2GGCA

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 87
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2ggcA00
3RORA 1B59A 2BWVA 1JAWA 1WN1A 4R60A 1W7VA 4U6ZA 4FLKA 2GZ5A 4IPAA 1YW9A 4U70A 1O0XA 3TAVA 4FO7A 2Q93A 2EA2A 3Q6DA 3CTZA 4FLIA 2BWWA 2EA4A 2GG9A 4RGZ1 2P9AA 1W2MA 3RVAA 1WLRA 3BIPA 4FLJA 5D6FA 1KQ9A 2GU4A 1PV9A 4FO8A 5CDVA 3PKBA 2P99A 4S01A 2B3KA 5CDEA 1XGSA 3FM3A 4RZYA 3IU7A 5CE6A 4ZWOA 3CB6A 1CHMA 4A6VA 5FCHA 2V6CA 2BHAA 1R58A 2GGBA 1BOAA 4FKCA 1C24A 1WBQA 1QXWA 3D27A 4PNCA 3S6BA 2BHDA 1WY2A 4S2RP 2BWTA 1C23A 2GG7A 2IW2A 2BWSA 5JFRA 2ZSGA 2Q96A 4U6WA 4U76A 3IU8A 2P98A 4IF7A 5FCFA 1KQ0A 1XNZA 4PV4A 1YW8A 4EGEA 2V3ZA 1M35A 4B28A 3IU9A 3L7GA 2BHCA 4KM3A 2HOWA 3PKCA 2V3XA 4U1BA 5CDLA 5E5BA 4OOKA 4ZWPA 5JI6A 1XGMA 2ADUA 4U75A 2B3HA 1MATA 1YW7A 4U6JA 5D6EA 2Q95A 4U73A 3BITA 1WL6A 2GA2A 2BHBA 4IKRA 2GGCA 2OKNA 3TB5A 4ZWUA 4IKTA 3BIQA 2BWXA 5JHUA 2GG3A 2NQ7A 2BH3A 2GTXA 4JUQA 2GG5A 1KP0A 2EVCA 2BWUA 3MR1A 1QXYA 1XGOA 2GU6A 2NQ6A 4HXXA 2OAZA 4ZNGA 3CB5A 3MATA 2GU7A 3FMQA 1C27A 4U69A 2GU5A 4U71A 1R5GA 1YVMA 4S00A 4U6EA 4FUKA 1WL9A 1A16A 2BWYA 4MATA 2V3YA 3IG4A 3L24A 1N51A 4RZZA 2GG8A 4IDYA 3FMRA 1C21A 1WKMA 4IKUA 4A6WA 1QZYA 1R5HA 3MX6A 4IKSA 4S2TP 2G6PA 3PKDA 2Q94A 1Y1NA 2GG0A 2DFIA 2BB7A 4IU6A 2Q8KA 2MATA 4U6CA 5CLSA 1B6AA 1QXZA 2B3LA 2EVMA 2EVOA 2GG2A 2BN7A 5CNXA 3PKAA 1YJ3A 5CIKA 4Z7MA 1BN5A 1C22A 2Q92A 1XGNA 4FLLA 4IECA 3PKEA 4QR8A
chains in the Genus database with same CATH superfamily
3RORA 1B59A 2BWVA 1JAWA 1WN1A 4R60A 1W7VA 4U6ZA 4FLKA 2GZ5A 4IPAA 1YW9A 4U70A 1O0XA 3TAVA 4FO7A 2Q93A 2EA2A 3Q6DA 3CTZA 4FLIA 2BWWA 2EA4A 2GG9A 4RGZ1 2P9AA 1W2MA 3RVAA 1WLRA 3BIPA 4FLJA 5D6FA 1KQ9A 2GU4A 1PV9A 4FO8A 5CDVA 3PKBA 2P99A 4S01A 2B3KA 5CDEA 1XGSA 3FM3A 4RZYA 3IU7A 5CE6A 4ZWOA 3CB6A 1CHMA 4A6VA 5FCHA 2V6CA 2BHAA 1R58A 2GGBA 1BOAA 4FKCA 1C24A 1WBQA 1QXWA 3D27A 4PNCA 3S6BA 2BHDA 1WY2A 4S2RP 2BWTA 1C23A 2GG7A 2IW2A 2BWSA 5JFRA 2ZSGA 2Q96A 4U6WA 4U76A 3IU8A 2P98A 4IF7A 5FCFA 1KQ0A 1XNZA 4PV4A 1YW8A 4EGEA 2V3ZA 1M35A 4B28A 