2GG7A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 85
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg7A00
2BWTA 4B28A 1C27A 1YW9A 3MX6A 1XGNA 2BWUA 2Q93A 2OKNA 5D6EA 1YW8A 1QXZA 1R5HA 3BIQA 4Z7MA 1M35A 2GG0A 4S00A 4U6EA 5FCHA 4FKCA 1QZYA 3TB5A 1KP0A 2GU6A 5CLSA 4U6WA 4EGEA 1WLRA 2P98A 4U1BA 3FM3A 4U73A 2EVMA 1R5GA 4OOKA 2GGCA 4IKTA 5E5BA 2V3XA 4FLLA 2GG5A 4IKRA 2MATA 2GGBA 4A6WA 2BWVA 2GG3A 3PKEA 4S2TP 4U69A 4FUKA 3CB6A 4IKUA 1WBQA 3Q6DA 1WY2A 2EA2A 4KM3A 3RVAA 2BHCA 4IDYA 4FLIA 5JFRA 2Q8KA 1B6AA 4ZWOA 3PKAA 1QXWA 5CDVA 5CE6A 1MATA 3RORA 2GG9A 2Q92A 2EVCA 1XNZA 2BHBA 4FO7A 3L7GA 2Q95A 4IU6A 4RZZA 5D6FA 1KQ0A 3IG4A 4U75A 2BWYA 1Y1NA 2GZ5A 1CHMA 1XGSA 4U76A 2EVOA 1BOAA 3FMQA 2EA4A 4ZNGA 2Q96A 4U70A 5JHUA 2ZSGA 4S01A 2GG8A 2GU5A 1O0XA 1QXYA 1WL9A 4PV4A 3IU7A 4U6CA 4U6JA 3TAVA 1B59A 2ADUA 2NQ6A 4JUQA 2BN7A 1W7VA 2B3HA 2G6PA 1WL6A 3L24A 3PKCA 2B3LA 2DFIA 2BH3A 1XGMA 4U6ZA 4S2RP 3S6BA 1A16A 4FLKA 1XGOA 1WKMA 2V6CA 3MR1A 4FLJA 1YVMA 4IECA 3PKDA 2HOWA 2NQ7A 1C22A 2V3YA 3FMRA 4RZYA 5FCFA 2BHDA 3IU9A 1C23A 2Q94A 1JAWA 2V3ZA 4ZWPA 2OAZA 1KQ9A 2P99A 1YJ3A 3D27A 4IF7A 4R60A 1C21A 2GG2A 5CDLA 4QR8A 1BN5A 2BB7A 5CIKA 3MATA 5JI6A 2GTXA 4IKSA 5CNXA 2BWXA 4ZWUA 2IW2A 1N51A 3PKBA 4RGZ1 2B3KA 2GU4A 2BWSA 4PNCA 1WN1A 4A6VA 1W2MA 4FO8A 3IU8A 4MATA 2BWWA 3CB5A 4HXXA 2BHAA 5CDEA 3BITA 2P9AA 1PV9A 1C24A 1YW7A 2GA2A 2GU7A 3BIPA 2GG7A 4IPAA 3CTZA 4U71A 1R58A
chains in the Genus database with same CATH superfamily
2BWTA 4B28A 1C27A 1YW9A 3MX6A 1XGNA 2BWUA 2Q93A 2OKNA 5D6EA 1YW8A 1QXZA 1R5HA 3BIQA 4Z7MA 1M35A 2GG0A 4S00A 4U6EA 5FCHA 4FKCA 1QZYA 3TB5A 1KP0A 2GU6A 5CLSA 4U6WA 4EGEA 1WLRA 2P98A 4U1BA 3FM3A 4U73A 2EVMA 1R5GA 4OOKA 2GGCA 4IKTA 5E5BA 2V3XA 4FLLA 2GG5A 4IKRA 2MATA 2GGBA 4A6WA 2BWVA 2GG3A 3PKEA 4S2TP 4U69A 4FUKA 3CB6A 4IKUA 1WBQA 3Q6DA 1WY2A 2EA2A 4KM3A 3RVAA 2BHCA 4IDYA 4FLIA 5JFRA 2Q8KA 1B6AA 4ZWOA 3PKAA 1QXWA 5CDVA 5CE6A 1MATA 3RORA 2GG9A 2Q92A 2EVCA 1XNZA 2BHBA 4FO7A 3L7GA 2Q95A 4IU6A 4RZZA 5D6FA 1KQ0A 3IG4A 4U75A 2BWYA 1Y1NA 