2GG7A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 85
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg7A00
4U70A 5CDVA 4RZYA 5E5BA 2Q93A 1XGMA 2BHBA 4ZWPA 3S6BA 4U69A 1B6AA 2B3LA 1B59A 4IKTA 4U6WA 1QXWA 2P99A 4S2TP 1C21A 1YVMA 4IECA 4A6WA 2GG3A 4FLKA 3L24A 4KM3A 1R5HA 4FUKA 2BH3A 2GA2A 2GU5A 3RVAA 2BB7A 1W2MA 3FMRA 2IW2A 2OAZA 1XNZA 1KP0A 2GU6A 4HXXA 1A16A 3BIPA 4FLLA 1WY2A 4S2RP 5CDEA 4OOKA 2NQ6A 3FM3A 2EA2A 2P9AA 5FCFA 1WKMA 2ZSGA 4U75A 4PV4A 3PKDA 3PKCA 4U6ZA 4U6JA 3MATA 4ZNGA 4U76A 2EVMA 4Z7MA 1KQ0A 2V3YA 1C22A 5CNXA 1WLRA 1WL9A 1XGNA 2Q94A 4R60A 2BHAA 4U1BA 1PV9A 4IKSA 3BIQA 1YW9A 4ZWUA 5CIKA 2V3ZA 2NQ7A 1QZYA 5JFRA 2EA4A 1N51A 3IU9A 2BHDA 3PKAA 4IU6A 2GU7A 2GZ5A 2MATA 1MATA 4U73A 2GTXA 3MR1A 2BWWA 2GG2A 4RGZ1 1KQ9A 4U6EA 1R5GA 1C23A 1R58A 1M35A 2BWYA 1QXYA 2GG0A 2HOWA 3PKBA 4IF7A 2GG5A 3D27A 2V3XA 1WN1A 5JI6A 2ADUA 1BOAA 1YJ3A 4S01A 1XGOA 4FLJA 4QR8A 4IKRA 3IG4A 3L7GA 2OKNA 5D6EA 3PKEA 4U6CA 4JUQA 2BWUA 3CB5A 5CLSA 2BWSA 3IU8A 1WBQA 2GG8A 2GGBA 1O0XA 1CHMA 1W7VA 2Q96A 4IKUA 1YW7A 3FMQA 5JHUA 2B3HA 2DFIA 2V6CA 3CB6A 1Y1NA 2G6PA 4FO7A 4MATA 1BN5A 3TAVA 1JAWA 3MX6A 4B28A 2Q95A 3CTZA 4FKCA 2EVCA 2GG9A 5D6FA 2GU4A 2BWTA 3TB5A 2Q8KA 1C27A 5CE6A 5FCHA 4S00A 1YW8A 3BITA 4RZZA 2Q92A 2EVOA 2P98A 4FLIA 2GG7A 2BWXA 1XGSA 4IDYA 4EGEA 4PNCA 4ZWOA 1QXZA 4U71A 1WL6A 2B3KA 2BWVA 2GGCA 5CDLA 3Q6DA 4A6VA 1C24A 4IPAA 2BN7A 4FO8A 2BHCA 3RORA 3IU7A
chains in the Genus database with same CATH superfamily
4U70A 5CDVA 4RZYA 5E5BA 2Q93A 1XGMA 2BHBA 4ZWPA 3S6BA 4U69A 1B6AA 2B3LA 1B59A 4IKTA 4U6WA 1QXWA 2P99A 4S2TP 1C21A 1YVMA 4IECA 4A6WA 2GG3A 4FLKA 3L24A 4KM3A 1R5HA 4FUKA 2BH3A 2GA2A 2GU5A 3RVAA 2BB7A 1W2MA 3FMRA 2IW2A 2OAZA 1XNZA 1KP0A 2GU6A 4HXXA 1A16A 3BIPA 4FLLA 1WY2A 4S2RP 5CDEA 4OOKA 2NQ6A 3FM3A 2EA2A 2P9AA 5FCFA 1WKMA 2ZSGA 4U75A 4PV4A 3PKDA 3PKCA 4U6ZA 4U6JA 3MATA 4ZNGA 4U76A 2EVMA 4Z7MA 1KQ0A 2V3YA 1C22A 5CNXA 1WLRA 1WL9A 1XGNA 2Q94A 4R60A 2BHAA 4U1BA 1PV9A 4IKSA 3BIQA 1YW9A 4ZWUA 5CIKA 2V3ZA 2NQ7A 1QZYA 5JFRA 2EA4A 1N51A 