2GGCA

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 87
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2ggcA00
5E5BA 4U6WA 1QXYA 2BHBA 3TAVA 4Z7MA 2ADUA 1XGNA 3PKBA 2GG0A 1WL9A 4U6ZA 3FM3A 1C23A 4A6WA 1WY2A 4U76A 5CDEA 1QXWA 3BITA 4ZWOA 1C21A 4S2TP 4U71A 5FCFA 1R5GA 3Q6DA 2GZ5A 1B59A 4U73A 2IW2A 5FCHA 3IU7A 1R58A 2GG8A 1BOAA 1N51A 1XGSA 4U6CA 1WKMA 5CNXA 2GG3A 2BWSA 2GA2A 3L24A 2V3YA 3IG4A 2MATA 1KP0A 1XGOA 4U70A 1B6AA 2GG2A 2OKNA 2Q96A 2B3KA 4U1BA 2BHCA 2EVMA 3RORA 2V6CA 1R5HA 1A16A 4IKTA 4RZYA 4FLKA 1CHMA 1YJ3A 2G6PA 2V3ZA 1XNZA 4IU6A 3BIQA 4IKSA 3IU8A 4U6JA 2EA4A 1WN1A 3FMQA 4JUQA 2EA2A 4RGZ1 3PKAA 1O0XA 4ZWPA 1XGMA 1YW9A 2NQ7A 3D27A 2EVCA 2Q92A 4IF7A 5JFRA 1YW8A 3PKCA 1C24A 3MX6A 4IPAA 1MATA 1C22A 3MR1A 4ZWUA 1QZYA 1BN5A 1WLRA 4B28A 2GU4A 2ZSGA 1Y1NA 4OOKA 1WL6A 3CB5A 3CB6A 2BWXA 1M35A 5JI6A 3RVAA 4U6EA 2BN7A 4EGEA 2B3HA 5D6EA 4IECA 5JHUA 1W2MA 2P98A 4FUKA 2NQ6A 2Q8KA 2BB7A 4IKUA 3CTZA 1JAWA 3L7GA 5CDVA 2BHDA 2GGBA 5CDLA 4R60A 3S6BA 1KQ9A 1QXZA 2BWYA 2BWUA 2GTXA 4RZZA 2DFIA 5CIKA 1W7VA 3FMRA 1KQ0A 2V3XA 4FLJA 4A6VA 2GU7A 2GU5A 4FO8A 1WBQA 2HOWA 4FO7A 3IU9A 4S2RP 4U75A 4IDYA 4PV4A 2OAZA 4PNCA 4S00A 2Q94A 4HXXA 4MATA 2GG9A 3PKEA 4ZNGA 5CE6A 2BWVA 2BH3A 4IKRA 4FKCA 3PKDA 4QR8A 5CLSA 2Q95A 2GG7A 1PV9A 2P9AA 3BIPA 2BWTA 2Q93A 1YVMA 4KM3A 2B3LA 2BWWA 2GGCA 2GU6A 4U69A 4FLIA 5D6FA 1C27A 2GG5A 1YW7A 3MATA 2EVOA 3TB5A 4S01A 4FLLA 2P99A 2BHAA
chains in the Genus database with same CATH superfamily
5E5BA 4U6WA 1QXYA 2BHBA 3TAVA 4Z7MA 2ADUA 1XGNA 3PKBA 2GG0A 1WL9A 4U6ZA 3FM3A 1C23A 4A6WA 1WY2A 4U76A 5CDEA 1QXWA 3BITA 4ZWOA 1C21A 4S2TP 4U71A 5FCFA 1R5GA 3Q6DA 2GZ5A 1B59A 4U73A 2IW2A 5FCHA 3IU7A 1R58A 2GG8A 1BOAA 1N51A 1XGSA 4U6CA 1WKMA 5CNXA 2GG3A 2BWSA 2GA2A 3L24A 2V3YA 3IG4A 2MATA 1KP0A 1XGOA 4U70A 1B6AA 2GG2A 2OKNA 2Q96A 2B3KA 4U1BA 2BHCA 2EVMA 3RORA 2V6CA 1R5HA 1A16A 4IKTA 4RZYA 4FLKA 1CHMA 1YJ3A 2G6PA 2V3ZA 1XNZA 4IU6A 3BIQA 4IKSA 3IU8A 4U6JA 2EA4A 1WN1A 3FMQA 4JUQA 2EA2A 4RGZ1 3PKAA 1O0XA 4ZWPA 1XGMA 1YW9A 2NQ7A 3D27A 