2GGCA

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 87
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2ggcA00
1YVMA 5CDVA 4U6CA 1KP0A 2GTXA 2EA4A 1WL9A 2MATA 2B3HA 4HXXA 4IF7A 2IW2A 1WN1A 1Y1NA 1QXYA 2GG5A 2BWYA 1BOAA 4U70A 5FCFA 4FLLA 1MATA 4U69A 2GG0A 2BHBA 1WKMA 4U75A 3BITA 2EVOA 3BIPA 2Q96A 5CIKA 2Q94A 4RZYA 2BHDA 2BH3A 2BN7A 4PV4A 4S00A 4U6JA 1WBQA 3FMRA 1R58A 2GG7A 1QXWA 3CB6A 5E5BA 4A6WA 3PKBA 2DFIA 4R60A 5CLSA 4EGEA 4FO7A 4KM3A 5CNXA 3PKDA 1XGOA 3MX6A 3CB5A 3PKAA 4U71A 1QXZA 4ZWOA 2BHAA 2V3XA 1YW9A 2OKNA 2B3LA 2BB7A 2Q92A 4FO8A 2ZSGA 5JI6A 4S01A 1C24A 4IECA 1N51A 2GG3A 1QZYA 1PV9A 4U6EA 3FM3A 2GU4A 2Q8KA 1WY2A 1XNZA 4FUKA 4A6VA 2GZ5A 4IKRA 4RZZA 2EVMA 2GU5A 3IG4A 4S2TP 2EVCA 1XGMA 1BN5A 4U76A 1WL6A 2BWSA 4IKTA 1R5HA 2GA2A 2GG9A 4U6ZA 3L24A 1O0XA 2BWTA 2P9AA 2BWXA 2GGCA 2GG2A 3RVAA 4JUQA 2P98A 4IPAA 4ZNGA 2GG8A 3D27A 4OOKA 2OAZA 4MATA 1B6AA 3IU7A 2BWWA 3IU9A 5CE6A 4U73A 4ZWPA 1YJ3A 1YW7A 5D6EA 4IKUA 1B59A 3RORA 3IU8A 1A16A 2GU7A 4PNCA 5JFRA 4Z7MA 2ADUA 2BHCA 4FKCA 1WLRA 4B28A 2BWVA 5CDLA 1XGSA 3MATA 3TB5A 3PKEA 1YW8A 1R5GA 5JHUA 3L7GA 2HOWA 3Q6DA 5CDEA 2GGBA 4IKSA 5FCHA 2B3KA 4QR8A 1C21A 4U1BA 3TAVA 1C27A 2V6CA 2NQ6A 2P99A 2G6PA 1W2MA 2NQ7A 2Q95A 2EA2A 1CHMA 3FMQA 3CTZA 1W7VA 2Q93A 1JAWA 2GU6A 4FLJA 1KQ0A 4U6WA 1C23A 4ZWUA 4IU6A 2V3ZA 3BIQA 1M35A 4FLKA 3MR1A 5D6FA 2BWUA 4S2RP 4FLIA 2V3YA 3PKCA 3S6BA 4IDYA 1KQ9A 1C22A 4RGZ1 1XGNA
chains in the Genus database with same CATH superfamily
1YVMA 5CDVA 4U6CA 1KP0A 2GTXA 2EA4A 1WL9A 2MATA 2B3HA 4HXXA 4IF7A 2IW2A 1WN1A 1Y1NA 1QXYA 2GG5A 2BWYA 1BOAA 4U70A 5FCFA 4FLLA 1MATA 4U69A 2GG0A 2BHBA 1WKMA 4U75A 3BITA 2EVOA 3BIPA 2Q96A 5CIKA 2Q94A 4RZYA 2BHDA 2BH3A 2BN7A 4PV4A 4S00A 4U6JA 1WBQA 3FMRA 1R58A 2GG7A 1QXWA 3CB6A 5E5BA 4A6WA 3PKBA 2DFIA 4R60A 5CLSA 4EGEA 4FO7A 4KM3A 5CNXA 3PKDA 1XGOA 3MX6A 3CB5A 3PKAA 4U71A 1QXZA 4ZWOA 2BHAA 2V3XA 1YW9A 2OKNA 2B3LA 2BB7A 2Q92A 4FO8A 2ZSGA 5JI6A 4S01A 1C24A 4IECA 1N51A 2GG3A 1QZYA 1PV9A 4U6EA 3FM3A 2GU4A 2Q8KA 1WY2A 1XNZA 4FUKA 4A6VA 2GZ5A 4IKRA 4RZZA 2EVMA 2GU5A 3IG4A 4S2TP 2EVCA 1XGMA 1BN5A 4U76A 1WL6A 2BWSA 4IKTA 1R5HA 2GA2A 2GG9A 4U6ZA 3L24A 1O0XA 2BWTA 2P9AA 2BWXA 2GGCA 2GG2A 3RVAA 4JUQA 2P98A 4IPAA 4ZNGA 2GG8A 3D27A 4OOKA 