2GGBA

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2ggbA00
1XGOA 1QXZA 1W2MA 3IU8A 4S2RP 2ADUA 2BWUA 1W7VA 2GGBA 4A6WA 4FUKA 4S00A 2HOWA 2BWTA 3BIPA 4IU6A 4IKSA 1C24A 2MATA 1YW9A 4KM3A 4U71A 2GG9A 2GU7A 2GU5A 1N51A 4ZWUA 4IF7A 4ZWOA 2EA4A 1XGMA 1XNZA 1KQ9A 3RVAA 2Q96A 5JFRA 1A16A 2BHBA 5D6EA 4FLKA 4U1BA 2EA2A 3D27A 4IKTA 1O0XA 5CIKA 2BWVA 1WL9A 2GG7A 4PNCA 1BN5A 1R58A 2B3HA 4R60A 3FM3A 3IU9A 3CB5A 2GU6A 4U73A 5JHUA 1Y1NA 5FCFA 5JI6A 4OOKA 4IDYA 1JAWA 4FLLA 2GA2A 3FMRA 5CDLA 4RZYA 1C27A 2B3LA 1PV9A 4Z7MA 1R5GA 3FMQA 3BITA 2EVOA 2V6CA 1WKMA 2BWYA 3CTZA 2V3XA 3MR1A 4PV4A 1C21A 4RZZA 3PKDA 1WY2A 4FO8A 4FKCA 2Q92A 5E5BA 1QZYA 4U69A 2V3YA 2EVMA 2GG3A 2ZSGA 2GTXA 2B3KA 3Q6DA 2BWSA 2BWXA 4A6VA 2GGCA 1R5HA 1YJ3A 4EGEA 5FCHA 4B28A 4FO7A 3PKCA 4HXXA 3TAVA 1MATA 2Q93A 4IKUA 2GZ5A 3PKEA 2Q94A 4FLJA 1B59A 2OAZA 5CLSA 2BH3A 1XGNA 4U6ZA 3L24A 2BHCA 1QXWA 2DFIA 3RORA 2EVCA 1WN1A 2GU4A 4FLIA 1WBQA 2V3ZA 2IW2A 3BIQA 2GG0A 4IPAA 5D6FA 4QR8A 2GG2A 3PKAA 2P98A 4U75A 2BHAA 1YW7A 3PKBA 4RGZ1 4S01A 4U6WA 4U6EA 2OKNA 3TB5A 1C23A 4IKRA 5CNXA 1XGSA 4MATA 4U76A 3MATA 3CB6A 1WL6A 2BWWA 2P99A 2GG5A 4ZNGA 3IG4A 1KP0A 4JUQA 5CDVA 1KQ0A 2Q8KA 3MX6A 2BHDA 4ZWPA 1YVMA 4U70A 1CHMA 2G6PA 2GG8A 2NQ7A 2Q95A 4S2TP 1M35A 2P9AA 4U6CA 1YW8A 5CE6A 1QXYA 1WLRA 3IU7A 4U6JA 3S6BA 1B6AA 1C22A 2NQ6A 3L7GA 4IECA 5CDEA 1BOAA 2BB7A 2BN7A
chains in the Genus database with same CATH superfamily
1XGOA 1QXZA 1W2MA 3IU8A 4S2RP 2ADUA 2BWUA 1W7VA 2GGBA 4A6WA 4FUKA 4S00A 2HOWA 2BWTA 3BIPA 4IU6A 4IKSA 1C24A 2MATA 1YW9A 4KM3A 4U71A 2GG9A 2GU7A 2GU5A 1N51A 4ZWUA 4IF7A 4ZWOA 2EA4A 1XGMA 1XNZA 1KQ9A 3RVAA 2Q96A 5JFRA 1A16A 2BHBA 5D6EA 4FLKA 4U1BA 2EA2A 3D27A 4IKTA 1O0XA 5CIKA 2BWVA 1WL9A 2GG7A 4PNCA 1BN5A 1R58A 2B3HA 4R60A 3FM3A 3IU9A 3CB5A 2GU6A 4U73A 5JHUA 1Y1NA 5FCFA 5JI6A 4OOKA 4IDYA 1JAWA 4FLLA 2GA2A 3FMRA 5CDLA 4RZYA 1C27A 2B3LA 1PV9A 4Z7MA 1R5GA 3FMQA 3BITA 2EVOA 2V6CA 1WKMA 2BWYA 3CTZA 2V3XA 3MR1A 4PV4A 1C21A 4RZZA 3PKDA 1WY2A 4FO8A 4FKCA 2Q92A 5E5BA 1QZYA 4U69A 