2GG2A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg2A00
1XGOA 4HXXA 4IECA 2EVMA 1PV9A 4S2TP 3L7GA 4R60A 2BHDA 4IKSA 2IW2A 1YW7A 3S6BA 2GU7A 3FMRA 1QXWA 2GG5A 2MATA 5CDVA 1YW8A 1C27A 1YJ3A 5D6EA 3IU9A 2V6CA 4IU6A 2EA4A 1R58A 1KP0A 2OKNA 5CDLA 2Q96A 2EA2A 4FUKA 4U1BA 5JI6A 4FLJA 4IDYA 2GU4A 2G6PA 4U73A 2V3XA 1C21A 1XGMA 2EVCA 3PKDA 4KM3A 2BWXA 2BB7A 1YW9A 3PKEA 3BIPA 4ZWOA 1YVMA 4IF7A 2B3LA 3PKBA 3PKCA 3FMQA 1R5HA 2GTXA 3IU8A 1M35A 2GU5A 4ZWPA 2GGBA 2BHBA 1JAWA 2BWVA 5CNXA 1XGNA 2ADUA 2GG9A 1WLRA 3BIQA 3FM3A 2NQ6A 2Q93A 4FLIA 4QR8A 4S01A 4U6WA 3TAVA 2P98A 3IG4A 2EVOA 4JUQA 2Q92A 1XGSA 4U70A 3PKAA 2P9AA 3CTZA 4RZYA 1KQ9A 1N51A 1W2MA 2GA2A 1WL6A 4IKTA 3TB5A 3MX6A 4A6WA 4PV4A 3MATA 4RGZ1 4IPAA 4Z7MA 5CE6A 2V3ZA 1KQ0A 2OAZA 3Q6DA 1A16A 2GG2A 3CB5A 4MATA 4B28A 2V3YA 1WBQA 4EGEA 4IKUA 2BHAA 2DFIA 4U6EA 1QXZA 2B3HA 2BWTA 4FLLA 2BH3A 2HOWA 5JHUA 1CHMA 4FLKA 4ZWUA 5CLSA 2GU6A 1BOAA 3D27A 2BWWA 2B3KA 2NQ7A 1QXYA 1O0XA 1C24A 4FO8A 2BWSA 1W7VA 2GZ5A 4U75A 1WY2A 2BHCA 1B6AA 4U6CA 4U71A 4RZZA 1WL9A 3MR1A 4U69A 4PNCA 1WKMA 2GG0A 4S00A 1C23A 5JFRA 1BN5A 5D6FA 3IU7A 4IKRA 1R5GA 5FCHA 3CB6A 4ZNGA 2GG8A 2BN7A 4U76A 5CIKA 2Q8KA 2P99A 2ZSGA 3RORA 2GGCA 3L24A 1B59A 3BITA 2GG7A 1QZYA 1Y1NA 2BWYA 2GG3A 5FCFA 4A6VA 2Q94A 5E5BA 2Q95A 3RVAA 1MATA 4U6JA 5CDEA 1WN1A 2BWUA 4U6ZA 1XNZA 1C22A 4FO7A 4FKCA 4S2RP 4OOKA
chains in the Genus database with same CATH superfamily
1XGOA 4HXXA 4IECA 2EVMA 1PV9A 4S2TP 3L7GA 4R60A 2BHDA 4IKSA 2IW2A 1YW7A 3S6BA 2GU7A 3FMRA 1QXWA 2GG5A 2MATA 5CDVA 1YW8A 1C27A 1YJ3A 5D6EA 3IU9A 2V6CA 4IU6A 2EA4A 1R58A 1KP0A 2OKNA 5CDLA 2Q96A 2EA2A 4FUKA 4U1BA 5JI6A 4FLJA 4IDYA 2GU4A 2G6PA 4U73A 2V3XA 1C21A 1XGMA 2EVCA 3PKDA 4KM3A 2BWXA 2BB7A 1YW9A 3PKEA 3BIPA 4ZWOA 1YVMA 4IF7A 2B3LA 3PKBA 3PKCA 3FMQA 1R5HA 2GTXA 3IU8A 1M35A 2GU5A 4ZWPA 2GGBA 2BHBA 1JAWA 2BWVA 5CNXA 1XGNA 2ADUA 2GG9A 1WLRA 3BIQA 3FM3A 2NQ6A 2Q93A 4FLIA 4QR8A 4S01A 4U6WA 3TAVA 2P98A 3IG4A 2EVOA 4JUQA 2Q92A 1XGSA 4U70A 3PKAA 2P9AA 3CTZA 4RZYA 1KQ9A 1N51A 1W2MA 