2OAZA 4MATA 1B6AA 3IU7A 2BWWA 3IU9A 5CE6A 4U73A 4ZWPA 1YJ3A 1YW7A 5D6EA 4IKUA 1B59A 3RORA 3IU8A 1A16A 2GU7A 4PNCA 5JFRA 4Z7MA 2ADUA 2BHCA 4FKCA 1WLRA 4B28A 2BWVA 5CDLA 1XGSA 3MATA 3TB5A 3PKEA 1YW8A 1R5GA 5JHUA 3L7GA 2HOWA 3Q6DA 5CDEA 2GGBA 4IKSA 5FCHA 2B3KA 4QR8A 1C21A 4U1BA 3TAVA 1C27A 2V6CA 2NQ6A 2P99A 2G6PA 1W2MA 2NQ7A 2Q95A 2EA2A 1CHMA 3FMQA 3CTZA 1W7VA 2Q93A 1JAWA 2GU6A 4FLJA 1KQ0A 4U6WA 1C23A 4ZWUA 4IU6A 2V3ZA 3BIQA 1M35A 4FLKA 3MR1A 5D6FA 2BWUA 4S2RP 4FLIA 2V3YA 3PKCA 3S6BA 4IDYA 1KQ9A 1C22A 4RGZ1 1XGNA
chains in the Genus database with same CATH topology
1YVMA 5CDVA 4U6CA 1KP0A 2GTXA 2EA4A 1WL9A 2MATA 2B3HA 4HXXA 4IF7A 2IW2A 1WN1A 1Y1NA 1QXYA 2GG5A 2BWYA 1BOAA 4U70A 5FCFA 4FLLA 1MATA 4U69A 2GG0A 2BHBA 1WKMA 4U75A 3BITA 2EVOA 3BIPA 2Q96A 5CIKA 2Q94A 4RZYA 2BHDA 2BH3A 2BN7A 4PV4A 4S00A 4U6JA 1WBQA 3FMRA 1R58A 2GG7A 1QXWA 3CB6A 5E5BA 4A6WA 3PKBA 2DFIA 4R60A 5CLSA 4EGEA 4FO7A 4KM3A 5CNXA 3PKDA 1XGOA 3MX6A 3CB5A 3PKAA 4U71A 1QXZA 4ZWOA 2BHAA 2V3XA 1YW9A 2OKNA 2B3LA 2BB7A 2Q92A 4FO8A 2ZSGA 5JI6A 4S01A 1C24A 4IECA 1N51A 2GG3A 1QZYA 1PV9A 4U6EA 3FM3A 2GU4A 2Q8KA 1WY2A 1XNZA 4FUKA 4A6VA 2GZ5A 4IKRA 4RZZA 2EVMA 2GU5A 3IG4A 4S2TP 2EVCA 1XGMA 1BN5A 4U76A 1WL6A 2BWSA 4IKTA 1R5HA 2GA2A 2GG9A 4U6ZA 3L24A 1O0XA 2BWTA 2P9AA 2BWXA 2GGCA 2GG2A 3RVAA 4JUQA 2P98A 4IPAA 4ZNGA 2GG8A 3D27A 4OOKA 2OAZA 4MATA 1B6AA 3IU7A 2BWWA 3IU9A 5CE6A 4U73A 4ZWPA 1YJ3A 1YW7A 5D6EA 4IKUA 1B59A 3RORA 3IU8A 1A16A 2GU7A 4PNCA 5JFRA 4Z7MA 2ADUA 2BHCA 4FKCA 1WLRA 4B28A 2BWVA 5CDLA 1XGSA 3MATA 3TB5A 3PKEA 1YW8A 1R5GA 5JHUA 3L7GA 2HOWA 3Q6DA 5CDEA 2GGBA 4IKSA 5FCHA 2B3KA 4QR8A 1C21A 4U1BA 3TAVA 1C27A 2V6CA 2NQ6A 2P99A 2G6PA 1W2MA 2NQ7A 2Q95A 2EA2A 1CHMA 3FMQA 3CTZA 1W7VA 2Q93A 1JAWA 2GU6A 4FLJA 1KQ0A 4U6WA 1C23A 4ZWUA 4IU6A 2V3ZA 3BIQA 1M35A 4FLKA 3MR1A 5D6FA 2BWUA 4S2RP 4FLIA 2V3YA 3PKCA 3S6BA 4IDYA 1KQ9A 1C22A 4RGZ1 1XGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVM A;  5CDV A;  4U6C A;  1KP0 A;  2GTX A;  2EA4 A;  1WL9 A;  2MAT A;  2B3H A;  4HXX A;  4IF7 A;  2IW2 A;  1WN1 A;  1Y1N A;  1QXY A;  2GG5 A;  2BWY A;  1BOA A;  4U70 A;  5FCF A;  4FLL A;  1MAT A;  4U69 A;  2GG0 A;  2BHB A;  1WKM A;  4U75 A;  3BIT A;  2EVO A;  3BIP A;  2Q96 A;  5CIK A;  2Q94 