2GG3A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 85
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg3A00
2BWTA 1QZYA 4FKCA 5CLSA 2B3HA 2IW2A 1XNZA 1MATA 1KQ0A 2BWSA 3CB5A 4FUKA 4U69A 2BWXA 2Q8KA 4A6WA 2G6PA 1WLRA 1C27A 4R60A 4ZWOA 2OKNA 3D27A 2ADUA 2GGCA 4U75A 3FMRA 4RZYA 1XGSA 5CDEA 1QXYA 3BIPA 2GGBA 2BB7A 2Q92A 2DFIA 2EVOA 3TB5A 4U76A 2GU4A 4U6EA 1R58A 2NQ7A 2ZSGA 4FLIA 2BWYA 2GU7A 2V3XA 3MATA 3CB6A 4FLKA 5CDVA 5CDLA 4IKSA 1WL9A 4HXXA 4RGZ1 5JI6A 1WKMA 1WL6A 2EVMA 4S01A 4ZWPA 4ZWUA 3PKAA 4FO8A 1W2MA 1A16A 3IG4A 2V3ZA 3BITA 2Q95A 1W7VA 4IKRA 4EGEA 1C21A 1PV9A 1YW8A 2EA2A 3BIQA 3FMQA 4U71A 2BWUA 2EVCA 4JUQA 4S2TP 4PV4A 2P98A 2GU5A 3IU7A 2BHBA 4IDYA 4U1BA 5JHUA 4IU6A 1B6AA 2HOWA 2GU6A 4S00A 2BHDA 1KP0A 1BOAA 2BWVA 4IKTA 3MR1A 4MATA 4U6CA 1XGNA 1QXWA 1XGOA 3L24A 2BWWA 1WBQA 2Q94A 3PKDA 4RZZA 1WY2A 2GG0A 3PKBA 2BN7A 1Y1NA 5FCHA 4U73A 1WN1A 1R5HA 2GA2A 2B3LA 5E5BA 4B28A 2MATA 2OAZA 5D6EA 5CE6A 3CTZA 1YJ3A 4PNCA 2GTXA 3PKCA 4IPAA 2BH3A 3TAVA 2P9AA 2GZ5A 5D6FA 2GG3A 4U70A 1CHMA 1YW7A 4U6ZA 2BHCA 2B3KA 1C23A 4OOKA 4Z7MA 2NQ6A 4FO7A 1QXZA 1YW9A 4IKUA 3RVAA 1C22A 4A6VA 2GG2A 4ZNGA 1B59A 3IU9A 5CNXA 4FLJA 2EA4A 1BN5A 2V3YA 5CIKA 3PKEA 1XGMA 2Q93A 4QR8A 4KM3A 2GG8A 2GG9A 1KQ9A 4U6JA 1JAWA 4FLLA 2P99A 4IF7A 2GG7A 3RORA 4U6WA 1C24A 2V6CA 3IU8A 3L7GA 2GG5A 5FCFA 1M35A 3MX6A 1N51A 3FM3A 2Q96A 1R5GA 3S6BA 2BHAA 4IECA 1O0XA 3Q6DA 5JFRA 1YVMA 4S2RP
chains in the Genus database with same CATH superfamily
2BWTA 1QZYA 4FKCA 5CLSA 2B3HA 2IW2A 1XNZA 1MATA 1KQ0A 2BWSA 3CB5A 4FUKA 4U69A 2BWXA 2Q8KA 4A6WA 2G6PA 1WLRA 1C27A 4R60A 4ZWOA 2OKNA 3D27A 2ADUA 2GGCA 4U75A 3FMRA 4RZYA 1XGSA 5CDEA 1QXYA 3BIPA 2GGBA 2BB7A 2Q92A 2DFIA 2EVOA 3TB5A 4U76A 2GU4A 4U6EA 1R58A 2NQ7A 2ZSGA 4FLIA 2BWYA 2GU7A 2V3XA 3MATA 3CB6A 4FLKA 5CDVA 5CDLA 4IKSA 1WL9A 4HXXA 4RGZ1 5JI6A 1WKMA 1WL6A 2EVMA 4S01A 4ZWPA 4ZWUA 3PKAA 4FO8A 1W2MA 1A16A 3IG4A 2V3ZA 3BITA 2Q95A 1W7VA 4IKRA 4EGEA 1C21A 1PV9A 1YW8A 2EA2A 3BIQA 3FMQA 4U71A 2BWUA 2EVCA 4JUQA 4S2TP 4PV4A 2P98A 2GU5A 