2GG3A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 85
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg3A00
4U71A 1BOAA 4IU6A 4MATA 1XGNA 5CLSA 5JFRA 1YW8A 2EVOA 5CIKA 3L7GA 1QXZA 2BHDA 4IPAA 4S2RP 3RVAA 2NQ6A 2EA2A 1KQ0A 2GG7A 4RZYA 3IU7A 3MX6A 5D6FA 5CDLA 3CTZA 5FCHA 2EA4A 3MATA 2Q94A 4RGZ1 4A6WA 3PKEA 2Q92A 3D27A 1YW9A 4EGEA 2GU5A 1QXWA 3CB6A 4U73A 1KP0A 2GGBA 2BWWA 2P9AA 4U76A 5JI6A 4S01A 4FLKA 4S00A 2Q95A 2B3KA 4OOKA 4U6JA 1XGOA 3S6BA 2IW2A 2MATA 5FCFA 4ZNGA 1C27A 2GG5A 1B6AA 5CNXA 2P99A 4FLJA 1JAWA 4R60A 2B3LA 1XGSA 4IF7A 2GU6A 2GGCA 3RORA 1C22A 2BH3A 3BITA 4U1BA 2GG2A 2BWYA 4U6EA 1C24A 2B3HA 4JUQA 4IKTA 4RZZA 1WLRA 4U6WA 4FUKA 1QXYA 2BWVA 2EVCA 4U70A 4U6CA 4ZWPA 1CHMA 3IU9A 3FMRA 4PNCA 1PV9A 3PKAA 2BHBA 2DFIA 2GG3A 4FLIA 4IKSA 3TAVA 3MR1A 4S2TP 2G6PA 2V3YA 1M35A 5CDVA 1B59A 2Q93A 1WN1A 4U69A 1MATA 1WKMA 1R5HA 5CDEA 1R58A 2ZSGA 4QR8A 1C21A 3IU8A 2GG9A 2HOWA 2Q96A 2GG8A 4A6VA 1N51A 2GU4A 4FKCA 1Y1NA 2OAZA 2BWXA 3PKBA 2BB7A 3PKCA 4FLLA 4U75A 4IKUA 1BN5A 2BWUA 3CB5A 1KQ9A 1YVMA 4FO7A 2ADUA 1WBQA 3TB5A 2GU7A 4FO8A 3BIQA 3PKDA 2EVMA 3BIPA 4IDYA 1WY2A 2BWSA 2V3ZA 1W2MA 1C23A 2GTXA 5CE6A 1YJ3A 1YW7A 4IKRA 2BWTA 1W7VA 4IECA 4KM3A 2Q8KA 3FM3A 4ZWOA 3IG4A 2GG0A 5JHUA 1QZYA 1XNZA 2V6CA 3Q6DA 4ZWUA 2OKNA 1A16A 1XGMA 1WL6A 2BN7A 1O0XA 4PV4A 5D6EA 3FMQA 2GZ5A 1WL9A 2V3XA 1R5GA 4HXXA 4B28A 2BHCA 2P98A 3L24A 4U6ZA 5E5BA 2NQ7A 2BHAA 2GA2A 4Z7MA
chains in the Genus database with same CATH superfamily
4U71A 1BOAA 4IU6A 4MATA 1XGNA 5CLSA 5JFRA 1YW8A 2EVOA 5CIKA 3L7GA 1QXZA 2BHDA 4IPAA 4S2RP 3RVAA 2NQ6A 2EA2A 1KQ0A 2GG7A 4RZYA 3IU7A 3MX6A 5D6FA 5CDLA 3CTZA 5FCHA 2EA4A 3MATA 2Q94A 4RGZ1 4A6WA 3PKEA 2Q92A 3D27A 1YW9A 4EGEA 2GU5A 1QXWA 3CB6A 4U73A 1KP0A 2GGBA 2BWWA 2P9AA 4U76A 5JI6A 4S01A 4FLKA 4S00A 2Q95A 2B3KA 4OOKA 4U6JA 1XGOA 3S6BA 2IW2A 2MATA 5FCFA 4ZNGA 1C27A 2GG5A 1B6AA 5CNXA 2P99A 4FLJA 1JAWA 4R60A 2B3LA 1XGSA 4IF7A 2GU6A 2GGCA 3RORA 1C22A 2BH3A 3BITA 4U1BA 2GG2A 2BWYA 4U6EA 1C24A 2B3HA 4JUQA 4IKTA 4RZZA 1WLRA 4U6WA 4FUKA 