2GG2A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg2A00
1XNZA 4FO7A 2Q96A 4ZWPA 4ZWUA 1B59A 4IF7A 1R58A 2BH3A 2EVCA 2GG5A 2GG0A 2Q8KA 4FO8A 4ZWOA 2GG2A 2Q93A 4KM3A 2ADUA 4A6VA 3PKAA 4MATA 2GG7A 5CNXA 2BN7A 2P98A 5FCHA 3L24A 2V6CA 4RGZ1 1YW7A 3S6BA 1WL9A 1Y1NA 2GU4A 2B3KA 4IKUA 1C24A 4U6EA 4IKTA 5CDVA 2EVOA 2IW2A 5D6EA 4IDYA 4JUQA 3MR1A 3MX6A 2GG9A 1M35A 5CE6A 1C21A 2BHCA 3CB5A 1YVMA 5JFRA 2EA4A 3IU9A 3BIPA 3IU8A 1KQ0A 4IU6A 2BWVA 3CB6A 4FKCA 5JI6A 4PNCA 2Q94A 1N51A 1R5GA 3FMQA 2BB7A 2V3YA 1CHMA 4U1BA 1W7VA 3Q6DA 5CDEA 4B28A 1KP0A 4FLJA 4IKRA 4U6CA 4EGEA 3TB5A 2ZSGA 2GA2A 4OOKA 4S01A 4S2TP 1WL6A 2BHBA 2B3HA 2MATA 4S00A 2GU6A 4R60A 4FUKA 4PV4A 1C27A 1WLRA 1W2MA 4U73A 2GU5A 4FLKA 2BHAA 2GG3A 1PV9A 2V3ZA 4ZNGA 1QXWA 4U69A 1JAWA 3PKCA 2HOWA 5CIKA 2G6PA 1WKMA 3FM3A 3RORA 4QR8A 2BWWA 1KQ9A 4U6WA 2BHDA 4RZYA 2GZ5A 2BWYA 2NQ7A 1XGSA 1QXZA 4U75A 1WY2A 2GG8A 2P99A 3L7GA 2EA2A 2BWUA 4A6WA 1QXYA 2GTXA 3IG4A 3D27A 4IPAA 4FLIA 1YW8A 2BWXA 4U6ZA 2Q95A 3PKEA 3RVAA 1XGOA 5D6FA 3TAVA 1XGMA 2OAZA 2P9AA 4S2RP 2B3LA 5CDLA 1YJ3A 2GGCA 1BN5A 1XGNA 3FMRA 2DFIA 1MATA 4U71A 4U6JA 2NQ6A 1C23A 3CTZA 1BOAA 2OKNA 2GU7A 5CLSA 2EVMA 1YW9A 4RZZA 1B6AA 4FLLA 5JHUA 4IKSA 2V3XA 1O0XA 3MATA 3IU7A 2BWSA 1QZYA 1R5HA 1WBQA 2Q92A 5FCFA 4IECA 3PKBA 4HXXA 4Z7MA 3BIQA 4U70A 5E5BA 4U76A 3BITA 3PKDA 1A16A 1WN1A 2GGBA 1C22A 2BWTA
chains in the Genus database with same CATH superfamily
1XNZA 4FO7A 2Q96A 4ZWPA 4ZWUA 1B59A 4IF7A 1R58A 2BH3A 2EVCA 2GG5A 2GG0A 2Q8KA 4FO8A 4ZWOA 2GG2A 2Q93A 4KM3A 2ADUA 4A6VA 3PKAA 4MATA 2GG7A 5CNXA 2BN7A 2P98A 5FCHA 3L24A 2V6CA 4RGZ1 1YW7A 3S6BA 1WL9A 1Y1NA 2GU4A 2B3KA 4IKUA 1C24A 4U6EA 4IKTA 5CDVA 2EVOA 2IW2A 5D6EA 4IDYA 4JUQA 3MR1A 3MX6A 2GG9A 1M35A 5CE6A 1C21A 2BHCA 3CB5A 1YVMA 5JFRA 2EA4A 3IU9A 3BIPA 3IU8A 1KQ0A 4IU6A 2BWVA 3CB6A 4FKCA 5JI6A 4PNCA 2Q94A 1N51A 1R5GA 3FMQA 2BB7A 2V3YA 1CHMA 4U1BA 1W7VA 3Q6DA 5CDEA 4B28A 1KP0A 4FLJA 4IKRA 4U6CA 4EGEA 3TB5A 2ZSGA 2GA2A 4OOKA 4S01A 4S2TP 1WL6A 2BHBA 2B3HA 2MATA 4S00A 2GU6A 4R60A 