3IU9A 2BHDA 3PKAA 4IU6A 2GU7A 2GZ5A 2MATA 1MATA 4U73A 2GTXA 3MR1A 2BWWA 2GG2A 4RGZ1 1KQ9A 4U6EA 1R5GA 1C23A 1R58A 1M35A 2BWYA 1QXYA 2GG0A 2HOWA 3PKBA 4IF7A 2GG5A 3D27A 2V3XA 1WN1A 5JI6A 2ADUA 1BOAA 1YJ3A 4S01A 1XGOA 4FLJA 4QR8A 4IKRA 3IG4A 3L7GA 2OKNA 5D6EA 3PKEA 4U6CA 4JUQA 2BWUA 3CB5A 5CLSA 2BWSA 3IU8A 1WBQA 2GG8A 2GGBA 1O0XA 1CHMA 1W7VA 2Q96A 4IKUA 1YW7A 3FMQA 5JHUA 2B3HA 2DFIA 2V6CA 3CB6A 1Y1NA 2G6PA 4FO7A 4MATA 1BN5A 3TAVA 1JAWA 3MX6A 4B28A 2Q95A 3CTZA 4FKCA 2EVCA 2GG9A 5D6FA 2GU4A 2BWTA 3TB5A 2Q8KA 1C27A 5CE6A 5FCHA 4S00A 1YW8A 3BITA 4RZZA 2Q92A 2EVOA 2P98A 4FLIA 2GG7A 2BWXA 1XGSA 4IDYA 4EGEA 4PNCA 4ZWOA 1QXZA 4U71A 1WL6A 2B3KA 2BWVA 2GGCA 5CDLA 3Q6DA 4A6VA 1C24A 4IPAA 2BN7A 4FO8A 2BHCA 3RORA 3IU7A
chains in the Genus database with same CATH topology
4U70A 5CDVA 4RZYA 5E5BA 2Q93A 1XGMA 2BHBA 4ZWPA 3S6BA 4U69A 1B6AA 2B3LA 1B59A 4IKTA 4U6WA 1QXWA 2P99A 4S2TP 1C21A 1YVMA 4IECA 4A6WA 2GG3A 4FLKA 3L24A 4KM3A 1R5HA 4FUKA 2BH3A 2GA2A 2GU5A 3RVAA 2BB7A 1W2MA 3FMRA 2IW2A 2OAZA 1XNZA 1KP0A 2GU6A 4HXXA 1A16A 3BIPA 4FLLA 1WY2A 4S2RP 5CDEA 4OOKA 2NQ6A 3FM3A 2EA2A 2P9AA 5FCFA 1WKMA 2ZSGA 4U75A 4PV4A 3PKDA 3PKCA 4U6ZA 4U6JA 3MATA 4ZNGA 4U76A 2EVMA 4Z7MA 1KQ0A 2V3YA 1C22A 5CNXA 1WLRA 1WL9A 1XGNA 2Q94A 4R60A 2BHAA 4U1BA 1PV9A 4IKSA 3BIQA 1YW9A 4ZWUA 5CIKA 2V3ZA 2NQ7A 1QZYA 5JFRA 2EA4A 1N51A 3IU9A 2BHDA 3PKAA 4IU6A 2GU7A 2GZ5A 2MATA 1MATA 4U73A 2GTXA 3MR1A 2BWWA 2GG2A 4RGZ1 1KQ9A 4U6EA 1R5GA 1C23A 1R58A 1M35A 2BWYA 1QXYA 2GG0A 2HOWA 3PKBA 4IF7A 2GG5A 3D27A 2V3XA 1WN1A 5JI6A 2ADUA 1BOAA 1YJ3A 4S01A 1XGOA 4FLJA 4QR8A 4IKRA 3IG4A 3L7GA 2OKNA 5D6EA 3PKEA 4U6CA 4JUQA 2BWUA 3CB5A 5CLSA 2BWSA 3IU8A 1WBQA 2GG8A 2GGBA 1O0XA 1CHMA 1W7VA 2Q96A 4IKUA 1YW7A 3FMQA 5JHUA 2B3HA 2DFIA 2V6CA 3CB6A 1Y1NA 2G6PA 4FO7A 4MATA 1BN5A 3TAVA 1JAWA 3MX6A 4B28A 2Q95A 3CTZA 4FKCA 2EVCA 2GG9A 5D6FA 2GU4A 2BWTA 3TB5A 2Q8KA 1C27A 5CE6A 5FCHA 4S00A 1YW8A 3BITA 4RZZA 2Q92A 2EVOA 2P98A 4FLIA 2GG7A 2BWXA 1XGSA 4IDYA 4EGEA 4PNCA 4ZWOA 1QXZA 4U71A 1WL6A 2B3KA 2BWVA 2GGCA 5CDLA 