2GZ5A 1CHMA 1XGSA 4U76A 2EVOA 1BOAA 3FMQA 2EA4A 4ZNGA 2Q96A 4U70A 5JHUA 2ZSGA 4S01A 2GG8A 2GU5A 1O0XA 1QXYA 1WL9A 4PV4A 3IU7A 4U6CA 4U6JA 3TAVA 1B59A 2ADUA 2NQ6A 4JUQA 2BN7A 1W7VA 2B3HA 2G6PA 1WL6A 3L24A 3PKCA 2B3LA 2DFIA 2BH3A 1XGMA 4U6ZA 4S2RP 3S6BA 1A16A 4FLKA 1XGOA 1WKMA 2V6CA 3MR1A 4FLJA 1YVMA 4IECA 3PKDA 2HOWA 2NQ7A 1C22A 2V3YA 3FMRA 4RZYA 5FCFA 2BHDA 3IU9A 1C23A 2Q94A 1JAWA 2V3ZA 4ZWPA 2OAZA 1KQ9A 2P99A 1YJ3A 3D27A 4IF7A 4R60A 1C21A 2GG2A 5CDLA 4QR8A 1BN5A 2BB7A 5CIKA 3MATA 5JI6A 2GTXA 4IKSA 5CNXA 2BWXA 4ZWUA 2IW2A 1N51A 3PKBA 4RGZ1 2B3KA 2GU4A 2BWSA 4PNCA 1WN1A 4A6VA 1W2MA 4FO8A 3IU8A 4MATA 2BWWA 3CB5A 4HXXA 2BHAA 5CDEA 3BITA 2P9AA 1PV9A 1C24A 1YW7A 2GA2A 2GU7A 3BIPA 2GG7A 4IPAA 3CTZA 4U71A 1R58A
chains in the Genus database with same CATH topology
2BWTA 4B28A 1C27A 1YW9A 3MX6A 1XGNA 2BWUA 2Q93A 2OKNA 5D6EA 1YW8A 1QXZA 1R5HA 3BIQA 4Z7MA 1M35A 2GG0A 4S00A 4U6EA 5FCHA 4FKCA 1QZYA 3TB5A 1KP0A 2GU6A 5CLSA 4U6WA 4EGEA 1WLRA 2P98A 4U1BA 3FM3A 4U73A 2EVMA 1R5GA 4OOKA 2GGCA 4IKTA 5E5BA 2V3XA 4FLLA 2GG5A 4IKRA 2MATA 2GGBA 4A6WA 2BWVA 2GG3A 3PKEA 4S2TP 4U69A 4FUKA 3CB6A 4IKUA 1WBQA 3Q6DA 1WY2A 2EA2A 4KM3A 3RVAA 2BHCA 4IDYA 4FLIA 5JFRA 2Q8KA 1B6AA 4ZWOA 3PKAA 1QXWA 5CDVA 5CE6A 1MATA 3RORA 2GG9A 2Q92A 2EVCA 1XNZA 2BHBA 4FO7A 3L7GA 2Q95A 4IU6A 4RZZA 5D6FA 1KQ0A 3IG4A 4U75A 2BWYA 1Y1NA 2GZ5A 1CHMA 1XGSA 4U76A 2EVOA 1BOAA 3FMQA 2EA4A 4ZNGA 2Q96A 4U70A 5JHUA 2ZSGA 4S01A 2GG8A 2GU5A 1O0XA 1QXYA 1WL9A 4PV4A 3IU7A 4U6CA 4U6JA 3TAVA 1B59A 2ADUA 2NQ6A 4JUQA 2BN7A 1W7VA 2B3HA 2G6PA 1WL6A 3L24A 3PKCA 2B3LA 2DFIA 2BH3A 1XGMA 4U6ZA 4S2RP 3S6BA 1A16A 4FLKA 1XGOA 1WKMA 2V6CA 3MR1A 4FLJA 1YVMA 4IECA 3PKDA 2HOWA 2NQ7A 1C22A 2V3YA 3FMRA 4RZYA 5FCFA 2BHDA 3IU9A 1C23A 2Q94A 1JAWA 2V3ZA 4ZWPA 2OAZA 1KQ9A 2P99A 1YJ3A 3D27A 4IF7A 4R60A 1C21A 2GG2A 5CDLA 4QR8A 1BN5A 2BB7A 5CIKA 3MATA 5JI6A 2GTXA 4IKSA 5CNXA 2BWXA 4ZWUA 2IW2A 1N51A 3PKBA 4RGZ1 2B3KA 2GU4A 2BWSA 4PNCA 1WN1A 4A6VA 1W2MA 4FO8A 3IU8A 4MATA 2BWWA 3CB5A 4HXXA 2BHAA 5CDEA 3BITA 2P9AA 1PV9A 1C24A 