2GGBA

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2ggbA00
5FCHA 2ZSGA 1R5GA 4IKTA 1C23A 4MATA 5CNXA 2GGCA 4U70A 2GU5A 2GG5A 4JUQA 2Q93A 2BHCA 4Z7MA 4EGEA 1KQ0A 4A6VA 3IU7A 4A6WA 1PV9A 1QXZA 1BN5A 1WL9A 2EA2A 1R58A 4U6WA 2V3ZA 2GG9A 2GU6A 4FLKA 4ZWUA 4FO7A 4S2TP 5D6EA 4QR8A 4ZNGA 3FMRA 4RZYA 2OAZA 2Q92A 1YW8A 3BITA 2Q96A 4U76A 2HOWA 1N51A 2V3XA 2G6PA 5JFRA 4U71A 2BN7A 1KP0A 2GG3A 4U69A 2P9AA 3IU8A 3BIPA 3CB6A 4U6EA 5FCFA 5CDLA 5CDEA 3PKBA 4IU6A 4B28A 4FLIA 1XGMA 2V6CA 4S01A 5E5BA 1C22A 2P99A 2GTXA 3PKDA 3CTZA 2B3HA 2B3LA 2GG0A 1WL6A 5JHUA 1W2MA 4RZZA 2BWWA 2IW2A 2EVOA 3TB5A 1YW7A 2NQ7A 3CB5A 3FM3A 3MATA 2MATA 5CDVA 1B59A 1QXYA 4ZWPA 1M35A 1O0XA 4OOKA 1XGOA 1XNZA 5CE6A 3PKCA 1YVMA 4FLLA 4U6CA 2BB7A 1QZYA 3IG4A 4U6ZA 1KQ9A 2BWYA 2GG7A 2ADUA 4IDYA 4IKSA 1C24A 2GA2A 1MATA 2BHAA 2GU4A 4FKCA 4U6JA 3MX6A 1JAWA 3BIQA 4IKUA 4ZWOA 2EVMA 3IU9A 3FMQA 4U73A 2OKNA 2GU7A 1WLRA 2B3KA 4FUKA 3S6BA 1BOAA 2BH3A 4IF7A 2BWTA 2GGBA 1A16A 1R5HA 2EVCA 2V3YA 4HXXA 1WN1A 4KM3A 2BWXA 2BWUA 1XGSA 3D27A 2BWVA 3L7GA 3PKEA 4S2RP 4R60A 1W7VA 2NQ6A 3PKAA 3MR1A 4IECA 1WY2A 4PV4A 5JI6A 2DFIA 2Q95A 3RORA 4PNCA 1QXWA 1WBQA 1C21A 4FLJA 4IKRA 4S00A 4IPAA 5CIKA 2EA4A 5D6FA 3TAVA 1XGNA 1B6AA 4FO8A 1YW9A 1CHMA 1Y1NA 1YJ3A 2Q94A 4U1BA 1WKMA 3RVAA 3Q6DA 1C27A 4U75A 2GG8A 2GZ5A 3L24A 2P98A 2BHDA 4RGZ1 2Q8KA 2GG2A 2BHBA 2BWSA 5CLSA
chains in the Genus database with same CATH superfamily
5FCHA 2ZSGA 1R5GA 4IKTA 1C23A 4MATA 5CNXA 2GGCA 4U70A 2GU5A 2GG5A 4JUQA 2Q93A 2BHCA 4Z7MA 4EGEA 1KQ0A 4A6VA 3IU7A 4A6WA 1PV9A 1QXZA 1BN5A 1WL9A 2EA2A 1R58A 4U6WA 2V3ZA 2GG9A 2GU6A 4FLKA 4ZWUA 4FO7A 4S2TP 5D6EA 4QR8A 4ZNGA 3FMRA 4RZYA 2OAZA 2Q92A 1YW8A 3BITA 2Q96A 4U76A 2HOWA 1N51A 2V3XA 2G6PA 5JFRA 4U71A 2BN7A 1KP0A 2GG3A 4U69A 2P9AA 3IU8A 3BIPA 3CB6A 4U6EA 5FCFA 5CDLA 5CDEA 3PKBA 4IU6A 4B28A 4FLIA 1XGMA 2V6CA 4S01A 5E5BA 1C22A 2P99A 2GTXA 3PKDA 3CTZA 2B3HA 2B3LA 2GG0A 1WL6A 5JHUA 1W2MA 4RZZA 2BWWA 2IW2A 2EVOA 3TB5A 1YW7A 2NQ7A 3CB5A 3FM3A 3MATA 2MATA 5CDVA 1B59A 1QXYA 