB7 A;  3CCQ T;  2CZ6 B;  4F7U F;  5CO7 A;  2VV5 A;  1BI2 A;  1WQW A;  3JCM P;  2LT4 A;  2EJ9 A;  2JVV A;  4JRI A;  5LJ5 d;  2ZGW A;  3OBW A;  1NPP A;  3L42 A;  4M77 G;  3PIO A;  2Y90 A;  2A7Y A;  4BDY A;  1Y07 A;  3FC3 A;  2QI2 A;  2VC8 A;  3CCM A;  1VQ4 A;  1VQL T;  2GQV A;  2K57 A;  1VQ8 T;  5GAN 7;  4IUQ A;  5FU6 B;  3RMQ A;  4J6X A;  3J81 E;  4E7J A;  2LVM A;  2V8K A;  1YBY A;  2V8I A;  3CMA A;  4M78 G;  2M16 A;  4JJN K;  3OB9 A;  2B8A A;  2XDP A;  4A4H A;  2HAX A;  4RMO A;  5GAM f;  2EFI A;  4JUV A;  5FRO A;  3GLX A;  5LL6 S;  4A4F A;  4QVZ A;  4XTX A;  2LQ8 A;  4M78 E;  1UGS B;  1OYX A;  2KMT A;  1YI2 A;  4FT4 A;  1Q82 U;  4IUR A;  5GAN 8;  3A8H B;  5IT9 E;  1BIA A;  2DAQ A;  3JB9 D;  1Q86 U;  4FIB A;  2DD5 A;  3L2R A;  4C8Q C;  2FL7 A;  5GAO m;  1EIF A;  2E1H A;  4N4I A;  2KVQ G;  5GAO l;  3M9Q A;  1O75 A;  3QG1 A;  1Q82 C;  4M75 D;  4M78 F;  2EJG A;  2V8J A;  1XQH A;  2PVD B;  3F70 A;  1Y96 B;  4M77 B;  3UDC A;  4C5H A;  3CPW A;  2R58 A;  5CQY A;  3CXC A;  4FT2 A;  4LDY A;  1Q86 C;  1YJW A;  4OP0 A;  5DY9 A;  3CCM T;  1VQ4 T;  4C8Q D;  4BAC A;  3FRN A;  3O8V A;  4N4G A;  3GNG A;  3TU4 K;  4RCC A;  5CKF A;  4J7I A;  3ZFJ A;  4KUD K;  4Z02 A;  4M78 B;  1ZHI A;  4OF1 A;  1KHI A;  4NS5 A;  5GAN f;  2QEX A;  3CMA T;  4L6V 5;  5GAM h;  3JCM f;  3OYE A;  3M58 A;  4VUB A;  4NL3 A;  2E12 A;  3E9F A;  4XU1 A;  3CBM A;  3LW5 E;  2L3R A;  3MEW A;  4Q5W A;  2OAU A;  1OZ3 A;  2JOY A;  2Y4X A;  5KH6 A;  5GMK j;  1YI2 T;  1LJO A;  2GCX A;  3WXM B;  2LX9 A;  1KQS A;  4MDX A;  4FL6 A;  4MZP A;  1Q81 U;  2M0O A;  5FU6 C;  2LT1 A;  5J26 A;  5GAN 6;  1SSF A;  1Y7X A;  1UB4 A;  1UGQ B;  2I2L A;  1VQ5 A;  2YLB A;  4M7D A;  3A8M B;  3X24 B;  1YJN A;  5I2M A;  1TH7 A;  1NZ9 A;  1YCY A;  3M54 A;  4BI3 A;  1Q81 C;  1BI1 A;  1YJW T;  4XTY A;  3G71 A;  3FDR A;  2MAM A;  4XU2 A;  3VUZ A;  3CCE A;  3C12 A;  3M56 A;  1K8A U;  4HCB A;  3OW2 S;  1N6A A;  3M5A A;  4KUI A;  2QEX T;  1W2B A;  2PUK B;  2LC4 A;  4N0A C;  2QTX A;  3HHT B;  4B9X A;  1KHC A;  3CC7 T;  2E70 A;  3BFM A;  4PKC C;  4M77 C;  2L89 A;  4C5E A;  3LYI A;  3OYC A;  1K8A C;  5KCH A;  3UPU A;  5HY6 A;  4M7A G;  1UGP B;  2E10 A;  2K3X A;  4EDU A;  2HNI A;  4BI4 A;  4E7L A;  2WSF E;  2XKO C;  4XTZ A;  4M78 C;  2X35 A;  4M77 D;  5C6S A;  3S3O A;  4M7D E;  1HXD A;  1VQ5 T;  3INZ A;  1YJN T;  1H3Z A;  3L2Q A;  3QJ6 A;  3V8L A;  2LDM A;  4A4G A;  3CCR A;  3I56 A;  3G71 T;  4KUL A;  3CCE T;  5KCO A;  2WSE E;  1N27 A;  4ZGJ B;  4M7D F;  4OVA A;  1WNL A;  3HFN A;  5AYF A;  3QZ9 B;  4C0Z A;  5GAO q;  3G6E A;  4ZTJ A;  1VQM A;  2RI2 A;  2QQ9 A;  3RKY A;  4F7U G;  2O4X B;  4MML A;  2QDY B;  2E41 A;  2ZPE B;  2DZ9 A;  3SFM A;  3OY9 A;  1D3B B;  4M7A B;  2RD1 A;  2C06 A;  2X4W A;  2PQW A;  3EAE A;  1V29 B;  4MMK A;  1I81 A;  3V7R A;  3CC4 A;  2WAC A;  3S3N A;  3CCS A;  1ZQ1 A;  2QQR A;  5LJ3 g;  3JCM b;  2VGM A;  2EQJ A;  4C92 E;  3FIF A;  3LWI A;  1X01 A;  1QW1 A;  2VYT A;  5CVI A;  4PJO A;  4J6W A;  4EMH A;  2DZC A;  4XK8 E;  5GMK e;  1QVP A;  3L1A A;  3PGG A;  4L5G A;  4X34 A;  5I21 A;  3I56 T;  2HBP A;  3CCR T;  3C94 A;  3JCM J;  3EFR A;  4C92 F;  2E65 A;  1KQ2 A;  4ELZ C;  3JRZ A;  3OS1 A;  2DXU A;  5L8R E;  4ZGD B;  2XK0 A;  3G6E T;  3MHX A;  3NTK A;  3BDL A;  4JLG A;  5D6W A;  3UT1 A;  3QJY A;  3ZBD A;  2K5F A;  3TRE A;  4F7U B;  4N4H A;  3Q1J A;  2QQB A;  5CCA A;  2HQX A;  3QYH B;  4FM4 B;  2R57 A;  5LJ3 e;  2DXT A;  3JAM E;  3OYJ A;  1M1K U;  3JB9 H;  4LDW A;  1LOJ A;  2P0P A;  1G3W A;  3KXT A;  1AHJ B;  2X4J A;  1JJ2 A;  5CQX A;  1KQ1 A;  1QVF S;  5IAY A;  3CC4 T;  3DLM A;  3CCS T;  2RHI A;  2PU9 B;  3VYH B;  3ME9 A;  3C95 A;  3MEA A;  4QQG A;  1M1K C;  5LJ5 g;  4J83 A;  4PL6 A;  2EYQ A;  4QQD A;  4KBM B;  3N5B B;  3OYM A;  3JB9 I;  4PJO E;  3OYN A;  3QXE B;  4J8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...