2GGBA

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2ggbA00
3FM3A 4U6JA 4ZNGA 4EGEA 4ZWPA 2GGBA 2Q92A 1A16A 4FKCA 4A6WA 2B3HA 2BWSA 3TAVA 2GG8A 2BN7A 2BWVA 1KQ9A 3MX6A 5D6EA 1YW8A 1XNZA 2GU7A 4S2TP 3PKEA 1M35A 2V3YA 3MATA 2BHBA 2BH3A 4IKTA 4Z7MA 4RGZ1 1WL9A 2GTXA 4PV4A 1O0XA 5E5BA 1XGNA 2BWWA 4IDYA 1XGSA 2GG2A 2ADUA 3IU8A 3L7GA 4S00A 1C21A 2Q95A 4KM3A 1QXWA 2GG9A 4FLKA 5CDLA 3PKAA 2DFIA 1YW7A 2P9AA 3IU7A 4U6WA 2V3ZA 5CIKA 1XGOA 5JI6A 1XGMA 4IECA 1QZYA 5D6FA 2BHDA 2EA4A 2EVOA 3PKBA 3FMRA 5CNXA 1KQ0A 4U71A 4A6VA 5CDVA 1QXYA 2Q96A 1JAWA 4U75A 2BWUA 4FLLA 4FLJA 1R58A 2GG5A 3IU9A 3PKDA 2GG3A 1BN5A 2GG0A 4IPAA 1KP0A 2BHAA 2B3KA 5FCHA 1R5GA 2NQ7A 1C22A 2NQ6A 4S2RP 1WLRA 2V3XA 4ZWOA 1C23A 3FMQA 3PKCA 1N51A 3CB5A 1WL6A 3Q6DA 1CHMA 4IKUA 4MATA 3BIQA 4U6ZA 4U6EA 4R60A 2BWXA 4FO7A 2OKNA 2IW2A 3RVAA 1B59A 4FUKA 2BHCA 3TB5A 4FLIA 4U70A 4S01A 3RORA 3S6BA 2GA2A 5CLSA 2Q8KA 2BWYA 2EA2A 3D27A 3MR1A 1C27A 2EVMA 2OAZA 4IKRA 4RZYA 4RZZA 2P98A 1YVMA 5CDEA 2GU5A 1WY2A 1W2MA 4U1BA 1Y1NA 1BOAA 2EVCA 1R5HA 1WBQA 3BITA 2GU4A 4IU6A 1QXZA 2GZ5A 3L24A 4HXXA 2BWTA 4U73A 2GGCA 2MATA 4IKSA 4ZWUA 1WKMA 3IG4A 5CE6A 2Q93A 4U6CA 1W7VA 4U69A 1YJ3A 3BIPA 1C24A 1MATA 1PV9A 2P99A 3CTZA 5FCFA 3CB6A 4OOKA 1YW9A 2B3LA 4FO8A 4PNCA 2BB7A 4JUQA 5JHUA 4IF7A 2GU6A 2G6PA 4QR8A 1B6AA 1WN1A 2Q94A 2GG7A 2V6CA 4B28A 5JFRA 4U76A 2ZSGA 2HOWA
chains in the Genus database with same CATH superfamily
3FM3A 4U6JA 4ZNGA 4EGEA 4ZWPA 2GGBA 2Q92A 1A16A 4FKCA 4A6WA 2B3HA 2BWSA 3TAVA 2GG8A 2BN7A 2BWVA 1KQ9A 3MX6A 5D6EA 1YW8A 1XNZA 2GU7A 4S2TP 3PKEA 1M35A 2V3YA 3MATA 2BHBA 2BH3A 4IKTA 4Z7MA 4RGZ1 1WL9A 2GTXA 4PV4A 1O0XA 5E5BA 1XGNA 2BWWA 4IDYA 1XGSA 2GG2A 2ADUA 3IU8A 3L7GA 4S00A 1C21A 2Q95A 4KM3A 1QXWA 2GG9A 4FLKA 5CDLA 3PKAA 2DFIA 1YW7A 2P9AA 3IU7A 4U6WA 2V3ZA 5CIKA 1XGOA 5JI6A 1XGMA 4IECA 1QZYA 5D6FA 2BHDA 2EA4A 2EVOA 3PKBA 3FMRA 5CNXA 1KQ0A 4U71A 4A6VA 5CDVA 1QXYA 2Q96A 1JAWA 4U75A 2BWUA 4FLLA 4FLJA 1R58A 2GG5A 3IU9A 3PKDA 2GG3A 1BN5A 2GG0A 4IPAA 1KP0A 2BHAA 2B3KA 5FCHA 