3Q6DA 4A6VA 1C24A 4IPAA 2BN7A 4FO8A 2BHCA 3RORA 3IU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U70 A;  5CDV A;  4RZY A;  5E5B A;  2Q93 A;  1XGM A;  2BHB A;  4ZWP A;  3S6B A;  4U69 A;  1B6A A;  2B3L A;  1B59 A;  4IKT A;  4U6W A;  1QXW A;  2P99 A;  4S2T P;  1C21 A;  1YVM A;  4IEC A;  4A6W A;  2GG3 A;  4FLK A;  3L24 A;  4KM3 A;  1R5H A;  4FUK A;  2BH3 A;  2GA2 A;  2GU5 A;  3RVA A;  2BB7 A;  1W2M A;  3FMR A;  2IW2 A;  2OAZ A;  1XNZ A;  1KP0 A;  2GU6 A;  4HXX A;  1A16 A;  3BIP A;  4FLL A;  1WY2 A;  4S2R P;  5CDE A;  4OOK A;  2NQ6 A;  3FM3 A;  2EA2 A;  2P9A A;  5FCF A;  1WKM A;  2ZSG A;  4U75 A;  4PV4 A;  3PKD A;  3PKC A;  4U6Z A;  4U6J A;  3MAT A;  4ZNG A;  4U76 A;  2EVM A;  4Z7M A;  1KQ0 A;  2V3Y A;  1C22 A;  5CNX A;  1WLR A;  1WL9 A;  1XGN A;  2Q94 A;  4R60 A;  2BHA A;  4U1B A;  1PV9 A;  4IKS A;  3BIQ A;  1YW9 A;  4ZWU A;  5CIK A;  2V3Z A;  2NQ7 A;  1QZY A;  5JFR A;  2EA4 A;  1N51 A;  3IU9 A;  2BHD A;  3PKA A;  4IU6 A;  2GU7 A;  2GZ5 A;  2MAT A;  1MAT A;  4U73 A;  2GTX A;  3MR1 A;  2BWW A;  2GG2 A;  4RGZ 1;  1KQ9 A;  4U6E A;  1R5G A;  1C23 A;  1R58 A;  1M35 A;  2BWY A;  1QXY A;  2GG0 A;  2HOW A;  3PKB A;  4IF7 A;  2GG5 A;  3D27 A;  2V3X A;  1WN1 A;  5JI6 A;  2ADU A;  1BOA A;  1YJ3 A;  4S01 A;  1XGO A;  4FLJ A;  4QR8 A;  4IKR A;  3IG4 A;  3L7G A;  2OKN A;  5D6E A;  3PKE A;  4U6C A;  4JUQ A;  2BWU A;  3CB5 A;  5CLS A;  2BWS A;  3IU8 A;  1WBQ A;  2GG8 A;  2GGB A;  1O0X A;  1CHM A;  1W7V A;  2Q96 A;  4IKU A;  1YW7 A;  3FMQ A;  5JHU A;  2B3H A;  2DFI A;  2V6C A;  3CB6 A;  1Y1N A;  2G6P A;  4FO7 A;  4MAT A;  1BN5 A;  3TAV A;  1JAW A;  3MX6 A;  4B28 A;  2Q95 A;  3CTZ A;  4FKC A;  2EVC A;  2GG9 A;  5D6F A;  2GU4 A;  2BWT A;  3TB5 A;  2Q8K A;  1C27 A;  5CE6 A;  5FCH A;  4S00 A;  1YW8 A;  3BIT A;  4RZZ A;  2Q92 A;  2EVO A;  2P98 A;  4FLI A;  2GG7 A;  2BWX A;  1XGS A;  4IDY A;  4EGE A;  4PNC A;  4ZWO A;  1QXZ A;  4U71 A;  1WL6 A;  2B3K A;  2BWV A;  2GGC A;  5CDL A;  3Q6D A;  4A6V A;  1C24 A;  4IPA A;  2BN7 A;  4FO8 A;  2BHC A;  3ROR A;  3IU7 A; 