4ZWPA 1M35A 1O0XA 4OOKA 1XGOA 1XNZA 5CE6A 3PKCA 1YVMA 4FLLA 4U6CA 2BB7A 1QZYA 3IG4A 4U6ZA 1KQ9A 2BWYA 2GG7A 2ADUA 4IDYA 4IKSA 1C24A 2GA2A 1MATA 2BHAA 2GU4A 4FKCA 4U6JA 3MX6A 1JAWA 3BIQA 4IKUA 4ZWOA 2EVMA 3IU9A 3FMQA 4U73A 2OKNA 2GU7A 1WLRA 2B3KA 4FUKA 3S6BA 1BOAA 2BH3A 4IF7A 2BWTA 2GGBA 1A16A 1R5HA 2EVCA 2V3YA 4HXXA 1WN1A 4KM3A 2BWXA 2BWUA 1XGSA 3D27A 2BWVA 3L7GA 3PKEA 4S2RP 4R60A 1W7VA 2NQ6A 3PKAA 3MR1A 4IECA 1WY2A 4PV4A 5JI6A 2DFIA 2Q95A 3RORA 4PNCA 1QXWA 1WBQA 1C21A 4FLJA 4IKRA 4S00A 4IPAA 5CIKA 2EA4A 5D6FA 3TAVA 1XGNA 1B6AA 4FO8A 1YW9A 1CHMA 1Y1NA 1YJ3A 2Q94A 4U1BA 1WKMA 3RVAA 3Q6DA 1C27A 4U75A 2GG8A 2GZ5A 3L24A 2P98A 2BHDA 4RGZ1 2Q8KA 2GG2A 2BHBA 2BWSA 5CLSA
chains in the Genus database with same CATH topology
5FCHA 2ZSGA 1R5GA 4IKTA 1C23A 4MATA 5CNXA 2GGCA 4U70A 2GU5A 2GG5A 4JUQA 2Q93A 2BHCA 4Z7MA 4EGEA 1KQ0A 4A6VA 3IU7A 4A6WA 1PV9A 1QXZA 1BN5A 1WL9A 2EA2A 1R58A 4U6WA 2V3ZA 2GG9A 2GU6A 4FLKA 4ZWUA 4FO7A 4S2TP 5D6EA 4QR8A 4ZNGA 3FMRA 4RZYA 2OAZA 2Q92A 1YW8A 3BITA 2Q96A 4U76A 2HOWA 1N51A 2V3XA 2G6PA 5JFRA 4U71A 2BN7A 1KP0A 2GG3A 4U69A 2P9AA 3IU8A 3BIPA 3CB6A 4U6EA 5FCFA 5CDLA 5CDEA 3PKBA 4IU6A 4B28A 4FLIA 1XGMA 2V6CA 4S01A 5E5BA 1C22A 2P99A 2GTXA 3PKDA 3CTZA 2B3HA 2B3LA 2GG0A 1WL6A 5JHUA 1W2MA 4RZZA 2BWWA 2IW2A 2EVOA 3TB5A 1YW7A 2NQ7A 3CB5A 3FM3A 3MATA 2MATA 5CDVA 1B59A 1QXYA 4ZWPA 1M35A 1O0XA 4OOKA 1XGOA 1XNZA 5CE6A 3PKCA 1YVMA 4FLLA 4U6CA 2BB7A 1QZYA 3IG4A 4U6ZA 1KQ9A 2BWYA 2GG7A 2ADUA 4IDYA 4IKSA 1C24A 2GA2A 1MATA 2BHAA 2GU4A 4FKCA 4U6JA 3MX6A 1JAWA 3BIQA 4IKUA 4ZWOA 2EVMA 3IU9A 3FMQA 4U73A 2OKNA 2GU7A 1WLRA 2B3KA 4FUKA 3S6BA 1BOAA 2BH3A 4IF7A 2BWTA 2GGBA 1A16A 1R5HA 2EVCA 2V3YA 4HXXA 1WN1A 4KM3A 2BWXA 2BWUA 1XGSA 3D27A 2BWVA 3L7GA 3PKEA 4S2RP 4R60A 1W7VA 2NQ6A 3PKAA 3MR1A 4IECA 1WY2A 4PV4A 5JI6A 2DFIA 2Q95A 3RORA 4PNCA 1QXWA 1WBQA 1C21A 4FLJA 4IKRA 4S00A 4IPAA 5CIKA 2EA4A 5D6FA 3TAVA 1XGNA 1B6AA 4FO8A 1YW9A 1CHMA 1Y1NA 1YJ3A 2Q94A 4U1BA 1WKMA 3RVAA 3Q6DA 1C27A 4U75A 2GG8A 2GZ5A 3L24A 2P98A 2BHDA 4RGZ1 2Q8KA 