2GFUA

Nmr solution structure of the pwwp domain of mismatch repair protein hmsh6
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
134
structure length
134
Chain Sequence
b'KAKNLNGGLRRSVAPAAPTSSDFSPGDLVWAKMEGYPWWPSLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVSDEPSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA mismatch repair protein MSH6
publication title The PWWP domain of Mismatch Repair protein hMSH6 is involved in double stranded and single stranded DNA binding
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 22
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gfuA00
2P0KA 3F70A 3S3MA 4A4FA 2R5AA 3E9FA 2YRVA 4OVAA 5C0MA 2L3RA 3C4SA 4RG2A 3L2RA 3OYHA 3LGFA 4IUUA 2WACA 2R57A 4E7KA 5J26A 2IG0A 3LGLA 4E7HA 1OZ2A 5KCHA 3OYEA 3ASKA 3OYLA 2BKDN 4Q5WA 2JZ2A 2RJCA 3MP6A 4BDYA 2RHYA 3OQ5A 4GY5A 5CIUA 2JTFA 3S6WA 3MO8A 4QW2A 4CRIA 1H3ZA 3OYBA 1WJRA 4L59A 1RI0A 2RI3A 4C5IA 3OS0A 4ZTJA 2QQRA 3LX7A 2DIQA 4PL6A 4X34A 2DAQA 2HQEA 3DLMA 3OMCA 3QIIA 2M16A 5J39A 4IUQA 2O4XA 3MEWA 4C5GA 3OYAA 3UWNA 3OS1A 2LRQA 2NLUA 2RJFA 2R58A 4E7IA 2FHDA 2RI2A 2K3YA 2QQSA 3EAEA 3GOXA 1XNIA 1MHNA 4BD3A 1WGSA 1N27A 3L42A 2XK0A 3DB4A 4IUTA 5IN1A 2EQKA 3DB3A 2X4XA 3NTHA 2RHIA 4B9WA 3M9QA 1G5VA 4PLLA 4B9XA 2EQUA 3KUFA 3Q1JA 2LDMA 1WJQA 3OB9A 3LYIA 4N4GA 3S3NA 5KH6A 3QBYA 4N4HA 3OYMA 3PMTA 3OYCA 3OY9A 3L2VA 2HQXA 3CEYA 4Z02A 5FROA 4IKFA 4FU6A 3L2UA 2XDPA 4C5HA 3L2QA 4NS5A 4EDUA 4A4EA 3O8VA 5C6SA 2R5MA 2EQMA 3OYJA 2RJEA 3META 2X4WA 3MEAA 3MP1A 4QVZA 3P8DA 3FDRA 2DIGA 4FL6A 3FC3A 3NTIA 2L8DA 2MWOA 1OYXA 5KCOA 4QQ6A 3SD4A 4BE2A 4UC4A 3MP8A 2GF7A 2LVMA 2RJDA 5D6YA 5FRMA 1WJSA 2L89A 4C5EA 4HCZA 5D6WA 4BACA 3FEOA 1SSFA 4PLIA 4IUVA 2EQJA 4QQGA 3OYDA 4IURA 2BIVA 2E5QA 5D6XA 2F5KA 4LD6A 3OA6A 4E7LA 2BUDA 2GFUA 2M0OA 2RO0A 4II1A 4IUPA 5M9OA 3OYNA 3H8ZA 4BE0A 2CKKA 3PNWC 3OMGA 3OYKA 3ME9A 1KHCA 4E7JA 3MEVA 2G3RA 2EKOA 3E9GA 2LTOA 3PFSA 3LLRA 3PMIA 5IAYA 2PQWA 2LCCA 2D9TA 2RHUA 2E6NA 3H6ZA 2K3XA 2RI5A 3UT1A 3OYGA 2O4XB 4N4IA 1OZ3A 3LH0A 2GFAA 2RHXA 2M1HA 1OI1A 3NTKA 3QJ6A 2X4YA 4ZTFA 2VYTA 3OS2A 2MWPA 4A4HA 3S3OA 5KE2A 4BE1A 2X35A 3P8HA 2B8AA 3BDLA 3ZEHA 4A4GA 3QKJA 2RHZA 3MEUA 5KE3A 3FLGA 5FRNA 3L2WA 3OYIA 2EFIA 4QQDA 4BDZA 3OYFA
chains in the Genus database with same CATH superfamily
5FU6B 1Y0MA 2HMAA 3QO3A 1IO6A 4R0KA 1VQLT 2G6FX 1MNDA 3JCMf 5KYNA 5KYUB 3M4GA 3TEEA 1KFZA 4IIMA 3JCMd 3DLMA 3OMCA 3RKWA 1AWOA 1HK9A 4OMPA 1VQ5A 1Y7XA 2R58A 3G71A 1RAGB 3VS7A 4FYWB 3G4ST 2M02A 2DXBA 1LVKA 5GAOn 3L42A 5IN1A 3X28B 2RM4A 4BY6C 4PFOA 2EQUA 1WJQA 1ZQ1A 2ZPHB 2QGFB 1M90C 3BDUA 2E6ZA 3JCMV 3I9QA 3HTRA 1BIBA 3OYYA 1K76A 4YTLA 2EWNA 3FRNA 4DOWA 5GMKm 2L2PA 1LPLA 2R5MA 1HXDA 4HT9A 3FDRA 1GL5A 2OTJQ 1NLPC 3NTIA 4HCCA 4UC4A 2DYBA 5IHNA 1IGQA 2F69A 2D6FA 3QWXX 1MV3A 2D8HA 2SEMA 3OA6A 4E7LA 1VQ4T 5CK9A 2YUOA 2FYKA 2QTXA 3ULRB 4E7JA 1YWOA 2ZPFB 1K9MR 2K2MA 3RIRA 2KYMA 4F7UB 3OSSC 1WFWA 3PTAA 4HCBA 2RHXA 3M59A 3CC7Q 1CKAA 2X4YA 3GLXA 2KI7A 5GAN3 1QVFA 1MMDA 4GLMA 1KQSA 2DL4A 1D1CA 3CCRT 3FLGA 1ZBJA 1TWBA 1BKBA 5GAOp 5FU7B 1UE9A 2V1QA 3HP9A 1YJNQ 4OMLA 2IG0A 4EPCA 1OZ2A 2QA4Q 3WVEB 3VS6A 1WA7A 3V8JA 4BDYA 1B07A 3MJXA 3OQ5A 4FT4A 4RTYA 5IHIA 4C92D 1VQPQ 3LW5E 2RI3A 4C5IA 4DQ2A 4PJOE 2KROA 2P84A 3CC2Q 4VUBA 3QIIA 3EFOB 3CCUQ 2KRMA 4LNPA 4C8QD 2LRQA 1GXIE 3CCET 2K5LA 2L0AA 3ZFJA 3TCJA 2RPNA 1MMAA 2DYIA 3JB9H 1YJWQ 4BD3A 4PFZA 2AKKA 2X9HA 1VIEA 3GP8A 1Q86C 1VQ8T 2C0OA 2QDYB 2D1XA 5AT1B 2MYSA 1PKTA 4O6JA 2XG8D 3CXCP 1BK2A 4M7AB 2DJZA 2E41A 1Q81C 2EJFA 2CT4A 3CCLQ 3L2QA 4J9EA 3CCRA 1SG5A 4FL6A 2YRCA 2MWOA 1OPKA 4C92G 1FYNA 1GBRA 4KBMB 4GBQA 3I55T 2KVQG 2XHCA 4C8QG 4M7DC 1TSFA 1MGQA 3VS1A 1OU9A 3H8ZA 2CKKA 1KIKA 1KHCA 1PRLC 3A98A 4OB1B 5IH2A 1V29B 1VQNQ 3FB9A 4QVCA 2KE9A 2HKQB 2YUNA 3MPUB 1WZOA 3CCSQ 2M1HA 1VOMA 4KULA 4PK4A 2JMAA 2MPXC 2XMFA 1Y96A 2KK4A 1VQ8A 4QT7A 4JRPA 3HRSA 2P0KA 2GTOA 2HQHA 3F70A 2RB6A 5GMKl 1I8FA 3C4SA 5FU6C 1U8RA 4IUUA 3EHQA 4M78B 4PJJA 1X27A 1IRXA 2JTFA 3QYHB 1BCOA 1UTIA 2ECZA 3CPFA 4FYYB 2VXFA 1QCOA 2DETA 5CCAA 2DAQA 1S72T 1Q82C 2M16A 5L8RE 3CC4T 4OB0B 2EBPA 1BI3A 4A63B 2MI6A 6AT1B 3ZBDA 2QQ9A 2ROTA 3TSZA 2FRYA 4JS5A 1QWFA 1PM3A 2EQKA 1EIFA 4LUEA 2RHIA 4F16A 3LH5A 2QI2A 2DA9A 5GMKi 3C0CA 4N4GA 2QASA 2ZCFB 1DJ7B 3TQ7P 3GIBA 1ZX6A 3OYCA 1ZA1B 5KYYA 4ORZA 4FU6A 1WNLA 2NUTB 1KD1R 4M7DE 5CVIA 4DBHA 3CD6Q 1LOJA 2SRCA 1QP2A 4AFSC 1CKBA 1SSHA 2PVGB 2X51A 3CMAA 3OW2P 3OW2S 4LXCA 2I0NA 1KD1U 2JS0A 4Z8AA 3A8OB 1WHMA 1SSFA 3PE0A 3SWNB 4XK8E 1TH7A 3CCMA 2A08A 1IB8A 2RA2A 4NL2A 4FYVB 3JCMg 1FXXA 2LCCA 1K0XA 2QQBA 2KDSA 2O31A 1S72A 1KQSS 4XTYA 1G3YA 4ZGJB 2COZA 4KH0B 2VVKA 2PUOB 1JBMA 2BZXA 2VYTA 3OS2A 1M5Q1 5CKEA 3M54A 1S1NA 4A4HA 2O01E 4LDYA 3H0HA 2RHZA 3I56Q 2LCSA 1ZBXA 1C6VX 1XOVA 4PJNA 2RQVA 1KJWA 1JU5C 4LDVA 2C0IA 3JSCA 1H8KA 3L2ZA 4M7DA 3UDCA 1EZZB 5FU7C 2ESWA 3MHXA 2XDBA 2MF2A 5DY9A 1F1BB 2DD5A 3QDFA 3VS0A 5EG2A 5GANh 2CP5A 4CC4B 1PHTA 4LE9A 3M57A 4JRKA 3QPHA 3OS1A 2RQRA 2DE0X 2QQSA 1XNIA 1H3HA 1D3BB 2JUFA 2GCXA 1AWWA 2KSSA 4JDSA 1K1ZA 1GCQC 2P4RA 2KXCA 4M7AC 4XAXB 3JB9I 1B34B 2BZYA 3V8KA 4IKFA 1JXOA 1Q95G 2JTMA 1QVPA 2C06A 1QLYA 4PKCC 2HBWA 2MIOA 1K9MC 2L8DA 4PJOB 4J9IA 2J7IA 4HT8A 1G3TA 2NUZA 2PU9B 3BW1A 5ECAA 4J9GA 3QUIA 1PG5B 1VIFA 1K73U 1U3OA 1K0SA 2DVEA 3BFMA 1K8AR 5HCKA 2ZZDA 3CBOA 2CP3A 3RERA 5I22A 5GAOm 3HSBA 2DEQA 3G6ET 1W4SA 2K3XA 2EJ9A 2RI5A 2O4XB 2ATCB 4M75E 1VQOQ 4RMOA 5A0LA 2KY9A 1G3WA 1R77A 4Z88A 2LQKA 1WQ7A 2JT4A 3HPWA 2HL5C 1VQ7Q 3OYEA 2HEQA 2AK5A 1TU0B 2RK2A 4Q5WA 3SEMA 3TREA 3UA6A 4M78C 1VQMQ 2LNVA 3QJYA 5KYWB 1WQWA 4CRIA 3EH1A 1YJ9Q 2OTJA 2JTEA 3LX7A 4F7UA 2D0QB 4P5NA 1WPYA 1M27C 4AFZC 1VQKQ 1M4ZA 1M1KR 1I81A 1C0MA 1I4K1 4LN2A 3JCMX 1NBEB 3V7CA 2VGMA 5FLXE 3M0SA 4M75A 1OU8A 2CT3A 2HSEB 4OMNA 4C0ZA 2LDMA 3G6EA 2A36A 2CGHA 2F2VA 3HRTA 4LDUA 1M1KU 3OYMA 3CEYA 2XDPA 2OAUA 3NPFA 3CC7A 3JCMW 3O8VA 1M1FA 2VC8A 4C0GA 1YI2T 2WSFE 3MEAA 1G2BA 4DOVA 1B3QA 1WYXA 1QVGP 1QVGS 3JRZA 2V8JA 5FRMA 5D6YA 1WJSA 3EFOA 4PLIA 4Y92A 3QDRB 2RD1A 1Z9QA 5GANe 4WTOB 3TSWA 3I5SA 2QA4A 4II1A 3SWNC 2CP6A 2ZPIB 2LCLA 2XKOC 2L3QA 3M58A 4EMKB 4M7AA 4L5GA 2E3HA 1O75A 2VXEA 4N4IA 1T3LA 3CC2A 1I07A 3CCUA 3WVDB 1T0JA 4ESRA 3S3OA 2PUKB 2DNUA 3X26B 1VQ5T 1TUCA 1NEBA 4C0DB 4XQ3A 2LJ1A 3HKSA 3REBB 2OAWA 1EX4A 4J9CA 2GQIA 2D0NA 1OQKA 3LGFA 1IHWA 1RACB 5KCHA 5CAIA 1VYTA 2JXBA 3VS2A 1QKXA 2O9VA 4NOYA 3CPWP 3CPWS 1BI1A 1IGUA 2EIFA 3TVTA 4JPBW 3EH2A 1M8MA 2LJ3A 1M3BA 2XD0A 2NYSA 5I21A 2EKHA 5GAOl 4NL3A 1KD1C 3VKIA 1W70A 1SEMA 2XK0A 3M56A 3CMEQ 1OEBA 3SHWA 3QBYA 1Y71A 2GTJA 4OMOA 3M0RA 4JRQA 3CCSA 4M78A 4C5HA 2JW4A 2AZSA 2CSQA 4CC2A 2LX7A 3MP1A 