1R5GA 2NQ7A 1C22A 2NQ6A 4S2RP 1WLRA 2V3XA 4ZWOA 1C23A 3FMQA 3PKCA 1N51A 3CB5A 1WL6A 3Q6DA 1CHMA 4IKUA 4MATA 3BIQA 4U6ZA 4U6EA 4R60A 2BWXA 4FO7A 2OKNA 2IW2A 3RVAA 1B59A 4FUKA 2BHCA 3TB5A 4FLIA 4U70A 4S01A 3RORA 3S6BA 2GA2A 5CLSA 2Q8KA 2BWYA 2EA2A 3D27A 3MR1A 1C27A 2EVMA 2OAZA 4IKRA 4RZYA 4RZZA 2P98A 1YVMA 5CDEA 2GU5A 1WY2A 1W2MA 4U1BA 1Y1NA 1BOAA 2EVCA 1R5HA 1WBQA 3BITA 2GU4A 4IU6A 1QXZA 2GZ5A 3L24A 4HXXA 2BWTA 4U73A 2GGCA 2MATA 4IKSA 4ZWUA 1WKMA 3IG4A 5CE6A 2Q93A 4U6CA 1W7VA 4U69A 1YJ3A 3BIPA 1C24A 1MATA 1PV9A 2P99A 3CTZA 5FCFA 3CB6A 4OOKA 1YW9A 2B3LA 4FO8A 4PNCA 2BB7A 4JUQA 5JHUA 4IF7A 2GU6A 2G6PA 4QR8A 1B6AA 1WN1A 2Q94A 2GG7A 2V6CA 4B28A 5JFRA 4U76A 2ZSGA 2HOWA
chains in the Genus database with same CATH topology
3FM3A 4U6JA 4ZNGA 4EGEA 4ZWPA 2GGBA 2Q92A 1A16A 4FKCA 4A6WA 2B3HA 2BWSA 3TAVA 2GG8A 2BN7A 2BWVA 1KQ9A 3MX6A 5D6EA 1YW8A 1XNZA 2GU7A 4S2TP 3PKEA 1M35A 2V3YA 3MATA 2BHBA 2BH3A 4IKTA 4Z7MA 4RGZ1 1WL9A 2GTXA 4PV4A 1O0XA 5E5BA 1XGNA 2BWWA 4IDYA 1XGSA 2GG2A 2ADUA 3IU8A 3L7GA 4S00A 1C21A 2Q95A 4KM3A 1QXWA 2GG9A 4FLKA 5CDLA 3PKAA 2DFIA 1YW7A 2P9AA 3IU7A 4U6WA 2V3ZA 5CIKA 1XGOA 5JI6A 1XGMA 4IECA 1QZYA 5D6FA 2BHDA 2EA4A 2EVOA 3PKBA 3FMRA 5CNXA 1KQ0A 4U71A 4A6VA 5CDVA 1QXYA 2Q96A 1JAWA 4U75A 2BWUA 4FLLA 4FLJA 1R58A 2GG5A 3IU9A 3PKDA 2GG3A 1BN5A 2GG0A 4IPAA 1KP0A 2BHAA 2B3KA 5FCHA 1R5GA 2NQ7A 1C22A 2NQ6A 4S2RP 1WLRA 2V3XA 4ZWOA 1C23A 3FMQA 3PKCA 1N51A 3CB5A 1WL6A 3Q6DA 1CHMA 4IKUA 4MATA 3BIQA 4U6ZA 4U6EA 4R60A 2BWXA 4FO7A 2OKNA 2IW2A 3RVAA 1B59A 4FUKA 2BHCA 3TB5A 4FLIA 4U70A 4S01A 3RORA 3S6BA 2GA2A 5CLSA 2Q8KA 2BWYA 2EA2A 3D27A 3MR1A 1C27A 2EVMA 2OAZA 4IKRA 4RZYA 4RZZA 2P98A 1YVMA 5CDEA 2GU5A 1WY2A 1W2MA 4U1BA 1Y1NA 1BOAA 2EVCA 1R5HA 1WBQA 3BITA 2GU4A 4IU6A 1QXZA 2GZ5A 3L24A 4HXXA 2BWTA 4U73A 2GGCA 2MATA 4IKSA 4ZWUA 1WKMA 3IG4A 5CE6A 2Q93A 4U6CA 1W7VA 4U69A 1YJ3A 3BIPA 1C24A 1MATA 1PV9A 2P99A 3CTZA 5FCFA 3CB6A 4OOKA 1YW9A 2B3LA 4FO8A 4PNCA 2BB7A 4JUQA 5JHUA 4IF7A 2GU6A 2G6PA 4QR8A 1B6AA 1WN1A 2Q94A 2GG7A 2V6CA 4B28A 