2GG2A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg2A00
1R58A 1YW9A 2EA2A 3BIPA 5D6FA 2GA2A 2GG9A 1CHMA 3TAVA 1XGSA 5CDVA 2Q8KA 2BWVA 5CDEA 2B3LA 2GG0A 2ADUA 5FCHA 1XGOA 4FLLA 4HXXA 2IW2A 1PV9A 1BOAA 2B3HA 4IKTA 2Q96A 1N51A 2EVCA 1C24A 4IF7A 1R5HA 2BN7A 2MATA 2GGCA 3MATA 4B28A 1B6AA 2EVMA 1KP0A 3S6BA 4IDYA 5JHUA 1A16A 1QZYA 4U6CA 3FMRA 3D27A 3RORA 1WKMA 4U70A 2BWWA 2ZSGA 2Q93A 3FMQA 4OOKA 4U69A 2OKNA 4IPAA 1JAWA 4FUKA 2V6CA 2GZ5A 2V3XA 4RGZ1 2BB7A 2Q95A 2BH3A 4ZWOA 3BIQA 1C21A 4IKRA 2G6PA 2GGBA 4S01A 4EGEA 1XGNA 3PKBA 5FCFA 2BWUA 5CE6A 3IU8A 3BITA 5CLSA 3MX6A 3PKAA 3CB5A 2P9AA 3L7GA 4U76A 2BHCA 4FO8A 3L24A 5CNXA 4Z7MA 5D6EA 4R60A 2Q94A 1QXWA 1WL6A 1WN1A 2BWYA 1WBQA 1B59A 4MATA 4FLKA 1MATA 2EVOA 3PKDA 2BWTA 3IG4A 4IU6A 4ZWUA 3TB5A 1R5GA 4RZZA 4IKSA 2EA4A 2GU5A 4IECA 1BN5A 4PNCA 5JFRA 1XNZA 2GU6A 2NQ6A 1YW7A 2GG7A 2GTXA 2P99A 4U6EA 3CTZA 4U75A 4U1BA 4U6WA 5E5BA 4U73A 4RZYA 2BWXA 4JUQA 1YJ3A 1WY2A 5CIKA 4S00A 1C27A 1O0XA 1WL9A 2V3ZA 3IU9A 4KM3A 4U71A 1C22A 1QXZA 2Q92A 1Y1NA 2V3YA 3FM3A 5JI6A 2GG2A 1W2MA 4A6VA 2GG5A 1XGMA 3MR1A 4A6WA 5CDLA 4FLJA 2DFIA 2GU4A 1KQ0A 3Q6DA 4PV4A 4U6ZA 1KQ9A 1QXYA 4S2RP 4S2TP 1WLRA 2P98A 2NQ7A 1C23A 2GU7A 2HOWA 1YVMA 2BWSA 2OAZA 2BHAA 3CB6A 4FKCA 3RVAA 4FLIA 4IKUA 4U6JA 3PKCA 4ZWPA 1W7VA 2BHBA 2GG8A 3IU7A 4QR8A 2B3KA 1YW8A 3PKEA 4ZNGA 2GG3A 4FO7A 1M35A 2BHDA
chains in the Genus database with same CATH superfamily
1R58A 1YW9A 2EA2A 3BIPA 5D6FA 2GA2A 2GG9A 1CHMA 3TAVA 1XGSA 5CDVA 2Q8KA 2BWVA 5CDEA 2B3LA 2GG0A 2ADUA 5FCHA 1XGOA 4FLLA 4HXXA 2IW2A 1PV9A 1BOAA 2B3HA 4IKTA 2Q96A 1N51A 2EVCA 1C24A 4IF7A 1R5HA 2BN7A 2MATA 2GGCA 3MATA 4B28A 1B6AA 2EVMA 1KP0A 3S6BA 4IDYA 5JHUA 1A16A 1QZYA 4U6CA 3FMRA 3D27A 3RORA 1WKMA 4U70A 2BWWA 2ZSGA 2Q93A 3FMQA 4OOKA 4U69A 2OKNA 4IPAA 1JAWA 4FUKA 2V6CA 2GZ5A 2V3XA 4RGZ1 2BB7A 2Q95A 2BH3A 4ZWOA 3BIQA 1C21A 4IKRA 2G6PA 2GGBA 4S01A 4EGEA 1XGNA 3PKBA 5FCFA 2BWUA 5CE6A 3IU8A 3BITA 5CLSA 3MX6A 3PKAA 3CB5A 2P9AA 3L7GA 4U76A 2BHCA 4FO8A 3L24A 5CNXA 4Z7MA 5D6EA 4R60A 