4FUKA 4PV4A 1C27A 1WLRA 1W2MA 4U73A 2GU5A 4FLKA 2BHAA 2GG3A 1PV9A 2V3ZA 4ZNGA 1QXWA 4U69A 1JAWA 3PKCA 2HOWA 5CIKA 2G6PA 1WKMA 3FM3A 3RORA 4QR8A 2BWWA 1KQ9A 4U6WA 2BHDA 4RZYA 2GZ5A 2BWYA 2NQ7A 1XGSA 1QXZA 4U75A 1WY2A 2GG8A 2P99A 3L7GA 2EA2A 2BWUA 4A6WA 1QXYA 2GTXA 3IG4A 3D27A 4IPAA 4FLIA 1YW8A 2BWXA 4U6ZA 2Q95A 3PKEA 3RVAA 1XGOA 5D6FA 3TAVA 1XGMA 2OAZA 2P9AA 4S2RP 2B3LA 5CDLA 1YJ3A 2GGCA 1BN5A 1XGNA 3FMRA 2DFIA 1MATA 4U71A 4U6JA 2NQ6A 1C23A 3CTZA 1BOAA 2OKNA 2GU7A 5CLSA 2EVMA 1YW9A 4RZZA 1B6AA 4FLLA 5JHUA 4IKSA 2V3XA 1O0XA 3MATA 3IU7A 2BWSA 1QZYA 1R5HA 1WBQA 2Q92A 5FCFA 4IECA 3PKBA 4HXXA 4Z7MA 3BIQA 4U70A 5E5BA 4U76A 3BITA 3PKDA 1A16A 1WN1A 2GGBA 1C22A 2BWTA
chains in the Genus database with same CATH topology
1XNZA 4FO7A 2Q96A 4ZWPA 4ZWUA 1B59A 4IF7A 1R58A 2BH3A 2EVCA 2GG5A 2GG0A 2Q8KA 4FO8A 4ZWOA 2GG2A 2Q93A 4KM3A 2ADUA 4A6VA 3PKAA 4MATA 2GG7A 5CNXA 2BN7A 2P98A 5FCHA 3L24A 2V6CA 4RGZ1 1YW7A 3S6BA 1WL9A 1Y1NA 2GU4A 2B3KA 4IKUA 1C24A 4U6EA 4IKTA 5CDVA 2EVOA 2IW2A 5D6EA 4IDYA 4JUQA 3MR1A 3MX6A 2GG9A 1M35A 5CE6A 1C21A 2BHCA 3CB5A 1YVMA 5JFRA 2EA4A 3IU9A 3BIPA 3IU8A 1KQ0A 4IU6A 2BWVA 3CB6A 4FKCA 5JI6A 4PNCA 2Q94A 1N51A 1R5GA 3FMQA 2BB7A 2V3YA 1CHMA 4U1BA 1W7VA 3Q6DA 5CDEA 4B28A 1KP0A 4FLJA 4IKRA 4U6CA 4EGEA 3TB5A 2ZSGA 2GA2A 4OOKA 4S01A 4S2TP 1WL6A 2BHBA 2B3HA 2MATA 4S00A 2GU6A 4R60A 4FUKA 4PV4A 1C27A 1WLRA 1W2MA 4U73A 2GU5A 4FLKA 2BHAA 2GG3A 1PV9A 2V3ZA 4ZNGA 1QXWA 4U69A 1JAWA 3PKCA 2HOWA 5CIKA 2G6PA 1WKMA 3FM3A 3RORA 4QR8A 2BWWA 1KQ9A 4U6WA 2BHDA 4RZYA 2GZ5A 2BWYA 2NQ7A 1XGSA 1QXZA 4U75A 1WY2A 2GG8A 2P99A 3L7GA 2EA2A 2BWUA 4A6WA 1QXYA 2GTXA 3IG4A 3D27A 4IPAA 4FLIA 1YW8A 2BWXA 4U6ZA 2Q95A 3PKEA 3RVAA 1XGOA 5D6FA 3TAVA 1XGMA 2OAZA 2P9AA 4S2RP 2B3LA 5CDLA 1YJ3A 2GGCA 1BN5A 1XGNA 3FMRA 2DFIA 1MATA 4U71A 4U6JA 2NQ6A 1C23A 3CTZA 1BOAA 2OKNA 2GU7A 5CLSA 2EVMA 1YW9A 4RZZA 1B6AA 4FLLA 5JHUA 4IKSA 2V3XA 1O0XA 3MATA 3IU7A 2BWSA 1QZYA 1R5HA 1WBQA 2Q92A 5FCFA 4IECA 3PKBA 4HXXA 4Z7MA 3BIQA 4U70A 5E5BA 4U76A 3BITA 3PKDA 1A16A 1WN1A 