2V3YA 2EVMA 2GG3A 2ZSGA 2GTXA 2B3KA 3Q6DA 2BWSA 2BWXA 4A6VA 2GGCA 1R5HA 1YJ3A 4EGEA 5FCHA 4B28A 4FO7A 3PKCA 4HXXA 3TAVA 1MATA 2Q93A 4IKUA 2GZ5A 3PKEA 2Q94A 4FLJA 1B59A 2OAZA 5CLSA 2BH3A 1XGNA 4U6ZA 3L24A 2BHCA 1QXWA 2DFIA 3RORA 2EVCA 1WN1A 2GU4A 4FLIA 1WBQA 2V3ZA 2IW2A 3BIQA 2GG0A 4IPAA 5D6FA 4QR8A 2GG2A 3PKAA 2P98A 4U75A 2BHAA 1YW7A 3PKBA 4RGZ1 4S01A 4U6WA 4U6EA 2OKNA 3TB5A 1C23A 4IKRA 5CNXA 1XGSA 4MATA 4U76A 3MATA 3CB6A 1WL6A 2BWWA 2P99A 2GG5A 4ZNGA 3IG4A 1KP0A 4JUQA 5CDVA 1KQ0A 2Q8KA 3MX6A 2BHDA 4ZWPA 1YVMA 4U70A 1CHMA 2G6PA 2GG8A 2NQ7A 2Q95A 4S2TP 1M35A 2P9AA 4U6CA 1YW8A 5CE6A 1QXYA 1WLRA 3IU7A 4U6JA 3S6BA 1B6AA 1C22A 2NQ6A 3L7GA 4IECA 5CDEA 1BOAA 2BB7A 2BN7A
chains in the Genus database with same CATH topology
1XGOA 1QXZA 1W2MA 3IU8A 4S2RP 2ADUA 2BWUA 1W7VA 2GGBA 4A6WA 4FUKA 4S00A 2HOWA 2BWTA 3BIPA 4IU6A 4IKSA 1C24A 2MATA 1YW9A 4KM3A 4U71A 2GG9A 2GU7A 2GU5A 1N51A 4ZWUA 4IF7A 4ZWOA 2EA4A 1XGMA 1XNZA 1KQ9A 3RVAA 2Q96A 5JFRA 1A16A 2BHBA 5D6EA 4FLKA 4U1BA 2EA2A 3D27A 4IKTA 1O0XA 5CIKA 2BWVA 1WL9A 2GG7A 4PNCA 1BN5A 1R58A 2B3HA 4R60A 3FM3A 3IU9A 3CB5A 2GU6A 4U73A 5JHUA 1Y1NA 5FCFA 5JI6A 4OOKA 4IDYA 1JAWA 4FLLA 2GA2A 3FMRA 5CDLA 4RZYA 1C27A 2B3LA 1PV9A 4Z7MA 1R5GA 3FMQA 3BITA 2EVOA 2V6CA 1WKMA 2BWYA 3CTZA 2V3XA 3MR1A 4PV4A 1C21A 4RZZA 3PKDA 1WY2A 4FO8A 4FKCA 2Q92A 5E5BA 1QZYA 4U69A 2V3YA 2EVMA 2GG3A 2ZSGA 2GTXA 2B3KA 3Q6DA 2BWSA 2BWXA 4A6VA 2GGCA 1R5HA 1YJ3A 4EGEA 5FCHA 4B28A 4FO7A 3PKCA 4HXXA 3TAVA 1MATA 2Q93A 4IKUA 2GZ5A 3PKEA 2Q94A 4FLJA 1B59A 2OAZA 5CLSA 2BH3A 1XGNA 4U6ZA 3L24A 2BHCA 1QXWA 2DFIA 3RORA 2EVCA 1WN1A 2GU4A 4FLIA 1WBQA 2V3ZA 2IW2A 3BIQA 2GG0A 4IPAA 5D6FA 4QR8A 2GG2A 3PKAA 2P98A 4U75A 2BHAA 1YW7A 3PKBA 4RGZ1 4S01A 4U6WA 4U6EA 2OKNA 3TB5A 1C23A 4IKRA 5CNXA 1XGSA 4MATA 4U76A 3MATA 3CB6A 1WL6A 2BWWA 2P99A 2GG5A 4ZNGA 3IG4A 1KP0A 4JUQA 5CDVA 1KQ0A 2Q8KA 3MX6A 2BHDA 4ZWPA 1YVMA 4U70A 1CHMA 2G6PA 2GG8A 2NQ7A 2Q95A 4S2TP 1M35A 2P9AA 4U6CA 1YW8A 5CE6A 1QXYA 1WLRA 3IU7A 4U6JA 3S6BA 1B6AA 1C22A 2NQ6A 3L7GA 4IECA 