2Q94A 1QXWA 1WL6A 1WN1A 2BWYA 1WBQA 1B59A 4MATA 4FLKA 1MATA 2EVOA 3PKDA 2BWTA 3IG4A 4IU6A 4ZWUA 3TB5A 1R5GA 4RZZA 4IKSA 2EA4A 2GU5A 4IECA 1BN5A 4PNCA 5JFRA 1XNZA 2GU6A 2NQ6A 1YW7A 2GG7A 2GTXA 2P99A 4U6EA 3CTZA 4U75A 4U1BA 4U6WA 5E5BA 4U73A 4RZYA 2BWXA 4JUQA 1YJ3A 1WY2A 5CIKA 4S00A 1C27A 1O0XA 1WL9A 2V3ZA 3IU9A 4KM3A 4U71A 1C22A 1QXZA 2Q92A 1Y1NA 2V3YA 3FM3A 5JI6A 2GG2A 1W2MA 4A6VA 2GG5A 1XGMA 3MR1A 4A6WA 5CDLA 4FLJA 2DFIA 2GU4A 1KQ0A 3Q6DA 4PV4A 4U6ZA 1KQ9A 1QXYA 4S2RP 4S2TP 1WLRA 2P98A 2NQ7A 1C23A 2GU7A 2HOWA 1YVMA 2BWSA 2OAZA 2BHAA 3CB6A 4FKCA 3RVAA 4FLIA 4IKUA 4U6JA 3PKCA 4ZWPA 1W7VA 2BHBA 2GG8A 3IU7A 4QR8A 2B3KA 1YW8A 3PKEA 4ZNGA 2GG3A 4FO7A 1M35A 2BHDA
chains in the Genus database with same CATH topology
1R58A 1YW9A 2EA2A 3BIPA 5D6FA 2GA2A 2GG9A 1CHMA 3TAVA 1XGSA 5CDVA 2Q8KA 2BWVA 5CDEA 2B3LA 2GG0A 2ADUA 5FCHA 1XGOA 4FLLA 4HXXA 2IW2A 1PV9A 1BOAA 2B3HA 4IKTA 2Q96A 1N51A 2EVCA 1C24A 4IF7A 1R5HA 2BN7A 2MATA 2GGCA 3MATA 4B28A 1B6AA 2EVMA 1KP0A 3S6BA 4IDYA 5JHUA 1A16A 1QZYA 4U6CA 3FMRA 3D27A 3RORA 1WKMA 4U70A 2BWWA 2ZSGA 2Q93A 3FMQA 4OOKA 4U69A 2OKNA 4IPAA 1JAWA 4FUKA 2V6CA 2GZ5A 2V3XA 4RGZ1 2BB7A 2Q95A 2BH3A 4ZWOA 3BIQA 1C21A 4IKRA 2G6PA 2GGBA 4S01A 4EGEA 1XGNA 3PKBA 5FCFA 2BWUA 5CE6A 3IU8A 3BITA 5CLSA 3MX6A 3PKAA 3CB5A 2P9AA 3L7GA 4U76A 2BHCA 4FO8A 3L24A 5CNXA 4Z7MA 5D6EA 4R60A 2Q94A 1QXWA 1WL6A 1WN1A 2BWYA 1WBQA 1B59A 4MATA 4FLKA 1MATA 2EVOA 3PKDA 2BWTA 3IG4A 4IU6A 4ZWUA 3TB5A 1R5GA 4RZZA 4IKSA 2EA4A 2GU5A 4IECA 1BN5A 4PNCA 5JFRA 1XNZA 2GU6A 2NQ6A 1YW7A 2GG7A 2GTXA 2P99A 4U6EA 3CTZA 4U75A 4U1BA 4U6WA 5E5BA 4U73A 4RZYA 2BWXA 4JUQA 1YJ3A 1WY2A 5CIKA 4S00A 1C27A 1O0XA 1WL9A 2V3ZA 3IU9A 4KM3A 4U71A 1C22A 1QXZA 2Q92A 1Y1NA 2V3YA 3FM3A 5JI6A 2GG2A 1W2MA 4A6VA 2GG5A 1XGMA 3MR1A 4A6WA 5CDLA 4FLJA 2DFIA 2GU4A 1KQ0A 3Q6DA 4PV4A 4U6ZA 1KQ9A 1QXYA 4S2RP 4S2TP 1WLRA 2P98A 2NQ7A 1C23A 2GU7A 2HOWA 1YVMA 2BWSA 2OAZA 2BHAA 3CB6A 4FKCA 3RVAA 4FLIA 4IKUA 4U6JA 3PKCA 4ZWPA 1W7VA 2BHBA 2GG8A 3IU7A 4QR8A 2B3KA 1YW8A 3PKEA 4ZNGA 2GG3A 