2EVCA 2Q92A 4IF7A 5JFRA 1YW8A 3PKCA 1C24A 3MX6A 4IPAA 1MATA 1C22A 3MR1A 4ZWUA 1QZYA 1BN5A 1WLRA 4B28A 2GU4A 2ZSGA 1Y1NA 4OOKA 1WL6A 3CB5A 3CB6A 2BWXA 1M35A 5JI6A 3RVAA 4U6EA 2BN7A 4EGEA 2B3HA 5D6EA 4IECA 5JHUA 1W2MA 2P98A 4FUKA 2NQ6A 2Q8KA 2BB7A 4IKUA 3CTZA 1JAWA 3L7GA 5CDVA 2BHDA 2GGBA 5CDLA 4R60A 3S6BA 1KQ9A 1QXZA 2BWYA 2BWUA 2GTXA 4RZZA 2DFIA 5CIKA 1W7VA 3FMRA 1KQ0A 2V3XA 4FLJA 4A6VA 2GU7A 2GU5A 4FO8A 1WBQA 2HOWA 4FO7A 3IU9A 4S2RP 4U75A 4IDYA 4PV4A 2OAZA 4PNCA 4S00A 2Q94A 4HXXA 4MATA 2GG9A 3PKEA 4ZNGA 5CE6A 2BWVA 2BH3A 4IKRA 4FKCA 3PKDA 4QR8A 5CLSA 2Q95A 2GG7A 1PV9A 2P9AA 3BIPA 2BWTA 2Q93A 1YVMA 4KM3A 2B3LA 2BWWA 2GGCA 2GU6A 4U69A 4FLIA 5D6FA 1C27A 2GG5A 1YW7A 3MATA 2EVOA 3TB5A 4S01A 4FLLA 2P99A 2BHAA
chains in the Genus database with same CATH topology
5E5BA 4U6WA 1QXYA 2BHBA 3TAVA 4Z7MA 2ADUA 1XGNA 3PKBA 2GG0A 1WL9A 4U6ZA 3FM3A 1C23A 4A6WA 1WY2A 4U76A 5CDEA 1QXWA 3BITA 4ZWOA 1C21A 4S2TP 4U71A 5FCFA 1R5GA 3Q6DA 2GZ5A 1B59A 4U73A 2IW2A 5FCHA 3IU7A 1R58A 2GG8A 1BOAA 1N51A 1XGSA 4U6CA 1WKMA 5CNXA 2GG3A 2BWSA 2GA2A 3L24A 2V3YA 3IG4A 2MATA 1KP0A 1XGOA 4U70A 1B6AA 2GG2A 2OKNA 2Q96A 2B3KA 4U1BA 2BHCA 2EVMA 3RORA 2V6CA 1R5HA 1A16A 4IKTA 4RZYA 4FLKA 1CHMA 1YJ3A 2G6PA 2V3ZA 1XNZA 4IU6A 3BIQA 4IKSA 3IU8A 4U6JA 2EA4A 1WN1A 3FMQA 4JUQA 2EA2A 4RGZ1 3PKAA 1O0XA 4ZWPA 1XGMA 1YW9A 2NQ7A 3D27A 2EVCA 2Q92A 4IF7A 5JFRA 1YW8A 3PKCA 1C24A 3MX6A 4IPAA 1MATA 1C22A 3MR1A 4ZWUA 1QZYA 1BN5A 1WLRA 4B28A 2GU4A 2ZSGA 1Y1NA 4OOKA 1WL6A 3CB5A 3CB6A 2BWXA 1M35A 5JI6A 3RVAA 4U6EA 2BN7A 4EGEA 2B3HA 5D6EA 4IECA 5JHUA 1W2MA 2P98A 4FUKA 2NQ6A 2Q8KA 2BB7A 4IKUA 3CTZA 1JAWA 3L7GA 5CDVA 2BHDA 2GGBA 5CDLA 4R60A 3S6BA 1KQ9A 1QXZA 2BWYA 2BWUA 2GTXA 4RZZA 2DFIA 5CIKA 1W7VA 3FMRA 1KQ0A 2V3XA 4FLJA 4A6VA 2GU7A 2GU5A 4FO8A 1WBQA 2HOWA 4FO7A 3IU9A 4S2RP 4U75A 4IDYA 4PV4A 2OAZA 4PNCA 4S00A 2Q94A 4HXXA 4MATA 2GG9A 3PKEA 4ZNGA 5CE6A 2BWVA 2BH3A 4IKRA 4FKCA 3PKDA 4QR8A 5CLSA 2Q95A 2GG7A 1PV9A 2P9AA 3BIPA 2BWTA 2Q93A 1YVMA 4KM3A 2B3LA 2BWWA 2GGCA 2GU6A 4U69A 4FLIA 5D6FA 1C27A 