1YW7A 2GA2A 2GU7A 3BIPA 2GG7A 4IPAA 3CTZA 4U71A 1R58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWT A;  4B28 A;  1C27 A;  1YW9 A;  3MX6 A;  1XGN A;  2BWU A;  2Q93 A;  2OKN A;  5D6E A;  1YW8 A;  1QXZ A;  1R5H A;  3BIQ A;  4Z7M A;  1M35 A;  2GG0 A;  4S00 A;  4U6E A;  5FCH A;  4FKC A;  1QZY A;  3TB5 A;  1KP0 A;  2GU6 A;  5CLS A;  4U6W A;  4EGE A;  1WLR A;  2P98 A;  4U1B A;  3FM3 A;  4U73 A;  2EVM A;  1R5G A;  4OOK A;  2GGC A;  4IKT A;  5E5B A;  2V3X A;  4FLL A;  2GG5 A;  4IKR A;  2MAT A;  2GGB A;  4A6W A;  2BWV A;  2GG3 A;  3PKE A;  4S2T P;  4U69 A;  4FUK A;  3CB6 A;  4IKU A;  1WBQ A;  3Q6D A;  1WY2 A;  2EA2 A;  4KM3 A;  3RVA A;  2BHC A;  4IDY A;  4FLI A;  5JFR A;  2Q8K A;  1B6A A;  4ZWO A;  3PKA A;  1QXW A;  5CDV A;  5CE6 A;  1MAT A;  3ROR A;  2GG9 A;  2Q92 A;  2EVC A;  1XNZ A;  2BHB A;  4FO7 A;  3L7G A;  2Q95 A;  4IU6 A;  4RZZ A;  5D6F A;  1KQ0 A;  3IG4 A;  4U75 A;  2BWY A;  1Y1N A;  2GZ5 A;  1CHM A;  1XGS A;  4U76 A;  2EVO A;  1BOA A;  3FMQ A;  2EA4 A;  4ZNG A;  2Q96 A;  4U70 A;  5JHU A;  2ZSG A;  4S01 A;  2GG8 A;  2GU5 A;  1O0X A;  1QXY A;  1WL9 A;  4PV4 A;  3IU7 A;  4U6C A;  4U6J A;  3TAV A;  1B59 A;  2ADU A;  2NQ6 A;  4JUQ A;  2BN7 A;  1W7V A;  2B3H A;  2G6P A;  1WL6 A;  3L24 A;  3PKC A;  2B3L A;  2DFI A;  2BH3 A;  1XGM A;  4U6Z A;  4S2R P;  3S6B A;  1A16 A;  4FLK A;  1XGO A;  1WKM A;  2V6C A;  3MR1 A;  4FLJ A;  1YVM A;  4IEC A;  3PKD A;  2HOW A;  2NQ7 A;  1C22 A;  2V3Y A;  3FMR A;  4RZY A;  5FCF A;  2BHD A;  3IU9 A;  1C23 A;  2Q94 A;  1JAW A;  2V3Z A;  4ZWP A;  2OAZ A;  1KQ9 A;  2P99 A;  1YJ3 A;  3D27 A;  4IF7 A;  4R60 A;  1C21 A;  2GG2 A;  5CDL A;  4QR8 A;  1BN5 A;  2BB7 A;  5CIK A;  3MAT A;  5JI6 A;  2GTX A;  4IKS A;  5CNX A;  2BWX A;  4ZWU A;  2IW2 A;  1N51 A;  3PKB A;  4RGZ 1;  2B3K A;  2GU4 A;  2BWS A;  4PNC A;  1WN1 A;  4A6V A;  1W2M A;  4FO8 A;  3IU8 A;  4MAT A;  2BWW A;  3CB5 A;  4HXX A;  2BHA A;  5CDE A;  3BIT A;  2P9A A;  1PV9 A;  1C24 A;  1YW7 A;  2GA2 A;  2GU7 A;  3BIP A;  2GG7 A;  4IPA A;  3CTZ A;  4U71 A;  1R58 A; 