3IU9A 3L7GA 2BHCA 4KM3A 2HOWA 3PKCA 2V3XA 4U1BA 5CDLA 5E5BA 4OOKA 4ZWPA 5JI6A 1XGMA 2ADUA 4U75A 2B3HA 1MATA 1YW7A 4U6JA 5D6EA 2Q95A 4U73A 3BITA 1WL6A 2GA2A 2BHBA 4IKRA 2GGCA 2OKNA 3TB5A 4ZWUA 4IKTA 3BIQA 2BWXA 5JHUA 2GG3A 2NQ7A 2BH3A 2GTXA 4JUQA 2GG5A 1KP0A 2EVCA 2BWUA 3MR1A 1QXYA 1XGOA 2GU6A 2NQ6A 4HXXA 2OAZA 4ZNGA 3CB5A 3MATA 2GU7A 3FMQA 1C27A 4U69A 2GU5A 4U71A 1R5GA 1YVMA 4S00A 4U6EA 4FUKA 1WL9A 1A16A 2BWYA 4MATA 2V3YA 3IG4A 3L24A 1N51A 4RZZA 2GG8A 4IDYA 3FMRA 1C21A 1WKMA 4IKUA 4A6WA 1QZYA 1R5HA 3MX6A 4IKSA 4S2TP 2G6PA 3PKDA 2Q94A 1Y1NA 2GG0A 2DFIA 2BB7A 4IU6A 2Q8KA 2MATA 4U6CA 5CLSA 1B6AA 1QXZA 2B3LA 2EVMA 2EVOA 2GG2A 2BN7A 5CNXA 3PKAA 1YJ3A 5CIKA 4Z7MA 1BN5A 1C22A 2Q92A 1XGNA 4FLLA 4IECA 3PKEA 4QR8A
chains in the Genus database with same CATH topology
3RORA 1B59A 2BWVA 1JAWA 1WN1A 4R60A 1W7VA 4U6ZA 4FLKA 2GZ5A 4IPAA 1YW9A 4U70A 1O0XA 3TAVA 4FO7A 2Q93A 2EA2A 3Q6DA 3CTZA 4FLIA 2BWWA 2EA4A 2GG9A 4RGZ1 2P9AA 1W2MA 3RVAA 1WLRA 3BIPA 4FLJA 5D6FA 1KQ9A 2GU4A 1PV9A 4FO8A 5CDVA 3PKBA 2P99A 4S01A 2B3KA 5CDEA 1XGSA 3FM3A 4RZYA 3IU7A 5CE6A 4ZWOA 3CB6A 1CHMA 4A6VA 5FCHA 2V6CA 2BHAA 1R58A 2GGBA 1BOAA 4FKCA 1C24A 1WBQA 1QXWA 3D27A 4PNCA 3S6BA 2BHDA 1WY2A 4S2RP 2BWTA 1C23A 2GG7A 2IW2A 2BWSA 5JFRA 2ZSGA 2Q96A 4U6WA 4U76A 3IU8A 2P98A 4IF7A 5FCFA 1KQ0A 1XNZA 4PV4A 1YW8A 4EGEA 2V3ZA 1M35A 4B28A 3IU9A 3L7GA 2BHCA 4KM3A 2HOWA 3PKCA 2V3XA 4U1BA 5CDLA 5E5BA 4OOKA 4ZWPA 5JI6A 1XGMA 2ADUA 4U75A 2B3HA 1MATA 1YW7A 4U6JA 5D6EA 2Q95A 4U73A 3BITA 1WL6A 2GA2A 2BHBA 4IKRA 2GGCA 2OKNA 3TB5A 4ZWUA 4IKTA 3BIQA 2BWXA 5JHUA 2GG3A 2NQ7A 2BH3A 2GTXA 4JUQA 2GG5A 1KP0A 2EVCA 2BWUA 3MR1A 1QXYA 1XGOA 2GU6A 2NQ6A 4HXXA 2OAZA 4ZNGA 3CB5A 3MATA 2GU7A 3FMQA 1C27A 4U69A 2GU5A 4U71A 1R5GA 1YVMA 4S00A 4U6EA 4FUKA 1WL9A 1A16A 2BWYA 4MATA 2V3YA 3IG4A 3L24A 1N51A 4RZZA 2GG8A 4IDYA 3FMRA 1C21A 1WKMA 4IKUA 4A6WA 1QZYA 1R5HA 3MX6A 4IKSA 4S2TP 2G6PA 3PKDA 2Q94A 1Y1NA 2GG0A 2DFIA 2BB7A 4IU6A 2Q8KA 2MATA 4U6CA 5CLSA 1B6AA 1QXZA 2B3LA 2EVMA 2EVOA 2GG2A 2BN7A 5CNXA 3PKAA 1YJ3A 5CIKA 