3MKDA 3R6NA 5GMKh 4ATOA 2VKNA 2DBKA 2GF7A 2MOXA 4PJOC 1D09B 2DL3A 4XTVA 4BACA 1SHFA 3QXEB 2DXTA 3M5AA 1RAFB 2KBTA 3EFSA 4IUPA 1MV0B 5CKBA 1E6HA 1FMVA 1YIJT 1NE8A 1AOJA 1PD1A 2KAFA 3NTKA 2LX9A 1WXTA 3GNGA 4ZTFA 4RTWA 1UDLA 4GLKA 4MZPA 2NUTA 2F2XA 1W1FA 3EG9B 3CQTA 2KXDA 5FRNA 4HXJA 3L2WA 1U06A 2L3PA 4A4FA 3E9FA 4KGXB 1BBZA 4N0AC 1YFNA 2J06A 3SWNA 1AT1B 2BKDN 2RNAA 3QWYA 1OV3A 2RHYA 2RN8A 2DXUA 1PC0A 1AHJB 3U23A 1G8XA 1UG1A 2KGTA 2XU8A 3DKMA 1UB4A 1O9SA 2VASA 4M77E 2E70A 2MAMA 3VUBA 4M75B 1N9SA 4PJLA 1T3SA 2XICA 2RJFA 1VQ9T 2F5TX 2VV5A 1NM7A 2CP7A 2COWA 2E5KA 3KXTA 5I2MA 2A7YA 1WHKA 3OB9A 2L3SA 1YIJA 5KH6A 5CQYA 3OS5A 5GAMh 4Z02A 5LL6S 4MZTA 2EJGA 3L2UA 3A1PA 3PT9A 1TOVA 1K8AC 2GBQA 4DBRA 1WX6A 1YCSB 2CUBA 1X69A 3I56A 5LJ5h 2VWFA 4R56A 4BE2A 1W6XA 1NJIU 1YN8A 1VQ6T 1E6GA 4QQGA 5GAOq 3THKA 1UFFA 1ZLMA 3OYNA 5CKFA 1D3BA 1PSEA 4M77A 2RQUA 8ATCB 2FPFA 1YITQ 2EYXA 1QQJA 2J6OA 3LLRA 5IAYA 4F7UG 3JAME 3HL8A 4EMKC 2KR3A 2QTVA 2YT6A 4FT2A 2OTLQ 1B34A 2M51A 1VQ9A 2JJ9A 3A5ZB 4AFUC 3ZEHA 1VUBA 2JM8A 4AT1B 1LNXA 2CUDA 4KUDK 4M7AD 3VRYA 4PJOA 4C0DC 2R5AA 1Q7YR 5C0MA 2KT8A 2V26A 1GFDA 2R57A 1MMGA 4HVWA 5GMKe 1M1KC 5CIUA 2MCNA 1Q7YU 2DRKA 2Y4YA 4RTVA 2EAYA 2ZPBB 2DTIA 4ZTJA 2FPDA 5A2QE 3RR6A 2O4XA 3CMAT 1VQ6A 2E64A 5DM7R 1G3SA 2K3YA 2KYBA 2EQIA 2JS2A 1BCMA 3CCMT 4MMKA 1SRMA 3RESA 1UHCA 4M7AG 3KUFA 3Q1JA 4HVUA 1I5OB 2ZGWA 4N0AA 3G71Q 1QW1A 2QEXQ 3PMTA 3OBWA 1QMCA 1AVZC 3G7ZA 2DTHA 1VQOA 1OOTA 5KYWA 2X4WA 4XTZA 2GNCA 4M4ZA 3H9NA 1BB9A 2DIGA 3EG0A 3AT1B 5GJVB 3MP8A 4OGCA 3CCQT 2CS7A 3OSVA 4OMFB 4A54A 4M78D 1JXMA 1UECA 3M55A 1WHLA 3OMGA 2KRNA 2EYWA 1KC8R 3PFSA 4PFPA 4LD9K 3SFMA 5DLQE 2D9TA 4KGVB 1VQLQ 2EYZA 2KEAA 3LH0A 1Z9ZA 3H0IA 2W0ZA 3JB9D 1KC8U 2MWPA 1W2BA 1VQKA 4A4GA 2BTTA 1WLPB 2RK1A 1Y57A 2DO3A 2JN0A 5GAMe 3PVLA 2WSCE 2EYQA 1D1AA 2YRVA 4OVAA 1YHQT 3G4SQ 2O88A 1QVFP 1LJOA 4EIKA 1QVFS 4M78G 9ATCB 1KQSP 1R0BG 1X43A 5LJ5e 2LQNA 3MP6A 1X75C 1WDXA 1N6AA 1OPLA 2LQ8A 4ZN1A 4EMKA 4C92F 3QZ5B 5GJWB 4PL6A 1PRMC 3CCQA 4C5GA 4FW2A 4KGZB 2FZCB 2NLUA 3JCMP 4M75C 3NHNA 4C8QF 2RI2A 1T0HA 3JB9G 2DL7A 1OULA 3DB4A 1G5VA 2DK3A 5A0GA 1VQ4Q 4V2SA 3V8LA 2DJQA 2FG0A 3L2VA 4A4KA 1KQ2A 1M90U 1ABQA 1RI9A 1X2QA 3RKYA 2Z0WA 3P8DA 2V1RA 4B6MA 1HSQA 4ZGEB 1ARKA 1PWTA 4M77B 1WHGA 1YHQA 1QCFA 1AZGB 3WXMB 3CCRQ 3OYDA 3FJ5A 1RLQC 4LD6A 5HY6A 2BUDA 2DEUA 5M9OA 1V1CA 4J8OA 1JO8A 3RKXA 2KMTA 2BE7D 2E10A 2K57A 1JJ2A 2C0TA 3MEVA 4DA4A 1UGVA 1H92A 2H8HA 2HBPA 1KHIA 2LNHB 2EGCA 1IREB 5D7UA 5IXBA 1K73R 4LDWA 2OTJT 4J6WA 2DZ9A 4BE1A 4MZMA 3RDVA 1NLOC 1NYGA 2OI3A 2YLBA 5CO7A 4E7SA 4ZNXA 3M0QA 3CCEQ 5IHKA 3JCMb 2FRWA 2NUPB 2EVRA 1NPPA 3LGLA 4WF2A 5J26A 3ASKA 2IIMA 1VQ8Q 2KNBB 5GAN7 2PNIA 4PJOD 4QW2A 3CC7T 1WIEA 5GAN2 3M53A 4C92E 2FZKB 2HQEA 2VGNA 4PNOA 5LJ3h 4IUQA 3VJPA 1ZUKA 2J05A 3OYAA 4LUDA 1UJ0A 2CSIA 4WCIA 1V76A 2Y4XA 1U1SA 3EG1A 4C8QE 1QKWA 1XTDA 1YJNT 3EG9A 1N27A 4E2FB 2BZ8A 3I55Q 5IXFA 2QA4T 3NTHA 1NYFA 3X20B 3EHRA 3M0UA 1RAAB 1Q86U 1I0CA 1VQPT 3OY9A 1AEYA 1BI0A 4BUGA 1Q81U 1NEGA 3CC2T 3R6OA 4A4EA 3CCUT 3OYJA 2PVDB 1BIAA 2DKGA 4PJOG 3GF5A 1UGSB 4JJNK 1YJWT 2QYZA 5GAN6 5GANf 3JCMh 5KYXB 2FZGB 3HHTB 1UUEA 3A8MB 5CKHA 5GANd 2F1LA 3J7AF 3VRZA 2JMCA 5GAMj 3CCLT 2LTOA 1YITT 3AHUA 1RAIB 3N5BB 5GAN4 5J3BA 2HZYA 5CR2A 1Q7YC 3A8GB 4CC3A 1OI1A 3I5RA 5LJ5j 2K6DA 1X6GA 2E3IA 4ANJA 3C12A 1YJNA 3CC4Q 2XIDA 4FIBA 4RCBA 5FW9A 2EFIA 4QQDA 2DL5A 3OYFA 3CCJQ 2DM1A 2HL3A 4RG2A 3L2RA 1VQPA 2DBMA 2WACA 3BE3A 4XU2A 1M3CA 2IPOB 4E7HA 1VQNT 3PIPA 3SB2A 4JLIA 3CCST 1VA7A 5I11A 3OYBA 1WJRA 2V8IA 2DERA 2QQRA 1YJWA 4TVRA 3CXCA 3MEWA 2E4HA 1MNEA 1Q82U 4X9DA 4ZGDB 1UGQB 2FHDA 1BU1A 1WXUA 4MDWA 4E6RA 4FSXA 1KK7A 4DBFA 3CCLA 4AG1C 1YITA 5LJ3f 1KSWA 1UHFA 4M7DD 2OTLA 5LJ3d 4BI8B 4QVZA 1PKSA 1IHVA 2X3XD 1KC8C 4RKUE 3SD4A 3NFCA 2EW3A 3VS3A 4J9BA 1UEBA 2XDDA 4M77C 2K5FA 3CBMA 4IURA 1VQNA 2RH2A 2RO0A 1ZUUA 2EPDA 2YWWA 2DPPB 3VYGA 3HFOA 3T9NA 1C1AA 5LJ3e 2QGGA 3QYGB 2EKOA 3E9GA 2QXFA 2K3BA 2LQWA 2ED0A 2J6FA 3OYGA 3CD6T 2M9UA 1OZ3A 2DX1A 2GFAA 4E47A 3J81E 4Y91A 5CKDA 4M7DG 3A8LB 3QSUA 4PJOF 1M2VB 1AWXA 5CQXA 2HSPA 4J7FA 5KE3A 5I2SA 2HAXA 2DL8A 4OGEA 1MMNA 2ABLA 3URGA 4BDZA 1D1BA 4RTUA 3S3MA 2QEXA 1TTHB 3GNFB 3GPLA 3ZL7C 4KRTA 4XTXA 4DEXA 2DD4A 2E12A 1H3ZA 2DLPA 3JCMe 3OS0A 5A0DA 2L5QA 3EGXA 1G83A 4AMCA 3I56T 2LZ6B 3UWNA 1HJDA 3E19A 3G1JA 4E7IA 2K4YA 2RQTA 1N8RR 1MHNA 2ROLA 2AZVA 1NZ9A 1D0ZA 1QCNA 2DTOA 5HK3A 3IQLA 2EGAA 3M9QA 3CCVQ 4XU3A 3CD6A 3OW2A 1N8RU 1VQLA 1ZSZB 2HQXA 4EMGA 1XQHA 2NWMA 1TUGB 2P4TA 2FL7A 5FWCA 3G6EQ 5C6SA 8AT1B 1N9RA 2IVWA 3CBPA 4RG8A 4JRIA 1OYXA 3KFVA 2A3LA 1X01A 2CYZB 1FMKA 4C92B 1Y07A 2RJDA 3RMQA 1K9MU 3EGUA 1K73C 3G4SA 4JJBA 2GQVA 2DVJA 2K7AA 3D7SB 4C8QB 5GANj 3OYKA 4KUIA 2AIRB 2K79A 1NJIR 4J9FA 2HNIA 4FM4B 2PQWA 3L1AA 2ZAEA 4M75D 3UT1A 1AWJA 3EGDB 2YXYA 2HDAA 4J9DA 1TUDA 1B7TA 1YBYA 4J9HA 1AZEA 4J7IA 4ME7A 2K2VA 2AHJB 3MEUA 1D0YA 2GGRA 2WSEE 2KT1A 2LC4A 2QAZA 2YRDA 2O9SA 1TXQA 2PTKA 1X6OA 5AYFA 2L3RA 2CH4A 2X3WD 1VQ4A 2FEIA 1SF9A 5IT9E 1M9SA 3O5ZA 4RTTA 1RLPC 2LT4A 2RJCA 3UATA 4D6WA 3CXCS 3M4YA 1VQOT 4L59A 3KBGA 2W10A 2KRSA 2CZ7B 2LMJA 4Z89A 4A53A 4X34A 4M75G 4XTUA 4M7DF 1YI2Q 3H41A 5GANg 3H0FA 4JS4A 3TU4K 2DRMA 4QKUA 1RUWA 2YDLA 4LDXA 1VQ7T 2CZ0B 2DMOA 3DB3A 2O2OA 4AG2C 2K9GA 3LYIA 1VQMT 1FMWA 2NUPA 3RBBB 2CZ1B 1WHJA 1YJ9T 2X4JA 2MMPA 4JLGA 4BB7A 1HD3A 3BY7A 4L6V5 4RUGA 2JOYA 5LJ3j 2RJEA 4MDXA 2JNGA 4QVDA 1VQKT 3FC3A 5KCOA 5GAN8 3CCEA 1JQQA 4KH1B 1NG2A 2DF6A 5HK0A 4HCZA 3P8BB 4OMMA 3E2UA 2EQJA 1VQ5Q 2AKLA 1R0CB 2F5KA 1U5SA 2GFUA 2QG9B 1JRIA 3UF4A 1YNZA 3PMIA 2ENMA 3HRUA 4MMLA 3V7RA 3H6ZA 1K9AA 1TG0A 2P0QA 2RF0A 3VS5A 2XI9A 2B8AA 3BDLA 1WHHA 3REAB 5GAMf 1GCPA 2YSQA 1VQ7A 1RADB 2P0PA 3QG1A 3I55A 1M30A 5GAMd 2JM9A 1VQMA 3CCJT 3OYHA 2ZPGB 1YJ9A 2CP2A 5KYXA 5LJ5f 3EGXB 4E7KA 2CREA 4J5YA 2DZCA 1SRLA 5LJ3g 3FJPA 2E65A 4J83A 5LJ5d 4HCKA 2FO0A 2QQAA 1RI0A 2H3EB 2DIQA 2A37A 1PSFA 3VV0A 1SPKA 3DLLA 2HCKA 1AD5A 4R55A 3GOXA 3VUZA 4ELZC 1WGSA 1CSKA 4IUTA 2X4XA 3C95A 3PGGA 4FW1A 3EG2A 4F7UF 4FCYA 3V7SA 1QWEA 1QVGA 1MUZA 4ZN3A 1GBQA 1ZSZC 2MK5A 3JCMQ 4NS5A 1IZ6A 4EDUA 1I5LA 5HKCA 2V8KA 1YIJQ 3META 4JZ3A 1OX9A 4JUVA 1X6BA 4M75F 3CC4A 3RUXA 4BI3A 1M90R 1HYOA 2L89A 4C5EA 1GRIA 4C92C 3CCJA 5GAOr 1UGPB 2YUPA 3CMET 5EC7A 3OBYA 2M0OA 2FPEA 4C8QC 2QDLA 1YWPA 2RHUA 4F14A 1LCKA 3VYHB 2YUQA 4X9CA 4PJMA 1GFCA 3A8HB 1PNJA 1EFNA 3CPWA 4O5VA 1WI7A 4X1VA 3UPUA 2RMOA 4M7AF 1UJYA 4D8KA 3I35A 1VQ9Q 4RTZA 4F17A 1UGRB 1RL2A 3QHSA 2EGEA 3EG3A 2K5IA 2OJ2A 2EYYA 3OYLA 2H3JA 4JJDA 2JZ2A 5GMKj 1X2KA 1N8RC 3LWHA 1JB0E 1YP5A 2AT1B 3NMZC 4Y28E 2VUBA 4KT0E 4M77D 2M0YA 2FVUA 3VU3C 1NPRA 3GBQA 5J39A 1VYVA 1K4US 