5CDEA 1BOAA 2BB7A 2BN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGO A;  1QXZ A;  1W2M A;  3IU8 A;  4S2R P;  2ADU A;  2BWU A;  1W7V A;  2GGB A;  4A6W A;  4FUK A;  4S00 A;  2HOW A;  2BWT A;  3BIP A;  4IU6 A;  4IKS A;  1C24 A;  2MAT A;  1YW9 A;  4KM3 A;  4U71 A;  2GG9 A;  2GU7 A;  2GU5 A;  1N51 A;  4ZWU A;  4IF7 A;  4ZWO A;  2EA4 A;  1XGM A;  1XNZ A;  1KQ9 A;  3RVA A;  2Q96 A;  5JFR A;  1A16 A;  2BHB A;  5D6E A;  4FLK A;  4U1B A;  2EA2 A;  3D27 A;  4IKT A;  1O0X A;  5CIK A;  2BWV A;  1WL9 A;  2GG7 A;  4PNC A;  1BN5 A;  1R58 A;  2B3H A;  4R60 A;  3FM3 A;  3IU9 A;  3CB5 A;  2GU6 A;  4U73 A;  5JHU A;  1Y1N A;  5FCF A;  5JI6 A;  4OOK A;  4IDY A;  1JAW A;  4FLL A;  2GA2 A;  3FMR A;  5CDL A;  4RZY A;  1C27 A;  2B3L A;  1PV9 A;  4Z7M A;  1R5G A;  3FMQ A;  3BIT A;  2EVO A;  2V6C A;  1WKM A;  2BWY A;  3CTZ A;  2V3X A;  3MR1 A;  4PV4 A;  1C21 A;  4RZZ A;  3PKD A;  1WY2 A;  4FO8 A;  4FKC A;  2Q92 A;  5E5B A;  1QZY A;  4U69 A;  2V3Y A;  2EVM A;  2GG3 A;  2ZSG A;  2GTX A;  2B3K A;  3Q6D A;  2BWS A;  2BWX A;  4A6V A;  2GGC A;  1R5H A;  1YJ3 A;  4EGE A;  5FCH A;  4B28 A;  4FO7 A;  3PKC A;  4HXX A;  3TAV A;  1MAT A;  2Q93 A;  4IKU A;  2GZ5 A;  3PKE A;  2Q94 A;  4FLJ A;  1B59 A;  2OAZ A;  5CLS A;  2BH3 A;  1XGN A;  4U6Z A;  3L24 A;  2BHC A;  1QXW A;  2DFI A;  3ROR A;  2EVC A;  1WN1 A;  2GU4 A;  4FLI A;  1WBQ A;  2V3Z A;  2IW2 A;  3BIQ A;  2GG0 A;  4IPA A;  5D6F A;  4QR8 A;  2GG2 A;  3PKA A;  2P98 A;  4U75 A;  2BHA A;  1YW7 A;  3PKB A;  4RGZ 1;  4S01 A;  4U6W A;  4U6E A;  2OKN A;  3TB5 A;  1C23 A;  4IKR A;  5CNX A;  1XGS A;  4MAT A;  4U76 A;  3MAT A;  3CB6 A;  1WL6 A;  2BWW A;  2P99 A;  2GG5 A;  4ZNG A;  3IG4 A;  1KP0 A;  4JUQ A;  5CDV A;  1KQ0 A;  2Q8K A;  3MX6 A;  2BHD A;  4ZWP A;  1YVM A;  4U70 A;  1CHM A;  2G6P A;  2GG8 A;  2NQ7 A;  2Q95 A;  4S2T P;  1M35 A;  2P9A A;  4U6C A;  1YW8 A;  5CE6 A;  1QXY A;  1WLR A;  3IU7 A;  4U6J A;  3S6B A;  1B6A A;  1C22 A;  2NQ6 A;  3L7G A;  4IEC A;  5CDE A;  1BOA A;  2BB7 A;  2BN7 A; 