2GA2A 1WL6A 4IKTA 3TB5A 3MX6A 4A6WA 4PV4A 3MATA 4RGZ1 4IPAA 4Z7MA 5CE6A 2V3ZA 1KQ0A 2OAZA 3Q6DA 1A16A 2GG2A 3CB5A 4MATA 4B28A 2V3YA 1WBQA 4EGEA 4IKUA 2BHAA 2DFIA 4U6EA 1QXZA 2B3HA 2BWTA 4FLLA 2BH3A 2HOWA 5JHUA 1CHMA 4FLKA 4ZWUA 5CLSA 2GU6A 1BOAA 3D27A 2BWWA 2B3KA 2NQ7A 1QXYA 1O0XA 1C24A 4FO8A 2BWSA 1W7VA 2GZ5A 4U75A 1WY2A 2BHCA 1B6AA 4U6CA 4U71A 4RZZA 1WL9A 3MR1A 4U69A 4PNCA 1WKMA 2GG0A 4S00A 1C23A 5JFRA 1BN5A 5D6FA 3IU7A 4IKRA 1R5GA 5FCHA 3CB6A 4ZNGA 2GG8A 2BN7A 4U76A 5CIKA 2Q8KA 2P99A 2ZSGA 3RORA 2GGCA 3L24A 1B59A 3BITA 2GG7A 1QZYA 1Y1NA 2BWYA 2GG3A 5FCFA 4A6VA 2Q94A 5E5BA 2Q95A 3RVAA 1MATA 4U6JA 5CDEA 1WN1A 2BWUA 4U6ZA 1XNZA 1C22A 4FO7A 4FKCA 4S2RP 4OOKA
chains in the Genus database with same CATH topology
1XGOA 4HXXA 4IECA 2EVMA 1PV9A 4S2TP 3L7GA 4R60A 2BHDA 4IKSA 2IW2A 1YW7A 3S6BA 2GU7A 3FMRA 1QXWA 2GG5A 2MATA 5CDVA 1YW8A 1C27A 1YJ3A 5D6EA 3IU9A 2V6CA 4IU6A 2EA4A 1R58A 1KP0A 2OKNA 5CDLA 2Q96A 2EA2A 4FUKA 4U1BA 5JI6A 4FLJA 4IDYA 2GU4A 2G6PA 4U73A 2V3XA 1C21A 1XGMA 2EVCA 3PKDA 4KM3A 2BWXA 2BB7A 1YW9A 3PKEA 3BIPA 4ZWOA 1YVMA 4IF7A 2B3LA 3PKBA 3PKCA 3FMQA 1R5HA 2GTXA 3IU8A 1M35A 2GU5A 4ZWPA 2GGBA 2BHBA 1JAWA 2BWVA 5CNXA 1XGNA 2ADUA 2GG9A 1WLRA 3BIQA 3FM3A 2NQ6A 2Q93A 4FLIA 4QR8A 4S01A 4U6WA 3TAVA 2P98A 3IG4A 2EVOA 4JUQA 2Q92A 1XGSA 4U70A 3PKAA 2P9AA 3CTZA 4RZYA 1KQ9A 1N51A 1W2MA 2GA2A 1WL6A 4IKTA 3TB5A 3MX6A 4A6WA 4PV4A 3MATA 4RGZ1 4IPAA 4Z7MA 5CE6A 2V3ZA 1KQ0A 2OAZA 3Q6DA 1A16A 2GG2A 3CB5A 4MATA 4B28A 2V3YA 1WBQA 4EGEA 4IKUA 2BHAA 2DFIA 4U6EA 1QXZA 2B3HA 2BWTA 4FLLA 2BH3A 2HOWA 5JHUA 1CHMA 4FLKA 4ZWUA 5CLSA 2GU6A 1BOAA 3D27A 2BWWA 2B3KA 2NQ7A 1QXYA 1O0XA 1C24A 4FO8A 2BWSA 1W7VA 2GZ5A 4U75A 1WY2A 2BHCA 1B6AA 4U6CA 4U71A 4RZZA 1WL9A 3MR1A 4U69A 4PNCA 1WKMA 2GG0A 4S00A 1C23A 5JFRA 1BN5A 5D6FA 3IU7A 4IKRA 1R5GA 5FCHA 3CB6A 4ZNGA 2GG8A 2BN7A 4U76A 5CIKA 2Q8KA 2P99A 2ZSGA 3RORA 2GGCA 3L24A 1B59A 3BITA 2GG7A 1QZYA 1Y1NA 2BWYA 2GG3A 5FCFA 4A6VA 2Q94A 5E5BA 2Q95A 3RVAA 1MATA 4U6JA 5CDEA 1WN1A 2BWUA 4U6ZA 1XNZA 1C22A 4FO7A 