1QXYA 2BWVA 2EVCA 4U70A 4U6CA 4ZWPA 1CHMA 3IU9A 3FMRA 4PNCA 1PV9A 3PKAA 2BHBA 2DFIA 2GG3A 4FLIA 4IKSA 3TAVA 3MR1A 4S2TP 2G6PA 2V3YA 1M35A 5CDVA 1B59A 2Q93A 1WN1A 4U69A 1MATA 1WKMA 1R5HA 5CDEA 1R58A 2ZSGA 4QR8A 1C21A 3IU8A 2GG9A 2HOWA 2Q96A 2GG8A 4A6VA 1N51A 2GU4A 4FKCA 1Y1NA 2OAZA 2BWXA 3PKBA 2BB7A 3PKCA 4FLLA 4U75A 4IKUA 1BN5A 2BWUA 3CB5A 1KQ9A 1YVMA 4FO7A 2ADUA 1WBQA 3TB5A 2GU7A 4FO8A 3BIQA 3PKDA 2EVMA 3BIPA 4IDYA 1WY2A 2BWSA 2V3ZA 1W2MA 1C23A 2GTXA 5CE6A 1YJ3A 1YW7A 4IKRA 2BWTA 1W7VA 4IECA 4KM3A 2Q8KA 3FM3A 4ZWOA 3IG4A 2GG0A 5JHUA 1QZYA 1XNZA 2V6CA 3Q6DA 4ZWUA 2OKNA 1A16A 1XGMA 1WL6A 2BN7A 1O0XA 4PV4A 5D6EA 3FMQA 2GZ5A 1WL9A 2V3XA 1R5GA 4HXXA 4B28A 2BHCA 2P98A 3L24A 4U6ZA 5E5BA 2NQ7A 2BHAA 2GA2A 4Z7MA
chains in the Genus database with same CATH topology
4U71A 1BOAA 4IU6A 4MATA 1XGNA 5CLSA 5JFRA 1YW8A 2EVOA 5CIKA 3L7GA 1QXZA 2BHDA 4IPAA 4S2RP 3RVAA 2NQ6A 2EA2A 1KQ0A 2GG7A 4RZYA 3IU7A 3MX6A 5D6FA 5CDLA 3CTZA 5FCHA 2EA4A 3MATA 2Q94A 4RGZ1 4A6WA 3PKEA 2Q92A 3D27A 1YW9A 4EGEA 2GU5A 1QXWA 3CB6A 4U73A 1KP0A 2GGBA 2BWWA 2P9AA 4U76A 5JI6A 4S01A 4FLKA 4S00A 2Q95A 2B3KA 4OOKA 4U6JA 1XGOA 3S6BA 2IW2A 2MATA 5FCFA 4ZNGA 1C27A 2GG5A 1B6AA 5CNXA 2P99A 4FLJA 1JAWA 4R60A 2B3LA 1XGSA 4IF7A 2GU6A 2GGCA 3RORA 1C22A 2BH3A 3BITA 4U1BA 2GG2A 2BWYA 4U6EA 1C24A 2B3HA 4JUQA 4IKTA 4RZZA 1WLRA 4U6WA 4FUKA 1QXYA 2BWVA 2EVCA 4U70A 4U6CA 4ZWPA 1CHMA 3IU9A 3FMRA 4PNCA 1PV9A 3PKAA 2BHBA 2DFIA 2GG3A 4FLIA 4IKSA 3TAVA 3MR1A 4S2TP 2G6PA 2V3YA 1M35A 5CDVA 1B59A 2Q93A 1WN1A 4U69A 1MATA 1WKMA 1R5HA 5CDEA 1R58A 2ZSGA 4QR8A 1C21A 3IU8A 2GG9A 2HOWA 2Q96A 2GG8A 4A6VA 1N51A 2GU4A 4FKCA 1Y1NA 2OAZA 2BWXA 3PKBA 2BB7A 3PKCA 4FLLA 4U75A 4IKUA 1BN5A 2BWUA 3CB5A 1KQ9A 1YVMA 4FO7A 2ADUA 1WBQA 3TB5A 2GU7A 4FO8A 3BIQA 3PKDA 2EVMA 3BIPA 4IDYA 1WY2A 2BWSA 2V3ZA 1W2MA 1C23A 2GTXA 5CE6A 1YJ3A 1YW7A 4IKRA 2BWTA 1W7VA 4IECA 4KM3A 2Q8KA 3FM3A 4ZWOA 3IG4A 2GG0A 5JHUA 1QZYA 1XNZA 2V6CA 3Q6DA 4ZWUA 2OKNA 1A16A 1XGMA 1WL6A 2BN7A 1O0XA 4PV4A 5D6EA 3FMQA 2GZ5A 1WL9A 2V3XA 1R5GA 4HXXA 4B28A 