5JFRA 4U76A 2ZSGA 2HOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM3 A;  4U6J A;  4ZNG A;  4EGE A;  4ZWP A;  2GGB A;  2Q92 A;  1A16 A;  4FKC A;  4A6W A;  2B3H A;  2BWS A;  3TAV A;  2GG8 A;  2BN7 A;  2BWV A;  1KQ9 A;  3MX6 A;  5D6E A;  1YW8 A;  1XNZ A;  2GU7 A;  4S2T P;  3PKE A;  1M35 A;  2V3Y A;  3MAT A;  2BHB A;  2BH3 A;  4IKT A;  4Z7M A;  4RGZ 1;  1WL9 A;  2GTX A;  4PV4 A;  1O0X A;  5E5B A;  1XGN A;  2BWW A;  4IDY A;  1XGS A;  2GG2 A;  2ADU A;  3IU8 A;  3L7G A;  4S00 A;  1C21 A;  2Q95 A;  4KM3 A;  1QXW A;  2GG9 A;  4FLK A;  5CDL A;  3PKA A;  2DFI A;  1YW7 A;  2P9A A;  3IU7 A;  4U6W A;  2V3Z A;  5CIK A;  1XGO A;  5JI6 A;  1XGM A;  4IEC A;  1QZY A;  5D6F A;  2BHD A;  2EA4 A;  2EVO A;  3PKB A;  3FMR A;  5CNX A;  1KQ0 A;  4U71 A;  4A6V A;  5CDV A;  1QXY A;  2Q96 A;  1JAW A;  4U75 A;  2BWU A;  4FLL A;  4FLJ A;  1R58 A;  2GG5 A;  3IU9 A;  3PKD A;  2GG3 A;  1BN5 A;  2GG0 A;  4IPA A;  1KP0 A;  2BHA A;  2B3K A;  5FCH A;  1R5G A;  2NQ7 A;  1C22 A;  2NQ6 A;  4S2R P;  1WLR A;  2V3X A;  4ZWO A;  1C23 A;  3FMQ A;  3PKC A;  1N51 A;  3CB5 A;  1WL6 A;  3Q6D A;  1CHM A;  4IKU A;  4MAT A;  3BIQ A;  4U6Z A;  4U6E A;  4R60 A;  2BWX A;  4FO7 A;  2OKN A;  2IW2 A;  3RVA A;  1B59 A;  4FUK A;  2BHC A;  3TB5 A;  4FLI A;  4U70 A;  4S01 A;  3ROR A;  3S6B A;  2GA2 A;  5CLS A;  2Q8K A;  2BWY A;  2EA2 A;  3D27 A;  3MR1 A;  1C27 A;  2EVM A;  2OAZ A;  4IKR A;  4RZY A;  4RZZ A;  2P98 A;  1YVM A;  5CDE A;  2GU5 A;  1WY2 A;  1W2M A;  4U1B A;  1Y1N A;  1BOA A;  2EVC A;  1R5H A;  1WBQ A;  3BIT A;  2GU4 A;  4IU6 A;  1QXZ A;  2GZ5 A;  3L24 A;  4HXX A;  2BWT A;  4U73 A;  2GGC A;  2MAT A;  4IKS A;  4ZWU A;  1WKM A;  3IG4 A;  5CE6 A;  2Q93 A;  4U6C A;  1W7V A;  4U69 A;  1YJ3 A;  3BIP A;  1C24 A;  1MAT A;  1PV9 A;  2P99 A;  3CTZ A;  5FCF A;  3CB6 A;  4OOK A;  1YW9 A;  2B3L A;  4FO8 A;  4PNC A;  2BB7 A;  4JUQ A;  5JHU A;  4IF7 A;  2GU6 A;  2G6P A;  4QR8 A;  1B6A A;  1WN1 A;  2Q94 A;  2GG7 A;  2V6C A;  4B28 A;  5JFR A;  4U76 A;  2ZSG A;  2HOW A; 