3IU7A 2BHBA 4IDYA 4U1BA 5JHUA 4IU6A 1B6AA 2HOWA 2GU6A 4S00A 2BHDA 1KP0A 1BOAA 2BWVA 4IKTA 3MR1A 4MATA 4U6CA 1XGNA 1QXWA 1XGOA 3L24A 2BWWA 1WBQA 2Q94A 3PKDA 4RZZA 1WY2A 2GG0A 3PKBA 2BN7A 1Y1NA 5FCHA 4U73A 1WN1A 1R5HA 2GA2A 2B3LA 5E5BA 4B28A 2MATA 2OAZA 5D6EA 5CE6A 3CTZA 1YJ3A 4PNCA 2GTXA 3PKCA 4IPAA 2BH3A 3TAVA 2P9AA 2GZ5A 5D6FA 2GG3A 4U70A 1CHMA 1YW7A 4U6ZA 2BHCA 2B3KA 1C23A 4OOKA 4Z7MA 2NQ6A 4FO7A 1QXZA 1YW9A 4IKUA 3RVAA 1C22A 4A6VA 2GG2A 4ZNGA 1B59A 3IU9A 5CNXA 4FLJA 2EA4A 1BN5A 2V3YA 5CIKA 3PKEA 1XGMA 2Q93A 4QR8A 4KM3A 2GG8A 2GG9A 1KQ9A 4U6JA 1JAWA 4FLLA 2P99A 4IF7A 2GG7A 3RORA 4U6WA 1C24A 2V6CA 3IU8A 3L7GA 2GG5A 5FCFA 1M35A 3MX6A 1N51A 3FM3A 2Q96A 1R5GA 3S6BA 2BHAA 4IECA 1O0XA 3Q6DA 5JFRA 1YVMA 4S2RP
chains in the Genus database with same CATH topology
2BWTA 1QZYA 4FKCA 5CLSA 2B3HA 2IW2A 1XNZA 1MATA 1KQ0A 2BWSA 3CB5A 4FUKA 4U69A 2BWXA 2Q8KA 4A6WA 2G6PA 1WLRA 1C27A 4R60A 4ZWOA 2OKNA 3D27A 2ADUA 2GGCA 4U75A 3FMRA 4RZYA 1XGSA 5CDEA 1QXYA 3BIPA 2GGBA 2BB7A 2Q92A 2DFIA 2EVOA 3TB5A 4U76A 2GU4A 4U6EA 1R58A 2NQ7A 2ZSGA 4FLIA 2BWYA 2GU7A 2V3XA 3MATA 3CB6A 4FLKA 5CDVA 5CDLA 4IKSA 1WL9A 4HXXA 4RGZ1 5JI6A 1WKMA 1WL6A 2EVMA 4S01A 4ZWPA 4ZWUA 3PKAA 4FO8A 1W2MA 1A16A 3IG4A 2V3ZA 3BITA 2Q95A 1W7VA 4IKRA 4EGEA 1C21A 1PV9A 1YW8A 2EA2A 3BIQA 3FMQA 4U71A 2BWUA 2EVCA 4JUQA 4S2TP 4PV4A 2P98A 2GU5A 3IU7A 2BHBA 4IDYA 4U1BA 5JHUA 4IU6A 1B6AA 2HOWA 2GU6A 4S00A 2BHDA 1KP0A 1BOAA 2BWVA 4IKTA 3MR1A 4MATA 4U6CA 1XGNA 1QXWA 1XGOA 3L24A 2BWWA 1WBQA 2Q94A 3PKDA 4RZZA 1WY2A 2GG0A 3PKBA 2BN7A 1Y1NA 5FCHA 4U73A 1WN1A 1R5HA 2GA2A 2B3LA 5E5BA 4B28A 2MATA 2OAZA 5D6EA 5CE6A 3CTZA 1YJ3A 4PNCA 2GTXA 3PKCA 4IPAA 2BH3A 3TAVA 2P9AA 2GZ5A 5D6FA 2GG3A 4U70A 1CHMA 1YW7A 4U6ZA 2BHCA 2B3KA 1C23A 4OOKA 4Z7MA 2NQ6A 4FO7A 1QXZA 1YW9A 4IKUA 3RVAA 1C22A 4A6VA 2GG2A 4ZNGA 1B59A 3IU9A 5CNXA 4FLJA 2EA4A 1BN5A 2V3YA 5CIKA 3PKEA 1XGMA 2Q93A 4QR8A 4KM3A 2GG8A 2GG9A 1KQ9A 4U6JA 1JAWA 4FLLA 2P99A 4IF7A 2GG7A 3RORA 4U6WA 1C24A 2V6CA 3IU8A 3L7GA 2GG5A 5FCFA 1M35A 3MX6A 1N51A 3FM3A 2Q96A 