#chains in the Genus database with same CATH topology
 2BWT A;  4B28 A;  1C27 A;  1YW9 A;  3MX6 A;  1XGN A;  2BWU A;  2Q93 A;  2OKN A;  5D6E A;  1YW8 A;  1QXZ A;  1R5H A;  3BIQ A;  4Z7M A;  1M35 A;  2GG0 A;  4S00 A;  4U6E A;  5FCH A;  4FKC A;  1QZY A;  3TB5 A;  1KP0 A;  2GU6 A;  5CLS A;  4U6W A;  4EGE A;  1WLR A;  2P98 A;  4U1B A;  3FM3 A;  4U73 A;  2EVM A;  1R5G A;  4OOK A;  2GGC A;  4IKT A;  5E5B A;  2V3X A;  4FLL A;  2GG5 A;  4IKR A;  2MAT A;  2GGB A;  4A6W A;  2BWV A;  2GG3 A;  3PKE A;  4S2T P;  4U69 A;  4FUK A;  3CB6 A;  4IKU A;  1WBQ A;  3Q6D A;  1WY2 A;  2EA2 A;  4KM3 A;  3RVA A;  2BHC A;  4IDY A;  4FLI A;  5JFR A;  2Q8K A;  1B6A A;  4ZWO A;  3PKA A;  1QXW A;  5CDV A;  5CE6 A;  1MAT A;  3ROR A;  2GG9 A;  2Q92 A;  2EVC A;  1XNZ A;  2BHB A;  4FO7 A;  3L7G A;  2Q95 A;  4IU6 A;  4RZZ A;  5D6F A;  1KQ0 A;  3IG4 A;  4U75 A;  2BWY A;  1Y1N A;  2GZ5 A;  1CHM A;  1XGS A;  4U76 A;  2EVO A;  1BOA A;  3FMQ A;  2EA4 A;  4ZNG A;  2Q96 A;  4U70 A;  5JHU A;  2ZSG A;  4S01 A;  2GG8 A;  2GU5 A;  1O0X A;  1QXY A;  1WL9 A;  4PV4 A;  3IU7 A;  4U6C A;  4U6J A;  3TAV A;  1B59 A;  2ADU A;  2NQ6 A;  4JUQ A;  2BN7 A;  1W7V A;  2B3H A;  2G6P A;  1WL6 A;  3L24 A;  3PKC A;  2B3L A;  2DFI A;  2BH3 A;  1XGM A;  4U6Z A;  4S2R P;  3S6B A;  1A16 A;  4FLK A;  1XGO A;  1WKM A;  2V6C A;  3MR1 A;  4FLJ A;  1YVM A;  4IEC A;  3PKD A;  2HOW A;  2NQ7 A;  1C22 A;  2V3Y A;  3FMR A;  4RZY A;  5FCF A;  2BHD A;  3IU9 A;  1C23 A;  2Q94 A;  1JAW A;  2V3Z A;  4ZWP A;  2OAZ A;  1KQ9 A;  2P99 A;  1YJ3 A;  3D27 A;  4IF7 A;  4R60 A;  1C21 A;  2GG2 A;  5CDL A;  4QR8 A;  1BN5 A;  2BB7 A;  5CIK A;  3MAT A;  5JI6 A;  2GTX A;  4IKS A;  5CNX A;  2BWX A;  4ZWU A;  2IW2 A;  1N51 A;  3PKB A;  4RGZ 1;  2B3K A;  2GU4 A;  2BWS A;  4PNC A;  1WN1 A;  4A6V A;  1W2M A;  4FO8 A;  3IU8 A;  4MAT A;  2BWW A;  3CB5 A;  4HXX A;  2BHA A;  5CDE A;  3BIT A;  2P9A A;  1PV9 A;  1C24 A;  1YW7 A;  2GA2 A;  2GU7 A;  3BIP A;  2GG7 A;  4IPA A;  3CTZ A;  4U71 A;  1R58 A; 