5KYUA 1TS9A 4RCCA 3X24B 3CMEA 3EAEA 1M2VA 1RABB 5FWBA 2B86A 4BY6B 5L23A 3UA7A 3INZA 3HFNA 1VQ6Q 4B9XA 3CCVT 2YHTA 3S3NA 4F7UE 2QK0A 4N4HA 4J6XA 4OF1A 4XTWA 1P92A 4FYXB 4IIOA 4K11A 4HKEA 4C0FA 1JEGA 4J6YA 2EQMA 1Y96B 4OP0A 2A0FB 1Q86R 1NJIC 1K8AU 1M8VA 2DXCA 4QQ6A 4M77G 3SDZA 1Q81R 3M0PA 3FIFA 3FEOA 2DFUA 1RAHB 3JB9J 2BIVA 1D0XA 4M78F 2KQWA 2RQWA 2LJ0A 4BE0A 3PNWC 3RNJA 4OB2B 1SKUB 3PIOA 2G3RA 2CDTA 2E1HA 2Y90A 4DBQA 4FSSA 1ZSZA 3NGPA 3J80E 3QJ6A 1PCXA 2YLCA 4OMQA 5KE2A 2X35A 3P8HA 3JB9F 1OX8A 2OX7A 3QZ9B 3LWIA 3OYIA 3CMAQ 4JJCA 4C92A 3CCVA 3EFRA 4M7AE 2ED1A 1BYMA 3JCMc 3RMSA 2I2LA 1W2BP 1W2BS 2HKNA 1XJWB 4XU1A 5KYYB 3CCMQ 2CZ6B 4C8QA 1IXDA 4GY5A 4F04B 4EMHA 3S6WA 3MO8A 2OTLT 4E7ZA 1BI2A 5DLOA 4BI4A 1S72Q 2BE9B 3EGDA 1N5ZA 1M1GA 1WXBA 3ER0A 3E1SA 3JCMJ 3C94A 3CCQQ 7AT1B 1ZHIA 4B9WA 4D8DA 1I1JA 4PLLA 4AFQC 4ELYC 1H641 1QP3A 1J3TA 1A0NB 1Q82R 4DEYA 1M2OA 2CH4W 1KQ1A 1M3AA 1E7OA 5FROA 1PD0A 4RTXA 1YCYA 1GCQA 2PZ1A 4HVVA 3PVQA 1R8OB 2A28A 1ZA2B 5GAMg 1ACMB 1ABOA 2LVMA 2F2WA 5D6WA 2DILA 4M7DB 1KG1A 1ZUYA 4IUVA 2E5QA 2COYA 5D6XA 4CC7A 2HD0A 4M78E 3G71T 1RAEB 5GAN5 3X25B 4CI0C 2QEXT 5LJ5g 3ME9A 2J6KA 3M0TA 1VYUA 1YHQQ 3MCAB 1U1TA 2LP5A 2E6NA 2FB7A 2VB6A 2LT1A 3VS4A 2CP0A 2PVOB 1FX7A 2ZPEB 1YI2A 1FWZA 3JV3A 1JJ2P 1JJ2S 3QKJA 4XU0A 1ZSGA 4HA8A 4JZ4A 2JVVA 4M77F 1SHGA 4OB3B 2D8JA
chains in the Genus database with same CATH topology
5FU6B 1X6OA 5AYFA 3HPWA 2YRVA 4OVAA 1YHQT 2L3RA 3QO3A 1VQ4A 1LJOA 1QVFS 4M78G 5IT9E 1M9SA 3OYEA 2RK2A 2LT4A 4Q5WA 1VQLT 3TREA 2RJCA 5LJ5e 3MP6A 4M78C 1X75C 3JCMf 4D6WA 2LNVA 1N6AA 3QJYA 3M4YA 3CXCS 1VQOT 1WQWA 4CRIA 2LQ8A 4ZN1A 3M4GA 4L59A 3TEEA 3KBGA 2CZ7B 4EMKA 3JCMd 2OTJA 4C92F 3QZ5B 3LX7A 4PL6A 4A53A 4F7UA 4X34A 2D0QB 3DLMA 3OMCA 4P5NA 3RKWA 3CCQA 1WPYA 4M75G 4XTUA 4M7DF 4C5GA 1HK9A 2NLUA 3JCMP 1VQ5A 1Y7XA 2R58A 4M75C 2RI2A 4C8QF 5GANg 4JS4A 1M4ZA 3G71A 3TU4K 3JB9G 1I81A 1I4K1 3JCMX 3G4ST 3V7CA 2DXBA 2VGMA 4LDXA 1VQ7T 5GAOn 3L42A 3DB4A 2CZ0B 5IN1A 3DB3A 3X28B 2RM4A 5FLXE 1G5VA 4BY6C 2DK3A 5A0GA 2EQUA 4M75A 4C0ZA 2LDMA 1WJQA 1ZQ1A 3G6EA 3LYIA 2CGHA 1VQMT 3HRTA 2ZPHB 4V2SA 1M90C 4LDUA 1M1KU 3BDUA 3V8LA 3OYMA 2E6ZA 2CZ1B 3JCMV 1YJ9T 2X4JA 3L2VA 4A4KA 1KQ2A 3CEYA 2MMPA 1BIBA 3OYYA 4JLGA 4YTLA 4BB7A 1M90U 2EWNA 2XDPA 2OAUA 3BY7A 3FRNA 4L6V5 3CC7A 3JCMW 3RKYA 4DOWA 5GMKm 3O8VA 1M1FA 2VC8A 2JOYA 4C0GA 5LJ3j 2WSFE 2R5MA 1HXDA 1YI2T 2RJEA 4MDXA 3MEAA 2JNGA 4DOVA 4QVDA 3P8DA 4HT9A 1VQKT 3FDRA 3FC3A 3NTIA 5KCOA 5GAN8 1QVGS 4HCCA 4UC4A 4ZGEB 3JRZA 2V8JA 5FRMA 3CCEA 5D6YA 4M77B 1WJSA 5HK0A 4HCZA 1YHQA 3P8BB 2F69A 2D6FA 4PLIA 3QDRB 2EQJA 3WXMB 2RD1A 3OYDA 2F5KA 5GANe 4LD6A 3OA6A 5HY6A 4E7LA 2BUDA 2QA4A 1VQ4T 2GFUA 5CK9A 4II1A 5M9OA 2FYKA 2QTXA 4J8OA 2ZPIB 2LCLA 2XKOC 3SWNC 1JRIA 3RKXA 2KMTA 2E10A 1JJ2A 2K57A 4E7JA 2ZPFB 3M58A 3MEVA 4DA4A 2HBPA 1KHIA 3PMIA 4EMKB 3HRUA 3RIRA 4MMLA 3V7RA 4M7AA 3H6ZA 4L5GA 4F7UB 1IREB 3OSSC 1O75A 2VXEA 4LDWA 2P0QA 4N4IA 3CC2A 3PTAA 4HCBA 2RHXA 3M59A 2OTJT 3CCUA 3WVDB 4J6WA 2X4YA 3GLXA 2DZ9A 5GAN3 1QVFA 2XI9A 3S3OA 4BE1A 1KQSA 2B8AA 2PUKB 3BDLA 4MZMA 2YLBA 3X26B 5CO7A 5GAMf 3CCRT 3FLGA 1VQ5T 1VQ7A 2P0PA 4C0DB 3QG1A 4XQ3A 3I55A 3HKSA 5GAMd 3JCMb 1BKBA 1VQMA 3CCJT 5GAOp 5FU7B 3OYHA 3HP9A 2ZPGB 3LGFA 1YJ9A 5LJ5f 1NPPA 2IG0A 3LGLA 4J5YA 1OZ2A 2DZCA 4WF2A 3ASKA 5J26A 3WVEB 4EPCA 5CAIA 5KCHA 3CPWS 3V8JA 4NOYA 5LJ3g 3FJPA 2E65A 4J83A 4BDYA 5LJ5d 3OQ5A 4FT4A 5GAN7 1BI1A 4PJOD 4QW2A 2EIFA 3CC7T 4C92D 5GAN2 3LW5E 2QQAA 1RI0A 3M53A 2RI3A 4C5IA 4DQ2A 4PJOE 2DIQA 4C92E 4VUBA 2HQEA 2VGNA 3QIIA 4PNOA 5LJ3h 4IUQA 3VJPA 1PSFA 3VV0A 3OYAA 4C8QD 3DLLA 2LRQA 2XD0A 1GXIE 3CCET 2K5LA 5I21A 3ZFJA 2Y4XA 3TCJA 1U1SA 5GAOl 4R55A 4C8QE 4NL3A 1KD1C 3GOXA 3JB9H 3VKIA 3VUZA 4BD3A 4ELZC 1XTDA 1YJNT 1WGSA 1N27A 2XK0A 4IUTA 2QA4T 2X4XA 1VIEA 3NTHA 3X20B 3GP8A 1Q86C 1VQ8T 3C95A 2QDYB 3PGGA 4O6JA 3M56A 2XG8D 4M7AB 4F7UF 2DJZA 2E41A 1Q81C 1Q86U 3V7SA 3QBYA 1QVGA 2EJFA 1Y71A 1VQPT 3OY9A 1BI0A 4BUGA 1Q81U 4ZN3A 4JRQA 3CCSA 4M78A 4C5HA 3JCMQ 3L2QA 4NS5A 1IZ6A 4EDUA 3CC2T 1I5LA 3R6OA 4A4EA 5HKCA 3CCUT 3OYJA 2V8KA 2PVDB 3MP1A 1BIAA 2DKGA 3META 3CCRA 4JUVA 4FL6A 4PJOG 5GMKh 4M75F 2MWOA 4C92G 3GF5A 1UGSB 4JJNK 3CC4A 4ATOA 1YJWT 3RUXA 4KBMB 2GF7A 4BI3A 5GAN6 4PJOC 2L89A 4C5EA 3CCJA 4C92C 5GANf 3I55T 4XTVA 4BACA 3JCMh 3QXEB 2KVQG 2DXTA 2XHCA 1UGPB 3HHTB 3M5AA 4C8QG 5GAOr 3A8MB 5CKHA 3CMET 4M7DC 1MGQA 5GANd 3OBYA 3EFSA 2M0OA 4IUPA 3H8ZA 5CKBA 2CKKA 3J7AF 4C8QC 1KHCA 2EYQA 5GAMj 3CCLT 2LTOA 4OB1B 1YITT 1V29B 2RHUA 3FB9A 4QVCA 3N5BB 3AHUA 1YIJT 5GAN4 5J3BA 3VYHB 1NE8A 5CR2A 1Q7YC 4X9CA 3A8GB 2KAFA 2M1HA 1OI1A 3NTKA 2LX9A 5LJ5j 3GNGA 4ZTFA 4GLKA 3A8HB 4KULA 4MZPA 3CPWA 3C12A 4O5VA 1YJNA 1Y96A 5FRNA 3UPUA 2KK4A 3L2WA 2XIDA 4FIBA 1VQ8A 4RCBA 2EFIA 4QQDA 4M7AF 4JRPA 3HRSA 3OYFA 2P0KA 1UGRB 3F70A 1RL2A 4A4FA 2RB6A 5GMKl 3E9FA 3QHSA 1I8FA 3C4SA 2K5IA 4RG2A 5FU6C 3L2RA 4N0AC 1VQPA 4IUUA 2WACA 4XU2A 1U8RA 4E7HA 1VQNT 3SWNA 2H3JA 3OYLA 4M78B 2BKDN 3PIPA 3SB2A 2JZ2A 2RHYA 5GMKj 2DXUA 1N8RC 4HT8A 2JTFA 3QYHB 4JLIA 3LWHA 1AHJB 1JB0E 3CCST 3OYBA 1WJRA 4Y28E 3CPFA 2VUBA 2VXFA 4KT0E 2V8IA 4M77D 2FVUA 2XU8A 3DKMA 2QQRA 4E7KA 1UB4A 3VU3C 1NPRA 1YJWA 5CCAA 1O9SA 2DAQA 1S72T 1Q82C 2M16A 4M77E 5L8RE 5J39A 4TVRA 2E70A 3CXCA 3MEWA 2MAMA 3VUBA 3CC4T 4M75B 4OB0B 1N9SA 1Q82U 2XICA 2RJFA 4X9DA 4ZGDB 1BI3A 1UGQB 4RCCA 2FHDA 3X24B 3CMEA 2F5TX 2MI6A 3EAEA 2VV5A 3ZBDA 4MDWA 4FSXA 2QQ9A 4JS5A 4BY6B 3KXTA 3INZA 2EQKA 3HFNA 1EIFA 5I2MA 2A7YA 2RHIA 3CCLA 4B9XA 1YITA 2QI2A 3CCVT 5GMKi 2YHTA 3OB9A 4N4GA 3S3NA 4F7UE 1YIJA 5KH6A 4N4HA 2ZCFB 1DJ7B 4J6XA 4OF1A 5CQYA 5LJ3f 3GIBA 3OYCA 4XTWA 3OS5A 1P92A 5GAMh 4Z02A 5LL6S 4M7DD 4FU6A 4HKEA 1WNLA 2EJGA 4MZTA 3L2UA 2OTLA 4C0FA 3PT9A 5LJ3d 4BI8B 4M7DE 1K8AC 4J6YA 2EQMA 5CVIA 1LOJA 1Y96B 4OP0A 4QVZA 1QP2A 1NJIC 1K8AU 1KC8C 2PVGB 4RKUE 2DXCA 3I56A 1M8VA 4QQ6A 3SD4A 5LJ5h 4R56A 3NFCA 3CMAA 4M77G 3SDZA 4BE2A 3OW2S 1NJIU 1UEBA 1KD1U 3FIFA 3A8OB 2XDDA 1VQ6T 3FEOA 1SSFA 4M77C 4QQGA 3JB9J 2K5FA 3CBMA 4IURA 2BIVA 4M78F 3SWNB 1VQNA 5GAOq 4XK8E 2KQWA 2RH2A 1TH7A 2RO0A 3OYNA 3CCMA 4NL2A 5CKFA 2RA2A 4BE0A 3PNWC 1D3BA 4OB2B 2DPPB 3VYGA 3HFOA 3T9NA 1PSEA 5LJ3e 3PIOA 4M77A 2G3RA 3QYGB 2EKOA 3E9GA 2QXFA 3LLRA 5IAYA 3JCMg 1FXXA 4F7UG 2LCCA 2E1HA 3JAME 2QQBA 3HL8A 2Y90A 2KDSA 4EMKC 1S72A 3OYGA 1KQSS 3CD6T 4XTYA 2M9UA 1G3YA 4ZGJB 1OZ3A 2GFAA 4FT2A 2PUOB 1JBMA 1B34A 3QJ6A 4E47A 3J80E 3J81E 2VYTA 3OS2A 1M5Q1 4Y91A 5CKEA 5CKDA 3M54A 2YLCA 4A4HA 1VQ9A 5KE2A 3A8LB 3QSUA 4M7DG 2X35A 3A5ZB 3P8HA 4PJOF 2O01E 3ZEHA 3JB9F 1VUBA 4LDYA 1LNXA 2RHZA 3QZ9B 5CQXA 4J7FA 5KE3A 3LWIA 5I2SA 4KUDK 2HAXA 4M7AD 3OYIA 1ZBXA 4OGEA 1XOVA 4PJOA 4C92A 