2GG7A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 85
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg7A00
1QXYA 3PKBA 4PV4A 4U6ZA 1MATA 4IECA 4U69A 5JI6A 1JAWA 5CIKA 3FMQA 1B6AA 3PKAA 1R58A 1C21A 2ADUA 3IU9A 2P9AA 2NQ6A 1XNZA 5CDLA 2BHDA 4R60A 1N51A 2GU6A 5CDEA 2BWUA 4U1BA 5JFRA 4FUKA 2NQ7A 1C27A 3FM3A 5E5BA 3RORA 2EA4A 4MATA 4IDYA 2EA2A 2Q95A 4IU6A 1PV9A 2EVCA 2BWVA 5JHUA 5CNXA 2V6CA 2DFIA 2G6PA 3MX6A 4PNCA 3CB5A 4ZNGA 2OKNA 2V3ZA 4U71A 1YW7A 2P99A 5CLSA 5D6EA 4JUQA 2Q94A 4B28A 2GG0A 5FCFA 2BWTA 3Q6DA 3D27A 1W7VA 1WY2A 4ZWUA 2GG5A 2GG9A 2GA2A 4FLIA 3RVAA 1O0XA 2GU5A 5FCHA 1WL9A 1R5GA 2V3YA 4RZYA 1KQ0A 2GGBA 3L7GA 3PKEA 2BB7A 4FKCA 4OOKA 3CTZA 3S6BA 4U6EA 3PKDA 3MATA 4FLKA 2MATA 4U73A 4S2TP 2BWSA 1CHMA 2Q8KA 1XGOA 2BWXA 4S01A 1YW8A 2GU7A 2HOWA 4ZWOA 1C22A 4Z7MA 2B3KA 3BIQA 5CE6A 2EVMA 2P98A 1KP0A 1YVMA 3TB5A 2BHBA 3MR1A 4ZWPA 4IKTA 2GZ5A 4IKUA 2BHCA 2GG7A 2BN7A 1Y1NA 5CDVA 4RGZ1 2Q92A 4U6WA 2B3HA 2Q93A 3BIPA 1BOAA 2BWWA 3BITA 1WKMA 3IU8A 2GU4A 4FO7A 4U6JA 2B3LA 4KM3A 2GG2A 2Q96A 2GGCA 2GG3A 1W2MA 2GG8A 4U75A 2ZSGA 2BWYA 3IG4A 4S2RP 1WN1A 4EGEA 1XGMA 2V3XA 1R5HA 1C24A 4S00A 1XGSA 5D6FA 4U76A 4IKRA 4QR8A 1YJ3A 1WL6A 2OAZA 2BH3A 3L24A 1QZYA 1WBQA 3CB6A 4U6CA 2EVOA 3IU7A 3FMRA 4RZZA 3TAVA 4FO8A 2BHAA 4HXXA 4IPAA 4FLJA 4U70A 4IF7A 4A6WA 1M35A 1C23A 4FLLA 2GTXA 1BN5A 1QXWA 1B59A 3PKCA 1XGNA 2IW2A 4IKSA 1WLRA 1YW9A 1A16A 4A6VA 1KQ9A 1QXZA
chains in the Genus database with same CATH superfamily
1QXYA 3PKBA 4PV4A 4U6ZA 1MATA 4IECA 4U69A 5JI6A 1JAWA 5CIKA 3FMQA 1B6AA 3PKAA 1R58A 1C21A 2ADUA 3IU9A 2P9AA 2NQ6A 1XNZA 5CDLA 2BHDA 4R60A 1N51A 2GU6A 5CDEA 2BWUA 4U1BA 5JFRA 4FUKA 2NQ7A 1C27A 3FM3A 5E5BA 3RORA 2EA4A 4MATA 4IDYA 2EA2A 2Q95A 4IU6A 1PV9A 2EVCA 2BWVA 5JHUA 5CNXA 2V6CA 2DFIA 2G6PA 3MX6A 4PNCA 3CB5A 4ZNGA 2OKNA 2V3ZA 4U71A 1YW7A 2P99A 5CLSA 5D6EA 4JUQA 2Q94A 4B28A 2GG0A 5FCFA 2BWTA 3Q6DA 3D27A 1W7VA 1WY2A 4ZWUA 2GG5A 2GG9A 2GA2A 4FLIA 3RVAA 1O0XA 2GU5A 5FCHA 1WL9A 1R5GA 2V3YA 4RZYA 1KQ0A 2GGBA 3L7GA 3PKEA 2BB7A 4FKCA 