4Z7MA 1BN5A 1C22A 2Q92A 1XGNA 4FLLA 4IECA 3PKEA 4QR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ROR A;  1B59 A;  2BWV A;  1JAW A;  1WN1 A;  4R60 A;  1W7V A;  4U6Z A;  4FLK A;  2GZ5 A;  4IPA A;  1YW9 A;  4U70 A;  1O0X A;  3TAV A;  4FO7 A;  2Q93 A;  2EA2 A;  3Q6D A;  3CTZ A;  4FLI A;  2BWW A;  2EA4 A;  2GG9 A;  4RGZ 1;  2P9A A;  1W2M A;  3RVA A;  1WLR A;  3BIP A;  4FLJ A;  5D6F A;  1KQ9 A;  2GU4 A;  1PV9 A;  4FO8 A;  5CDV A;  3PKB A;  2P99 A;  4S01 A;  2B3K A;  5CDE A;  1XGS A;  3FM3 A;  4RZY A;  3IU7 A;  5CE6 A;  4ZWO A;  3CB6 A;  1CHM A;  4A6V A;  5FCH A;  2V6C A;  2BHA A;  1R58 A;  2GGB A;  1BOA A;  4FKC A;  1C24 A;  1WBQ A;  1QXW A;  3D27 A;  4PNC A;  3S6B A;  2BHD A;  1WY2 A;  4S2R P;  2BWT A;  1C23 A;  2GG7 A;  2IW2 A;  2BWS A;  5JFR A;  2ZSG A;  2Q96 A;  4U6W A;  4U76 A;  3IU8 A;  2P98 A;  4IF7 A;  5FCF A;  1KQ0 A;  1XNZ A;  4PV4 A;  1YW8 A;  4EGE A;  2V3Z A;  1M35 A;  4B28 A;  3IU9 A;  3L7G A;  2BHC A;  4KM3 A;  2HOW A;  3PKC A;  2V3X A;  4U1B A;  5CDL A;  5E5B A;  4OOK A;  4ZWP A;  5JI6 A;  1XGM A;  2ADU A;  4U75 A;  2B3H A;  1MAT A;  1YW7 A;  4U6J A;  5D6E A;  2Q95 A;  4U73 A;  3BIT A;  1WL6 A;  2GA2 A;  2BHB A;  4IKR A;  2GGC A;  2OKN A;  3TB5 A;  4ZWU A;  4IKT A;  3BIQ A;  2BWX A;  5JHU A;  2GG3 A;  2NQ7 A;  2BH3 A;  2GTX A;  4JUQ A;  2GG5 A;  1KP0 A;  2EVC A;  2BWU A;  3MR1 A;  1QXY A;  1XGO A;  2GU6 A;  2NQ6 A;  4HXX A;  2OAZ A;  4ZNG A;  3CB5 A;  3MAT A;  2GU7 A;  3FMQ A;  1C27 A;  4U69 A;  2GU5 A;  4U71 A;  1R5G A;  1YVM A;  4S00 A;  4U6E A;  4FUK A;  1WL9 A;  1A16 A;  2BWY A;  4MAT A;  2V3Y A;  3IG4 A;  3L24 A;  1N51 A;  4RZZ A;  2GG8 A;  4IDY A;  3FMR A;  1C21 A;  1WKM A;  4IKU A;  4A6W A;  1QZY A;  1R5H A;  3MX6 A;  4IKS A;  4S2T P;  2G6P A;  3PKD A;  2Q94 A;  1Y1N A;  2GG0 A;  2DFI A;  2BB7 A;  4IU6 A;  2Q8K A;  2MAT A;  4U6C A;  5CLS A;  1B6A A;  1QXZ A;  2B3L A;  2EVM A;  2EVO A;  2GG2 A;  2BN7 A;  5CNX A;  3PKA A;  1YJ3 A;  5CIK A;  4Z7M A;  1BN5 A;  1C22 A;  2Q92 A;  1XGN A;  4FLL A;  4IEC A;  3PKE A;  4QR8 A; 