3URGA 4C0DC 3EFRA 3CCVA 4BDZA 4M7AE 1BYMA 3JCMc 3S3MA 4LDVA 2R5AA 5C0MA 3JSCA 3L2ZA 3RMSA 2I2LA 4M7DA 3UDCA 1W2BS 2R57A 2QEXA 4XU1A 5FU7C 3GNFB 3GPLA 3MHXA 5GMKe 2CZ6B 2XDBA 4C8QA 1M1KC 2MF2A 4GY5A 4XTXA 5CIUA 5DY9A 2DD4A 2DD5A 2E12A 4EMHA 3S6WA 3MO8A 1Q7YU 2OTLT 1H3ZA 5EG2A 5GANh 2Y4YA 2EAYA 3JCMe 1BI2A 5DLOA 2ZPBB 3OS0A 5A0DA 2L5QA 4BI4A 2DTIA 4ZTJA 5A2QE 2O4XA 3I56T 1M1GA 3UWNA 3M57A 4JRKA 3QPHA 3OS1A 3CMAT 1VQ6A 3E19A 2E64A 5DM7R 1G3SA 3ER0A 4E7IA 2K3YA 2QQSA 3E1SA 2K4YA 3JCMJ 1XNIA 1MHNA 3C94A 1D3BB 1NZ9A 1ZHIA 2DTOA 5HK3A 2JUFA 3CCMT 4MMKA 4B9WA 3M9QA 2GCXA 4PLLA 3RESA 4M7AG 3KUFA 3Q1JA 4XU3A 1H641 1QP3A 4ELYC 2KSSA 2ZGWA 4JDSA 4N0AA 1QW1A 3CD6A 1KQ1A 3PMTA 4XAXB 3OBWA 3OW2A 3JB9I 1N8RU 1VQLA 4M7AC 2HQXA 3G7ZA 1XQHA 4EMGA 1B34B 5FROA 4IKFA 3V8KA 2DTHA 1VQOA 2P4TA 1YCYA 2JTMA 2FL7A 1QVPA 2C06A 5C6SA 1N9RA 2IVWA 2X4WA 4PKCC 1R8OB 4XTZA 3CBPA 4RG8A 2DIGA 1K9MC 2L8DA 4JRIA 1OYXA 2A3LA 1X01A 2CYZB 4PJOB 5GAMg 4C92B 1VQ9T 3MP8A 1Y07A 4OGCA 3CCQT 2RJDA 2LVMA 2CS7A 1G3TA 3OSVA 2PU9B 4OMFB 3RMQA 4A54A 1K9MU 3BW1A 4M78D 5D6WA 1K73C 4M7DB 1KG1A 4IUVA 3G4SA 3QUIA 2E5QA 2GQVA 5D6XA 1VIFA 2HD0A 4M78E 3G71T 1K73U 4C8QB 2DVEA 3M55A 3BFMA 5GAN5 5GANj 3X25B 4CI0C 2QEXT 5LJ5g 2ZZDA 3CBOA 3OMGA 3OYKA 3ME9A 4KUIA 3RERA 3MCAB 2HNIA 3PFSA 4FM4B 5GAOm 4LD9K 3SFMA 3HSBA 5DLQE 2DEQA 2PQWA 1U1TA 2D9TA 3G6ET 2E6NA 1W4SA 2FB7A 3L1AA 4M75D 2K3XA 2EJ9A 2RI5A 2LT1A 3UT1A 2PVOB 2O4XB 1FX7A 3LH0A 2ZPEB 4M75E 1YI2A 4RMOA 5A0LA 1FWZA 3JB9D 1KC8U 1YBYA 2MWPA 1W2BA 1VQKA 1JJ2S 2KY9A 4A4GA 3QKJA 4J7IA 4ME7A 4XU0A 2K2VA 2AHJB 1G3WA 2JVVA 3MEUA 4HA8A 4M77F 2LQKA 1WQ7A 2RK1A 2DO3A 2WSEE 2JN0A 2LC4A 4OB3B 5GAMe 2WSCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0K A;  3F70 A;  3S3M A;  4A4F A;  2R5A A;  3E9F A;  2YRV A;  4OVA A;  5C0M A;  2L3R A;  3C4S A;  4RG2 A;  3L2R A;  3OYH A;  3LGF A;  4IUU A;  2WAC A;  2R57 A;  4E7K A;  5J26 A;  2IG0 A;  3LGL A;  4E7H A;  1OZ2 A;  5KCH A;  3OYE A;  3ASK A;  3OYL A;  2BKD N;  4Q5W A;  2JZ2 A;  2RJC A;  3MP6 A;  4BDY A;  2RHY A;  3OQ5 A;  4GY5 A;  5CIU A;  2JTF A;  3S6W A;  3MO8 A;  4QW2 A;  4CRI A;  1H3Z A;  3OYB A;  1WJR A;  4L59 A;  1RI0 A;  2RI3 A;  4C5I A;  3OS0 A;  4ZTJ A;  2QQR A;  3LX7 A;  2DIQ A;  4PL6 A;  4X34 A;  2DAQ A;  2HQE A;  3DLM A;  3OMC A;  3QII A;  2M16 A;  5J39 A;  4IUQ A;  2O4X A;  3MEW A;  4C5G A;  3OYA A;  3UWN A;  3OS1 A;  2LRQ A;  2NLU A;  2RJF A;  2R58 A;  4E7I A;  2FHD A;  2RI2 A;  2K3Y A;  2QQS A;  3EAE A;  3GOX A;  1XNI A;  1MHN A;  4BD3 A;  1WGS A;  1N27 A;  3L42 A;  2XK0 A;  3DB4 A;  4IUT A;  5IN1 A;  2EQK A;  3DB3 A;  2X4X A;  3NTH A;  2RHI A;  4B9W A;  3M9Q A;  1G5V A;  4PLL A;  4B9X A;  2EQU A;  3KUF A;  3Q1J A;  2LDM A;  1WJQ A;  3OB9 A;  3LYI A;  4N4G A;  3S3N A;  5KH6 A;  3QBY A;  4N4H A;  3OYM A;  3PMT A;  3OYC A;  3OY9 A;  3L2V A;  2HQX A;  3CEY A;  4Z02 A;  5FRO A;  4IKF A;  4FU6 A;  3L2U A;  2XDP A;  4C5H A;  3L2Q A;  4NS5 A;  4EDU A;  4A4E A;  3O8V A;  5C6S A;  2R5M A;  2EQM A;  3OYJ A;  2RJE A;  3MET A;  2X4W A;  3MEA A;  3MP1 A;  4QVZ A;  3P8D A;  3FDR A;  2DIG A;  4FL6 A;  3FC3 A;  3NTI A;  2L8D A;  2MWO A;  1OYX A;  5KCO A;  4QQ6 A;  3SD4 A;  4BE2 A;  4UC4 A;  3MP8 A;  2GF7 A;  2LVM A;  2RJD A;  5D6Y A;  5FRM A;  1WJS A;  2L89 A;  4C5E A;  4HCZ A;  5D6W A;  4BAC A;  3FEO A;  1SSF A;  4PLI A;  4IUV A;  2EQJ A;  4QQG A;  3OYD A;  4IUR A;  2BIV A;  2E5Q A;  5D6X A;  2F5K A;  4LD6 A;  3OA6 A;  4E7L A;  2BUD A;  2GFU A;  2M0O A;  2RO0 A;  4II1 A;  4IUP A;  5M9O A;  3OYN A;  3H8Z A;  4BE0 A;  2CKK A;  3PNW C;  3OMG A;  3OYK A;  3ME9 A;  1KHC A;  4E7J A;  3MEV A;  2G3R A;  2EKO A;  3E9G A;  2LTO A;  3PFS A;  3LLR A;  3PMI A;  5IAY A;  2PQW A;  2LCC A;  2D9T A;  2RHU A;  2E6N A;  3H6Z A;  2K3X A;  2RI5 A;  3UT1 A;  3OYG A;  2O4X B;  4N4I A;  1OZ3 A;  3LH0 A;  2GFA A;  2RHX A;  2M1H A;  1OI1 A;  3NTK A;  3QJ6 A;  2X4Y A;  4ZTF A;  2VYT A;  3OS2 A;  2MWP A;  4A4H A;  3S3O A;  5KE2 A;  4BE1 A;  2X35 A;  3P8H A;  2B8A A;  3BDL A;  3ZEH A;  4A4G A;  3QKJ A;  2RHZ A;  3MEU A;  5KE3 A;  3FLG A;  5FRN A;  3L2W A;  3OYI A;  2EFI A;  4QQD A;  4BDZ A;  3OYF A; 
#chains in the Genus database with same CATH topology
 5FU6 B;  1Y0M A;  2HMA A;  3QO3 A;  1IO6 A;  4R0K A;  1VQL T;  2G6F X;  1MND A;  3JCM f;  5KYN A;  5KYU B;  3M4G A;  3TEE A;  1KFZ A;  4IIM A;  3JCM d;  3DLM A;  3OMC A;  3RKW A;  1AWO A;  1HK9 A;  4OMP A;  1VQ5 A;  1Y7X A;  2R58 A;  3G71 A;  1RAG B;  3VS7 A;  4FYW B;  3G4S T;  2M02 A;  2DXB A;  1LVK A;  5GAO n;  3L42 A;  5IN1 A;  3X28 B;  2RM4 A;  4BY6 C;  4PFO A;  2EQU A;  1WJQ A;  1ZQ1 A;  2ZPH B;  2QGF B;  1M90 C;  3BDU A;  2E6Z A;  3JCM V;  3I9Q A;  3HTR A;  1BIB A;  3OYY A;  1K76 A;  4YTL A;  2EWN A;  3FRN A;  4DOW A;  5GMK m;  2L2P A;  1LPL A;  2R5M A;  1HXD A;  4HT9 A;  3FDR A;  1GL5 A;  2OTJ Q;  1NLP C;  3NTI A;  4HCC A;  4UC4 A;  2DYB A;  5IHN A;  1IGQ A;  2F69 A;  2D6F A;  3QWX X;  1MV3 A;  2D8H A;  2SEM A;  3OA6 A;  4E7L A;  1VQ4 T;  5CK9 A;  2YUO A;  2FYK A;  2QTX A;  3ULR B;  4E7J A;  1YWO A;  2ZPF B;  1K9M R;  2K2M A;  3RIR A;  2KYM A;  4F7U B;  3OSS C;  1WFW A;  3PTA A;  4HCB A;  2RHX A;  3M59 A;  3CC7 Q;  1CKA A;  2X4Y A;  3GLX A;  2KI7 A;  5GAN 3;  1QVF A;  1MMD A;  4GLM A;  1KQS A;  2DL4 A;  1D1C A;  3CCR T;  3FLG A;  1ZBJ A;  1TWB A;  1BKB A;  5GAO p;  5FU7 B;  1UE9 A;  2V1Q A;  3HP9 A;  1YJN Q;  4OML A;  2IG0 A;  4EPC A;  1OZ2 A;  2QA4 Q;  3WVE B;  3VS6 A;  1WA7 A;  3V8J A;  4BDY A;  1B07 A;  3MJX A;  3OQ5 A;  4FT4 A;  4RTY A;  5IHI A;  4C92 D;  1VQP Q;  3LW5 E;  2RI3 A;  4C5I A;  4DQ2 A;  4PJO E;  2KRO A;  2P84 A;  3CC2 Q;  4VUB A;  3QII A;  3EFO B;  3CCU Q;  2KRM A;  4LNP A;  4C8Q D;  2LRQ A;  1GXI E;  3CCE T;  2K5L A;  2L0A A;  3ZFJ A;  3TCJ A;  2RPN A;  1MMA A;  2DYI A;  3JB9 H;  1YJW Q;  4BD3 A;  4PFZ A;  2AKK A;  2X9H A;  1VIE A;  3GP8 A;  1Q86 C;  1VQ8 T;  2C0O A;  2QDY B;  2D1X A;  5AT1 B;  2MYS A;  1PKT A;  4O6J A;  2XG8 D;  3CXC P;  1BK2 A;  4M7A B;  2DJZ A;  2E41 A;  1Q81 C;  2EJF A;  2CT4 A;  3CCL Q;  3L2Q A;  4J9E A;  3CCR A;  1SG5 A;  4FL6 A;  2YRC A;  2MWO A;  1OPK A;  4C92 G;  1FYN A;  1GBR A;  4KBM B;  4GBQ A;  3I55 T;  2KVQ G;  2XHC A;  4C8Q G;  4M7D C;  1TSF A;  1MGQ A;  3VS1 A;  1OU9 A;  3H8Z A;  2CKK A;  1KIK A;  1KHC A;  1PRL C;  3A98 A;  4OB1 B;  5IH2 A;  1V29 B;  1VQN Q;  3FB9 A;  4QVC A;  2KE9 A;  2HKQ B;  2YUN A;  3MPU B;  1WZO A;  3CCS Q;  2M1H A;  1VOM A;  4KUL A;  4PK4 A;  2JMA A;  2MPX C;  2XMF A;  1Y96 A;  2KK4 A;  1VQ8 A;  4QT7 A;  4JRP A;  3HRS A;  2P0K A;  2GTO A;  2HQH A;  3F70 A;  2RB6 A;  