2BHCA 2P98A 3L24A 4U6ZA 5E5BA 2NQ7A 2BHAA 2GA2A 4Z7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U71 A;  1BOA A;  4IU6 A;  4MAT A;  1XGN A;  5CLS A;  5JFR A;  1YW8 A;  2EVO A;  5CIK A;  3L7G A;  1QXZ A;  2BHD A;  4IPA A;  4S2R P;  3RVA A;  2NQ6 A;  2EA2 A;  1KQ0 A;  2GG7 A;  4RZY A;  3IU7 A;  3MX6 A;  5D6F A;  5CDL A;  3CTZ A;  5FCH A;  2EA4 A;  3MAT A;  2Q94 A;  4RGZ 1;  4A6W A;  3PKE A;  2Q92 A;  3D27 A;  1YW9 A;  4EGE A;  2GU5 A;  1QXW A;  3CB6 A;  4U73 A;  1KP0 A;  2GGB A;  2BWW A;  2P9A A;  4U76 A;  5JI6 A;  4S01 A;  4FLK A;  4S00 A;  2Q95 A;  2B3K A;  4OOK A;  4U6J A;  1XGO A;  3S6B A;  2IW2 A;  2MAT A;  5FCF A;  4ZNG A;  1C27 A;  2GG5 A;  1B6A A;  5CNX A;  2P99 A;  4FLJ A;  1JAW A;  4R60 A;  2B3L A;  1XGS A;  4IF7 A;  2GU6 A;  2GGC A;  3ROR A;  1C22 A;  2BH3 A;  3BIT A;  4U1B A;  2GG2 A;  2BWY A;  4U6E A;  1C24 A;  2B3H A;  4JUQ A;  4IKT A;  4RZZ A;  1WLR A;  4U6W A;  4FUK A;  1QXY A;  2BWV A;  2EVC A;  4U70 A;  4U6C A;  4ZWP A;  1CHM A;  3IU9 A;  3FMR A;  4PNC A;  1PV9 A;  3PKA A;  2BHB A;  2DFI A;  2GG3 A;  4FLI A;  4IKS A;  3TAV A;  3MR1 A;  4S2T P;  2G6P A;  2V3Y A;  1M35 A;  5CDV A;  1B59 A;  2Q93 A;  1WN1 A;  4U69 A;  1MAT A;  1WKM A;  1R5H A;  5CDE A;  1R58 A;  2ZSG A;  4QR8 A;  1C21 A;  3IU8 A;  2GG9 A;  2HOW A;  2Q96 A;  2GG8 A;  4A6V A;  1N51 A;  2GU4 A;  4FKC A;  1Y1N A;  2OAZ A;  2BWX A;  3PKB A;  2BB7 A;  3PKC A;  4FLL A;  4U75 A;  4IKU A;  1BN5 A;  2BWU A;  3CB5 A;  1KQ9 A;  1YVM A;  4FO7 A;  2ADU A;  1WBQ A;  3TB5 A;  2GU7 A;  4FO8 A;  3BIQ A;  3PKD A;  2EVM A;  3BIP A;  4IDY A;  1WY2 A;  2BWS A;  2V3Z A;  1W2M A;  1C23 A;  2GTX A;  5CE6 A;  1YJ3 A;  1YW7 A;  4IKR A;  2BWT A;  1W7V A;  4IEC A;  4KM3 A;  2Q8K A;  3FM3 A;  4ZWO A;  3IG4 A;  2GG0 A;  5JHU A;  1QZY A;  1XNZ A;  2V6C A;  3Q6D A;  4ZWU A;  2OKN A;  1A16 A;  1XGM A;  1WL6 A;  2BN7 A;  1O0X A;  4PV4 A;  5D6E A;  3FMQ A;  2GZ5 A;  1WL9 A;  2V3X A;  1R5G A;  4HXX A;  4B28 A;  2BHC A;  2P98 A;  3L24 A;  4U6Z A;  5E5B A;  2NQ7 A;  2BHA A;  2GA2 A;  4Z7M A; 