#chains in the Genus database with same CATH topology
 1XGO A;  1QXZ A;  1W2M A;  3IU8 A;  4S2R P;  2ADU A;  2BWU A;  1W7V A;  2GGB A;  4A6W A;  4FUK A;  4S00 A;  2HOW A;  2BWT A;  3BIP A;  4IU6 A;  4IKS A;  1C24 A;  2MAT A;  1YW9 A;  4KM3 A;  4U71 A;  2GG9 A;  2GU7 A;  2GU5 A;  1N51 A;  4ZWU A;  4IF7 A;  4ZWO A;  2EA4 A;  1XGM A;  1XNZ A;  1KQ9 A;  3RVA A;  2Q96 A;  5JFR A;  1A16 A;  2BHB A;  5D6E A;  4FLK A;  4U1B A;  2EA2 A;  3D27 A;  4IKT A;  1O0X A;  5CIK A;  2BWV A;  1WL9 A;  2GG7 A;  4PNC A;  1BN5 A;  1R58 A;  2B3H A;  4R60 A;  3FM3 A;  3IU9 A;  3CB5 A;  2GU6 A;  4U73 A;  5JHU A;  1Y1N A;  5FCF A;  5JI6 A;  4OOK A;  4IDY A;  1JAW A;  4FLL A;  2GA2 A;  3FMR A;  5CDL A;  4RZY A;  1C27 A;  2B3L A;  1PV9 A;  4Z7M A;  1R5G A;  3FMQ A;  3BIT A;  2EVO A;  2V6C A;  1WKM A;  2BWY A;  3CTZ A;  2V3X A;  3MR1 A;  4PV4 A;  1C21 A;  4RZZ A;  3PKD A;  1WY2 A;  4FO8 A;  4FKC A;  2Q92 A;  5E5B A;  1QZY A;  4U69 A;  2V3Y A;  2EVM A;  2GG3 A;  2ZSG A;  2GTX A;  2B3K A;  3Q6D A;  2BWS A;  2BWX A;  4A6V A;  2GGC A;  1R5H A;  1YJ3 A;  4EGE A;  5FCH A;  4B28 A;  4FO7 A;  3PKC A;  4HXX A;  3TAV A;  1MAT A;  2Q93 A;  4IKU A;  2GZ5 A;  3PKE A;  2Q94 A;  4FLJ A;  1B59 A;  2OAZ A;  5CLS A;  2BH3 A;  1XGN A;  4U6Z A;  3L24 A;  2BHC A;  1QXW A;  2DFI A;  3ROR A;  2EVC A;  1WN1 A;  2GU4 A;  4FLI A;  1WBQ A;  2V3Z A;  2IW2 A;  3BIQ A;  2GG0 A;  4IPA A;  5D6F A;  4QR8 A;  2GG2 A;  3PKA A;  2P98 A;  4U75 A;  2BHA A;  1YW7 A;  3PKB A;  4RGZ 1;  4S01 A;  4U6W A;  4U6E A;  2OKN A;  3TB5 A;  1C23 A;  4IKR A;  5CNX A;  1XGS A;  4MAT A;  4U76 A;  3MAT A;  3CB6 A;  1WL6 A;  2BWW A;  2P99 A;  2GG5 A;  4ZNG A;  3IG4 A;  1KP0 A;  4JUQ A;  5CDV A;  1KQ0 A;  2Q8K A;  3MX6 A;  2BHD A;  4ZWP A;  1YVM A;  4U70 A;  1CHM A;  2G6P A;  2GG8 A;  2NQ7 A;  2Q95 A;  4S2T P;  1M35 A;  2P9A A;  4U6C A;  1YW8 A;  5CE6 A;  1QXY A;  1WLR A;  3IU7 A;  4U6J A;  3S6B A;  1B6A A;  1C22 A;  2NQ6 A;  3L7G A;  4IEC A;  5CDE A;  1BOA A;  2BB7 A;  2BN7 A; 
#chains in the Genus database with same CATH homology
