2GG7A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 85
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg7A00
3PKDA 3Q6DA 3PKBA 2MATA 5CLSA 4U76A 3TB5A 1QXWA 2OAZA 4RZYA 5CDEA 3IU9A 3L7GA 4IF7A 4S2TP 1XGNA 2EVCA 1JAWA 2GGCA 1CHMA 1WY2A 2Q93A 5JFRA 2EA2A 4U6CA 2B3LA 4U71A 3MATA 4KM3A 1N51A 4FLKA 1YW7A 4FLLA 1WKMA 2GTXA 3IU7A 4ZNGA 2BHAA 2GG8A 5JHUA 2BWUA 1WLRA 2EVOA 2GA2A 2V6CA 4FLIA 4B28A 4FKCA 1C23A 1O0XA 2GG9A 2BWTA 4A6VA 3TAVA 1QXYA 4U6EA 2EVMA 3BIPA 4S2RP 3CB5A 5CDVA 2BHBA 2BHDA 4JUQA 5E5BA 2Q92A 1R5HA 4U6JA 4OOKA 4ZWUA 3BIQA 2V3YA 4QR8A 2BWVA 2Q96A 1BN5A 2BHCA 4IKTA 4IU6A 4S01A 4IPAA 4ZWOA 1WL9A 2EA4A 2GG7A 3FM3A 1KQ9A 1R58A 3IU8A 1YVMA 1C24A 4U69A 2GU7A 2HOWA 2OKNA 2P99A 2Q94A 3MR1A 4PNCA 4U70A 4HXXA 1Y1NA 2BN7A 2GU4A 5D6EA 2Q8KA 2NQ7A 1W7VA 5CDLA 4U6ZA 3MX6A 4FUKA 1KQ0A 4FO8A 2BWYA 4IKUA 3FMRA 2V3XA 2BWXA 4Z7MA 4U1BA 2GG3A 2ZSGA 3RORA 2BB7A 1PV9A 2GU5A 4S00A 4U6WA 3FMQA 1BOAA 1A16A 1YJ3A 2BWSA 2GG2A 4MATA 1YW8A 3CTZA 5JI6A 2IW2A 4FO7A 2GGBA 1XGSA 2GU6A 3S6BA 1R5GA 2P98A 2BH3A 2V3ZA 1XNZA 5CE6A 1KP0A 4RGZ1 4RZZA 3RVAA 3BITA 1C21A 4ZWPA 1QZYA 1M35A 2P9AA 3PKAA 5CNXA 2NQ6A 1W2MA 4PV4A 4A6WA 4R60A 2GG0A 1QXZA 4IKRA 3CB6A 4IDYA 1C27A 4U75A 1C22A 4U73A 3PKEA 2GG5A 5D6FA 2G6PA 2GZ5A 1WBQA 3PKCA 5FCFA 4EGEA 1WN1A 1WL6A 2BWWA 1MATA 2Q95A 5FCHA 1XGMA 3D27A 4IECA 1XGOA 2B3KA 5CIKA 1YW9A 3IG4A 2ADUA 4IKSA 1B59A 3L24A 1B6AA 2DFIA 4FLJA 2B3HA
chains in the Genus database with same CATH superfamily
3PKDA 3Q6DA 3PKBA 2MATA 5CLSA 4U76A 3TB5A 1QXWA 2OAZA 4RZYA 5CDEA 3IU9A 3L7GA 4IF7A 4S2TP 1XGNA 2EVCA 1JAWA 2GGCA 1CHMA 1WY2A 2Q93A 5JFRA 2EA2A 4U6CA 2B3LA 4U71A 3MATA 4KM3A 1N51A 4FLKA 1YW7A 4FLLA 1WKMA 2GTXA 3IU7A 4ZNGA 2BHAA 2GG8A 5JHUA 2BWUA 1WLRA 2EVOA 2GA2A 2V6CA 4FLIA 4B28A 4FKCA 1C23A 1O0XA 2GG9A 2BWTA 4A6VA 3TAVA 1QXYA 4U6EA 2EVMA 3BIPA 4S2RP 3CB5A 5CDVA 2BHBA 2BHDA 4JUQA 5E5BA 2Q92A 1R5HA 4U6JA 4OOKA 4ZWUA 3BIQA 2V3YA 4QR8A 2BWVA 2Q96A 1BN5A 2BHCA 4IKTA 4IU6A 4S01A 4IPAA 4ZWOA 1WL9A 2EA4A 2GG7A 3FM3A 1KQ9A 1R58A 3IU8A 