5GMK l;  1I8F A;  3C4S A;  5FU6 C;  1U8R A;  4IUU A;  3EHQ A;  4M78 B;  4PJJ A;  1X27 A;  1IRX A;  2JTF A;  3QYH B;  1BCO A;  1UTI A;  2ECZ A;  3CPF A;  4FYY B;  2VXF A;  1QCO A;  2DET A;  5CCA A;  2DAQ A;  1S72 T;  1Q82 C;  2M16 A;  5L8R E;  3CC4 T;  4OB0 B;  2EBP A;  1BI3 A;  4A63 B;  2MI6 A;  6AT1 B;  3ZBD A;  2QQ9 A;  2ROT A;  3TSZ A;  2FRY A;  4JS5 A;  1QWF A;  1PM3 A;  2EQK A;  1EIF A;  4LUE A;  2RHI A;  4F16 A;  3LH5 A;  2QI2 A;  2DA9 A;  5GMK i;  3C0C A;  4N4G A;  2QAS A;  2ZCF B;  1DJ7 B;  3TQ7 P;  3GIB A;  1ZX6 A;  3OYC A;  1ZA1 B;  5KYY A;  4ORZ A;  4FU6 A;  1WNL A;  2NUT B;  1KD1 R;  4M7D E;  5CVI A;  4DBH A;  3CD6 Q;  1LOJ A;  2SRC A;  1QP2 A;  4AFS C;  1CKB A;  1SSH A;  2PVG B;  2X51 A;  3CMA A;  3OW2 P;  3OW2 S;  4LXC A;  2I0N A;  1KD1 U;  2JS0 A;  4Z8A A;  3A8O B;  1WHM A;  1SSF A;  3PE0 A;  3SWN B;  4XK8 E;  1TH7 A;  3CCM A;  2A08 A;  1IB8 A;  2RA2 A;  4NL2 A;  4FYV B;  3JCM g;  1FXX A;  2LCC A;  1K0X A;  2QQB A;  2KDS A;  2O31 A;  1S72 A;  1KQS S;  4XTY A;  1G3Y A;  4ZGJ B;  2COZ A;  4KH0 B;  2VVK A;  2PUO B;  1JBM A;  2BZX A;  2VYT A;  3OS2 A;  1M5Q 1;  5CKE A;  3M54 A;  1S1N A;  4A4H A;  2O01 E;  4LDY A;  3H0H A;  2RHZ A;  3I56 Q;  2LCS A;  1ZBX A;  1C6V X;  1XOV A;  4PJN A;  2RQV A;  1KJW A;  1JU5 C;  4LDV A;  2C0I A;  3JSC A;  1H8K A;  3L2Z A;  4M7D A;  3UDC A;  1EZZ B;  5FU7 C;  2ESW A;  3MHX A;  2XDB A;  2MF2 A;  5DY9 A;  1F1B B;  2DD5 A;  3QDF A;  3VS0 A;  5EG2 A;  5GAN h;  2CP5 A;  4CC4 B;  1PHT A;  4LE9 A;  3M57 A;  4JRK A;  3QPH A;  3OS1 A;  2RQR A;  2DE0 X;  2QQS A;  1XNI A;  1H3H A;  1D3B B;  2JUF A;  2GCX A;  1AWW A;  2KSS A;  4JDS A;  1K1Z A;  1GCQ C;  2P4R A;  2KXC A;  4M7A C;  4XAX B;  3JB9 I;  1B34 B;  2BZY A;  3V8K A;  4IKF A;  1JXO A;  1Q95 G;  2JTM A;  1QVP A;  2C06 A;  1QLY A;  4PKC C;  2HBW A;  2MIO A;  1K9M C;  2L8D A;  4PJO B;  4J9I A;  2J7I A;  4HT8 A;  1G3T A;  2NUZ A;  2PU9 B;  3BW1 A;  5ECA A;  4J9G A;  3QUI A;  1PG5 B;  1VIF A;  1K73 U;  1U3O A;  1K0S A;  2DVE A;  3BFM A;  1K8A R;  5HCK A;  2ZZD A;  3CBO A;  2CP3 A;  3RER A;  5I22 A;  5GAO m;  3HSB A;  2DEQ A;  3G6E T;  1W4S A;  2K3X A;  2EJ9 A;  2RI5 A;  2O4X B;  2ATC B;  4M75 E;  1VQO Q;  4RMO A;  5A0L A;  2KY9 A;  1G3W A;  1R77 A;  4Z88 A;  2LQK A;  1WQ7 A;  2JT4 A;  3HPW A;  2HL5 C;  1VQ7 Q;  3OYE A;  2HEQ A;  2AK5 A;  1TU0 B;  2RK2 A;  4Q5W A;  3SEM A;  3TRE A;  3UA6 A;  4M78 C;  1VQM Q;  2LNV A;  3QJY A;  5KYW B;  1WQW A;  4CRI A;  3EH1 A;  1YJ9 Q;  2OTJ A;  2JTE A;  3LX7 A;  4F7U A;  2D0Q B;  4P5N A;  1WPY A;  1M27 C;  4AFZ C;  1VQK Q;  1M4Z A;  1M1K R;  1I81 A;  1C0M A;  1I4K 1;  4LN2 A;  3JCM X;  1NBE B;  3V7C A;  2VGM A;  5FLX E;  3M0S A;  4M75 A;  1OU8 A;  2CT3 A;  2HSE B;  4OMN A;  4C0Z A;  2LDM A;  3G6E A;  2A36 A;  2CGH A;  2F2V A;  3HRT A;  4LDU A;  1M1K U;  3OYM A;  3CEY A;  2XDP A;  2OAU A;  3NPF A;  3CC7 A;  3JCM W;  3O8V A;  1M1F A;  2VC8 A;  4C0G A;  1YI2 T;  2WSF E;  3MEA A;  1G2B A;  4DOV A;  1B3Q A;  1WYX A;  1QVG P;  1QVG S;  3JRZ A;  2V8J A;  5FRM A;  5D6Y A;  1WJS A;  3EFO A;  4PLI A;  4Y92 A;  3QDR B;  2RD1 A;  1Z9Q A;  5GAN e;  4WTO B;  3TSW A;  3I5S A;  2QA4 A;  4II1 A;  3SWN C;  2CP6 A;  2ZPI B;  2LCL A;  2XKO C;  2L3Q A;  3M58 A;  4EMK B;  4M7A A;  4L5G A;  2E3H A;  1O75 A;  2VXE A;  4N4I A;  1T3L A;  3CC2 A;  1I07 A;  3CCU A;  3WVD B;  1T0J A;  4ESR A;  3S3O A;  2PUK B;  2DNU A;  3X26 B;  1VQ5 T;  1TUC A;  1NEB A;  4C0D B;  4XQ3 A;  2LJ1 A;  3HKS A;  3REB B;  2OAW A;  1EX4 A;  4J9C A;  2GQI A;  2D0N A;  1OQK A;  3LGF A;  1IHW A;  1RAC B;  5KCH A;  5CAI A;  1VYT A;  2JXB A;  3VS2 A;  1QKX A;  2O9V A;  4NOY A;  3CPW P;  3CPW S;  1BI1 A;  1IGU A;  2EIF A;  3TVT A;  4JPB W;  3EH2 A;  1M8M A;  2LJ3 A;  1M3B A;  2XD0 A;  2NYS A;  5I21 A;  2EKH A;  5GAO l;  4NL3 A;  1KD1 C;  3VKI A;  1W70 A;  1SEM A;  2XK0 A;  3M56 A;  3CME Q;  1OEB A;  3SHW A;  3QBY A;  1Y71 A;  2GTJ A;  4OMO A;  3M0R A;  4JRQ A;  3CCS A;  4M78 A;  4C5H A;  2JW4 A;  2AZS A;  2CSQ A;  4CC2 A;  2LX7 A;  3MP1 A;  3MKD A;  3R6N A;  5GMK h;  4ATO A;  2VKN A;  2DBK A;  2GF7 A;  2MOX A;  4PJO C;  1D09 B;  2DL3 A;  4XTV A;  4BAC A;  1SHF A;  3QXE B;  2DXT A;  3M5A A;  1RAF B;  2KBT A;  3EFS A;  4IUP A;  1MV0 B;  5CKB A;  1E6H A;  1FMV A;  1YIJ T;  1NE8 A;  1AOJ A;  1PD1 A;  2KAF A;  3NTK A;  2LX9 A;  1WXT A;  3GNG A;  4ZTF A;  4RTW A;  1UDL A;  4GLK A;  4MZP A;  2NUT A;  2F2X A;  1W1F A;  3EG9 B;  3CQT A;  2KXD A;  5FRN A;  4HXJ A;  3L2W A;  1U06 A;  2L3P A;  4A4F A;  3E9F A;  4KGX B;  1BBZ A;  4N0A C;  1YFN A;  2J06 A;  3SWN A;  1AT1 B;  2BKD N;  2RNA A;  3QWY A;  1OV3 A;  2RHY A;  2RN8 A;  2DXU A;  1PC0 A;  1AHJ B;  3U23 A;  1G8X A;  1UG1 A;  2KGT A;  2XU8 A;  3DKM A;  1UB4 A;  1O9S A;  2VAS A;  4M77 E;  2E70 A;  2MAM A;  3VUB A;  4M75 B;  1N9S A;  4PJL A;  1T3S A;  2XIC A;  2RJF A;  1VQ9 T;  2F5T X;  2VV5 A;  1NM7 A;  2CP7 A;  2COW A;  2E5K A;  3KXT A;  5I2M A;  2A7Y A;  1WHK A;  3OB9 A;  2L3S A;  1YIJ A;  5KH6 A;  5CQY A;  3OS5 A;  5GAM h;  4Z02 A;  5LL6 S;  4MZT A;  2EJG A;  3L2U A;  3A1P A;  3PT9 A;  1TOV A;  1K8A C;  2GBQ A;  4DBR A;  1WX6 A;  1YCS B;  2CUB A;  1X69 A;  3I56 A;  5LJ5 h;  2VWF A;  4R56 A;  4BE2 A;  1W6X A;  1NJI U;  1YN8 A;  1VQ6 T;  1E6G A;  4QQG A;  5GAO q;  3THK A;  1UFF A;  1ZLM A;  3OYN A;  5CKF A;  1D3B A;  1PSE A;  4M77 A;  2RQU A;  8ATC B;  2FPF A;  1YIT Q;  2EYX A;  1QQJ A;  2J6O A;  3LLR A;  5IAY A;  4F7U G;  3JAM E;  3HL8 A;  4EMK C;  2KR3 A;  2QTV A;  2YT6 A;  4FT2 A;  2OTL Q;  1B34 A;  2M51 A;  1VQ9 A;  2JJ9 A;  3A5Z B;  4AFU C;  3ZEH A;  1VUB A;  2JM8 A;  4AT1 B;  1LNX A;  2CUD A;  4KUD K;  4M7A D;  3VRY A;  4PJO A;  4C0D C;  2R5A A;  1Q7Y R;  5C0M A;  2KT8 A;  2V26 A;  1GFD A;  2R57 A;  1MMG A;  4HVW A;  5GMK e;  1M1K C;  5CIU A;  2MCN A;  1Q7Y U;  2DRK A;  2Y4Y A;  4RTV A;  2EAY A;  2ZPB B;  2DTI A;  4ZTJ A;  2FPD A;  5A2Q E;  3RR6 A;  2O4X A;  3CMA T;  1VQ6 A;  2E64 A;  5DM7 R;  1G3S A;  2K3Y A;  2KYB A;  2EQI A;  2JS2 A;  1BCM A;  3CCM T;  4MMK A;  1SRM A;  3RES A;  1UHC A;  4M7A G;  3KUF A;  3Q1J A;  4HVU A;  1I5O B;  2ZGW A;  4N0A A;  3G71 Q;  1QW1 A;  2QEX Q;  3PMT A;  3OBW A;  1QMC A;  1AVZ C;  3G7Z A;  2DTH A;  1VQO A;  1OOT A;  5KYW A;  2X4W A;  4XTZ A;  2GNC A;  4M4Z A;  3H9N A;  1BB9 A;  2DIG A;  3EG0 A;  3AT1 B;  5GJV B;  3MP8 A;  4OGC A;  3CCQ T;  2CS7 A;  3OSV A;  4OMF B;  4A54 A;  4M78 D;  1JXM A;  1UEC A;  3M55 A;  1WHL A;  3OMG A;  2KRN A;  2EYW A;  1KC8 R;  3PFS A;  4PFP A;  4LD9 K;  3SFM A;  5DLQ E;  2D9T A;  4KGV B;  1VQL Q;  2EYZ A;  2KEA A;  3LH0 A;  1Z9Z A;  