4OOKA 3CTZA 3S6BA 4U6EA 3PKDA 3MATA 4FLKA 2MATA 4U73A 4S2TP 2BWSA 1CHMA 2Q8KA 1XGOA 2BWXA 4S01A 1YW8A 2GU7A 2HOWA 4ZWOA 1C22A 4Z7MA 2B3KA 3BIQA 5CE6A 2EVMA 2P98A 1KP0A 1YVMA 3TB5A 2BHBA 3MR1A 4ZWPA 4IKTA 2GZ5A 4IKUA 2BHCA 2GG7A 2BN7A 1Y1NA 5CDVA 4RGZ1 2Q92A 4U6WA 2B3HA 2Q93A 3BIPA 1BOAA 2BWWA 3BITA 1WKMA 3IU8A 2GU4A 4FO7A 4U6JA 2B3LA 4KM3A 2GG2A 2Q96A 2GGCA 2GG3A 1W2MA 2GG8A 4U75A 2ZSGA 2BWYA 3IG4A 4S2RP 1WN1A 4EGEA 1XGMA 2V3XA 1R5HA 1C24A 4S00A 1XGSA 5D6FA 4U76A 4IKRA 4QR8A 1YJ3A 1WL6A 2OAZA 2BH3A 3L24A 1QZYA 1WBQA 3CB6A 4U6CA 2EVOA 3IU7A 3FMRA 4RZZA 3TAVA 4FO8A 2BHAA 4HXXA 4IPAA 4FLJA 4U70A 4IF7A 4A6WA 1M35A 1C23A 4FLLA 2GTXA 1BN5A 1QXWA 1B59A 3PKCA 1XGNA 2IW2A 4IKSA 1WLRA 1YW9A 1A16A 4A6VA 1KQ9A 1QXZA
chains in the Genus database with same CATH topology
1QXYA 3PKBA 4PV4A 4U6ZA 1MATA 4IECA 4U69A 5JI6A 1JAWA 5CIKA 3FMQA 1B6AA 3PKAA 1R58A 1C21A 2ADUA 3IU9A 2P9AA 2NQ6A 1XNZA 5CDLA 2BHDA 4R60A 1N51A 2GU6A 5CDEA 2BWUA 4U1BA 5JFRA 4FUKA 2NQ7A 1C27A 3FM3A 5E5BA 3RORA 2EA4A 4MATA 4IDYA 2EA2A 2Q95A 4IU6A 1PV9A 2EVCA 2BWVA 5JHUA 5CNXA 2V6CA 2DFIA 2G6PA 3MX6A 4PNCA 3CB5A 4ZNGA 2OKNA 2V3ZA 4U71A 1YW7A 2P99A 5CLSA 5D6EA 4JUQA 2Q94A 4B28A 2GG0A 5FCFA 2BWTA 3Q6DA 3D27A 1W7VA 1WY2A 4ZWUA 2GG5A 2GG9A 2GA2A 4FLIA 3RVAA 1O0XA 2GU5A 5FCHA 1WL9A 1R5GA 2V3YA 4RZYA 1KQ0A 2GGBA 3L7GA 3PKEA 2BB7A 4FKCA 4OOKA 3CTZA 3S6BA 4U6EA 3PKDA 3MATA 4FLKA 2MATA 4U73A 4S2TP 2BWSA 1CHMA 2Q8KA 1XGOA 2BWXA 4S01A 1YW8A 2GU7A 2HOWA 4ZWOA 1C22A 4Z7MA 2B3KA 3BIQA 5CE6A 2EVMA 2P98A 1KP0A 1YVMA 3TB5A 2BHBA 3MR1A 4ZWPA 4IKTA 2GZ5A 4IKUA 2BHCA 2GG7A 2BN7A 1Y1NA 5CDVA 4RGZ1 2Q92A 4U6WA 2B3HA 2Q93A 3BIPA 1BOAA 2BWWA 3BITA 1WKMA 3IU8A 2GU4A 4FO7A 4U6JA 2B3LA 4KM3A 2GG2A 2Q96A 2GGCA 2GG3A 1W2MA 2GG8A 4U75A 2ZSGA 2BWYA 3IG4A 4S2RP 1WN1A 4EGEA 1XGMA 2V3XA 1R5HA 1C24A 4S00A 1XGSA 5D6FA 4U76A 4IKRA 4QR8A 1YJ3A 1WL6A 2OAZA 2BH3A 3L24A 1QZYA 1WBQA 3CB6A 4U6CA 2EVOA 3IU7A 3FMRA 4RZZA 3TAVA 4FO8A 2BHAA 4HXXA 4IPAA 4FLJA 4U70A 4IF7A 4A6WA 1M35A 1C23A 4FLLA 2GTXA 1BN5A 1QXWA 1B59A 3PKCA 