#chains in the Genus database with same CATH topology
 3FM3 A;  4U6J A;  4ZNG A;  4EGE A;  4ZWP A;  2GGB A;  2Q92 A;  1A16 A;  4FKC A;  4A6W A;  2B3H A;  2BWS A;  3TAV A;  2GG8 A;  2BN7 A;  2BWV A;  1KQ9 A;  3MX6 A;  5D6E A;  1YW8 A;  1XNZ A;  2GU7 A;  4S2T P;  3PKE A;  1M35 A;  2V3Y A;  3MAT A;  2BHB A;  2BH3 A;  4IKT A;  4Z7M A;  4RGZ 1;  1WL9 A;  2GTX A;  4PV4 A;  1O0X A;  5E5B A;  1XGN A;  2BWW A;  4IDY A;  1XGS A;  2GG2 A;  2ADU A;  3IU8 A;  3L7G A;  4S00 A;  1C21 A;  2Q95 A;  4KM3 A;  1QXW A;  2GG9 A;  4FLK A;  5CDL A;  3PKA A;  2DFI A;  1YW7 A;  2P9A A;  3IU7 A;  4U6W A;  2V3Z A;  5CIK A;  1XGO A;  5JI6 A;  1XGM A;  4IEC A;  1QZY A;  5D6F A;  2BHD A;  2EA4 A;  2EVO A;  3PKB A;  3FMR A;  5CNX A;  1KQ0 A;  4U71 A;  4A6V A;  5CDV A;  1QXY A;  2Q96 A;  1JAW A;  4U75 A;  2BWU A;  4FLL A;  4FLJ A;  1R58 A;  2GG5 A;  3IU9 A;  3PKD A;  2GG3 A;  1BN5 A;  2GG0 A;  4IPA A;  1KP0 A;  2BHA A;  2B3K A;  5FCH A;  1R5G A;  2NQ7 A;  1C22 A;  2NQ6 A;  4S2R P;  1WLR A;  2V3X A;  4ZWO A;  1C23 A;  3FMQ A;  3PKC A;  1N51 A;  3CB5 A;  1WL6 A;  3Q6D A;  1CHM A;  4IKU A;  4MAT A;  3BIQ A;  4U6Z A;  4U6E A;  4R60 A;  2BWX A;  4FO7 A;  2OKN A;  2IW2 A;  3RVA A;  1B59 A;  4FUK A;  2BHC A;  3TB5 A;  4FLI A;  4U70 A;  4S01 A;  3ROR A;  3S6B A;  2GA2 A;  5CLS A;  2Q8K A;  2BWY A;  2EA2 A;  3D27 A;  3MR1 A;  1C27 A;  2EVM A;  2OAZ A;  4IKR A;  4RZY A;  4RZZ A;  2P98 A;  1YVM A;  5CDE A;  2GU5 A;  1WY2 A;  1W2M A;  4U1B A;  1Y1N A;  1BOA A;  2EVC A;  1R5H A;  1WBQ A;  3BIT A;  2GU4 A;  4IU6 A;  1QXZ A;  2GZ5 A;  3L24 A;  4HXX A;  2BWT A;  4U73 A;  2GGC A;  2MAT A;  4IKS A;  4ZWU A;  1WKM A;  3IG4 A;  5CE6 A;  2Q93 A;  4U6C A;  1W7V A;  4U69 A;  1YJ3 A;  3BIP A;  1C24 A;  1MAT A;  1PV9 A;  2P99 A;  3CTZ A;  5FCF A;  3CB6 A;  4OOK A;  1YW9 A;  2B3L A;  4FO8 A;  4PNC A;  2BB7 A;  4JUQ A;  5JHU A;  4IF7 A;  2GU6 A;  2G6P A;  4QR8 A;  1B6A A;  1WN1 A;  2Q94 A;  2GG7 A;  2V6C A;  4B28 A;  5JFR A;  4U76 A;  2ZSG A;  2HOW A; 
#chains in the Genus database with same CATH homology