4FO7A 1M35A 2BHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R58 A;  1YW9 A;  2EA2 A;  3BIP A;  5D6F A;  2GA2 A;  2GG9 A;  1CHM A;  3TAV A;  1XGS A;  5CDV A;  2Q8K A;  2BWV A;  5CDE A;  2B3L A;  2GG0 A;  2ADU A;  5FCH A;  1XGO A;  4FLL A;  4HXX A;  2IW2 A;  1PV9 A;  1BOA A;  2B3H A;  4IKT A;  2Q96 A;  1N51 A;  2EVC A;  1C24 A;  4IF7 A;  1R5H A;  2BN7 A;  2MAT A;  2GGC A;  3MAT A;  4B28 A;  1B6A A;  2EVM A;  1KP0 A;  3S6B A;  4IDY A;  5JHU A;  1A16 A;  1QZY A;  4U6C A;  3FMR A;  3D27 A;  3ROR A;  1WKM A;  4U70 A;  2BWW A;  2ZSG A;  2Q93 A;  3FMQ A;  4OOK A;  4U69 A;  2OKN A;  4IPA A;  1JAW A;  4FUK A;  2V6C A;  2GZ5 A;  2V3X A;  4RGZ 1;  2BB7 A;  2Q95 A;  2BH3 A;  4ZWO A;  3BIQ A;  1C21 A;  4IKR A;  2G6P A;  2GGB A;  4S01 A;  4EGE A;  1XGN A;  3PKB A;  5FCF A;  2BWU A;  5CE6 A;  3IU8 A;  3BIT A;  5CLS A;  3MX6 A;  3PKA A;  3CB5 A;  2P9A A;  3L7G A;  4U76 A;  2BHC A;  4FO8 A;  3L24 A;  5CNX A;  4Z7M A;  5D6E A;  4R60 A;  2Q94 A;  1QXW A;  1WL6 A;  1WN1 A;  2BWY A;  1WBQ A;  1B59 A;  4MAT A;  4FLK A;  1MAT A;  2EVO A;  3PKD A;  2BWT A;  3IG4 A;  4IU6 A;  4ZWU A;  3TB5 A;  1R5G A;  4RZZ A;  4IKS A;  2EA4 A;  2GU5 A;  4IEC A;  1BN5 A;  4PNC A;  5JFR A;  1XNZ A;  2GU6 A;  2NQ6 A;  1YW7 A;  2GG7 A;  2GTX A;  2P99 A;  4U6E A;  3CTZ A;  4U75 A;  4U1B A;  4U6W A;  5E5B A;  4U73 A;  4RZY A;  2BWX A;  4JUQ A;  1YJ3 A;  1WY2 A;  5CIK A;  4S00 A;  1C27 A;  1O0X A;  1WL9 A;  2V3Z A;  3IU9 A;  4KM3 A;  4U71 A;  1C22 A;  1QXZ A;  2Q92 A;  1Y1N A;  2V3Y A;  3FM3 A;  5JI6 A;  2GG2 A;  1W2M A;  4A6V A;  2GG5 A;  1XGM A;  3MR1 A;  4A6W A;  5CDL A;  4FLJ A;  2DFI A;  2GU4 A;  1KQ0 A;  3Q6D A;  4PV4 A;  4U6Z A;  1KQ9 A;  1QXY A;  4S2R P;  4S2T P;  1WLR A;  2P98 A;  2NQ7 A;  1C23 A;  2GU7 A;  2HOW A;  1YVM A;  2BWS A;  2OAZ A;  2BHA A;  3CB6 A;  4FKC A;  3RVA A;  4FLI A;  4IKU A;  4U6J A;  3PKC A;  4ZWP A;  1W7V A;  2BHB A;  2GG8 A;  3IU7 A;  4QR8 A;  2B3K A;  1YW8 A;  3PKE A;  4ZNG A;  2GG3 A;  4FO7 A;  1M35 A;  2BHD A; 