2GG2A 2BHBA 2BWSA 5CLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FCH A;  2ZSG A;  1R5G A;  4IKT A;  1C23 A;  4MAT A;  5CNX A;  2GGC A;  4U70 A;  2GU5 A;  2GG5 A;  4JUQ A;  2Q93 A;  2BHC A;  4Z7M A;  4EGE A;  1KQ0 A;  4A6V A;  3IU7 A;  4A6W A;  1PV9 A;  1QXZ A;  1BN5 A;  1WL9 A;  2EA2 A;  1R58 A;  4U6W A;  2V3Z A;  2GG9 A;  2GU6 A;  4FLK A;  4ZWU A;  4FO7 A;  4S2T P;  5D6E A;  4QR8 A;  4ZNG A;  3FMR A;  4RZY A;  2OAZ A;  2Q92 A;  1YW8 A;  3BIT A;  2Q96 A;  4U76 A;  2HOW A;  1N51 A;  2V3X A;  2G6P A;  5JFR A;  4U71 A;  2BN7 A;  1KP0 A;  2GG3 A;  4U69 A;  2P9A A;  3IU8 A;  3BIP A;  3CB6 A;  4U6E A;  5FCF A;  5CDL A;  5CDE A;  3PKB A;  4IU6 A;  4B28 A;  4FLI A;  1XGM A;  2V6C A;  4S01 A;  5E5B A;  1C22 A;  2P99 A;  2GTX A;  3PKD A;  3CTZ A;  2B3H A;  2B3L A;  2GG0 A;  1WL6 A;  5JHU A;  1W2M A;  4RZZ A;  2BWW A;  2IW2 A;  2EVO A;  3TB5 A;  1YW7 A;  2NQ7 A;  3CB5 A;  3FM3 A;  3MAT A;  2MAT A;  5CDV A;  1B59 A;  1QXY A;  4ZWP A;  1M35 A;  1O0X A;  4OOK A;  1XGO A;  1XNZ A;  5CE6 A;  3PKC A;  1YVM A;  4FLL A;  4U6C A;  2BB7 A;  1QZY A;  3IG4 A;  4U6Z A;  1KQ9 A;  2BWY A;  2GG7 A;  2ADU A;  4IDY A;  4IKS A;  1C24 A;  2GA2 A;  1MAT A;  2BHA A;  2GU4 A;  4FKC A;  4U6J A;  3MX6 A;  1JAW A;  3BIQ A;  4IKU A;  4ZWO A;  2EVM A;  3IU9 A;  3FMQ A;  4U73 A;  2OKN A;  2GU7 A;  1WLR A;  2B3K A;  4FUK A;  3S6B A;  1BOA A;  2BH3 A;  4IF7 A;  2BWT A;  2GGB A;  1A16 A;  1R5H A;  2EVC A;  2V3Y A;  4HXX A;  1WN1 A;  4KM3 A;  2BWX A;  2BWU A;  1XGS A;  3D27 A;  2BWV A;  3L7G A;  3PKE A;  4S2R P;  4R60 A;  1W7V A;  2NQ6 A;  3PKA A;  3MR1 A;  4IEC A;  1WY2 A;  4PV4 A;  5JI6 A;  2DFI A;  2Q95 A;  3ROR A;  4PNC A;  1QXW A;  1WBQ A;  1C21 A;  4FLJ A;  4IKR A;  4S00 A;  4IPA A;  5CIK A;  2EA4 A;  5D6F A;  3TAV A;  1XGN A;  1B6A A;  4FO8 A;  1YW9 A;  1CHM A;  1Y1N A;  1YJ3 A;  2Q94 A;  4U1B A;  1WKM A;  3RVA A;  3Q6D A;  1C27 A;  4U75 A;  2GG8 A;  2GZ5 A;  3L24 A;  2P98 A;  2BHD A;  4RGZ 1;  2Q8K A;  2GG2 A;  2BHB A;  2BWS A;  5CLS A; 