#chains in the Genus database with same CATH topology
 4U70 A;  5CDV A;  4RZY A;  5E5B A;  2Q93 A;  1XGM A;  2BHB A;  4ZWP A;  3S6B A;  4U69 A;  1B6A A;  2B3L A;  1B59 A;  4IKT A;  4U6W A;  1QXW A;  2P99 A;  4S2T P;  1C21 A;  1YVM A;  4IEC A;  4A6W A;  2GG3 A;  4FLK A;  3L24 A;  4KM3 A;  1R5H A;  4FUK A;  2BH3 A;  2GA2 A;  2GU5 A;  3RVA A;  2BB7 A;  1W2M A;  3FMR A;  2IW2 A;  2OAZ A;  1XNZ A;  1KP0 A;  2GU6 A;  4HXX A;  1A16 A;  3BIP A;  4FLL A;  1WY2 A;  4S2R P;  5CDE A;  4OOK A;  2NQ6 A;  3FM3 A;  2EA2 A;  2P9A A;  5FCF A;  1WKM A;  2ZSG A;  4U75 A;  4PV4 A;  3PKD A;  3PKC A;  4U6Z A;  4U6J A;  3MAT A;  4ZNG A;  4U76 A;  2EVM A;  4Z7M A;  1KQ0 A;  2V3Y A;  1C22 A;  5CNX A;  1WLR A;  1WL9 A;  1XGN A;  2Q94 A;  4R60 A;  2BHA A;  4U1B A;  1PV9 A;  4IKS A;  3BIQ A;  1YW9 A;  4ZWU A;  5CIK A;  2V3Z A;  2NQ7 A;  1QZY A;  5JFR A;  2EA4 A;  1N51 A;  3IU9 A;  2BHD A;  3PKA A;  4IU6 A;  2GU7 A;  2GZ5 A;  2MAT A;  1MAT A;  4U73 A;  2GTX A;  3MR1 A;  2BWW A;  2GG2 A;  4RGZ 1;  1KQ9 A;  4U6E A;  1R5G A;  1C23 A;  1R58 A;  1M35 A;  2BWY A;  1QXY A;  2GG0 A;  2HOW A;  3PKB A;  4IF7 A;  2GG5 A;  3D27 A;  2V3X A;  1WN1 A;  5JI6 A;  2ADU A;  1BOA A;  1YJ3 A;  4S01 A;  1XGO A;  4FLJ A;  4QR8 A;  4IKR A;  3IG4 A;  3L7G A;  2OKN A;  5D6E A;  3PKE A;  4U6C A;  4JUQ A;  2BWU A;  3CB5 A;  5CLS A;  2BWS A;  3IU8 A;  1WBQ A;  2GG8 A;  2GGB A;  1O0X A;  1CHM A;  1W7V A;  2Q96 A;  4IKU A;  1YW7 A;  3FMQ A;  5JHU A;  2B3H A;  2DFI A;  2V6C A;  3CB6 A;  1Y1N A;  2G6P A;  4FO7 A;  4MAT A;  1BN5 A;  3TAV A;  1JAW A;  3MX6 A;  4B28 A;  2Q95 A;  3CTZ A;  4FKC A;  2EVC A;  2GG9 A;  5D6F A;  2GU4 A;  2BWT A;  3TB5 A;  2Q8K A;  1C27 A;  5CE6 A;  5FCH A;  4S00 A;  1YW8 A;  3BIT A;  4RZZ A;  2Q92 A;  2EVO A;  2P98 A;  4FLI A;  2GG7 A;  2BWX A;  1XGS A;  4IDY A;  4EGE A;  4PNC A;  4ZWO A;  1QXZ A;  4U71 A;  1WL6 A;  2B3K A;  2BWV A;  2GGC A;  5CDL A;  3Q6D A;  4A6V A;  1C24 A;  4IPA A;  2BN7 A;  4FO8 A;  2BHC A;  3ROR A;  3IU7 A; 