1XGNA 2IW2A 4IKSA 1WLRA 1YW9A 1A16A 4A6VA 1KQ9A 1QXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXY A;  3PKB A;  4PV4 A;  4U6Z A;  1MAT A;  4IEC A;  4U69 A;  5JI6 A;  1JAW A;  5CIK A;  3FMQ A;  1B6A A;  3PKA A;  1R58 A;  1C21 A;  2ADU A;  3IU9 A;  2P9A A;  2NQ6 A;  1XNZ A;  5CDL A;  2BHD A;  4R60 A;  1N51 A;  2GU6 A;  5CDE A;  2BWU A;  4U1B A;  5JFR A;  4FUK A;  2NQ7 A;  1C27 A;  3FM3 A;  5E5B A;  3ROR A;  2EA4 A;  4MAT A;  4IDY A;  2EA2 A;  2Q95 A;  4IU6 A;  1PV9 A;  2EVC A;  2BWV A;  5JHU A;  5CNX A;  2V6C A;  2DFI A;  2G6P A;  3MX6 A;  4PNC A;  3CB5 A;  4ZNG A;  2OKN A;  2V3Z A;  4U71 A;  1YW7 A;  2P99 A;  5CLS A;  5D6E A;  4JUQ A;  2Q94 A;  4B28 A;  2GG0 A;  5FCF A;  2BWT A;  3Q6D A;  3D27 A;  1W7V A;  1WY2 A;  4ZWU A;  2GG5 A;  2GG9 A;  2GA2 A;  4FLI A;  3RVA A;  1O0X A;  2GU5 A;  5FCH A;  1WL9 A;  1R5G A;  2V3Y A;  4RZY A;  1KQ0 A;  2GGB A;  3L7G A;  3PKE A;  2BB7 A;  4FKC A;  4OOK A;  3CTZ A;  3S6B A;  4U6E A;  3PKD A;  3MAT A;  4FLK A;  2MAT A;  4U73 A;  4S2T P;  2BWS A;  1CHM A;  2Q8K A;  1XGO A;  2BWX A;  4S01 A;  1YW8 A;  2GU7 A;  2HOW A;  4ZWO A;  1C22 A;  4Z7M A;  2B3K A;  3BIQ A;  5CE6 A;  2EVM A;  2P98 A;  1KP0 A;  1YVM A;  3TB5 A;  2BHB A;  3MR1 A;  4ZWP A;  4IKT A;  2GZ5 A;  4IKU A;  2BHC A;  2GG7 A;  2BN7 A;  1Y1N A;  5CDV A;  4RGZ 1;  2Q92 A;  4U6W A;  2B3H A;  2Q93 A;  3BIP A;  1BOA A;  2BWW A;  3BIT A;  1WKM A;  3IU8 A;  2GU4 A;  4FO7 A;  4U6J A;  2B3L A;  4KM3 A;  2GG2 A;  2Q96 A;  2GGC A;  2GG3 A;  1W2M A;  2GG8 A;  4U75 A;  2ZSG A;  2BWY A;  3IG4 A;  4S2R P;  1WN1 A;  4EGE A;  1XGM A;  2V3X A;  1R5H A;  1C24 A;  4S00 A;  1XGS A;  5D6F A;  4U76 A;  4IKR A;  4QR8 A;  1YJ3 A;  1WL6 A;  2OAZ A;  2BH3 A;  3L24 A;  1QZY A;  1WBQ A;  3CB6 A;  4U6C A;  2EVO A;  3IU7 A;  3FMR A;  4RZZ A;  3TAV A;  4FO8 A;  2BHA A;  4HXX A;  4IPA A;  4FLJ A;  4U70 A;  4IF7 A;  4A6W A;  1M35 A;  1C23 A;  4FLL A;  2GTX A;  1BN5 A;  1QXW A;  1B59 A;  3PKC A;  1XGN A;  2IW2 A;  4IKS A;  1WLR A;  1YW9 A;  1A16 A;  4A6V A;  1KQ9 A;  1QXZ A; 