#chains in the Genus database with same CATH topology
 1R58 A;  1YW9 A;  2EA2 A;  3BIP A;  5D6F A;  2GA2 A;  2GG9 A;  1CHM A;  3TAV A;  1XGS A;  5CDV A;  2Q8K A;  2BWV A;  5CDE A;  2B3L A;  2GG0 A;  2ADU A;  5FCH A;  1XGO A;  4FLL A;  4HXX A;  2IW2 A;  1PV9 A;  1BOA A;  2B3H A;  4IKT A;  2Q96 A;  1N51 A;  2EVC A;  1C24 A;  4IF7 A;  1R5H A;  2BN7 A;  2MAT A;  2GGC A;  3MAT A;  4B28 A;  1B6A A;  2EVM A;  1KP0 A;  3S6B A;  4IDY A;  5JHU A;  1A16 A;  1QZY A;  4U6C A;  3FMR A;  3D27 A;  3ROR A;  1WKM A;  4U70 A;  2BWW A;  2ZSG A;  2Q93 A;  3FMQ A;  4OOK A;  4U69 A;  2OKN A;  4IPA A;  1JAW A;  4FUK A;  2V6C A;  2GZ5 A;  2V3X A;  4RGZ 1;  2BB7 A;  2Q95 A;  2BH3 A;  4ZWO A;  3BIQ A;  1C21 A;  4IKR A;  2G6P A;  2GGB A;  4S01 A;  4EGE A;  1XGN A;  3PKB A;  5FCF A;  2BWU A;  5CE6 A;  3IU8 A;  3BIT A;  5CLS A;  3MX6 A;  3PKA A;  3CB5 A;  2P9A A;  3L7G A;  4U76 A;  2BHC A;  4FO8 A;  3L24 A;  5CNX A;  4Z7M A;  5D6E A;  4R60 A;  2Q94 A;  1QXW A;  1WL6 A;  1WN1 A;  2BWY A;  1WBQ A;  1B59 A;  4MAT A;  4FLK A;  1MAT A;  2EVO A;  3PKD A;  2BWT A;  3IG4 A;  4IU6 A;  4ZWU A;  3TB5 A;  1R5G A;  4RZZ A;  4IKS A;  2EA4 A;  2GU5 A;  4IEC A;  1BN5 A;  4PNC A;  5JFR A;  1XNZ A;  2GU6 A;  2NQ6 A;  1YW7 A;  2GG7 A;  2GTX A;  2P99 A;  4U6E A;  3CTZ A;  4U75 A;  4U1B A;  4U6W A;  5E5B A;  4U73 A;  4RZY A;  2BWX A;  4JUQ A;  1YJ3 A;  1WY2 A;  5CIK A;  4S00 A;  1C27 A;  1O0X A;  1WL9 A;  2V3Z A;  3IU9 A;  4KM3 A;  4U71 A;  1C22 A;  1QXZ A;  2Q92 A;  1Y1N A;  2V3Y A;  3FM3 A;  5JI6 A;  2GG2 A;  1W2M A;  4A6V A;  2GG5 A;  1XGM A;  3MR1 A;  4A6W A;  5CDL A;  4FLJ A;  2DFI A;  2GU4 A;  1KQ0 A;  3Q6D A;  4PV4 A;  4U6Z A;  1KQ9 A;  1QXY A;  4S2R P;  4S2T P;  1WLR A;  2P98 A;  2NQ7 A;  1C23 A;  2GU7 A;  2HOW A;  1YVM A;  2BWS A;  2OAZ A;  2BHA A;  3CB6 A;  4FKC A;  3RVA A;  4FLI A;  4IKU A;  4U6J A;  3PKC A;  4ZWP A;  1W7V A;  2BHB A;  2GG8 A;  3IU7 A;  4QR8 A;  2B3K A;  1YW8 A;  3PKE A;  4ZNG A;  2GG3 A;  4FO7 A;  1M35 A;  2BHD A; 
#chains in the Genus database with same CATH homology