4FKCA 4S2RP 4OOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGO A;  4HXX A;  4IEC A;  2EVM A;  1PV9 A;  4S2T P;  3L7G A;  4R60 A;  2BHD A;  4IKS A;  2IW2 A;  1YW7 A;  3S6B A;  2GU7 A;  3FMR A;  1QXW A;  2GG5 A;  2MAT A;  5CDV A;  1YW8 A;  1C27 A;  1YJ3 A;  5D6E A;  3IU9 A;  2V6C A;  4IU6 A;  2EA4 A;  1R58 A;  1KP0 A;  2OKN A;  5CDL A;  2Q96 A;  2EA2 A;  4FUK A;  4U1B A;  5JI6 A;  4FLJ A;  4IDY A;  2GU4 A;  2G6P A;  4U73 A;  2V3X A;  1C21 A;  1XGM A;  2EVC A;  3PKD A;  4KM3 A;  2BWX A;  2BB7 A;  1YW9 A;  3PKE A;  3BIP A;  4ZWO A;  1YVM A;  4IF7 A;  2B3L A;  3PKB A;  3PKC A;  3FMQ A;  1R5H A;  2GTX A;  3IU8 A;  1M35 A;  2GU5 A;  4ZWP A;  2GGB A;  2BHB A;  1JAW A;  2BWV A;  5CNX A;  1XGN A;  2ADU A;  2GG9 A;  1WLR A;  3BIQ A;  3FM3 A;  2NQ6 A;  2Q93 A;  4FLI A;  4QR8 A;  4S01 A;  4U6W A;  3TAV A;  2P98 A;  3IG4 A;  2EVO A;  4JUQ A;  2Q92 A;  1XGS A;  4U70 A;  3PKA A;  2P9A A;  3CTZ A;  4RZY A;  1KQ9 A;  1N51 A;  1W2M A;  2GA2 A;  1WL6 A;  4IKT A;  3TB5 A;  3MX6 A;  4A6W A;  4PV4 A;  3MAT A;  4RGZ 1;  4IPA A;  4Z7M A;  5CE6 A;  2V3Z A;  1KQ0 A;  2OAZ A;  3Q6D A;  1A16 A;  2GG2 A;  3CB5 A;  4MAT A;  4B28 A;  2V3Y A;  1WBQ A;  4EGE A;  4IKU A;  2BHA A;  2DFI A;  4U6E A;  1QXZ A;  2B3H A;  2BWT A;  4FLL A;  2BH3 A;  2HOW A;  5JHU A;  1CHM A;  4FLK A;  4ZWU A;  5CLS A;  2GU6 A;  1BOA A;  3D27 A;  2BWW A;  2B3K A;  2NQ7 A;  1QXY A;  1O0X A;  1C24 A;  4FO8 A;  2BWS A;  1W7V A;  2GZ5 A;  4U75 A;  1WY2 A;  2BHC A;  1B6A A;  4U6C A;  4U71 A;  4RZZ A;  1WL9 A;  3MR1 A;  4U69 A;  4PNC A;  1WKM A;  2GG0 A;  4S00 A;  1C23 A;  5JFR A;  1BN5 A;  5D6F A;  3IU7 A;  4IKR A;  1R5G A;  5FCH A;  3CB6 A;  4ZNG A;  2GG8 A;  2BN7 A;  4U76 A;  5CIK A;  2Q8K A;  2P99 A;  2ZSG A;  3ROR A;  2GGC A;  3L24 A;  1B59 A;  3BIT A;  2GG7 A;  1QZY A;  1Y1N A;  2BWY A;  2GG3 A;  5FCF A;  4A6V A;  2Q94 A;  5E5B A;  2Q95 A;  3RVA A;  1MAT A;  4U6J A;  5CDE A;  1WN1 A;  2BWU A;  4U6Z A;  1XNZ A;  1C22 A;  4FO7 A;  4FKC A;  4S2R P;  4OOK A; 