#chains in the Genus database with same CATH homology
 4U70 A;  5CDV A;  4RZY A;  5E5B A;  2Q93 A;  1XGM A;  2BHB A;  4ZWP A;  3S6B A;  4U69 A;  1B6A A;  2B3L A;  1B59 A;  4IKT A;  4U6W A;  1QXW A;  2P99 A;  4S2T P;  1C21 A;  1YVM A;  4IEC A;  4A6W A;  2GG3 A;  4FLK A;  3L24 A;  4KM3 A;  1R5H A;  4FUK A;  2BH3 A;  2GA2 A;  2GU5 A;  3RVA A;  2BB7 A;  1W2M A;  3FMR A;  2IW2 A;  2OAZ A;  1XNZ A;  1KP0 A;  2GU6 A;  4HXX A;  1A16 A;  3BIP A;  4FLL A;  1WY2 A;  4S2R P;  5CDE A;  4OOK A;  2NQ6 A;  3FM3 A;  2EA2 A;  2P9A A;  5FCF A;  1WKM A;  2ZSG A;  4U75 A;  4PV4 A;  3PKD A;  3PKC A;  4U6Z A;  4U6J A;  3MAT A;  4ZNG A;  4U76 A;  2EVM A;  4Z7M A;  1KQ0 A;  2V3Y A;  1C22 A;  5CNX A;  1WLR A;  1WL9 A;  1XGN A;  2Q94 A;  4R60 A;  2BHA A;  4U1B A;  1PV9 A;  4IKS A;  3BIQ A;  1YW9 A;  4ZWU A;  5CIK A;  2V3Z A;  2NQ7 A;  1QZY A;  5JFR A;  2EA4 A;  1N51 A;  3IU9 A;  2BHD A;  3PKA A;  4IU6 A;  2GU7 A;  2GZ5 A;  2MAT A;  1MAT A;  4U73 A;  2GTX A;  3MR1 A;  2BWW A;  2GG2 A;  4RGZ 1;  1KQ9 A;  4U6E A;  1R5G A;  1C23 A;  1R58 A;  1M35 A;  2BWY A;  1QXY A;  2GG0 A;  2HOW A;  3PKB A;  4IF7 A;  2GG5 A;  3D27 A;  2V3X A;  1WN1 A;  5JI6 A;  2ADU A;  1BOA A;  1YJ3 A;  4S01 A;  1XGO A;  4FLJ A;  4QR8 A;  4IKR A;  3IG4 A;  3L7G A;  2OKN A;  5D6E A;  3PKE A;  4U6C A;  4JUQ A;  2BWU A;  3CB5 A;  5CLS A;  2BWS A;  3IU8 A;  1WBQ A;  2GG8 A;  2GGB A;  1O0X A;  1CHM A;  1W7V A;  2Q96 A;  4IKU A;  1YW7 A;  3FMQ A;  5JHU A;  2B3H A;  2DFI A;  2V6C A;  3CB6 A;  1Y1N A;  2G6P A;  4FO7 A;  4MAT A;  1BN5 A;  3TAV A;  1JAW A;  3MX6 A;  4B28 A;  2Q95 A;  3CTZ A;  4FKC A;  2EVC A;  2GG9 A;  5D6F A;  2GU4 A;  2BWT A;  3TB5 A;  2Q8K A;  1C27 A;  5CE6 A;  5FCH A;  4S00 A;  1YW8 A;  3BIT A;  4RZZ A;  2Q92 A;  2EVO A;  2P98 A;  4FLI A;  2GG7 A;  2BWX A;  1XGS A;  4IDY A;  4EGE A;  4PNC A;  4ZWO A;  1QXZ A;  4U71 A;  1WL6 A;  2B3K A;  2BWV A;  2GGC A;  5CDL A;  3Q6D A;  4A6V A;  1C24 A;  4IPA A;  2BN7 A;  4FO8 A;  2BHC A;  3ROR A;  3IU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...