3H0I A;  2W0Z A;  3JB9 D;  1KC8 U;  2MWP A;  1W2B A;  1VQK A;  4A4G A;  2BTT A;  1WLP B;  2RK1 A;  1Y57 A;  2DO3 A;  2JN0 A;  5GAM e;  3PVL A;  2WSC E;  2EYQ A;  1D1A A;  2YRV A;  4OVA A;  1YHQ T;  3G4S Q;  2O88 A;  1QVF P;  1LJO A;  4EIK A;  1QVF S;  4M78 G;  9ATC B;  1KQS P;  1R0B G;  1X43 A;  5LJ5 e;  2LQN A;  3MP6 A;  1X75 C;  1WDX A;  1N6A A;  1OPL A;  2LQ8 A;  4ZN1 A;  4EMK A;  4C92 F;  3QZ5 B;  5GJW B;  4PL6 A;  1PRM C;  3CCQ A;  4C5G A;  4FW2 A;  4KGZ B;  2FZC B;  2NLU A;  3JCM P;  4M75 C;  3NHN A;  4C8Q F;  2RI2 A;  1T0H A;  3JB9 G;  2DL7 A;  1OUL A;  3DB4 A;  1G5V A;  2DK3 A;  5A0G A;  1VQ4 Q;  4V2S A;  3V8L A;  2DJQ A;  2FG0 A;  3L2V A;  4A4K A;  1KQ2 A;  1M90 U;  1ABQ A;  1RI9 A;  1X2Q A;  3RKY A;  2Z0W A;  3P8D A;  2V1R A;  4B6M A;  1HSQ A;  4ZGE B;  1ARK A;  1PWT A;  4M77 B;  1WHG A;  1YHQ A;  1QCF A;  1AZG B;  3WXM B;  3CCR Q;  3OYD A;  3FJ5 A;  1RLQ C;  4LD6 A;  5HY6 A;  2BUD A;  2DEU A;  5M9O A;  1V1C A;  4J8O A;  1JO8 A;  3RKX A;  2KMT A;  2BE7 D;  2E10 A;  2K57 A;  1JJ2 A;  2C0T A;  3MEV A;  4DA4 A;  1UGV A;  1H92 A;  2H8H A;  2HBP A;  1KHI A;  2LNH B;  2EGC A;  1IRE B;  5D7U A;  5IXB A;  1K73 R;  4LDW A;  2OTJ T;  4J6W A;  2DZ9 A;  4BE1 A;  4MZM A;  3RDV A;  1NLO C;  1NYG A;  2OI3 A;  2YLB A;  5CO7 A;  4E7S A;  4ZNX A;  3M0Q A;  3CCE Q;  5IHK A;  3JCM b;  2FRW A;  2NUP B;  2EVR A;  1NPP A;  3LGL A;  4WF2 A;  5J26 A;  3ASK A;  2IIM A;  1VQ8 Q;  2KNB B;  5GAN 7;  2PNI A;  4PJO D;  4QW2 A;  3CC7 T;  1WIE A;  5GAN 2;  3M53 A;  4C92 E;  2FZK B;  2HQE A;  2VGN A;  4PNO A;  5LJ3 h;  4IUQ A;  3VJP A;  1ZUK A;  2J05 A;  3OYA A;  4LUD A;  1UJ0 A;  2CSI A;  4WCI A;  1V76 A;  2Y4X A;  1U1S A;  3EG1 A;  4C8Q E;  1QKW A;  1XTD A;  1YJN T;  3EG9 A;  1N27 A;  4E2F B;  2BZ8 A;  3I55 Q;  5IXF A;  2QA4 T;  3NTH A;  1NYF A;  3X20 B;  3EHR A;  3M0U A;  1RAA B;  1Q86 U;  1I0C A;  1VQP T;  3OY9 A;  1AEY A;  1BI0 A;  4BUG A;  1Q81 U;  1NEG A;  3CC2 T;  3R6O A;  4A4E A;  3CCU T;  3OYJ A;  2PVD B;  1BIA A;  2DKG A;  4PJO G;  3GF5 A;  1UGS B;  4JJN K;  1YJW T;  2QYZ A;  5GAN 6;  5GAN f;  3JCM h;  5KYX B;  2FZG B;  3HHT B;  1UUE A;  3A8M B;  5CKH A;  5GAN d;  2F1L A;  3J7A F;  3VRZ A;  2JMC A;  5GAM j;  3CCL T;  2LTO A;  1YIT T;  3AHU A;  1RAI B;  3N5B B;  5GAN 4;  5J3B A;  2HZY A;  5CR2 A;  1Q7Y C;  3A8G B;  4CC3 A;  1OI1 A;  3I5R A;  5LJ5 j;  2K6D A;  1X6G A;  2E3I A;  4ANJ A;  3C12 A;  1YJN A;  3CC4 Q;  2XID A;  4FIB A;  4RCB A;  5FW9 A;  2EFI A;  4QQD A;  2DL5 A;  3OYF A;  3CCJ Q;  2DM1 A;  2HL3 A;  4RG2 A;  3L2R A;  1VQP A;  2DBM A;  2WAC A;  3BE3 A;  4XU2 A;  1M3C A;  2IPO B;  4E7H A;  1VQN T;  3PIP A;  3SB2 A;  4JLI A;  3CCS T;  1VA7 A;  5I11 A;  3OYB A;  1WJR A;  2V8I A;  2DER A;  2QQR A;  1YJW A;  4TVR A;  3CXC A;  3MEW A;  2E4H A;  1MNE A;  1Q82 U;  4X9D A;  4ZGD B;  1UGQ B;  2FHD A;  1BU1 A;  1WXU A;  4MDW A;  4E6R A;  4FSX A;  1KK7 A;  4DBF A;  3CCL A;  4AG1 C;  1YIT A;  5LJ3 f;  1KSW A;  1UHF A;  4M7D D;  2OTL A;  5LJ3 d;  4BI8 B;  4QVZ A;  1PKS A;  1IHV A;  2X3X D;  1KC8 C;  4RKU E;  3SD4 A;  3NFC A;  2EW3 A;  3VS3 A;  4J9B A;  1UEB A;  2XDD A;  4M77 C;  2K5F A;  3CBM A;  4IUR A;  1VQN A;  2RH2 A;  2RO0 A;  1ZUU A;  2EPD A;  2YWW A;  2DPP B;  3VYG A;  3HFO A;  3T9N A;  1C1A A;  5LJ3 e;  2QGG A;  3QYG B;  2EKO A;  3E9G A;  2QXF A;  2K3B A;  2LQW A;  2ED0 A;  2J6F A;  3OYG A;  3CD6 T;  2M9U A;  1OZ3 A;  2DX1 A;  2GFA A;  4E47 A;  3J81 E;  4Y91 A;  5CKD A;  4M7D G;  3A8L B;  3QSU A;  4PJO F;  1M2V B;  1AWX A;  5CQX A;  2HSP A;  4J7F A;  5KE3 A;  5I2S A;  2HAX A;  2DL8 A;  4OGE A;  1MMN A;  2ABL A;  3URG A;  4BDZ A;  1D1B A;  4RTU A;  3S3M A;  2QEX A;  1TTH B;  3GNF B;  3GPL A;  3ZL7 C;  4KRT A;  4XTX A;  4DEX A;  2DD4 A;  2E12 A;  1H3Z A;  2DLP A;  3JCM e;  3OS0 A;  5A0D A;  2L5Q A;  3EGX A;  1G83 A;  4AMC A;  3I56 T;  2LZ6 B;  3UWN A;  1HJD A;  3E19 A;  3G1J A;  4E7I A;  2K4Y A;  2RQT A;  1N8R R;  1MHN A;  2ROL A;  2AZV A;  1NZ9 A;  1D0Z A;  1QCN A;  2DTO A;  5HK3 A;  3IQL A;  2EGA A;  3M9Q A;  3CCV Q;  4XU3 A;  3CD6 A;  3OW2 A;  1N8R U;  1VQL A;  1ZSZ B;  2HQX A;  4EMG A;  1XQH A;  2NWM A;  1TUG B;  2P4T A;  2FL7 A;  5FWC A;  3G6E Q;  5C6S A;  8AT1 B;  1N9R A;  2IVW A;  3CBP A;  4RG8 A;  4JRI A;  1OYX A;  3KFV A;  2A3L A;  1X01 A;  2CYZ B;  1FMK A;  4C92 B;  1Y07 A;  2RJD A;  3RMQ A;  1K9M U;  3EGU A;  1K73 C;  3G4S A;  4JJB A;  2GQV A;  2DVJ A;  2K7A A;  3D7S B;  4C8Q B;  5GAN j;  3OYK A;  4KUI A;  2AIR B;  2K79 A;  1NJI R;  4J9F A;  2HNI A;  4FM4 B;  2PQW A;  3L1A A;  2ZAE A;  4M75 D;  3UT1 A;  1AWJ A;  3EGD B;  2YXY A;  2HDA A;  4J9D A;  1TUD A;  1B7T A;  1YBY A;  4J9H A;  1AZE A;  4J7I A;  4ME7 A;  2K2V A;  2AHJ B;  3MEU A;  1D0Y A;  2GGR A;  2WSE E;  2KT1 A;  2LC4 A;  2QAZ A;  2YRD A;  2O9S A;  1TXQ A;  2PTK A;  1X6O A;  5AYF A;  2L3R A;  2CH4 A;  2X3W D;  1VQ4 A;  2FEI A;  1SF9 A;  5IT9 E;  1M9S A;  3O5Z A;  4RTT A;  1RLP C;  2LT4 A;  2RJC A;  3UAT A;  4D6W A;  3CXC S;  3M4Y A;  1VQO T;  4L59 A;  3KBG A;  2W10 A;  2KRS A;  2CZ7 B;  2LMJ A;  4Z89 A;  4A53 A;  4X34 A;  4M75 G;  4XTU A;  4M7D F;  1YI2 Q;  3H41 A;  5GAN g;  3H0F A;  4JS4 A;  3TU4 K;  2DRM A;  4QKU A;  1RUW A;  2YDL A;  4LDX A;  1VQ7 T;  2CZ0 B;  2DMO A;  3DB3 A;  2O2O A;  4AG2 C;  2K9G A;  3LYI A;  1VQM T;  1FMW A;  2NUP A;  3RBB B;  2CZ1 B;  1WHJ A;  1YJ9 T;  2X4J A;  2MMP A;  4JLG A;  4BB7 A;  1HD3 A;  3BY7 A;  4L6V 5;  4RUG A;  2JOY A;  5LJ3 j;  2RJE A;  4MDX A;  2JNG A;  4QVD A;  1VQK T;  3FC3 A;  5KCO A;  5GAN 8;  3CCE A;  1JQQ A;  4KH1 B;  1NG2 A;  2DF6 A;  5HK0 A;  4HCZ A;  3P8B B;  4OMM A;  3E2U A;  2EQJ A;  1VQ5 Q;  2AKL A;  1R0C B;  2F5K A;  1U5S A;  2GFU A;  2QG9 B;  1JRI A;  3UF4 A;  1YNZ A;  3PMI A;  2ENM A;  3HRU A;  4MML A;  3V7R A;  3H6Z A;  1K9A A;  1TG0 A;  2P0Q A;  2RF0 A;  3VS5 A;  2XI9 A;  2B8A A;  3BDL A;  1WHH A;  3REA B;  5GAM f;  1GCP A;  2YSQ A;  1VQ7 A;  1RAD B;  2P0P A;  3QG1 A;  3I55 A;  1M30 A;  5GAM d;  2JM9 A;  1VQM A;  3CCJ T;  3OYH A;  2ZPG B;  1YJ9 A;  2CP2 A;  5KYX A;  5LJ5 f;  3EGX B;  4E7K A;  2CRE A;  4J5Y A;  2DZC A;  1SRL A;  5LJ3 g;  3FJP A;  2E65 A;  4J83 A;  5LJ5 d;  4HCK A;  2FO0 A;  2QQA A;  1RI0 A;  2H3E B;  2DIQ A;  2A37 A;  1PSF A;  3VV0 A;  1SPK A;  3DLL A;  2HCK A;  1AD5 A;  4R55 A;  3GOX A;  3VUZ A;  4ELZ C;  1WGS A;  1CSK A;  4IUT A;  2X4X A;  3C95 A;  3PGG A;  4FW1 A;  3EG2 A;  4F7U F;  4FCY A;  3V7S A;  1QWE A;  1QVG A;  1MUZ A;  4ZN3 A;  1GBQ A;  1ZSZ C;  2MK5 A;  3JCM Q;  4NS5 A;  1IZ6 A;  4EDU A;  1I5L A;  5HKC A;  2V8K A;  1YIJ Q;  3MET A;  4JZ3 A;  1OX9 A;  4JUV