#chains in the Genus database with same CATH topology
 4U71 A;  1BOA A;  4IU6 A;  4MAT A;  1XGN A;  5CLS A;  5JFR A;  1YW8 A;  2EVO A;  5CIK A;  3L7G A;  1QXZ A;  2BHD A;  4IPA A;  4S2R P;  3RVA A;  2NQ6 A;  2EA2 A;  1KQ0 A;  2GG7 A;  4RZY A;  3IU7 A;  3MX6 A;  5D6F A;  5CDL A;  3CTZ A;  5FCH A;  2EA4 A;  3MAT A;  2Q94 A;  4RGZ 1;  4A6W A;  3PKE A;  2Q92 A;  3D27 A;  1YW9 A;  4EGE A;  2GU5 A;  1QXW A;  3CB6 A;  4U73 A;  1KP0 A;  2GGB A;  2BWW A;  2P9A A;  4U76 A;  5JI6 A;  4S01 A;  4FLK A;  4S00 A;  2Q95 A;  2B3K A;  4OOK A;  4U6J A;  1XGO A;  3S6B A;  2IW2 A;  2MAT A;  5FCF A;  4ZNG A;  1C27 A;  2GG5 A;  1B6A A;  5CNX A;  2P99 A;  4FLJ A;  1JAW A;  4R60 A;  2B3L A;  1XGS A;  4IF7 A;  2GU6 A;  2GGC A;  3ROR A;  1C22 A;  2BH3 A;  3BIT A;  4U1B A;  2GG2 A;  2BWY A;  4U6E A;  1C24 A;  2B3H A;  4JUQ A;  4IKT A;  4RZZ A;  1WLR A;  4U6W A;  4FUK A;  1QXY A;  2BWV A;  2EVC A;  4U70 A;  4U6C A;  4ZWP A;  1CHM A;  3IU9 A;  3FMR A;  4PNC A;  1PV9 A;  3PKA A;  2BHB A;  2DFI A;  2GG3 A;  4FLI A;  4IKS A;  3TAV A;  3MR1 A;  4S2T P;  2G6P A;  2V3Y A;  1M35 A;  5CDV A;  1B59 A;  2Q93 A;  1WN1 A;  4U69 A;  1MAT A;  1WKM A;  1R5H A;  5CDE A;  1R58 A;  2ZSG A;  4QR8 A;  1C21 A;  3IU8 A;  2GG9 A;  2HOW A;  2Q96 A;  2GG8 A;  4A6V A;  1N51 A;  2GU4 A;  4FKC A;  1Y1N A;  2OAZ A;  2BWX A;  3PKB A;  2BB7 A;  3PKC A;  4FLL A;  4U75 A;  4IKU A;  1BN5 A;  2BWU A;  3CB5 A;  1KQ9 A;  1YVM A;  4FO7 A;  2ADU A;  1WBQ A;  3TB5 A;  2GU7 A;  4FO8 A;  3BIQ A;  3PKD A;  2EVM A;  3BIP A;  4IDY A;  1WY2 A;  2BWS A;  2V3Z A;  1W2M A;  1C23 A;  2GTX A;  5CE6 A;  1YJ3 A;  1YW7 A;  4IKR A;  2BWT A;  1W7V A;  4IEC A;  4KM3 A;  2Q8K A;  3FM3 A;  4ZWO A;  3IG4 A;  2GG0 A;  5JHU A;  1QZY A;  1XNZ A;  2V6C A;  3Q6D A;  4ZWU A;  2OKN A;  1A16 A;  1XGM A;  1WL6 A;  2BN7 A;  1O0X A;  4PV4 A;  5D6E A;  3FMQ A;  2GZ5 A;  1WL9 A;  2V3X A;  1R5G A;  4HXX A;  4B28 A;  2BHC A;  2P98 A;  3L24 A;  4U6Z A;  5E5B A;  2NQ7 A;  2BHA A;  2GA2 A;  4Z7M A; 