1YVMA 1C24A 4U69A 2GU7A 2HOWA 2OKNA 2P99A 2Q94A 3MR1A 4PNCA 4U70A 4HXXA 1Y1NA 2BN7A 2GU4A 5D6EA 2Q8KA 2NQ7A 1W7VA 5CDLA 4U6ZA 3MX6A 4FUKA 1KQ0A 4FO8A 2BWYA 4IKUA 3FMRA 2V3XA 2BWXA 4Z7MA 4U1BA 2GG3A 2ZSGA 3RORA 2BB7A 1PV9A 2GU5A 4S00A 4U6WA 3FMQA 1BOAA 1A16A 1YJ3A 2BWSA 2GG2A 4MATA 1YW8A 3CTZA 5JI6A 2IW2A 4FO7A 2GGBA 1XGSA 2GU6A 3S6BA 1R5GA 2P98A 2BH3A 2V3ZA 1XNZA 5CE6A 1KP0A 4RGZ1 4RZZA 3RVAA 3BITA 1C21A 4ZWPA 1QZYA 1M35A 2P9AA 3PKAA 5CNXA 2NQ6A 1W2MA 4PV4A 4A6WA 4R60A 2GG0A 1QXZA 4IKRA 3CB6A 4IDYA 1C27A 4U75A 1C22A 4U73A 3PKEA 2GG5A 5D6FA 2G6PA 2GZ5A 1WBQA 3PKCA 5FCFA 4EGEA 1WN1A 1WL6A 2BWWA 1MATA 2Q95A 5FCHA 1XGMA 3D27A 4IECA 1XGOA 2B3KA 5CIKA 1YW9A 3IG4A 2ADUA 4IKSA 1B59A 3L24A 1B6AA 2DFIA 4FLJA 2B3HA
chains in the Genus database with same CATH topology
3PKDA 3Q6DA 3PKBA 2MATA 5CLSA 4U76A 3TB5A 1QXWA 2OAZA 4RZYA 5CDEA 3IU9A 3L7GA 4IF7A 4S2TP 1XGNA 2EVCA 1JAWA 2GGCA 1CHMA 1WY2A 2Q93A 5JFRA 2EA2A 4U6CA 2B3LA 4U71A 3MATA 4KM3A 1N51A 4FLKA 1YW7A 4FLLA 1WKMA 2GTXA 3IU7A 4ZNGA 2BHAA 2GG8A 5JHUA 2BWUA 1WLRA 2EVOA 2GA2A 2V6CA 4FLIA 4B28A 4FKCA 1C23A 1O0XA 2GG9A 2BWTA 4A6VA 3TAVA 1QXYA 4U6EA 2EVMA 3BIPA 4S2RP 3CB5A 5CDVA 2BHBA 2BHDA 4JUQA 5E5BA 2Q92A 1R5HA 4U6JA 4OOKA 4ZWUA 3BIQA 2V3YA 4QR8A 2BWVA 2Q96A 1BN5A 2BHCA 4IKTA 4IU6A 4S01A 4IPAA 4ZWOA 1WL9A 2EA4A 2GG7A 3FM3A 1KQ9A 1R58A 3IU8A 1YVMA 1C24A 4U69A 2GU7A 2HOWA 2OKNA 2P99A 2Q94A 3MR1A 4PNCA 4U70A 4HXXA 1Y1NA 2BN7A 2GU4A 5D6EA 2Q8KA 2NQ7A 1W7VA 5CDLA 4U6ZA 3MX6A 4FUKA 1KQ0A 4FO8A 2BWYA 4IKUA 3FMRA 2V3XA 2BWXA 4Z7MA 4U1BA 2GG3A 2ZSGA 3RORA 2BB7A 1PV9A 2GU5A 4S00A 4U6WA 3FMQA 1BOAA 1A16A 1YJ3A 2BWSA 2GG2A 4MATA 1YW8A 3CTZA 5JI6A 2IW2A 4FO7A 2GGBA 1XGSA 2GU6A 3S6BA 1R5GA 2P98A 2BH3A 2V3ZA 1XNZA 5CE6A 1KP0A 4RGZ1 4RZZA 3RVAA 3BITA 1C21A 4ZWPA 1QZYA 1M35A 2P9AA 3PKAA 5CNXA 2NQ6A 1W2MA 4PV4A 4A6WA 4R60A 2GG0A 1QXZA 4IKRA 3CB6A 4IDYA 1C27A 4U75A 1C22A 4U73A 3PKEA 2GG5A 5D6FA 2G6PA 2GZ5A 1WBQA 3PKCA 5FCFA 4EGEA 1WN1A 1WL6A 2BWWA 1MATA 2Q95A 5FCHA 1XGMA 3D27A 4IECA 1XGOA 2B3KA 5CIKA 1YW9A 