#chains in the Genus database with same CATH topology
 1XGO A;  4HXX A;  4IEC A;  2EVM A;  1PV9 A;  4S2T P;  3L7G A;  4R60 A;  2BHD A;  4IKS A;  2IW2 A;  1YW7 A;  3S6B A;  2GU7 A;  3FMR A;  1QXW A;  2GG5 A;  2MAT A;  5CDV A;  1YW8 A;  1C27 A;  1YJ3 A;  5D6E A;  3IU9 A;  2V6C A;  4IU6 A;  2EA4 A;  1R58 A;  1KP0 A;  2OKN A;  5CDL A;  2Q96 A;  2EA2 A;  4FUK A;  4U1B A;  5JI6 A;  4FLJ A;  4IDY A;  2GU4 A;  2G6P A;  4U73 A;  2V3X A;  1C21 A;  1XGM A;  2EVC A;  3PKD A;  4KM3 A;  2BWX A;  2BB7 A;  1YW9 A;  3PKE A;  3BIP A;  4ZWO A;  1YVM A;  4IF7 A;  2B3L A;  3PKB A;  3PKC A;  3FMQ A;  1R5H A;  2GTX A;  3IU8 A;  1M35 A;  2GU5 A;  4ZWP A;  2GGB A;  2BHB A;  1JAW A;  2BWV A;  5CNX A;  1XGN A;  2ADU A;  2GG9 A;  1WLR A;  3BIQ A;  3FM3 A;  2NQ6 A;  2Q93 A;  4FLI A;  4QR8 A;  4S01 A;  4U6W A;  3TAV A;  2P98 A;  3IG4 A;  2EVO A;  4JUQ A;  2Q92 A;  1XGS A;  4U70 A;  3PKA A;  2P9A A;  3CTZ A;  4RZY A;  1KQ9 A;  1N51 A;  1W2M A;  2GA2 A;  1WL6 A;  4IKT A;  3TB5 A;  3MX6 A;  4A6W A;  4PV4 A;  3MAT A;  4RGZ 1;  4IPA A;  4Z7M A;  5CE6 A;  2V3Z A;  1KQ0 A;  2OAZ A;  3Q6D A;  1A16 A;  2GG2 A;  3CB5 A;  4MAT A;  4B28 A;  2V3Y A;  1WBQ A;  4EGE A;  4IKU A;  2BHA A;  2DFI A;  4U6E A;  1QXZ A;  2B3H A;  2BWT A;  4FLL A;  2BH3 A;  2HOW A;  5JHU A;  1CHM A;  4FLK A;  4ZWU A;  5CLS A;  2GU6 A;  1BOA A;  3D27 A;  2BWW A;  2B3K A;  2NQ7 A;  1QXY A;  1O0X A;  1C24 A;  4FO8 A;  2BWS A;  1W7V A;  2GZ5 A;  4U75 A;  1WY2 A;  2BHC A;  1B6A A;  4U6C A;  4U71 A;  4RZZ A;  1WL9 A;  3MR1 A;  4U69 A;  4PNC A;  1WKM A;  2GG0 A;  4S00 A;  1C23 A;  5JFR A;  1BN5 A;  5D6F A;  3IU7 A;  4IKR A;  1R5G A;  5FCH A;  3CB6 A;  4ZNG A;  2GG8 A;  2BN7 A;  4U76 A;  5CIK A;  2Q8K A;  2P99 A;  2ZSG A;  3ROR A;  2GGC A;  3L24 A;  1B59 A;  3BIT A;  2GG7 A;  1QZY A;  1Y1N A;  2BWY A;  2GG3 A;  5FCF A;  4A6V A;  2Q94 A;  5E5B A;  2Q95 A;  3RVA A;  1MAT A;  4U6J A;  5CDE A;  1WN1 A;  2BWU A;  4U6Z A;  1XNZ A;  1C22 A;  4FO7 A;  4FKC A;  4S2R P;  4OOK A; 
#chains in the Genus database with same CATH homology