#chains in the Genus database with same CATH topology
 5FCH A;  2ZSG A;  1R5G A;  4IKT A;  1C23 A;  4MAT A;  5CNX A;  2GGC A;  4U70 A;  2GU5 A;  2GG5 A;  4JUQ A;  2Q93 A;  2BHC A;  4Z7M A;  4EGE A;  1KQ0 A;  4A6V A;  3IU7 A;  4A6W A;  1PV9 A;  1QXZ A;  1BN5 A;  1WL9 A;  2EA2 A;  1R58 A;  4U6W A;  2V3Z A;  2GG9 A;  2GU6 A;  4FLK A;  4ZWU A;  4FO7 A;  4S2T P;  5D6E A;  4QR8 A;  4ZNG A;  3FMR A;  4RZY A;  2OAZ A;  2Q92 A;  1YW8 A;  3BIT A;  2Q96 A;  4U76 A;  2HOW A;  1N51 A;  2V3X A;  2G6P A;  5JFR A;  4U71 A;  2BN7 A;  1KP0 A;  2GG3 A;  4U69 A;  2P9A A;  3IU8 A;  3BIP A;  3CB6 A;  4U6E A;  5FCF A;  5CDL A;  5CDE A;  3PKB A;  4IU6 A;  4B28 A;  4FLI A;  1XGM A;  2V6C A;  4S01 A;  5E5B A;  1C22 A;  2P99 A;  2GTX A;  3PKD A;  3CTZ A;  2B3H A;  2B3L A;  2GG0 A;  1WL6 A;  5JHU A;  1W2M A;  4RZZ A;  2BWW A;  2IW2 A;  2EVO A;  3TB5 A;  1YW7 A;  2NQ7 A;  3CB5 A;  3FM3 A;  3MAT A;  2MAT A;  5CDV A;  1B59 A;  1QXY A;  4ZWP A;  1M35 A;  1O0X A;  4OOK A;  1XGO A;  1XNZ A;  5CE6 A;  3PKC A;  1YVM A;  4FLL A;  4U6C A;  2BB7 A;  1QZY A;  3IG4 A;  4U6Z A;  1KQ9 A;  2BWY A;  2GG7 A;  2ADU A;  4IDY A;  4IKS A;  1C24 A;  2GA2 A;  1MAT A;  2BHA A;  2GU4 A;  4FKC A;  4U6J A;  3MX6 A;  1JAW A;  3BIQ A;  4IKU A;  4ZWO A;  2EVM A;  3IU9 A;  3FMQ A;  4U73 A;  2OKN A;  2GU7 A;  1WLR A;  2B3K A;  4FUK A;  3S6B A;  1BOA A;  2BH3 A;  4IF7 A;  2BWT A;  2GGB A;  1A16 A;  1R5H A;  2EVC A;  2V3Y A;  4HXX A;  1WN1 A;  4KM3 A;  2BWX A;  2BWU A;  1XGS A;  3D27 A;  2BWV A;  3L7G A;  3PKE A;  4S2R P;  4R60 A;  1W7V A;  2NQ6 A;  3PKA A;  3MR1 A;  4IEC A;  1WY2 A;  4PV4 A;  5JI6 A;  2DFI A;  2Q95 A;  3ROR A;  4PNC A;  1QXW A;  1WBQ A;  1C21 A;  4FLJ A;  4IKR A;  4S00 A;  4IPA A;  5CIK A;  2EA4 A;  5D6F A;  3TAV A;  1XGN A;  1B6A A;  4FO8 A;  1YW9 A;  1CHM A;  1Y1N A;  1YJ3 A;  2Q94 A;  4U1B A;  1WKM A;  3RVA A;  3Q6D A;  1C27 A;  4U75 A;  2GG8 A;  2GZ5 A;  3L24 A;  2P98 A;  2BHD A;  4RGZ 1;  2Q8K A;  2GG2 A;  2BHB A;  2BWS A;  5CLS A; 
#chains in the Genus database with same CATH homology