3IG4A 2ADUA 4IKSA 1B59A 3L24A 1B6AA 2DFIA 4FLJA 2B3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PKD A;  3Q6D A;  3PKB A;  2MAT A;  5CLS A;  4U76 A;  3TB5 A;  1QXW A;  2OAZ A;  4RZY A;  5CDE A;  3IU9 A;  3L7G A;  4IF7 A;  4S2T P;  1XGN A;  2EVC A;  1JAW A;  2GGC A;  1CHM A;  1WY2 A;  2Q93 A;  5JFR A;  2EA2 A;  4U6C A;  2B3L A;  4U71 A;  3MAT A;  4KM3 A;  1N51 A;  4FLK A;  1YW7 A;  4FLL A;  1WKM A;  2GTX A;  3IU7 A;  4ZNG A;  2BHA A;  2GG8 A;  5JHU A;  2BWU A;  1WLR A;  2EVO A;  2GA2 A;  2V6C A;  4FLI A;  4B28 A;  4FKC A;  1C23 A;  1O0X A;  2GG9 A;  2BWT A;  4A6V A;  3TAV A;  1QXY A;  4U6E A;  2EVM A;  3BIP A;  4S2R P;  3CB5 A;  5CDV A;  2BHB A;  2BHD A;  4JUQ A;  5E5B A;  2Q92 A;  1R5H A;  4U6J A;  4OOK A;  4ZWU A;  3BIQ A;  2V3Y A;  4QR8 A;  2BWV A;  2Q96 A;  1BN5 A;  2BHC A;  4IKT A;  4IU6 A;  4S01 A;  4IPA A;  4ZWO A;  1WL9 A;  2EA4 A;  2GG7 A;  3FM3 A;  1KQ9 A;  1R58 A;  3IU8 A;  1YVM A;  1C24 A;  4U69 A;  2GU7 A;  2HOW A;  2OKN A;  2P99 A;  2Q94 A;  3MR1 A;  4PNC A;  4U70 A;  4HXX A;  1Y1N A;  2BN7 A;  2GU4 A;  5D6E A;  2Q8K A;  2NQ7 A;  1W7V A;  5CDL A;  4U6Z A;  3MX6 A;  4FUK A;  1KQ0 A;  4FO8 A;  2BWY A;  4IKU A;  3FMR A;  2V3X A;  2BWX A;  4Z7M A;  4U1B A;  2GG3 A;  2ZSG A;  3ROR A;  2BB7 A;  1PV9 A;  2GU5 A;  4S00 A;  4U6W A;  3FMQ A;  1BOA A;  1A16 A;  1YJ3 A;  2BWS A;  2GG2 A;  4MAT A;  1YW8 A;  3CTZ A;  5JI6 A;  2IW2 A;  4FO7 A;  2GGB A;  1XGS A;  2GU6 A;  3S6B A;  1R5G A;  2P98 A;  2BH3 A;  2V3Z A;  1XNZ A;  5CE6 A;  1KP0 A;  4RGZ 1;  4RZZ A;  3RVA A;  3BIT A;  1C21 A;  4ZWP A;  1QZY A;  1M35 A;  2P9A A;  3PKA A;  5CNX A;  2NQ6 A;  1W2M A;  4PV4 A;  4A6W A;  4R60 A;  2GG0 A;  1QXZ A;  4IKR A;  3CB6 A;  4IDY A;  1C27 A;  4U75 A;  1C22 A;  4U73 A;  3PKE A;  2GG5 A;  5D6F A;  2G6P A;  2GZ5 A;  1WBQ A;  3PKC A;  5FCF A;  4EGE A;  1WN1 A;  1WL6 A;  2BWW A;  1MAT A;  2Q95 A;  5FCH A;  1XGM A;  3D27 A;  4IEC A;  1XGO A;  2B3K A;  5CIK A;  1YW9 A;  3IG4 A;  2ADU A;  4IKS A;  1B59 A;  3L24 A;  1B6A A;  2DFI A;  4FLJ A;  2B3H A; 