#chains in the Genus database with same CATH topology
 3ROR A;  1B59 A;  2BWV A;  1JAW A;  1WN1 A;  4R60 A;  1W7V A;  4U6Z A;  4FLK A;  2GZ5 A;  4IPA A;  1YW9 A;  4U70 A;  1O0X A;  3TAV A;  4FO7 A;  2Q93 A;  2EA2 A;  3Q6D A;  3CTZ A;  4FLI A;  2BWW A;  2EA4 A;  2GG9 A;  4RGZ 1;  2P9A A;  1W2M A;  3RVA A;  1WLR A;  3BIP A;  4FLJ A;  5D6F A;  1KQ9 A;  2GU4 A;  1PV9 A;  4FO8 A;  5CDV A;  3PKB A;  2P99 A;  4S01 A;  2B3K A;  5CDE A;  1XGS A;  3FM3 A;  4RZY A;  3IU7 A;  5CE6 A;  4ZWO A;  3CB6 A;  1CHM A;  4A6V A;  5FCH A;  2V6C A;  2BHA A;  1R58 A;  2GGB A;  1BOA A;  4FKC A;  1C24 A;  1WBQ A;  1QXW A;  3D27 A;  4PNC A;  3S6B A;  2BHD A;  1WY2 A;  4S2R P;  2BWT A;  1C23 A;  2GG7 A;  2IW2 A;  2BWS A;  5JFR A;  2ZSG A;  2Q96 A;  4U6W A;  4U76 A;  3IU8 A;  2P98 A;  4IF7 A;  5FCF A;  1KQ0 A;  1XNZ A;  4PV4 A;  1YW8 A;  4EGE A;  2V3Z A;  1M35 A;  4B28 A;  3IU9 A;  3L7G A;  2BHC A;  4KM3 A;  2HOW A;  3PKC A;  2V3X A;  4U1B A;  5CDL A;  5E5B A;  4OOK A;  4ZWP A;  5JI6 A;  1XGM A;  2ADU A;  4U75 A;  2B3H A;  1MAT A;  1YW7 A;  4U6J A;  5D6E A;  2Q95 A;  4U73 A;  3BIT A;  1WL6 A;  2GA2 A;  2BHB A;  4IKR A;  2GGC A;  2OKN A;  3TB5 A;  4ZWU A;  4IKT A;  3BIQ A;  2BWX A;  5JHU A;  2GG3 A;  2NQ7 A;  2BH3 A;  2GTX A;  4JUQ A;  2GG5 A;  1KP0 A;  2EVC A;  2BWU A;  3MR1 A;  1QXY A;  1XGO A;  2GU6 A;  2NQ6 A;  4HXX A;  2OAZ A;  4ZNG A;  3CB5 A;  3MAT A;  2GU7 A;  3FMQ A;  1C27 A;  4U69 A;  2GU5 A;  4U71 A;  1R5G A;  1YVM A;  4S00 A;  4U6E A;  4FUK A;  1WL9 A;  1A16 A;  2BWY A;  4MAT A;  2V3Y A;  3IG4 A;  3L24 A;  1N51 A;  4RZZ A;  2GG8 A;  4IDY A;  3FMR A;  1C21 A;  1WKM A;  4IKU A;  4A6W A;  1QZY A;  1R5H A;  3MX6 A;  4IKS A;  4S2T P;  2G6P A;  3PKD A;  2Q94 A;  1Y1N A;  2GG0 A;  2DFI A;  2BB7 A;  4IU6 A;  2Q8K A;  2MAT A;  4U6C A;  5CLS A;  1B6A A;  1QXZ A;  2B3L A;  2EVM A;  2EVO A;  2GG2 A;  2BN7 A;  5CNX A;  3PKA A;  1YJ3 A;  5CIK A;  4Z7M A;  1BN5 A;  1C22 A;  2Q92 A;  1XGN A;  4FLL A;  4IEC A;  3PKE A;  4QR8 A; 