2GGBA 1C22A 2BWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNZ A;  4FO7 A;  2Q96 A;  4ZWP A;  4ZWU A;  1B59 A;  4IF7 A;  1R58 A;  2BH3 A;  2EVC A;  2GG5 A;  2GG0 A;  2Q8K A;  4FO8 A;  4ZWO A;  2GG2 A;  2Q93 A;  4KM3 A;  2ADU A;  4A6V A;  3PKA A;  4MAT A;  2GG7 A;  5CNX A;  2BN7 A;  2P98 A;  5FCH A;  3L24 A;  2V6C A;  4RGZ 1;  1YW7 A;  3S6B A;  1WL9 A;  1Y1N A;  2GU4 A;  2B3K A;  4IKU A;  1C24 A;  4U6E A;  4IKT A;  5CDV A;  2EVO A;  2IW2 A;  5D6E A;  4IDY A;  4JUQ A;  3MR1 A;  3MX6 A;  2GG9 A;  1M35 A;  5CE6 A;  1C21 A;  2BHC A;  3CB5 A;  1YVM A;  5JFR A;  2EA4 A;  3IU9 A;  3BIP A;  3IU8 A;  1KQ0 A;  4IU6 A;  2BWV A;  3CB6 A;  4FKC A;  5JI6 A;  4PNC A;  2Q94 A;  1N51 A;  1R5G A;  3FMQ A;  2BB7 A;  2V3Y A;  1CHM A;  4U1B A;  1W7V A;  3Q6D A;  5CDE A;  4B28 A;  1KP0 A;  4FLJ A;  4IKR A;  4U6C A;  4EGE A;  3TB5 A;  2ZSG A;  2GA2 A;  4OOK A;  4S01 A;  4S2T P;  1WL6 A;  2BHB A;  2B3H A;  2MAT A;  4S00 A;  2GU6 A;  4R60 A;  4FUK A;  4PV4 A;  1C27 A;  1WLR A;  1W2M A;  4U73 A;  2GU5 A;  4FLK A;  2BHA A;  2GG3 A;  1PV9 A;  2V3Z A;  4ZNG A;  1QXW A;  4U69 A;  1JAW A;  3PKC A;  2HOW A;  5CIK A;  2G6P A;  1WKM A;  3FM3 A;  3ROR A;  4QR8 A;  2BWW A;  1KQ9 A;  4U6W A;  2BHD A;  4RZY A;  2GZ5 A;  2BWY A;  2NQ7 A;  1XGS A;  1QXZ A;  4U75 A;  1WY2 A;  2GG8 A;  2P99 A;  3L7G A;  2EA2 A;  2BWU A;  4A6W A;  1QXY A;  2GTX A;  3IG4 A;  3D27 A;  4IPA A;  4FLI A;  1YW8 A;  2BWX A;  4U6Z A;  2Q95 A;  3PKE A;  3RVA A;  1XGO A;  5D6F A;  3TAV A;  1XGM A;  2OAZ A;  2P9A A;  4S2R P;  2B3L A;  5CDL A;  1YJ3 A;  2GGC A;  1BN5 A;  1XGN A;  3FMR A;  2DFI A;  1MAT A;  4U71 A;  4U6J A;  2NQ6 A;  1C23 A;  3CTZ A;  1BOA A;  2OKN A;  2GU7 A;  5CLS A;  2EVM A;  1YW9 A;  4RZZ A;  1B6A A;  4FLL A;  5JHU A;  4IKS A;  2V3X A;  1O0X A;  3MAT A;  3IU7 A;  2BWS A;  1QZY A;  1R5H A;  1WBQ A;  2Q92 A;  5FCF A;  4IEC A;  3PKB A;  4HXX A;  4Z7M A;  3BIQ A;  4U70 A;  5E5B A;  4U76 A;  3BIT A;  3PKD A;  1A16 A;  1WN1 A;  2GGB A;  1C22 A;  2BWT A; 