#chains in the Genus database with same CATH topology
 1QXY A;  3PKB A;  4PV4 A;  4U6Z A;  1MAT A;  4IEC A;  4U69 A;  5JI6 A;  1JAW A;  5CIK A;  3FMQ A;  1B6A A;  3PKA A;  1R58 A;  1C21 A;  2ADU A;  3IU9 A;  2P9A A;  2NQ6 A;  1XNZ A;  5CDL A;  2BHD A;  4R60 A;  1N51 A;  2GU6 A;  5CDE A;  2BWU A;  4U1B A;  5JFR A;  4FUK A;  2NQ7 A;  1C27 A;  3FM3 A;  5E5B A;  3ROR A;  2EA4 A;  4MAT A;  4IDY A;  2EA2 A;  2Q95 A;  4IU6 A;  1PV9 A;  2EVC A;  2BWV A;  5JHU A;  5CNX A;  2V6C A;  2DFI A;  2G6P A;  3MX6 A;  4PNC A;  3CB5 A;  4ZNG A;  2OKN A;  2V3Z A;  4U71 A;  1YW7 A;  2P99 A;  5CLS A;  5D6E A;  4JUQ A;  2Q94 A;  4B28 A;  2GG0 A;  5FCF A;  2BWT A;  3Q6D A;  3D27 A;  1W7V A;  1WY2 A;  4ZWU A;  2GG5 A;  2GG9 A;  2GA2 A;  4FLI A;  3RVA A;  1O0X A;  2GU5 A;  5FCH A;  1WL9 A;  1R5G A;  2V3Y A;  4RZY A;  1KQ0 A;  2GGB A;  3L7G A;  3PKE A;  2BB7 A;  4FKC A;  4OOK A;  3CTZ A;  3S6B A;  4U6E A;  3PKD A;  3MAT A;  4FLK A;  2MAT A;  4U73 A;  4S2T P;  2BWS A;  1CHM A;  2Q8K A;  1XGO A;  2BWX A;  4S01 A;  1YW8 A;  2GU7 A;  2HOW A;  4ZWO A;  1C22 A;  4Z7M A;  2B3K A;  3BIQ A;  5CE6 A;  2EVM A;  2P98 A;  1KP0 A;  1YVM A;  3TB5 A;  2BHB A;  3MR1 A;  4ZWP A;  4IKT A;  2GZ5 A;  4IKU A;  2BHC A;  2GG7 A;  2BN7 A;  1Y1N A;  5CDV A;  4RGZ 1;  2Q92 A;  4U6W A;  2B3H A;  2Q93 A;  3BIP A;  1BOA A;  2BWW A;  3BIT A;  1WKM A;  3IU8 A;  2GU4 A;  4FO7 A;  4U6J A;  2B3L A;  4KM3 A;  2GG2 A;  2Q96 A;  2GGC A;  2GG3 A;  1W2M A;  2GG8 A;  4U75 A;  2ZSG A;  2BWY A;  3IG4 A;  4S2R P;  1WN1 A;  4EGE A;  1XGM A;  2V3X A;  1R5H A;  1C24 A;  4S00 A;  1XGS A;  5D6F A;  4U76 A;  4IKR A;  4QR8 A;  1YJ3 A;  1WL6 A;  2OAZ A;  2BH3 A;  3L24 A;  1QZY A;  1WBQ A;  3CB6 A;  4U6C A;  2EVO A;  3IU7 A;  3FMR A;  4RZZ A;  3TAV A;  4FO8 A;  2BHA A;  4HXX A;  4IPA A;  4FLJ A;  4U70 A;  4IF7 A;  4A6W A;  1M35 A;  1C23 A;  4FLL A;  2GTX A;  1BN5 A;  1QXW A;  1B59 A;  3PKC A;  1XGN A;  2IW2 A;  4IKS A;  1WLR A;  1YW9 A;  1A16 A;  4A6V A;  1KQ9 A;  1QXZ A; 