2GG5A 1YW7A 3MATA 2EVOA 3TB5A 4S01A 4FLLA 2P99A 2BHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E5B A;  4U6W A;  1QXY A;  2BHB A;  3TAV A;  4Z7M A;  2ADU A;  1XGN A;  3PKB A;  2GG0 A;  1WL9 A;  4U6Z A;  3FM3 A;  1C23 A;  4A6W A;  1WY2 A;  4U76 A;  5CDE A;  1QXW A;  3BIT A;  4ZWO A;  1C21 A;  4S2T P;  4U71 A;  5FCF A;  1R5G A;  3Q6D A;  2GZ5 A;  1B59 A;  4U73 A;  2IW2 A;  5FCH A;  3IU7 A;  1R58 A;  2GG8 A;  1BOA A;  1N51 A;  1XGS A;  4U6C A;  1WKM A;  5CNX A;  2GG3 A;  2BWS A;  2GA2 A;  3L24 A;  2V3Y A;  3IG4 A;  2MAT A;  1KP0 A;  1XGO A;  4U70 A;  1B6A A;  2GG2 A;  2OKN A;  2Q96 A;  2B3K A;  4U1B A;  2BHC A;  2EVM A;  3ROR A;  2V6C A;  1R5H A;  1A16 A;  4IKT A;  4RZY A;  4FLK A;  1CHM A;  1YJ3 A;  2G6P A;  2V3Z A;  1XNZ A;  4IU6 A;  3BIQ A;  4IKS A;  3IU8 A;  4U6J A;  2EA4 A;  1WN1 A;  3FMQ A;  4JUQ A;  2EA2 A;  4RGZ 1;  3PKA A;  1O0X A;  4ZWP A;  1XGM A;  1YW9 A;  2NQ7 A;  3D27 A;  2EVC A;  2Q92 A;  4IF7 A;  5JFR A;  1YW8 A;  3PKC A;  1C24 A;  3MX6 A;  4IPA A;  1MAT A;  1C22 A;  3MR1 A;  4ZWU A;  1QZY A;  1BN5 A;  1WLR A;  4B28 A;  2GU4 A;  2ZSG A;  1Y1N A;  4OOK A;  1WL6 A;  3CB5 A;  3CB6 A;  2BWX A;  1M35 A;  5JI6 A;  3RVA A;  4U6E A;  2BN7 A;  4EGE A;  2B3H A;  5D6E A;  4IEC A;  5JHU A;  1W2M A;  2P98 A;  4FUK A;  2NQ6 A;  2Q8K A;  2BB7 A;  4IKU A;  3CTZ A;  1JAW A;  3L7G A;  5CDV A;  2BHD A;  2GGB A;  5CDL A;  4R60 A;  3S6B A;  1KQ9 A;  1QXZ A;  2BWY A;  2BWU A;  2GTX A;  4RZZ A;  2DFI A;  5CIK A;  1W7V A;  3FMR A;  1KQ0 A;  2V3X A;  4FLJ A;  4A6V A;  2GU7 A;  2GU5 A;  4FO8 A;  1WBQ A;  2HOW A;  4FO7 A;  3IU9 A;  4S2R P;  4U75 A;  4IDY A;  4PV4 A;  2OAZ A;  4PNC A;  4S00 A;  2Q94 A;  4HXX A;  4MAT A;  2GG9 A;  3PKE A;  4ZNG A;  5CE6 A;  2BWV A;  2BH3 A;  4IKR A;  4FKC A;  3PKD A;  4QR8 A;  5CLS A;  2Q95 A;  2GG7 A;  1PV9 A;  2P9A A;  3BIP A;  2BWT A;  2Q93 A;  1YVM A;  4KM3 A;  2B3L A;  2BWW A;  2GGC A;  2GU6 A;  4U69 A;  4FLI A;  5D6F A;  1C27 A;  2GG5 A;  1YW7 A;  3MAT A;  2EVO A;  3TB5 A;  4S01 A;  4FLL A;  2P99 A;  2BHA A; 