1R5GA 3S6BA 2BHAA 4IECA 1O0XA 3Q6DA 5JFRA 1YVMA 4S2RP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWT A;  1QZY A;  4FKC A;  5CLS A;  2B3H A;  2IW2 A;  1XNZ A;  1MAT A;  1KQ0 A;  2BWS A;  3CB5 A;  4FUK A;  4U69 A;  2BWX A;  2Q8K A;  4A6W A;  2G6P A;  1WLR A;  1C27 A;  4R60 A;  4ZWO A;  2OKN A;  3D27 A;  2ADU A;  2GGC A;  4U75 A;  3FMR A;  4RZY A;  1XGS A;  5CDE A;  1QXY A;  3BIP A;  2GGB A;  2BB7 A;  2Q92 A;  2DFI A;  2EVO A;  3TB5 A;  4U76 A;  2GU4 A;  4U6E A;  1R58 A;  2NQ7 A;  2ZSG A;  4FLI A;  2BWY A;  2GU7 A;  2V3X A;  3MAT A;  3CB6 A;  4FLK A;  5CDV A;  5CDL A;  4IKS A;  1WL9 A;  4HXX A;  4RGZ 1;  5JI6 A;  1WKM A;  1WL6 A;  2EVM A;  4S01 A;  4ZWP A;  4ZWU A;  3PKA A;  4FO8 A;  1W2M A;  1A16 A;  3IG4 A;  2V3Z A;  3BIT A;  2Q95 A;  1W7V A;  4IKR A;  4EGE A;  1C21 A;  1PV9 A;  1YW8 A;  2EA2 A;  3BIQ A;  3FMQ A;  4U71 A;  2BWU A;  2EVC A;  4JUQ A;  4S2T P;  4PV4 A;  2P98 A;  2GU5 A;  3IU7 A;  2BHB A;  4IDY A;  4U1B A;  5JHU A;  4IU6 A;  1B6A A;  2HOW A;  2GU6 A;  4S00 A;  2BHD A;  1KP0 A;  1BOA A;  2BWV A;  4IKT A;  3MR1 A;  4MAT A;  4U6C A;  1XGN A;  1QXW A;  1XGO A;  3L24 A;  2BWW A;  1WBQ A;  2Q94 A;  3PKD A;  4RZZ A;  1WY2 A;  2GG0 A;  3PKB A;  2BN7 A;  1Y1N A;  5FCH A;  4U73 A;  1WN1 A;  1R5H A;  2GA2 A;  2B3L A;  5E5B A;  4B28 A;  2MAT A;  2OAZ A;  5D6E A;  5CE6 A;  3CTZ A;  1YJ3 A;  4PNC A;  2GTX A;  3PKC A;  4IPA A;  2BH3 A;  3TAV A;  2P9A A;  2GZ5 A;  5D6F A;  2GG3 A;  4U70 A;  1CHM A;  1YW7 A;  4U6Z A;  2BHC A;  2B3K A;  1C23 A;  4OOK A;  4Z7M A;  2NQ6 A;  4FO7 A;  1QXZ A;  1YW9 A;  4IKU A;  3RVA A;  1C22 A;  4A6V A;  2GG2 A;  4ZNG A;  1B59 A;  3IU9 A;  5CNX A;  4FLJ A;  2EA4 A;  1BN5 A;  2V3Y A;  5CIK A;  3PKE A;  1XGM A;  2Q93 A;  4QR8 A;  4KM3 A;  2GG8 A;  2GG9 A;  1KQ9 A;  4U6J A;  1JAW A;  4FLL A;  2P99 A;  4IF7 A;  2GG7 A;  3ROR A;  4U6W A;  1C24 A;  2V6C A;  3IU8 A;  3L7G A;  2GG5 A;  5FCF A;  1M35 A;  3MX6 A;  1N51 A;  3FM3 A;  2Q96 A;  1R5G A;  3S6B A;  2BHA A;  4IEC A;  1O0X A;  3Q6D A;  5JFR A;  1YVM A;  4S2R P; 