#chains in the Genus database with same CATH topology
 1XNZ A;  4FO7 A;  2Q96 A;  4ZWP A;  4ZWU A;  1B59 A;  4IF7 A;  1R58 A;  2BH3 A;  2EVC A;  2GG5 A;  2GG0 A;  2Q8K A;  4FO8 A;  4ZWO A;  2GG2 A;  2Q93 A;  4KM3 A;  2ADU A;  4A6V A;  3PKA A;  4MAT A;  2GG7 A;  5CNX A;  2BN7 A;  2P98 A;  5FCH A;  3L24 A;  2V6C A;  4RGZ 1;  1YW7 A;  3S6B A;  1WL9 A;  1Y1N A;  2GU4 A;  2B3K A;  4IKU A;  1C24 A;  4U6E A;  4IKT A;  5CDV A;  2EVO A;  2IW2 A;  5D6E A;  4IDY A;  4JUQ A;  3MR1 A;  3MX6 A;  2GG9 A;  1M35 A;  5CE6 A;  1C21 A;  2BHC A;  3CB5 A;  1YVM A;  5JFR A;  2EA4 A;  3IU9 A;  3BIP A;  3IU8 A;  1KQ0 A;  4IU6 A;  2BWV A;  3CB6 A;  4FKC A;  5JI6 A;  4PNC A;  2Q94 A;  1N51 A;  1R5G A;  3FMQ A;  2BB7 A;  2V3Y A;  1CHM A;  4U1B A;  1W7V A;  3Q6D A;  5CDE A;  4B28 A;  1KP0 A;  4FLJ A;  4IKR A;  4U6C A;  4EGE A;  3TB5 A;  2ZSG A;  2GA2 A;  4OOK A;  4S01 A;  4S2T P;  1WL6 A;  2BHB A;  2B3H A;  2MAT A;  4S00 A;  2GU6 A;  4R60 A;  4FUK A;  4PV4 A;  1C27 A;  1WLR A;  1W2M A;  4U73 A;  2GU5 A;  4FLK A;  2BHA A;  2GG3 A;  1PV9 A;  2V3Z A;  4ZNG A;  1QXW A;  4U69 A;  1JAW A;  3PKC A;  2HOW A;  5CIK A;  2G6P A;  1WKM A;  3FM3 A;  3ROR A;  4QR8 A;  2BWW A;  1KQ9 A;  4U6W A;  2BHD A;  4RZY A;  2GZ5 A;  2BWY A;  2NQ7 A;  1XGS A;  1QXZ A;  4U75 A;  1WY2 A;  2GG8 A;  2P99 A;  3L7G A;  2EA2 A;  2BWU A;  4A6W A;  1QXY A;  2GTX A;  3IG4 A;  3D27 A;  4IPA A;  4FLI A;  1YW8 A;  2BWX A;  4U6Z A;  2Q95 A;  3PKE A;  3RVA A;  1XGO A;  5D6F A;  3TAV A;  1XGM A;  2OAZ A;  2P9A A;  4S2R P;  2B3L A;  5CDL A;  1YJ3 A;  2GGC A;  1BN5 A;  1XGN A;  3FMR A;  2DFI A;  1MAT A;  4U71 A;  4U6J A;  2NQ6 A;  1C23 A;  3CTZ A;  1BOA A;  2OKN A;  2GU7 A;  5CLS A;  2EVM A;  1YW9 A;  4RZZ A;  1B6A A;  4FLL A;  5JHU A;  4IKS A;  2V3X A;  1O0X A;  3MAT A;  3IU7 A;  2BWS A;  1QZY A;  1R5H A;  1WBQ A;  2Q92 A;  5FCF A;  4IEC A;  3PKB A;  4HXX A;  4Z7M A;  3BIQ A;  4U70 A;  5E5B A;  4U76 A;  3BIT A;  3PKD A;  1A16 A;  1WN1 A;  2GGB A;  1C22 A;  2BWT A; 
#chains in the Genus database with same CATH homology