#chains in the Genus database with same CATH topology
 3PKD A;  3Q6D A;  3PKB A;  2MAT A;  5CLS A;  4U76 A;  3TB5 A;  1QXW A;  2OAZ A;  4RZY A;  5CDE A;  3IU9 A;  3L7G A;  4IF7 A;  4S2T P;  1XGN A;  2EVC A;  1JAW A;  2GGC A;  1CHM A;  1WY2 A;  2Q93 A;  5JFR A;  2EA2 A;  4U6C A;  2B3L A;  4U71 A;  3MAT A;  4KM3 A;  1N51 A;  4FLK A;  1YW7 A;  4FLL A;  1WKM A;  2GTX A;  3IU7 A;  4ZNG A;  2BHA A;  2GG8 A;  5JHU A;  2BWU A;  1WLR A;  2EVO A;  2GA2 A;  2V6C A;  4FLI A;  4B28 A;  4FKC A;  1C23 A;  1O0X A;  2GG9 A;  2BWT A;  4A6V A;  3TAV A;  1QXY A;  4U6E A;  2EVM A;  3BIP A;  4S2R P;  3CB5 A;  5CDV A;  2BHB A;  2BHD A;  4JUQ A;  5E5B A;  2Q92 A;  1R5H A;  4U6J A;  4OOK A;  4ZWU A;  3BIQ A;  2V3Y A;  4QR8 A;  2BWV A;  2Q96 A;  1BN5 A;  2BHC A;  4IKT A;  4IU6 A;  4S01 A;  4IPA A;  4ZWO A;  1WL9 A;  2EA4 A;  2GG7 A;  3FM3 A;  1KQ9 A;  1R58 A;  3IU8 A;  1YVM A;  1C24 A;  4U69 A;  2GU7 A;  2HOW A;  2OKN A;  2P99 A;  2Q94 A;  3MR1 A;  4PNC A;  4U70 A;  4HXX A;  1Y1N A;  2BN7 A;  2GU4 A;  5D6E A;  2Q8K A;  2NQ7 A;  1W7V A;  5CDL A;  4U6Z A;  3MX6 A;  4FUK A;  1KQ0 A;  4FO8 A;  2BWY A;  4IKU A;  3FMR A;  2V3X A;  2BWX A;  4Z7M A;  4U1B A;  2GG3 A;  2ZSG A;  3ROR A;  2BB7 A;  1PV9 A;  2GU5 A;  4S00 A;  4U6W A;  3FMQ A;  1BOA A;  1A16 A;  1YJ3 A;  2BWS A;  2GG2 A;  4MAT A;  1YW8 A;  3CTZ A;  5JI6 A;  2IW2 A;  4FO7 A;  2GGB A;  1XGS A;  2GU6 A;  3S6B A;  1R5G A;  2P98 A;  2BH3 A;  2V3Z A;  1XNZ A;  5CE6 A;  1KP0 A;  4RGZ 1;  4RZZ A;  3RVA A;  3BIT A;  1C21 A;  4ZWP A;  1QZY A;  1M35 A;  2P9A A;  3PKA A;  5CNX A;  2NQ6 A;  1W2M A;  4PV4 A;  4A6W A;  4R60 A;  2GG0 A;  1QXZ A;  4IKR A;  3CB6 A;  4IDY A;  1C27 A;  4U75 A;  1C22 A;  4U73 A;  3PKE A;  2GG5 A;  5D6F A;  2G6P A;  2GZ5 A;  1WBQ A;  3PKC A;  5FCF A;  4EGE A;  1WN1 A;  1WL6 A;  2BWW A;  1MAT A;  2Q95 A;  5FCH A;  1XGM A;  3D27 A;  4IEC A;  1XGO A;  2B3K A;  5CIK A;  1YW9 A;  3IG4 A;  2ADU A;  4IKS A;  1B59 A;  3L24 A;  1B6A A;  2DFI A;  4FLJ A;  2B3H A; 