A;  1X6B A;  4M75 F;  3CC4 A;  3RUX A;  4BI3 A;  1M90 R;  1HYO A;  2L89 A;  4C5E A;  1GRI A;  4C92 C;  3CCJ A;  5GAO r;  1UGP B;  2YUP A;  3CME T;  5EC7 A;  3OBY A;  2M0O A;  2FPE A;  4C8Q C;  2QDL A;  1YWP A;  2RHU A;  4F14 A;  1LCK A;  3VYH B;  2YUQ A;  4X9C A;  4PJM A;  1GFC A;  3A8H B;  1PNJ A;  1EFN A;  3CPW A;  4O5V A;  1WI7 A;  4X1V A;  3UPU A;  2RMO A;  4M7A F;  1UJY A;  4D8K A;  3I35 A;  1VQ9 Q;  4RTZ A;  4F17 A;  1UGR B;  1RL2 A;  3QHS A;  2EGE A;  3EG3 A;  2K5I A;  2OJ2 A;  2EYY A;  3OYL A;  2H3J A;  4JJD A;  2JZ2 A;  5GMK j;  1X2K A;  1N8R C;  3LWH A;  1JB0 E;  1YP5 A;  2AT1 B;  3NMZ C;  4Y28 E;  2VUB A;  4KT0 E;  4M77 D;  2M0Y A;  2FVU A;  3VU3 C;  1NPR A;  3GBQ A;  5J39 A;  1VYV A;  1K4U S;  5KYU A;  1TS9 A;  4RCC A;  3X24 B;  3CME A;  3EAE A;  1M2V A;  1RAB B;  5FWB A;  2B86 A;  4BY6 B;  5L23 A;  3UA7 A;  3INZ A;  3HFN A;  1VQ6 Q;  4B9X A;  3CCV T;  2YHT A;  3S3N A;  4F7U E;  2QK0 A;  4N4H A;  4J6X A;  4OF1 A;  4XTW A;  1P92 A;  4FYX B;  4IIO A;  4K11 A;  4HKE A;  4C0F A;  1JEG A;  4J6Y A;  2EQM A;  1Y96 B;  4OP0 A;  2A0F B;  1Q86 R;  1NJI C;  1K8A U;  1M8V A;  2DXC A;  4QQ6 A;  4M77 G;  3SDZ A;  1Q81 R;  3M0P A;  3FIF A;  3FEO A;  2DFU A;  1RAH B;  3JB9 J;  2BIV A;  1D0X A;  4M78 F;  2KQW A;  2RQW A;  2LJ0 A;  4BE0 A;  3PNW C;  3RNJ A;  4OB2 B;  1SKU B;  3PIO A;  2G3R A;  2CDT A;  2E1H A;  2Y90 A;  4DBQ A;  4FSS A;  1ZSZ A;  3NGP A;  3J80 E;  3QJ6 A;  1PCX A;  2YLC A;  4OMQ A;  5KE2 A;  2X35 A;  3P8H A;  3JB9 F;  1OX8 A;  2OX7 A;  3QZ9 B;  3LWI A;  3OYI A;  3CMA Q;  4JJC A;  4C92 A;  3CCV A;  3EFR A;  4M7A E;  2ED1 A;  1BYM A;  3JCM c;  3RMS A;  2I2L A;  1W2B P;  1W2B S;  2HKN A;  1XJW B;  4XU1 A;  5KYY B;  3CCM Q;  2CZ6 B;  4C8Q A;  1IXD A;  4GY5 A;  4F04 B;  4EMH A;  3S6W A;  3MO8 A;  2OTL T;  4E7Z A;  1BI2 A;  5DLO A;  4BI4 A;  1S72 Q;  2BE9 B;  3EGD A;  1N5Z A;  1M1G A;  1WXB A;  3ER0 A;  3E1S A;  3JCM J;  3C94 A;  3CCQ Q;  7AT1 B;  1ZHI A;  4B9W A;  4D8D A;  1I1J A;  4PLL A;  4AFQ C;  4ELY C;  1H64 1;  1QP3 A;  1J3T A;  1A0N B;  1Q82 R;  4DEY A;  1M2O A;  2CH4 W;  1KQ1 A;  1M3A A;  1E7O A;  5FRO A;  1PD0 A;  4RTX A;  1YCY A;  1GCQ A;  2PZ1 A;  4HVV A;  3PVQ A;  1R8O B;  2A28 A;  1ZA2 B;  5GAM g;  1ACM B;  1ABO A;  2LVM A;  2F2W A;  5D6W A;  2DIL A;  4M7D B;  1KG1 A;  1ZUY A;  4IUV A;  2E5Q A;  2COY A;  5D6X A;  4CC7 A;  2HD0 A;  4M78 E;  3G71 T;  1RAE B;  5GAN 5;  3X25 B;  4CI0 C;  2QEX T;  5LJ5 g;  3ME9 A;  2J6K A;  3M0T A;  1VYU A;  1YHQ Q;  3MCA B;  1U1T A;  2LP5 A;  2E6N A;  2FB7 A;  2VB6 A;  2LT1 A;  3VS4 A;  2CP0 A;  2PVO B;  1FX7 A;  2ZPE B;  1YI2 A;  1FWZ A;  3JV3 A;  1JJ2 P;  1JJ2 S;  3QKJ A;  4XU0 A;  1ZSG A;  4HA8 A;  4JZ4 A;  2JVV A;  4M77 F;  1SHG A;  4OB3 B;  2D8J A; 
#chains in the Genus database with same CATH homology
 5FU6 B;  1X6O A;  5AYF A;  3HPW A;  2YRV A;  4OVA A;  1YHQ T;  2L3R A;  3QO3 A;  1VQ4 A;  1LJO A;  1QVF S;  4M78 G;  5IT9 E;  1M9S A;  3OYE A;  2RK2 A;  2LT4 A;  4Q5W A;  1VQL T;  3TRE A;  2RJC A;  5LJ5 e;  3MP6 A;  4M78 C;  1X75 C;  3JCM f;  4D6W A;  2LNV A;  1N6A A;  3QJY A;  3M4Y A;  3CXC S;  1VQO T;  1WQW A;  4CRI A;  2LQ8 A;  4ZN1 A;  3M4G A;  4L59 A;  3TEE A;  3KBG A;  2CZ7 B;  4EMK A;  3JCM d;  2OTJ A;  4C92 F;  3QZ5 B;  3LX7 A;  4PL6 A;  4A53 A;  4F7U A;  4X34 A;  2D0Q B;  3DLM A;  3OMC A;  4P5N A;  3RKW A;  3CCQ A;  1WPY A;  4M75 G;  4XTU A;  4M7D F;  4C5G A;  1HK9 A;  2NLU A;  3JCM P;  1VQ5 A;  1Y7X A;  2R58 A;  4M75 C;  2RI2 A;  4C8Q F;  5GAN g;  4JS4 A;  1M4Z A;  3G71 A;  3TU4 K;  3JB9 G;  1I81 A;  1I4K 1;  3JCM X;  3G4S T;  3V7C A;  2DXB A;  2VGM A;  4LDX A;  1VQ7 T;  5GAO n;  3L42 A;  3DB4 A;  2CZ0 B;  5IN1 A;  3DB3 A;  3X28 B;  2RM4 A;  5FLX E;  1G5V A;  4BY6 C;  2DK3 A;  5A0G A;  2EQU A;  4M75 A;  4C0Z A;  2LDM A;  1WJQ A;  1ZQ1 A;  3G6E A;  3LYI A;  2CGH A;  1VQM T;  3HRT A;  2ZPH B;  4V2S A;  1M90 C;  4LDU A;  1M1K U;  3BDU A;  3V8L A;  3OYM A;  2E6Z A;  2CZ1 B;  3JCM V;  1YJ9 T;  2X4J A;  3L2V A;  4A4K A;  1KQ2 A;  3CEY A;  2MMP A;  1BIB A;  3OYY A;  4JLG A;  4YTL A;  4BB7 A;  1M90 U;  2EWN A;  2XDP A;  2OAU A;  3BY7 A;  3FRN A;  4L6V 5;  3CC7 A;  3JCM W;  3RKY A;  4DOW A;  5GMK m;  3O8V A;  1M1F A;  2VC8 A;  2JOY A;  4C0G A;  5LJ3 j;  2WSF E;  2R5M A;  1HXD A;  1YI2 T;  2RJE A;  4MDX A;  3MEA A;  2JNG A;  4DOV A;  4QVD A;  3P8D A;  4HT9 A;  1VQK T;  3FDR A;  3FC3 A;  3NTI A;  5KCO A;  5GAN 8;  1QVG S;  4HCC A;  4UC4 A;  4ZGE B;  3JRZ A;  2V8J A;  5FRM A;  3CCE A;  5D6Y A;  4M77 B;  1WJS A;  5HK0 A;  4HCZ A;  1YHQ A;  3P8B B;  2F69 A;  2D6F A;  4PLI A;  3QDR B;  2EQJ A;  3WXM B;  2RD1 A;  3OYD A;  2F5K A;  5GAN e;  4LD6 A;  3OA6 A;  5HY6 A;  4E7L A;  2BUD A;  2QA4 A;  1VQ4 T;  2GFU A;  5CK9 A;  4II1 A;  5M9O A;  2FYK A;  2QTX A;  4J8O A;  2ZPI B;  2LCL A;  2XKO C;  3SWN C;  1JRI A;  3RKX A;  2KMT A;  2E10 A;  1JJ2 A;  2K57 A;  4E7J A;  2ZPF B;  3M58 A;  3MEV A;  4DA4 A;  2HBP A;  1KHI A;  3PMI A;  4EMK B;  3HRU A;  3RIR A;  4MML A;  3V7R A;  4M7A A;  3H6Z A;  4L5G A;  4F7U B;  1IRE B;  3OSS C;  1O75 A;  2VXE A;  4LDW A;  2P0Q A;  4N4I A;  3CC2 A;  3PTA A;  4HCB A;  2RHX A;  3M59 A;  2OTJ T;  3CCU A;  3WVD B;  4J6W A;  2X4Y A;  3GLX A;  2DZ9 A;  5GAN 3;  1QVF A;  2XI9 A;  3S3O A;  4BE1 A;  1KQS A;  2B8A A;  2PUK B;  3BDL A;  4MZM A;  2YLB A;  3X26 B;  5CO7 A;  5GAM f;  3CCR T;  3FLG A;  1VQ5 T;  1VQ7 A;  2P0P A;  4C0D B;  3QG1 A;  4XQ3 A;  3I55 A;  3HKS A;  5GAM d;  3JCM b;  1BKB A;  1VQM A;  3CCJ T;  5GAO p;  5FU7 B;  3OYH A;  3HP9 A;  2ZPG B;  3LGF A;  1YJ9 A;  5LJ5 f;  1NPP A;  2IG0 A;  3LGL A;  4J5Y A;  1OZ2 A;  2DZC A;  4WF2 A;  3ASK A;  5J26 A;  3WVE B;  4EPC A;  5CAI A;  5KCH A;  3CPW S;  3V8J A;  4NOY A;  5LJ3 g;  3FJP A;  2E65 A;  4J83 A;  4BDY A;  5LJ5 d;  3OQ5 A;  4FT4 A;  5GAN 7;  1BI1 A;  4PJO D;  4QW2 A;  2EIF A;  3CC7 T;  4C92 D;  5GAN 2;  3LW5 E;  2QQA A;  1RI0 A;  3M53 A;  2RI3 A;  4C5I A;  4DQ2 A;  4PJO E;  2DIQ A;  4C92 E;  4VUB A;  2HQE A;  2VGN A;  3QII A;  4PNO A;  5LJ3 h;  4IUQ A;  3VJP A;  1PSF A;  3VV0 A;  3OYA A;  4C8Q D;  3DLL A;  2LRQ A;  2XD0 A;  1GXI E;  3CCE T;  2K5L A;  5I21 A;  3ZFJ A;  2Y4X A;  3TCJ A;  1U1S A;  5GAO l;  4R55 A;  4C8Q E;  4NL3 A;  1KD1 C;  3GOX A;  3JB9 H;  3VKI A;  3VUZ A;  4BD3 A;  4ELZ C;  1XTD A;  1YJN T;  1WGS A;  1N27 A;  2XK0 A;  4IUT A;  2QA4 T;  2X4X A;  1VIE A;  3NTH A;  3X20 B;  3GP8 A;  1Q86 C;  1VQ8 T;  3C95 A;  2QDY B;  3PGG A;  4O6J A;  3M56 A;  2XG8 D;  4M7A B;  4F7U F;  2DJZ A;  2E41 A;  1Q81 C;  1Q86 U;  3V7S A;  3QBY A;  1QVG A;  2EJF A;  1Y71 A;  1VQP T;  