#chains in the Genus database with same CATH homology
 4U71 A;  1BOA A;  4IU6 A;  4MAT A;  1XGN A;  5CLS A;  5JFR A;  1YW8 A;  2EVO A;  5CIK A;  3L7G A;  1QXZ A;  2BHD A;  4IPA A;  4S2R P;  3RVA A;  2NQ6 A;  2EA2 A;  1KQ0 A;  2GG7 A;  4RZY A;  3IU7 A;  3MX6 A;  5D6F A;  5CDL A;  3CTZ A;  5FCH A;  2EA4 A;  3MAT A;  2Q94 A;  4RGZ 1;  4A6W A;  3PKE A;  2Q92 A;  3D27 A;  1YW9 A;  4EGE A;  2GU5 A;  1QXW A;  3CB6 A;  4U73 A;  1KP0 A;  2GGB A;  2BWW A;  2P9A A;  4U76 A;  5JI6 A;  4S01 A;  4FLK A;  4S00 A;  2Q95 A;  2B3K A;  4OOK A;  4U6J A;  1XGO A;  3S6B A;  2IW2 A;  2MAT A;  5FCF A;  4ZNG A;  1C27 A;  2GG5 A;  1B6A A;  5CNX A;  2P99 A;  4FLJ A;  1JAW A;  4R60 A;  2B3L A;  1XGS A;  4IF7 A;  2GU6 A;  2GGC A;  3ROR A;  1C22 A;  2BH3 A;  3BIT A;  4U1B A;  2GG2 A;  2BWY A;  4U6E A;  1C24 A;  2B3H A;  4JUQ A;  4IKT A;  4RZZ A;  1WLR A;  4U6W A;  4FUK A;  1QXY A;  2BWV A;  2EVC A;  4U70 A;  4U6C A;  4ZWP A;  1CHM A;  3IU9 A;  3FMR A;  4PNC A;  1PV9 A;  3PKA A;  2BHB A;  2DFI A;  2GG3 A;  4FLI A;  4IKS A;  3TAV A;  3MR1 A;  4S2T P;  2G6P A;  2V3Y A;  1M35 A;  5CDV A;  1B59 A;  2Q93 A;  1WN1 A;  4U69 A;  1MAT A;  1WKM A;  1R5H A;  5CDE A;  1R58 A;  2ZSG A;  4QR8 A;  1C21 A;  3IU8 A;  2GG9 A;  2HOW A;  2Q96 A;  2GG8 A;  4A6V A;  1N51 A;  2GU4 A;  4FKC A;  1Y1N A;  2OAZ A;  2BWX A;  3PKB A;  2BB7 A;  3PKC A;  4FLL A;  4U75 A;  4IKU A;  1BN5 A;  2BWU A;  3CB5 A;  1KQ9 A;  1YVM A;  4FO7 A;  2ADU A;  1WBQ A;  3TB5 A;  2GU7 A;  4FO8 A;  3BIQ A;  3PKD A;  2EVM A;  3BIP A;  4IDY A;  1WY2 A;  2BWS A;  2V3Z A;  1W2M A;  1C23 A;  2GTX A;  5CE6 A;  1YJ3 A;  1YW7 A;  4IKR A;  2BWT A;  1W7V A;  4IEC A;  4KM3 A;  2Q8K A;  3FM3 A;  4ZWO A;  3IG4 A;  2GG0 A;  5JHU A;  1QZY A;  1XNZ A;  2V6C A;  3Q6D A;  4ZWU A;  2OKN A;  1A16 A;  1XGM A;  1WL6 A;  2BN7 A;  1O0X A;  4PV4 A;  5D6E A;  3FMQ A;  2GZ5 A;  1WL9 A;  2V3X A;  1R5G A;  4HXX A;  4B28 A;  2BHC A;  2P98 A;  3L24 A;  4U6Z A;  5E5B A;  2NQ7 A;  2BHA A;  2GA2 A;  4Z7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...