 1XGO A;  4HXX A;  4IEC A;  2EVM A;  1PV9 A;  4S2T P;  3L7G A;  4R60 A;  2BHD A;  4IKS A;  2IW2 A;  1YW7 A;  3S6B A;  2GU7 A;  3FMR A;  1QXW A;  2GG5 A;  2MAT A;  5CDV A;  1YW8 A;  1C27 A;  1YJ3 A;  5D6E A;  3IU9 A;  2V6C A;  4IU6 A;  2EA4 A;  1R58 A;  1KP0 A;  2OKN A;  5CDL A;  2Q96 A;  2EA2 A;  4FUK A;  4U1B A;  5JI6 A;  4FLJ A;  4IDY A;  2GU4 A;  2G6P A;  4U73 A;  2V3X A;  1C21 A;  1XGM A;  2EVC A;  3PKD A;  4KM3 A;  2BWX A;  2BB7 A;  1YW9 A;  3PKE A;  3BIP A;  4ZWO A;  1YVM A;  4IF7 A;  2B3L A;  3PKB A;  3PKC A;  3FMQ A;  1R5H A;  2GTX A;  3IU8 A;  1M35 A;  2GU5 A;  4ZWP A;  2GGB A;  2BHB A;  1JAW A;  2BWV A;  5CNX A;  1XGN A;  2ADU A;  2GG9 A;  1WLR A;  3BIQ A;  3FM3 A;  2NQ6 A;  2Q93 A;  4FLI A;  4QR8 A;  4S01 A;  4U6W A;  3TAV A;  2P98 A;  3IG4 A;  2EVO A;  4JUQ A;  2Q92 A;  1XGS A;  4U70 A;  3PKA A;  2P9A A;  3CTZ A;  4RZY A;  1KQ9 A;  1N51 A;  1W2M A;  2GA2 A;  1WL6 A;  4IKT A;  3TB5 A;  3MX6 A;  4A6W A;  4PV4 A;  3MAT A;  4RGZ 1;  4IPA A;  4Z7M A;  5CE6 A;  2V3Z A;  1KQ0 A;  2OAZ A;  3Q6D A;  1A16 A;  2GG2 A;  3CB5 A;  4MAT A;  4B28 A;  2V3Y A;  1WBQ A;  4EGE A;  4IKU A;  2BHA A;  2DFI A;  4U6E A;  1QXZ A;  2B3H A;  2BWT A;  4FLL A;  2BH3 A;  2HOW A;  5JHU A;  1CHM A;  4FLK A;  4ZWU A;  5CLS A;  2GU6 A;  1BOA A;  3D27 A;  2BWW A;  2B3K A;  2NQ7 A;  1QXY A;  1O0X A;  1C24 A;  4FO8 A;  2BWS A;  1W7V A;  2GZ5 A;  4U75 A;  1WY2 A;  2BHC A;  1B6A A;  4U6C A;  4U71 A;  4RZZ A;  1WL9 A;  3MR1 A;  4U69 A;  4PNC A;  1WKM A;  2GG0 A;  4S00 A;  1C23 A;  5JFR A;  1BN5 A;  5D6F A;  3IU7 A;  4IKR A;  1R5G A;  5FCH A;  3CB6 A;  4ZNG A;  2GG8 A;  2BN7 A;  4U76 A;  5CIK A;  2Q8K A;  2P99 A;  2ZSG A;  3ROR A;  2GGC A;  3L24 A;  1B59 A;  3BIT A;  2GG7 A;  1QZY A;  1Y1N A;  2BWY A;  2GG3 A;  5FCF A;  4A6V A;  2Q94 A;  5E5B A;  2Q95 A;  3RVA A;  1MAT A;  4U6J A;  5CDE A;  1WN1 A;  2BWU A;  4U6Z A;  1XNZ A;  1C22 A;  4FO7 A;  4FKC A;  4S2R P;  4OOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...