 5FCH A;  2ZSG A;  1R5G A;  4IKT A;  1C23 A;  4MAT A;  5CNX A;  2GGC A;  4U70 A;  2GU5 A;  2GG5 A;  4JUQ A;  2Q93 A;  2BHC A;  4Z7M A;  4EGE A;  1KQ0 A;  4A6V A;  3IU7 A;  4A6W A;  1PV9 A;  1QXZ A;  1BN5 A;  1WL9 A;  2EA2 A;  1R58 A;  4U6W A;  2V3Z A;  2GG9 A;  2GU6 A;  4FLK A;  4ZWU A;  4FO7 A;  4S2T P;  5D6E A;  4QR8 A;  4ZNG A;  3FMR A;  4RZY A;  2OAZ A;  2Q92 A;  1YW8 A;  3BIT A;  2Q96 A;  4U76 A;  2HOW A;  1N51 A;  2V3X A;  2G6P A;  5JFR A;  4U71 A;  2BN7 A;  1KP0 A;  2GG3 A;  4U69 A;  2P9A A;  3IU8 A;  3BIP A;  3CB6 A;  4U6E A;  5FCF A;  5CDL A;  5CDE A;  3PKB A;  4IU6 A;  4B28 A;  4FLI A;  1XGM A;  2V6C A;  4S01 A;  5E5B A;  1C22 A;  2P99 A;  2GTX A;  3PKD A;  3CTZ A;  2B3H A;  2B3L A;  2GG0 A;  1WL6 A;  5JHU A;  1W2M A;  4RZZ A;  2BWW A;  2IW2 A;  2EVO A;  3TB5 A;  1YW7 A;  2NQ7 A;  3CB5 A;  3FM3 A;  3MAT A;  2MAT A;  5CDV A;  1B59 A;  1QXY A;  4ZWP A;  1M35 A;  1O0X A;  4OOK A;  1XGO A;  1XNZ A;  5CE6 A;  3PKC A;  1YVM A;  4FLL A;  4U6C A;  2BB7 A;  1QZY A;  3IG4 A;  4U6Z A;  1KQ9 A;  2BWY A;  2GG7 A;  2ADU A;  4IDY A;  4IKS A;  1C24 A;  2GA2 A;  1MAT A;  2BHA A;  2GU4 A;  4FKC A;  4U6J A;  3MX6 A;  1JAW A;  3BIQ A;  4IKU A;  4ZWO A;  2EVM A;  3IU9 A;  3FMQ A;  4U73 A;  2OKN A;  2GU7 A;  1WLR A;  2B3K A;  4FUK A;  3S6B A;  1BOA A;  2BH3 A;  4IF7 A;  2BWT A;  2GGB A;  1A16 A;  1R5H A;  2EVC A;  2V3Y A;  4HXX A;  1WN1 A;  4KM3 A;  2BWX A;  2BWU A;  1XGS A;  3D27 A;  2BWV A;  3L7G A;  3PKE A;  4S2R P;  4R60 A;  1W7V A;  2NQ6 A;  3PKA A;  3MR1 A;  4IEC A;  1WY2 A;  4PV4 A;  5JI6 A;  2DFI A;  2Q95 A;  3ROR A;  4PNC A;  1QXW A;  1WBQ A;  1C21 A;  4FLJ A;  4IKR A;  4S00 A;  4IPA A;  5CIK A;  2EA4 A;  5D6F A;  3TAV A;  1XGN A;  1B6A A;  4FO8 A;  1YW9 A;  1CHM A;  1Y1N A;  1YJ3 A;  2Q94 A;  4U1B A;  1WKM A;  3RVA A;  3Q6D A;  1C27 A;  4U75 A;  2GG8 A;  2GZ5 A;  3L24 A;  2P98 A;  2BHD A;  4RGZ 1;  2Q8K A;  2GG2 A;  2BHB A;  2BWS A;  5CLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...