#chains in the Genus database with same CATH homology
 1QXY A;  3PKB A;  4PV4 A;  4U6Z A;  1MAT A;  4IEC A;  4U69 A;  5JI6 A;  1JAW A;  5CIK A;  3FMQ A;  1B6A A;  3PKA A;  1R58 A;  1C21 A;  2ADU A;  3IU9 A;  2P9A A;  2NQ6 A;  1XNZ A;  5CDL A;  2BHD A;  4R60 A;  1N51 A;  2GU6 A;  5CDE A;  2BWU A;  4U1B A;  5JFR A;  4FUK A;  2NQ7 A;  1C27 A;  3FM3 A;  5E5B A;  3ROR A;  2EA4 A;  4MAT A;  4IDY A;  2EA2 A;  2Q95 A;  4IU6 A;  1PV9 A;  2EVC A;  2BWV A;  5JHU A;  5CNX A;  2V6C A;  2DFI A;  2G6P A;  3MX6 A;  4PNC A;  3CB5 A;  4ZNG A;  2OKN A;  2V3Z A;  4U71 A;  1YW7 A;  2P99 A;  5CLS A;  5D6E A;  4JUQ A;  2Q94 A;  4B28 A;  2GG0 A;  5FCF A;  2BWT A;  3Q6D A;  3D27 A;  1W7V A;  1WY2 A;  4ZWU A;  2GG5 A;  2GG9 A;  2GA2 A;  4FLI A;  3RVA A;  1O0X A;  2GU5 A;  5FCH A;  1WL9 A;  1R5G A;  2V3Y A;  4RZY A;  1KQ0 A;  2GGB A;  3L7G A;  3PKE A;  2BB7 A;  4FKC A;  4OOK A;  3CTZ A;  3S6B A;  4U6E A;  3PKD A;  3MAT A;  4FLK A;  2MAT A;  4U73 A;  4S2T P;  2BWS A;  1CHM A;  2Q8K A;  1XGO A;  2BWX A;  4S01 A;  1YW8 A;  2GU7 A;  2HOW A;  4ZWO A;  1C22 A;  4Z7M A;  2B3K A;  3BIQ A;  5CE6 A;  2EVM A;  2P98 A;  1KP0 A;  1YVM A;  3TB5 A;  2BHB A;  3MR1 A;  4ZWP A;  4IKT A;  2GZ5 A;  4IKU A;  2BHC A;  2GG7 A;  2BN7 A;  1Y1N A;  5CDV A;  4RGZ 1;  2Q92 A;  4U6W A;  2B3H A;  2Q93 A;  3BIP A;  1BOA A;  2BWW A;  3BIT A;  1WKM A;  3IU8 A;  2GU4 A;  4FO7 A;  4U6J A;  2B3L A;  4KM3 A;  2GG2 A;  2Q96 A;  2GGC A;  2GG3 A;  1W2M A;  2GG8 A;  4U75 A;  2ZSG A;  2BWY A;  3IG4 A;  4S2R P;  1WN1 A;  4EGE A;  1XGM A;  2V3X A;  1R5H A;  1C24 A;  4S00 A;  1XGS A;  5D6F A;  4U76 A;  4IKR A;  4QR8 A;  1YJ3 A;  1WL6 A;  2OAZ A;  2BH3 A;  3L24 A;  1QZY A;  1WBQ A;  3CB6 A;  4U6C A;  2EVO A;  3IU7 A;  3FMR A;  4RZZ A;  3TAV A;  4FO8 A;  2BHA A;  4HXX A;  4IPA A;  4FLJ A;  4U70 A;  4IF7 A;  4A6W A;  1M35 A;  1C23 A;  4FLL A;  2GTX A;  1BN5 A;  1QXW A;  1B59 A;  3PKC A;  1XGN A;  2IW2 A;  4IKS A;  1WLR A;  1YW9 A;  1A16 A;  4A6V A;  1KQ9 A;  1QXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...