#chains in the Genus database with same CATH topology
 5E5B A;  4U6W A;  1QXY A;  2BHB A;  3TAV A;  4Z7M A;  2ADU A;  1XGN A;  3PKB A;  2GG0 A;  1WL9 A;  4U6Z A;  3FM3 A;  1C23 A;  4A6W A;  1WY2 A;  4U76 A;  5CDE A;  1QXW A;  3BIT A;  4ZWO A;  1C21 A;  4S2T P;  4U71 A;  5FCF A;  1R5G A;  3Q6D A;  2GZ5 A;  1B59 A;  4U73 A;  2IW2 A;  5FCH A;  3IU7 A;  1R58 A;  2GG8 A;  1BOA A;  1N51 A;  1XGS A;  4U6C A;  1WKM A;  5CNX A;  2GG3 A;  2BWS A;  2GA2 A;  3L24 A;  2V3Y A;  3IG4 A;  2MAT A;  1KP0 A;  1XGO A;  4U70 A;  1B6A A;  2GG2 A;  2OKN A;  2Q96 A;  2B3K A;  4U1B A;  2BHC A;  2EVM A;  3ROR A;  2V6C A;  1R5H A;  1A16 A;  4IKT A;  4RZY A;  4FLK A;  1CHM A;  1YJ3 A;  2G6P A;  2V3Z A;  1XNZ A;  4IU6 A;  3BIQ A;  4IKS A;  3IU8 A;  4U6J A;  2EA4 A;  1WN1 A;  3FMQ A;  4JUQ A;  2EA2 A;  4RGZ 1;  3PKA A;  1O0X A;  4ZWP A;  1XGM A;  1YW9 A;  2NQ7 A;  3D27 A;  2EVC A;  2Q92 A;  4IF7 A;  5JFR A;  1YW8 A;  3PKC A;  1C24 A;  3MX6 A;  4IPA A;  1MAT A;  1C22 A;  3MR1 A;  4ZWU A;  1QZY A;  1BN5 A;  1WLR A;  4B28 A;  2GU4 A;  2ZSG A;  1Y1N A;  4OOK A;  1WL6 A;  3CB5 A;  3CB6 A;  2BWX A;  1M35 A;  5JI6 A;  3RVA A;  4U6E A;  2BN7 A;  4EGE A;  2B3H A;  5D6E A;  4IEC A;  5JHU A;  1W2M A;  2P98 A;  4FUK A;  2NQ6 A;  2Q8K A;  2BB7 A;  4IKU A;  3CTZ A;  1JAW A;  3L7G A;  5CDV A;  2BHD A;  2GGB A;  5CDL A;  4R60 A;  3S6B A;  1KQ9 A;  1QXZ A;  2BWY A;  2BWU A;  2GTX A;  4RZZ A;  2DFI A;  5CIK A;  1W7V A;  3FMR A;  1KQ0 A;  2V3X A;  4FLJ A;  4A6V A;  2GU7 A;  2GU5 A;  4FO8 A;  1WBQ A;  2HOW A;  4FO7 A;  3IU9 A;  4S2R P;  4U75 A;  4IDY A;  4PV4 A;  2OAZ A;  4PNC A;  4S00 A;  2Q94 A;  4HXX A;  4MAT A;  2GG9 A;  3PKE A;  4ZNG A;  5CE6 A;  2BWV A;  2BH3 A;  4IKR A;  4FKC A;  3PKD A;  4QR8 A;  5CLS A;  2Q95 A;  2GG7 A;  1PV9 A;  2P9A A;  3BIP A;  2BWT A;  2Q93 A;  1YVM A;  4KM3 A;  2B3L A;  2BWW A;  2GGC A;  2GU6 A;  4U69 A;  4FLI A;  5D6F A;  1C27 A;  2GG5 A;  1YW7 A;  3MAT A;  2EVO A;  3TB5 A;  4S01 A;  4FLL A;  2P99 A;  2BHA A; 