#chains in the Genus database with same CATH homology
 3ROR A;  1B59 A;  2BWV A;  1JAW A;  1WN1 A;  4R60 A;  1W7V A;  4U6Z A;  4FLK A;  2GZ5 A;  4IPA A;  1YW9 A;  4U70 A;  1O0X A;  3TAV A;  4FO7 A;  2Q93 A;  2EA2 A;  3Q6D A;  3CTZ A;  4FLI A;  2BWW A;  2EA4 A;  2GG9 A;  4RGZ 1;  2P9A A;  1W2M A;  3RVA A;  1WLR A;  3BIP A;  4FLJ A;  5D6F A;  1KQ9 A;  2GU4 A;  1PV9 A;  4FO8 A;  5CDV A;  3PKB A;  2P99 A;  4S01 A;  2B3K A;  5CDE A;  1XGS A;  3FM3 A;  4RZY A;  3IU7 A;  5CE6 A;  4ZWO A;  3CB6 A;  1CHM A;  4A6V A;  5FCH A;  2V6C A;  2BHA A;  1R58 A;  2GGB A;  1BOA A;  4FKC A;  1C24 A;  1WBQ A;  1QXW A;  3D27 A;  4PNC A;  3S6B A;  2BHD A;  1WY2 A;  4S2R P;  2BWT A;  1C23 A;  2GG7 A;  2IW2 A;  2BWS A;  5JFR A;  2ZSG A;  2Q96 A;  4U6W A;  4U76 A;  3IU8 A;  2P98 A;  4IF7 A;  5FCF A;  1KQ0 A;  1XNZ A;  4PV4 A;  1YW8 A;  4EGE A;  2V3Z A;  1M35 A;  4B28 A;  3IU9 A;  3L7G A;  2BHC A;  4KM3 A;  2HOW A;  3PKC A;  2V3X A;  4U1B A;  5CDL A;  5E5B A;  4OOK A;  4ZWP A;  5JI6 A;  1XGM A;  2ADU A;  4U75 A;  2B3H A;  1MAT A;  1YW7 A;  4U6J A;  5D6E A;  2Q95 A;  4U73 A;  3BIT A;  1WL6 A;  2GA2 A;  2BHB A;  4IKR A;  2GGC A;  2OKN A;  3TB5 A;  4ZWU A;  4IKT A;  3BIQ A;  2BWX A;  5JHU A;  2GG3 A;  2NQ7 A;  2BH3 A;  2GTX A;  4JUQ A;  2GG5 A;  1KP0 A;  2EVC A;  2BWU A;  3MR1 A;  1QXY A;  1XGO A;  2GU6 A;  2NQ6 A;  4HXX A;  2OAZ A;  4ZNG A;  3CB5 A;  3MAT A;  2GU7 A;  3FMQ A;  1C27 A;  4U69 A;  2GU5 A;  4U71 A;  1R5G A;  1YVM A;  4S00 A;  4U6E A;  4FUK A;  1WL9 A;  1A16 A;  2BWY A;  4MAT A;  2V3Y A;  3IG4 A;  3L24 A;  1N51 A;  4RZZ A;  2GG8 A;  4IDY A;  3FMR A;  1C21 A;  1WKM A;  4IKU A;  4A6W A;  1QZY A;  1R5H A;  3MX6 A;  4IKS A;  4S2T P;  2G6P A;  3PKD A;  2Q94 A;  1Y1N A;  2GG0 A;  2DFI A;  2BB7 A;  4IU6 A;  2Q8K A;  2MAT A;  4U6C A;  5CLS A;  1B6A A;  1QXZ A;  2B3L A;  2EVM A;  2EVO A;  2GG2 A;  2BN7 A;  5CNX A;  3PKA A;  1YJ3 A;  5CIK A;  4Z7M A;  1BN5 A;  1C22 A;  2Q92 A;  1XGN A;  4FLL A;  4IEC A;  3PKE A;  4QR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...