 1XGO A;  1QXZ A;  1W2M A;  3IU8 A;  4S2R P;  2ADU A;  2BWU A;  1W7V A;  2GGB A;  4A6W A;  4FUK A;  4S00 A;  2HOW A;  2BWT A;  3BIP A;  4IU6 A;  4IKS A;  1C24 A;  2MAT A;  1YW9 A;  4KM3 A;  4U71 A;  2GG9 A;  2GU7 A;  2GU5 A;  1N51 A;  4ZWU A;  4IF7 A;  4ZWO A;  2EA4 A;  1XGM A;  1XNZ A;  1KQ9 A;  3RVA A;  2Q96 A;  5JFR A;  1A16 A;  2BHB A;  5D6E A;  4FLK A;  4U1B A;  2EA2 A;  3D27 A;  4IKT A;  1O0X A;  5CIK A;  2BWV A;  1WL9 A;  2GG7 A;  4PNC A;  1BN5 A;  1R58 A;  2B3H A;  4R60 A;  3FM3 A;  3IU9 A;  3CB5 A;  2GU6 A;  4U73 A;  5JHU A;  1Y1N A;  5FCF A;  5JI6 A;  4OOK A;  4IDY A;  1JAW A;  4FLL A;  2GA2 A;  3FMR A;  5CDL A;  4RZY A;  1C27 A;  2B3L A;  1PV9 A;  4Z7M A;  1R5G A;  3FMQ A;  3BIT A;  2EVO A;  2V6C A;  1WKM A;  2BWY A;  3CTZ A;  2V3X A;  3MR1 A;  4PV4 A;  1C21 A;  4RZZ A;  3PKD A;  1WY2 A;  4FO8 A;  4FKC A;  2Q92 A;  5E5B A;  1QZY A;  4U69 A;  2V3Y A;  2EVM A;  2GG3 A;  2ZSG A;  2GTX A;  2B3K A;  3Q6D A;  2BWS A;  2BWX A;  4A6V A;  2GGC A;  1R5H A;  1YJ3 A;  4EGE A;  5FCH A;  4B28 A;  4FO7 A;  3PKC A;  4HXX A;  3TAV A;  1MAT A;  2Q93 A;  4IKU A;  2GZ5 A;  3PKE A;  2Q94 A;  4FLJ A;  1B59 A;  2OAZ A;  5CLS A;  2BH3 A;  1XGN A;  4U6Z A;  3L24 A;  2BHC A;  1QXW A;  2DFI A;  3ROR A;  2EVC A;  1WN1 A;  2GU4 A;  4FLI A;  1WBQ A;  2V3Z A;  2IW2 A;  3BIQ A;  2GG0 A;  4IPA A;  5D6F A;  4QR8 A;  2GG2 A;  3PKA A;  2P98 A;  4U75 A;  2BHA A;  1YW7 A;  3PKB A;  4RGZ 1;  4S01 A;  4U6W A;  4U6E A;  2OKN A;  3TB5 A;  1C23 A;  4IKR A;  5CNX A;  1XGS A;  4MAT A;  4U76 A;  3MAT A;  3CB6 A;  1WL6 A;  2BWW A;  2P99 A;  2GG5 A;  4ZNG A;  3IG4 A;  1KP0 A;  4JUQ A;  5CDV A;  1KQ0 A;  2Q8K A;  3MX6 A;  2BHD A;  4ZWP A;  1YVM A;  4U70 A;  1CHM A;  2G6P A;  2GG8 A;  2NQ7 A;  2Q95 A;  4S2T P;  1M35 A;  2P9A A;  4U6C A;  1YW8 A;  5CE6 A;  1QXY A;  1WLR A;  3IU7 A;  4U6J A;  3S6B A;  1B6A A;  1C22 A;  2NQ6 A;  3L7G A;  4IEC A;  5CDE A;  1BOA A;  2BB7 A;  2BN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...