#chains in the Genus database with same CATH homology
 5E5B A;  4U6W A;  1QXY A;  2BHB A;  3TAV A;  4Z7M A;  2ADU A;  1XGN A;  3PKB A;  2GG0 A;  1WL9 A;  4U6Z A;  3FM3 A;  1C23 A;  4A6W A;  1WY2 A;  4U76 A;  5CDE A;  1QXW A;  3BIT A;  4ZWO A;  1C21 A;  4S2T P;  4U71 A;  5FCF A;  1R5G A;  3Q6D A;  2GZ5 A;  1B59 A;  4U73 A;  2IW2 A;  5FCH A;  3IU7 A;  1R58 A;  2GG8 A;  1BOA A;  1N51 A;  1XGS A;  4U6C A;  1WKM A;  5CNX A;  2GG3 A;  2BWS A;  2GA2 A;  3L24 A;  2V3Y A;  3IG4 A;  2MAT A;  1KP0 A;  1XGO A;  4U70 A;  1B6A A;  2GG2 A;  2OKN A;  2Q96 A;  2B3K A;  4U1B A;  2BHC A;  2EVM A;  3ROR A;  2V6C A;  1R5H A;  1A16 A;  4IKT A;  4RZY A;  4FLK A;  1CHM A;  1YJ3 A;  2G6P A;  2V3Z A;  1XNZ A;  4IU6 A;  3BIQ A;  4IKS A;  3IU8 A;  4U6J A;  2EA4 A;  1WN1 A;  3FMQ A;  4JUQ A;  2EA2 A;  4RGZ 1;  3PKA A;  1O0X A;  4ZWP A;  1XGM A;  1YW9 A;  2NQ7 A;  3D27 A;  2EVC A;  2Q92 A;  4IF7 A;  5JFR A;  1YW8 A;  3PKC A;  1C24 A;  3MX6 A;  4IPA A;  1MAT A;  1C22 A;  3MR1 A;  4ZWU A;  1QZY A;  1BN5 A;  1WLR A;  4B28 A;  2GU4 A;  2ZSG A;  1Y1N A;  4OOK A;  1WL6 A;  3CB5 A;  3CB6 A;  2BWX A;  1M35 A;  5JI6 A;  3RVA A;  4U6E A;  2BN7 A;  4EGE A;  2B3H A;  5D6E A;  4IEC A;  5JHU A;  1W2M A;  2P98 A;  4FUK A;  2NQ6 A;  2Q8K A;  2BB7 A;  4IKU A;  3CTZ A;  1JAW A;  3L7G A;  5CDV A;  2BHD A;  2GGB A;  5CDL A;  4R60 A;  3S6B A;  1KQ9 A;  1QXZ A;  2BWY A;  2BWU A;  2GTX A;  4RZZ A;  2DFI A;  5CIK A;  1W7V A;  3FMR A;  1KQ0 A;  2V3X A;  4FLJ A;  4A6V A;  2GU7 A;  2GU5 A;  4FO8 A;  1WBQ A;  2HOW A;  4FO7 A;  3IU9 A;  4S2R P;  4U75 A;  4IDY A;  4PV4 A;  2OAZ A;  4PNC A;  4S00 A;  2Q94 A;  4HXX A;  4MAT A;  2GG9 A;  3PKE A;  4ZNG A;  5CE6 A;  2BWV A;  2BH3 A;  4IKR A;  4FKC A;  3PKD A;  4QR8 A;  5CLS A;  2Q95 A;  2GG7 A;  1PV9 A;  2P9A A;  3BIP A;  2BWT A;  2Q93 A;  1YVM A;  4KM3 A;  2B3L A;  2BWW A;  2GGC A;  2GU6 A;  4U69 A;  4FLI A;  5D6F A;  1C27 A;  2GG5 A;  1YW7 A;  3MAT A;  2EVO A;  3TB5 A;  4S01 A;  4FLL A;  2P99 A;  2BHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...