#chains in the Genus database with same CATH topology
 2BWT A;  1QZY A;  4FKC A;  5CLS A;  2B3H A;  2IW2 A;  1XNZ A;  1MAT A;  1KQ0 A;  2BWS A;  3CB5 A;  4FUK A;  4U69 A;  2BWX A;  2Q8K A;  4A6W A;  2G6P A;  1WLR A;  1C27 A;  4R60 A;  4ZWO A;  2OKN A;  3D27 A;  2ADU A;  2GGC A;  4U75 A;  3FMR A;  4RZY A;  1XGS A;  5CDE A;  1QXY A;  3BIP A;  2GGB A;  2BB7 A;  2Q92 A;  2DFI A;  2EVO A;  3TB5 A;  4U76 A;  2GU4 A;  4U6E A;  1R58 A;  2NQ7 A;  2ZSG A;  4FLI A;  2BWY A;  2GU7 A;  2V3X A;  3MAT A;  3CB6 A;  4FLK A;  5CDV A;  5CDL A;  4IKS A;  1WL9 A;  4HXX A;  4RGZ 1;  5JI6 A;  1WKM A;  1WL6 A;  2EVM A;  4S01 A;  4ZWP A;  4ZWU A;  3PKA A;  4FO8 A;  1W2M A;  1A16 A;  3IG4 A;  2V3Z A;  3BIT A;  2Q95 A;  1W7V A;  4IKR A;  4EGE A;  1C21 A;  1PV9 A;  1YW8 A;  2EA2 A;  3BIQ A;  3FMQ A;  4U71 A;  2BWU A;  2EVC A;  4JUQ A;  4S2T P;  4PV4 A;  2P98 A;  2GU5 A;  3IU7 A;  2BHB A;  4IDY A;  4U1B A;  5JHU A;  4IU6 A;  1B6A A;  2HOW A;  2GU6 A;  4S00 A;  2BHD A;  1KP0 A;  1BOA A;  2BWV A;  4IKT A;  3MR1 A;  4MAT A;  4U6C A;  1XGN A;  1QXW A;  1XGO A;  3L24 A;  2BWW A;  1WBQ A;  2Q94 A;  3PKD A;  4RZZ A;  1WY2 A;  2GG0 A;  3PKB A;  2BN7 A;  1Y1N A;  5FCH A;  4U73 A;  1WN1 A;  1R5H A;  2GA2 A;  2B3L A;  5E5B A;  4B28 A;  2MAT A;  2OAZ A;  5D6E A;  5CE6 A;  3CTZ A;  1YJ3 A;  4PNC A;  2GTX A;  3PKC A;  4IPA A;  2BH3 A;  3TAV A;  2P9A A;  2GZ5 A;  5D6F A;  2GG3 A;  4U70 A;  1CHM A;  1YW7 A;  4U6Z A;  2BHC A;  2B3K A;  1C23 A;  4OOK A;  4Z7M A;  2NQ6 A;  4FO7 A;  1QXZ A;  1YW9 A;  4IKU A;  3RVA A;  1C22 A;  4A6V A;  2GG2 A;  4ZNG A;  1B59 A;  3IU9 A;  5CNX A;  4FLJ A;  2EA4 A;  1BN5 A;  2V3Y A;  5CIK A;  3PKE A;  1XGM A;  2Q93 A;  4QR8 A;  4KM3 A;  2GG8 A;  2GG9 A;  1KQ9 A;  4U6J A;  1JAW A;  4FLL A;  2P99 A;  4IF7 A;  2GG7 A;  3ROR A;  4U6W A;  1C24 A;  2V6C A;  3IU8 A;  3L7G A;  2GG5 A;  5FCF A;  1M35 A;  3MX6 A;  1N51 A;  3FM3 A;  2Q96 A;  1R5G A;  3S6B A;  2BHA A;  4IEC A;  1O0X A;  3Q6D A;  5JFR A;  1YVM A;  4S2R P; 