#chains in the Genus database with same CATH homology
 2BWT A;  4B28 A;  1C27 A;  1YW9 A;  3MX6 A;  1XGN A;  2BWU A;  2Q93 A;  2OKN A;  5D6E A;  1YW8 A;  1QXZ A;  1R5H A;  3BIQ A;  4Z7M A;  1M35 A;  2GG0 A;  4S00 A;  4U6E A;  5FCH A;  4FKC A;  1QZY A;  3TB5 A;  1KP0 A;  2GU6 A;  5CLS A;  4U6W A;  4EGE A;  1WLR A;  2P98 A;  4U1B A;  3FM3 A;  4U73 A;  2EVM A;  1R5G A;  4OOK A;  2GGC A;  4IKT A;  5E5B A;  2V3X A;  4FLL A;  2GG5 A;  4IKR A;  2MAT A;  2GGB A;  4A6W A;  2BWV A;  2GG3 A;  3PKE A;  4S2T P;  4U69 A;  4FUK A;  3CB6 A;  4IKU A;  1WBQ A;  3Q6D A;  1WY2 A;  2EA2 A;  4KM3 A;  3RVA A;  2BHC A;  4IDY A;  4FLI A;  5JFR A;  2Q8K A;  1B6A A;  4ZWO A;  3PKA A;  1QXW A;  5CDV A;  5CE6 A;  1MAT A;  3ROR A;  2GG9 A;  2Q92 A;  2EVC A;  1XNZ A;  2BHB A;  4FO7 A;  3L7G A;  2Q95 A;  4IU6 A;  4RZZ A;  5D6F A;  1KQ0 A;  3IG4 A;  4U75 A;  2BWY A;  1Y1N A;  2GZ5 A;  1CHM A;  1XGS A;  4U76 A;  2EVO A;  1BOA A;  3FMQ A;  2EA4 A;  4ZNG A;  2Q96 A;  4U70 A;  5JHU A;  2ZSG A;  4S01 A;  2GG8 A;  2GU5 A;  1O0X A;  1QXY A;  1WL9 A;  4PV4 A;  3IU7 A;  4U6C A;  4U6J A;  3TAV A;  1B59 A;  2ADU A;  2NQ6 A;  4JUQ A;  2BN7 A;  1W7V A;  2B3H A;  2G6P A;  1WL6 A;  3L24 A;  3PKC A;  2B3L A;  2DFI A;  2BH3 A;  1XGM A;  4U6Z A;  4S2R P;  3S6B A;  1A16 A;  4FLK A;  1XGO A;  1WKM A;  2V6C A;  3MR1 A;  4FLJ A;  1YVM A;  4IEC A;  3PKD A;  2HOW A;  2NQ7 A;  1C22 A;  2V3Y A;  3FMR A;  4RZY A;  5FCF A;  2BHD A;  3IU9 A;  1C23 A;  2Q94 A;  1JAW A;  2V3Z A;  4ZWP A;  2OAZ A;  1KQ9 A;  2P99 A;  1YJ3 A;  3D27 A;  4IF7 A;  4R60 A;  1C21 A;  2GG2 A;  5CDL A;  4QR8 A;  1BN5 A;  2BB7 A;  5CIK A;  3MAT A;  5JI6 A;  2GTX A;  4IKS A;  5CNX A;  2BWX A;  4ZWU A;  2IW2 A;  1N51 A;  3PKB A;  4RGZ 1;  2B3K A;  2GU4 A;  2BWS A;  4PNC A;  1WN1 A;  4A6V A;  1W2M A;  4FO8 A;  3IU8 A;  4MAT A;  2BWW A;  3CB5 A;  4HXX A;  2BHA A;  5CDE A;  3BIT A;  2P9A A;  1PV9 A;  1C24 A;  1YW7 A;  2GA2 A;  2GU7 A;  3BIP A;  2GG7 A;  4IPA A;  3CTZ A;  4U71 A;  1R58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...