3OY9 A;  1BI0 A;  4BUG A;  1Q81 U;  4ZN3 A;  4JRQ A;  3CCS A;  4M78 A;  4C5H A;  3JCM Q;  3L2Q A;  4NS5 A;  1IZ6 A;  4EDU A;  3CC2 T;  1I5L A;  3R6O A;  4A4E A;  5HKC A;  3CCU T;  3OYJ A;  2V8K A;  2PVD B;  3MP1 A;  1BIA A;  2DKG A;  3MET A;  3CCR A;  4JUV A;  4FL6 A;  4PJO G;  5GMK h;  4M75 F;  2MWO A;  4C92 G;  3GF5 A;  1UGS B;  4JJN K;  3CC4 A;  4ATO A;  1YJW T;  3RUX A;  4KBM B;  2GF7 A;  4BI3 A;  5GAN 6;  4PJO C;  2L89 A;  4C5E A;  3CCJ A;  4C92 C;  5GAN f;  3I55 T;  4XTV A;  4BAC A;  3JCM h;  3QXE B;  2KVQ G;  2DXT A;  2XHC A;  1UGP B;  3HHT B;  3M5A A;  4C8Q G;  5GAO r;  3A8M B;  5CKH A;  3CME T;  4M7D C;  1MGQ A;  5GAN d;  3OBY A;  3EFS A;  2M0O A;  4IUP A;  3H8Z A;  5CKB A;  2CKK A;  3J7A F;  4C8Q C;  1KHC A;  2EYQ A;  5GAM j;  3CCL T;  2LTO A;  4OB1 B;  1YIT T;  1V29 B;  2RHU A;  3FB9 A;  4QVC A;  3N5B B;  3AHU A;  1YIJ T;  5GAN 4;  5J3B A;  3VYH B;  1NE8 A;  5CR2 A;  1Q7Y C;  4X9C A;  3A8G B;  2KAF A;  2M1H A;  1OI1 A;  3NTK A;  2LX9 A;  5LJ5 j;  3GNG A;  4ZTF A;  4GLK A;  3A8H B;  4KUL A;  4MZP A;  3CPW A;  3C12 A;  4O5V A;  1YJN A;  1Y96 A;  5FRN A;  3UPU A;  2KK4 A;  3L2W A;  2XID A;  4FIB A;  1VQ8 A;  4RCB A;  2EFI A;  4QQD A;  4M7A F;  4JRP A;  3HRS A;  3OYF A;  2P0K A;  1UGR B;  3F70 A;  1RL2 A;  4A4F A;  2RB6 A;  5GMK l;  3E9F A;  3QHS A;  1I8F A;  3C4S A;  2K5I A;  4RG2 A;  5FU6 C;  3L2R A;  4N0A C;  1VQP A;  4IUU A;  2WAC A;  4XU2 A;  1U8R A;  4E7H A;  1VQN T;  3SWN A;  2H3J A;  3OYL A;  4M78 B;  2BKD N;  3PIP A;  3SB2 A;  2JZ2 A;  2RHY A;  5GMK j;  2DXU A;  1N8R C;  4HT8 A;  2JTF A;  3QYH B;  4JLI A;  3LWH A;  1AHJ B;  1JB0 E;  3CCS T;  3OYB A;  1WJR A;  4Y28 E;  3CPF A;  2VUB A;  2VXF A;  4KT0 E;  2V8I A;  4M77 D;  2FVU A;  2XU8 A;  3DKM A;  2QQR A;  4E7K A;  1UB4 A;  3VU3 C;  1NPR A;  1YJW A;  5CCA A;  1O9S A;  2DAQ A;  1S72 T;  1Q82 C;  2M16 A;  4M77 E;  5L8R E;  5J39 A;  4TVR A;  2E70 A;  3CXC A;  3MEW A;  2MAM A;  3VUB A;  3CC4 T;  4M75 B;  4OB0 B;  1N9S A;  1Q82 U;  2XIC A;  2RJF A;  4X9D A;  4ZGD B;  1BI3 A;  1UGQ B;  4RCC A;  2FHD A;  3X24 B;  3CME A;  2F5T X;  2MI6 A;  3EAE A;  2VV5 A;  3ZBD A;  4MDW A;  4FSX A;  2QQ9 A;  4JS5 A;  4BY6 B;  3KXT A;  3INZ A;  2EQK A;  3HFN A;  1EIF A;  5I2M A;  2A7Y A;  2RHI A;  3CCL A;  4B9X A;  1YIT A;  2QI2 A;  3CCV T;  5GMK i;  2YHT A;  3OB9 A;  4N4G A;  3S3N A;  4F7U E;  1YIJ A;  5KH6 A;  4N4H A;  2ZCF B;  1DJ7 B;  4J6X A;  4OF1 A;  5CQY A;  5LJ3 f;  3GIB A;  3OYC A;  4XTW A;  3OS5 A;  1P92 A;  5GAM h;  4Z02 A;  5LL6 S;  4M7D D;  4FU6 A;  4HKE A;  1WNL A;  2EJG A;  4MZT A;  3L2U A;  2OTL A;  4C0F A;  3PT9 A;  5LJ3 d;  4BI8 B;  4M7D E;  1K8A C;  4J6Y A;  2EQM A;  5CVI A;  1LOJ A;  1Y96 B;  4OP0 A;  4QVZ A;  1QP2 A;  1NJI C;  1K8A U;  1KC8 C;  2PVG B;  4RKU E;  2DXC A;  3I56 A;  1M8V A;  4QQ6 A;  3SD4 A;  5LJ5 h;  4R56 A;  3NFC A;  3CMA A;  4M77 G;  3SDZ A;  4BE2 A;  3OW2 S;  1NJI U;  1UEB A;  1KD1 U;  3FIF A;  3A8O B;  2XDD A;  1VQ6 T;  3FEO A;  1SSF A;  4M77 C;  4QQG A;  3JB9 J;  2K5F A;  3CBM A;  4IUR A;  2BIV A;  4M78 F;  3SWN B;  1VQN A;  5GAO q;  4XK8 E;  2KQW A;  2RH2 A;  1TH7 A;  2RO0 A;  3OYN A;  3CCM A;  4NL2 A;  5CKF A;  2RA2 A;  4BE0 A;  3PNW C;  1D3B A;  4OB2 B;  2DPP B;  3VYG A;  3HFO A;  3T9N A;  1PSE A;  5LJ3 e;  3PIO A;  4M77 A;  2G3R A;  3QYG B;  2EKO A;  3E9G A;  2QXF A;  3LLR A;  5IAY A;  3JCM g;  1FXX A;  4F7U G;  2LCC A;  2E1H A;  3JAM E;  2QQB A;  3HL8 A;  2Y90 A;  2KDS A;  4EMK C;  1S72 A;  3OYG A;  1KQS S;  3CD6 T;  4XTY A;  2M9U A;  1G3Y A;  4ZGJ B;  1OZ3 A;  2GFA A;  4FT2 A;  2PUO B;  1JBM A;  1B34 A;  3QJ6 A;  4E47 A;  3J80 E;  3J81 E;  2VYT A;  3OS2 A;  1M5Q 1;  4Y91 A;  5CKE A;  5CKD A;  3M54 A;  2YLC A;  4A4H A;  1VQ9 A;  5KE2 A;  3A8L B;  3QSU A;  4M7D G;  2X35 A;  3A5Z B;  3P8H A;  4PJO F;  2O01 E;  3ZEH A;  3JB9 F;  1VUB A;  4LDY A;  1LNX A;  2RHZ A;  3QZ9 B;  5CQX A;  4J7F A;  5KE3 A;  3LWI A;  5I2S A;  4KUD K;  2HAX A;  4M7A D;  3OYI A;  1ZBX A;  4OGE A;  1XOV A;  4PJO A;  4C92 A;  3URG A;  4C0D C;  3EFR A;  3CCV A;  4BDZ A;  4M7A E;  1BYM A;  3JCM c;  3S3M A;  4LDV A;  2R5A A;  5C0M A;  3JSC A;  3L2Z A;  3RMS A;  2I2L A;  4M7D A;  3UDC A;  1W2B S;  2R57 A;  2QEX A;  4XU1 A;  5FU7 C;  3GNF B;  3GPL A;  3MHX A;  5GMK e;  2CZ6 B;  2XDB A;  4C8Q A;  1M1K C;  2MF2 A;  4GY5 A;  4XTX A;  5CIU A;  5DY9 A;  2DD4 A;  2DD5 A;  2E12 A;  4EMH A;  3S6W A;  3MO8 A;  1Q7Y U;  2OTL T;  1H3Z A;  5EG2 A;  5GAN h;  2Y4Y A;  2EAY A;  3JCM e;  1BI2 A;  5DLO A;  2ZPB B;  3OS0 A;  5A0D A;  2L5Q A;  4BI4 A;  2DTI A;  4ZTJ A;  5A2Q E;  2O4X A;  3I56 T;  1M1G A;  3UWN A;  3M57 A;  4JRK A;  3QPH A;  3OS1 A;  3CMA T;  1VQ6 A;  3E19 A;  2E64 A;  5DM7 R;  1G3S A;  3ER0 A;  4E7I A;  2K3Y A;  2QQS A;  3E1S A;  2K4Y A;  3JCM J;  1XNI A;  1MHN A;  3C94 A;  1D3B B;  1NZ9 A;  1ZHI A;  2DTO A;  5HK3 A;  2JUF A;  3CCM T;  4MMK A;  4B9W A;  3M9Q A;  2GCX A;  4PLL A;  3RES A;  4M7A G;  3KUF A;  3Q1J A;  4XU3 A;  1H64 1;  1QP3 A;  4ELY C;  2KSS A;  2ZGW A;  4JDS A;  4N0A A;  1QW1 A;  3CD6 A;  1KQ1 A;  3PMT A;  4XAX B;  3OBW A;  3OW2 A;  3JB9 I;  1N8R U;  1VQL A;  4M7A C;  2HQX A;  3G7Z A;  1XQH A;  4EMG A;  1B34 B;  5FRO A;  4IKF A;  3V8K A;  2DTH A;  1VQO A;  2P4T A;  1YCY A;  2JTM A;  2FL7 A;  1QVP A;  2C06 A;  5C6S A;  1N9R A;  2IVW A;  2X4W A;  4PKC C;  1R8O B;  4XTZ A;  3CBP A;  4RG8 A;  2DIG A;  1K9M C;  2L8D A;  4JRI A;  1OYX A;  2A3L A;  1X01 A;  2CYZ B;  4PJO B;  5GAM g;  4C92 B;  1VQ9 T;  3MP8 A;  1Y07 A;  4OGC A;  3CCQ T;  2RJD A;  2LVM A;  2CS7 A;  1G3T A;  3OSV A;  2PU9 B;  4OMF B;  3RMQ A;  4A54 A;  1K9M U;  3BW1 A;  4M78 D;  5D6W A;  1K73 C;  4M7D B;  1KG1 A;  4IUV A;  3G4S A;  3QUI A;  2E5Q A;  2GQV A;  5D6X A;  1VIF A;  2HD0 A;  4M78 E;  3G71 T;  1K73 U;  4C8Q B;  2DVE A;  3M55 A;  3BFM A;  5GAN 5;  5GAN j;  3X25 B;  4CI0 C;  2QEX T;  5LJ5 g;  2ZZD A;  3CBO A;  3OMG A;  3OYK A;  3ME9 A;  4KUI A;  3RER A;  3MCA B;  2HNI A;  3PFS A;  4FM4 B;  5GAO m;  4LD9 K;  3SFM A;  3HSB A;  5DLQ E;  2DEQ A;  2PQW A;  1U1T A;  2D9T A;  3G6E T;  2E6N A;  1W4S A;  2FB7 A;  3L1A A;  4M75 D;  2K3X A;  2EJ9 A;  2RI5 A;  2LT1 A;  3UT1 A;  2PVO B;  2O4X B;  1FX7 A;  3LH0 A;  2ZPE B;  4M75 E;  1YI2 A;  4RMO A;  5A0L A;  1FWZ A;  3JB9 D;  1KC8 U;  1YBY A;  2MWP A;  1W2B A;  1VQK A;  1JJ2 S;  2KY9 A;  4A4G A;  3QKJ A;  4J7I A;  4ME7 A;  4XU0 A;  2K2V A;  2AHJ B;  1G3W A;  2JVV A;  3MEU A;  4HA8 A;  4M77 F;  2LQK A;  1WQ7 A;  2RK1 A;  2DO3 A;  2WSE E;  2JN0 A;  2LC4 A;  4OB3 B;  5GAM e;  2WSC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...