#chains in the Genus database with same CATH homology
 2BWT A;  1QZY A;  4FKC A;  5CLS A;  2B3H A;  2IW2 A;  1XNZ A;  1MAT A;  1KQ0 A;  2BWS A;  3CB5 A;  4FUK A;  4U69 A;  2BWX A;  2Q8K A;  4A6W A;  2G6P A;  1WLR A;  1C27 A;  4R60 A;  4ZWO A;  2OKN A;  3D27 A;  2ADU A;  2GGC A;  4U75 A;  3FMR A;  4RZY A;  1XGS A;  5CDE A;  1QXY A;  3BIP A;  2GGB A;  2BB7 A;  2Q92 A;  2DFI A;  2EVO A;  3TB5 A;  4U76 A;  2GU4 A;  4U6E A;  1R58 A;  2NQ7 A;  2ZSG A;  4FLI A;  2BWY A;  2GU7 A;  2V3X A;  3MAT A;  3CB6 A;  4FLK A;  5CDV A;  5CDL A;  4IKS A;  1WL9 A;  4HXX A;  4RGZ 1;  5JI6 A;  1WKM A;  1WL6 A;  2EVM A;  4S01 A;  4ZWP A;  4ZWU A;  3PKA A;  4FO8 A;  1W2M A;  1A16 A;  3IG4 A;  2V3Z A;  3BIT A;  2Q95 A;  1W7V A;  4IKR A;  4EGE A;  1C21 A;  1PV9 A;  1YW8 A;  2EA2 A;  3BIQ A;  3FMQ A;  4U71 A;  2BWU A;  2EVC A;  4JUQ A;  4S2T P;  4PV4 A;  2P98 A;  2GU5 A;  3IU7 A;  2BHB A;  4IDY A;  4U1B A;  5JHU A;  4IU6 A;  1B6A A;  2HOW A;  2GU6 A;  4S00 A;  2BHD A;  1KP0 A;  1BOA A;  2BWV A;  4IKT A;  3MR1 A;  4MAT A;  4U6C A;  1XGN A;  1QXW A;  1XGO A;  3L24 A;  2BWW A;  1WBQ A;  2Q94 A;  3PKD A;  4RZZ A;  1WY2 A;  2GG0 A;  3PKB A;  2BN7 A;  1Y1N A;  5FCH A;  4U73 A;  1WN1 A;  1R5H A;  2GA2 A;  2B3L A;  5E5B A;  4B28 A;  2MAT A;  2OAZ A;  5D6E A;  5CE6 A;  3CTZ A;  1YJ3 A;  4PNC A;  2GTX A;  3PKC A;  4IPA A;  2BH3 A;  3TAV A;  2P9A A;  2GZ5 A;  5D6F A;  2GG3 A;  4U70 A;  1CHM A;  1YW7 A;  4U6Z A;  2BHC A;  2B3K A;  1C23 A;  4OOK A;  4Z7M A;  2NQ6 A;  4FO7 A;  1QXZ A;  1YW9 A;  4IKU A;  3RVA A;  1C22 A;  4A6V A;  2GG2 A;  4ZNG A;  1B59 A;  3IU9 A;  5CNX A;  4FLJ A;  2EA4 A;  1BN5 A;  2V3Y A;  5CIK A;  3PKE A;  1XGM A;  2Q93 A;  4QR8 A;  4KM3 A;  2GG8 A;  2GG9 A;  1KQ9 A;  4U6J A;  1JAW A;  4FLL A;  2P99 A;  4IF7 A;  2GG7 A;  3ROR A;  4U6W A;  1C24 A;  2V6C A;  3IU8 A;  3L7G A;  2GG5 A;  5FCF A;  1M35 A;  3MX6 A;  1N51 A;  3FM3 A;  2Q96 A;  1R5G A;  3S6B A;  2BHA A;  4IEC A;  1O0X A;  3Q6D A;  5JFR A;  1YVM A;  4S2R P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...