#chains in the Genus database with same CATH homology
 3PKD A;  3Q6D A;  3PKB A;  2MAT A;  5CLS A;  4U76 A;  3TB5 A;  1QXW A;  2OAZ A;  4RZY A;  5CDE A;  3IU9 A;  3L7G A;  4IF7 A;  4S2T P;  1XGN A;  2EVC A;  1JAW A;  2GGC A;  1CHM A;  1WY2 A;  2Q93 A;  5JFR A;  2EA2 A;  4U6C A;  2B3L A;  4U71 A;  3MAT A;  4KM3 A;  1N51 A;  4FLK A;  1YW7 A;  4FLL A;  1WKM A;  2GTX A;  3IU7 A;  4ZNG A;  2BHA A;  2GG8 A;  5JHU A;  2BWU A;  1WLR A;  2EVO A;  2GA2 A;  2V6C A;  4FLI A;  4B28 A;  4FKC A;  1C23 A;  1O0X A;  2GG9 A;  2BWT A;  4A6V A;  3TAV A;  1QXY A;  4U6E A;  2EVM A;  3BIP A;  4S2R P;  3CB5 A;  5CDV A;  2BHB A;  2BHD A;  4JUQ A;  5E5B A;  2Q92 A;  1R5H A;  4U6J A;  4OOK A;  4ZWU A;  3BIQ A;  2V3Y A;  4QR8 A;  2BWV A;  2Q96 A;  1BN5 A;  2BHC A;  4IKT A;  4IU6 A;  4S01 A;  4IPA A;  4ZWO A;  1WL9 A;  2EA4 A;  2GG7 A;  3FM3 A;  1KQ9 A;  1R58 A;  3IU8 A;  1YVM A;  1C24 A;  4U69 A;  2GU7 A;  2HOW A;  2OKN A;  2P99 A;  2Q94 A;  3MR1 A;  4PNC A;  4U70 A;  4HXX A;  1Y1N A;  2BN7 A;  2GU4 A;  5D6E A;  2Q8K A;  2NQ7 A;  1W7V A;  5CDL A;  4U6Z A;  3MX6 A;  4FUK A;  1KQ0 A;  4FO8 A;  2BWY A;  4IKU A;  3FMR A;  2V3X A;  2BWX A;  4Z7M A;  4U1B A;  2GG3 A;  2ZSG A;  3ROR A;  2BB7 A;  1PV9 A;  2GU5 A;  4S00 A;  4U6W A;  3FMQ A;  1BOA A;  1A16 A;  1YJ3 A;  2BWS A;  2GG2 A;  4MAT A;  1YW8 A;  3CTZ A;  5JI6 A;  2IW2 A;  4FO7 A;  2GGB A;  1XGS A;  2GU6 A;  3S6B A;  1R5G A;  2P98 A;  2BH3 A;  2V3Z A;  1XNZ A;  5CE6 A;  1KP0 A;  4RGZ 1;  4RZZ A;  3RVA A;  3BIT A;  1C21 A;  4ZWP A;  1QZY A;  1M35 A;  2P9A A;  3PKA A;  5CNX A;  2NQ6 A;  1W2M A;  4PV4 A;  4A6W A;  4R60 A;  2GG0 A;  1QXZ A;  4IKR A;  3CB6 A;  4IDY A;  1C27 A;  4U75 A;  1C22 A;  4U73 A;  3PKE A;  2GG5 A;  5D6F A;  2G6P A;  2GZ5 A;  1WBQ A;  3PKC A;  5FCF A;  4EGE A;  1WN1 A;  1WL6 A;  2BWW A;  1MAT A;  2Q95 A;  5FCH A;  1XGM A;  3D27 A;  4IEC A;  1XGO A;  2B3K A;  5CIK A;  1YW9 A;  3IG4 A;  2ADU A;  4IKS A;  1B59 A;  3L24 A;  1B6A A;  2DFI A;  4FLJ A;  2B3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...