 3FM3 A;  4U6J A;  4ZNG A;  4EGE A;  4ZWP A;  2GGB A;  2Q92 A;  1A16 A;  4FKC A;  4A6W A;  2B3H A;  2BWS A;  3TAV A;  2GG8 A;  2BN7 A;  2BWV A;  1KQ9 A;  3MX6 A;  5D6E A;  1YW8 A;  1XNZ A;  2GU7 A;  4S2T P;  3PKE A;  1M35 A;  2V3Y A;  3MAT A;  2BHB A;  2BH3 A;  4IKT A;  4Z7M A;  4RGZ 1;  1WL9 A;  2GTX A;  4PV4 A;  1O0X A;  5E5B A;  1XGN A;  2BWW A;  4IDY A;  1XGS A;  2GG2 A;  2ADU A;  3IU8 A;  3L7G A;  4S00 A;  1C21 A;  2Q95 A;  4KM3 A;  1QXW A;  2GG9 A;  4FLK A;  5CDL A;  3PKA A;  2DFI A;  1YW7 A;  2P9A A;  3IU7 A;  4U6W A;  2V3Z A;  5CIK A;  1XGO A;  5JI6 A;  1XGM A;  4IEC A;  1QZY A;  5D6F A;  2BHD A;  2EA4 A;  2EVO A;  3PKB A;  3FMR A;  5CNX A;  1KQ0 A;  4U71 A;  4A6V A;  5CDV A;  1QXY A;  2Q96 A;  1JAW A;  4U75 A;  2BWU A;  4FLL A;  4FLJ A;  1R58 A;  2GG5 A;  3IU9 A;  3PKD A;  2GG3 A;  1BN5 A;  2GG0 A;  4IPA A;  1KP0 A;  2BHA A;  2B3K A;  5FCH A;  1R5G A;  2NQ7 A;  1C22 A;  2NQ6 A;  4S2R P;  1WLR A;  2V3X A;  4ZWO A;  1C23 A;  3FMQ A;  3PKC A;  1N51 A;  3CB5 A;  1WL6 A;  3Q6D A;  1CHM A;  4IKU A;  4MAT A;  3BIQ A;  4U6Z A;  4U6E A;  4R60 A;  2BWX A;  4FO7 A;  2OKN A;  2IW2 A;  3RVA A;  1B59 A;  4FUK A;  2BHC A;  3TB5 A;  4FLI A;  4U70 A;  4S01 A;  3ROR A;  3S6B A;  2GA2 A;  5CLS A;  2Q8K A;  2BWY A;  2EA2 A;  3D27 A;  3MR1 A;  1C27 A;  2EVM A;  2OAZ A;  4IKR A;  4RZY A;  4RZZ A;  2P98 A;  1YVM A;  5CDE A;  2GU5 A;  1WY2 A;  1W2M A;  4U1B A;  1Y1N A;  1BOA A;  2EVC A;  1R5H A;  1WBQ A;  3BIT A;  2GU4 A;  4IU6 A;  1QXZ A;  2GZ5 A;  3L24 A;  4HXX A;  2BWT A;  4U73 A;  2GGC A;  2MAT A;  4IKS A;  4ZWU A;  1WKM A;  3IG4 A;  5CE6 A;  2Q93 A;  4U6C A;  1W7V A;  4U69 A;  1YJ3 A;  3BIP A;  1C24 A;  1MAT A;  1PV9 A;  2P99 A;  3CTZ A;  5FCF A;  3CB6 A;  4OOK A;  1YW9 A;  2B3L A;  4FO8 A;  4PNC A;  2BB7 A;  4JUQ A;  5JHU A;  4IF7 A;  2GU6 A;  2G6P A;  4QR8 A;  1B6A A;  1WN1 A;  2Q94 A;  2GG7 A;  2V6C A;  4B28 A;  5JFR A;  4U76 A;  2ZSG A;  2HOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...