 1R58 A;  1YW9 A;  2EA2 A;  3BIP A;  5D6F A;  2GA2 A;  2GG9 A;  1CHM A;  3TAV A;  1XGS A;  5CDV A;  2Q8K A;  2BWV A;  5CDE A;  2B3L A;  2GG0 A;  2ADU A;  5FCH A;  1XGO A;  4FLL A;  4HXX A;  2IW2 A;  1PV9 A;  1BOA A;  2B3H A;  4IKT A;  2Q96 A;  1N51 A;  2EVC A;  1C24 A;  4IF7 A;  1R5H A;  2BN7 A;  2MAT A;  2GGC A;  3MAT A;  4B28 A;  1B6A A;  2EVM A;  1KP0 A;  3S6B A;  4IDY A;  5JHU A;  1A16 A;  1QZY A;  4U6C A;  3FMR A;  3D27 A;  3ROR A;  1WKM A;  4U70 A;  2BWW A;  2ZSG A;  2Q93 A;  3FMQ A;  4OOK A;  4U69 A;  2OKN A;  4IPA A;  1JAW A;  4FUK A;  2V6C A;  2GZ5 A;  2V3X A;  4RGZ 1;  2BB7 A;  2Q95 A;  2BH3 A;  4ZWO A;  3BIQ A;  1C21 A;  4IKR A;  2G6P A;  2GGB A;  4S01 A;  4EGE A;  1XGN A;  3PKB A;  5FCF A;  2BWU A;  5CE6 A;  3IU8 A;  3BIT A;  5CLS A;  3MX6 A;  3PKA A;  3CB5 A;  2P9A A;  3L7G A;  4U76 A;  2BHC A;  4FO8 A;  3L24 A;  5CNX A;  4Z7M A;  5D6E A;  4R60 A;  2Q94 A;  1QXW A;  1WL6 A;  1WN1 A;  2BWY A;  1WBQ A;  1B59 A;  4MAT A;  4FLK A;  1MAT A;  2EVO A;  3PKD A;  2BWT A;  3IG4 A;  4IU6 A;  4ZWU A;  3TB5 A;  1R5G A;  4RZZ A;  4IKS A;  2EA4 A;  2GU5 A;  4IEC A;  1BN5 A;  4PNC A;  5JFR A;  1XNZ A;  2GU6 A;  2NQ6 A;  1YW7 A;  2GG7 A;  2GTX A;  2P99 A;  4U6E A;  3CTZ A;  4U75 A;  4U1B A;  4U6W A;  5E5B A;  4U73 A;  4RZY A;  2BWX A;  4JUQ A;  1YJ3 A;  1WY2 A;  5CIK A;  4S00 A;  1C27 A;  1O0X A;  1WL9 A;  2V3Z A;  3IU9 A;  4KM3 A;  4U71 A;  1C22 A;  1QXZ A;  2Q92 A;  1Y1N A;  2V3Y A;  3FM3 A;  5JI6 A;  2GG2 A;  1W2M A;  4A6V A;  2GG5 A;  1XGM A;  3MR1 A;  4A6W A;  5CDL A;  4FLJ A;  2DFI A;  2GU4 A;  1KQ0 A;  3Q6D A;  4PV4 A;  4U6Z A;  1KQ9 A;  1QXY A;  4S2R P;  4S2T P;  1WLR A;  2P98 A;  2NQ7 A;  1C23 A;  2GU7 A;  2HOW A;  1YVM A;  2BWS A;  2OAZ A;  2BHA A;  3CB6 A;  4FKC A;  3RVA A;  4FLI A;  4IKU A;  4U6J A;  3PKC A;  4ZWP A;  1W7V A;  2BHB A;  2GG8 A;  3IU7 A;  4QR8 A;  2B3K A;  1YW8 A;  3PKE A;  4ZNG A;  2GG3 A;  4FO7 A;  1M35 A;  2BHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...