 1XNZ A;  4FO7 A;  2Q96 A;  4ZWP A;  4ZWU A;  1B59 A;  4IF7 A;  1R58 A;  2BH3 A;  2EVC A;  2GG5 A;  2GG0 A;  2Q8K A;  4FO8 A;  4ZWO A;  2GG2 A;  2Q93 A;  4KM3 A;  2ADU A;  4A6V A;  3PKA A;  4MAT A;  2GG7 A;  5CNX A;  2BN7 A;  2P98 A;  5FCH A;  3L24 A;  2V6C A;  4RGZ 1;  1YW7 A;  3S6B A;  1WL9 A;  1Y1N A;  2GU4 A;  2B3K A;  4IKU A;  1C24 A;  4U6E A;  4IKT A;  5CDV A;  2EVO A;  2IW2 A;  5D6E A;  4IDY A;  4JUQ A;  3MR1 A;  3MX6 A;  2GG9 A;  1M35 A;  5CE6 A;  1C21 A;  2BHC A;  3CB5 A;  1YVM A;  5JFR A;  2EA4 A;  3IU9 A;  3BIP A;  3IU8 A;  1KQ0 A;  4IU6 A;  2BWV A;  3CB6 A;  4FKC A;  5JI6 A;  4PNC A;  2Q94 A;  1N51 A;  1R5G A;  3FMQ A;  2BB7 A;  2V3Y A;  1CHM A;  4U1B A;  1W7V A;  3Q6D A;  5CDE A;  4B28 A;  1KP0 A;  4FLJ A;  4IKR A;  4U6C A;  4EGE A;  3TB5 A;  2ZSG A;  2GA2 A;  4OOK A;  4S01 A;  4S2T P;  1WL6 A;  2BHB A;  2B3H A;  2MAT A;  4S00 A;  2GU6 A;  4R60 A;  4FUK A;  4PV4 A;  1C27 A;  1WLR A;  1W2M A;  4U73 A;  2GU5 A;  4FLK A;  2BHA A;  2GG3 A;  1PV9 A;  2V3Z A;  4ZNG A;  1QXW A;  4U69 A;  1JAW A;  3PKC A;  2HOW A;  5CIK A;  2G6P A;  1WKM A;  3FM3 A;  3ROR A;  4QR8 A;  2BWW A;  1KQ9 A;  4U6W A;  2BHD A;  4RZY A;  2GZ5 A;  2BWY A;  2NQ7 A;  1XGS A;  1QXZ A;  4U75 A;  1WY2 A;  2GG8 A;  2P99 A;  3L7G A;  2EA2 A;  2BWU A;  4A6W A;  1QXY A;  2GTX A;  3IG4 A;  3D27 A;  4IPA A;  4FLI A;  1YW8 A;  2BWX A;  4U6Z A;  2Q95 A;  3PKE A;  3RVA A;  1XGO A;  5D6F A;  3TAV A;  1XGM A;  2OAZ A;  2P9A A;  4S2R P;  2B3L A;  5CDL A;  1YJ3 A;  2GGC A;  1BN5 A;  1XGN A;  3FMR A;  2DFI A;  1MAT A;  4U71 A;  4U6J A;  2NQ6 A;  1C23 A;  3CTZ A;  1BOA A;  2OKN A;  2GU7 A;  5CLS A;  2EVM A;  1YW9 A;  4RZZ A;  1B6A A;  4FLL A;  5JHU A;  4IKS A;  2V3X A;  1O0X A;  3MAT A;  3IU7 A;  2BWS A;  1QZY A;  1R5H A;  1WBQ A;  2Q92 A;  5FCF A;  4IEC A;  3PKB A;  4HXX A;  4Z7M A;  3BIQ A;  4U70 A;  5E5B A;  4U76 A;  3BIT A;  3PKD A;  1A16 A;  1WN1 A;  2GGB A;  1C22 A;  2BWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...