A;  4RZY A;  2BHD A;  2BH3 A;  2BN7 A;  4PV4 A;  4S00 A;  4U6J A;  1WBQ A;  3FMR A;  1R58 A;  2GG7 A;  1QXW A;  3CB6 A;  5E5B A;  4A6W A;  3PKB A;  2DFI A;  4R60 A;  5CLS A;  4EGE A;  4FO7 A;  4KM3 A;  5CNX A;  3PKD A;  1XGO A;  3MX6 A;  3CB5 A;  3PKA A;  4U71 A;  1QXZ A;  4ZWO A;  2BHA A;  2V3X A;  1YW9 A;  2OKN A;  2B3L A;  2BB7 A;  2Q92 A;  4FO8 A;  2ZSG A;  5JI6 A;  4S01 A;  1C24 A;  4IEC A;  1N51 A;  2GG3 A;  1QZY A;  1PV9 A;  4U6E A;  3FM3 A;  2GU4 A;  2Q8K A;  1WY2 A;  1XNZ A;  4FUK A;  4A6V A;  2GZ5 A;  4IKR A;  4RZZ A;  2EVM A;  2GU5 A;  3IG4 A;  4S2T P;  2EVC A;  1XGM A;  1BN5 A;  4U76 A;  1WL6 A;  2BWS A;  4IKT A;  1R5H A;  2GA2 A;  2GG9 A;  4U6Z A;  3L24 A;  1O0X A;  2BWT A;  2P9A A;  2BWX A;  2GGC A;  2GG2 A;  3RVA A;  4JUQ A;  2P98 A;  4IPA A;  4ZNG A;  2GG8 A;  3D27 A;  4OOK A;  2OAZ A;  4MAT A;  1B6A A;  3IU7 A;  2BWW A;  3IU9 A;  5CE6 A;  4U73 A;  4ZWP A;  1YJ3 A;  1YW7 A;  5D6E A;  4IKU A;  1B59 A;  3ROR A;  3IU8 A;  1A16 A;  2GU7 A;  4PNC A;  5JFR A;  4Z7M A;  2ADU A;  2BHC A;  4FKC A;  1WLR A;  4B28 A;  2BWV A;  5CDL A;  1XGS A;  3MAT A;  3TB5 A;  3PKE A;  1YW8 A;  1R5G A;  5JHU A;  3L7G A;  2HOW A;  3Q6D A;  5CDE A;  2GGB A;  4IKS A;  5FCH A;  2B3K A;  4QR8 A;  1C21 A;  4U1B A;  3TAV A;  1C27 A;  2V6C A;  2NQ6 A;  2P99 A;  2G6P A;  1W2M A;  2NQ7 A;  2Q95 A;  2EA2 A;  1CHM A;  3FMQ A;  3CTZ A;  1W7V A;  2Q93 A;  1JAW A;  2GU6 A;  4FLJ A;  1KQ0 A;  4U6W A;  1C23 A;  4ZWU A;  4IU6 A;  2V3Z A;  3BIQ A;  1M35 A;  4FLK A;  3MR1 A;  5D6F A;  2BWU A;  4S2R P;  4FLI A;  2V3Y A;  3PKC A;  3S6B A;  4IDY A;  1KQ9 A;  1C22 A;  4RGZ 1;  1XGN A; 
#chains in the Genus database with same CATH topology
 1YVM A;  5CDV A;  4U6C A;  1KP0 A;  2GTX A;  2EA4 A;  1WL9 A;  2MAT A;  2B3H A;  4HXX A;  4IF7 A;  2IW2 A;  1WN1 A;  1Y1N A;  1QXY A;  2GG5 A;  2BWY A;  1BOA A;  4U70 A;  5FCF A;  4FLL A;  1MAT A;  4U69 A;  2GG0 A;  2BHB A;  1WKM A;  4U75 A;  3BIT A;  2EVO A;  3BIP A;  2Q96 A;  5CIK A;  2Q94 A;  4RZY A;  2BHD A;  2BH3 A;  2BN7 A;  4PV4 A;  4S00 A;  4U6J A;  1WBQ A;  3FMR A;  1R58 A;  2GG7 A;  1QXW A;  3CB6 A;  5E5B A;  4A6W A;  3PKB A;  2DFI A;  4R60 A;  5CLS A;  4EGE A;  4FO7 A;  4KM3 A;  5CNX A;  3PKD A;  1XGO A;  3MX6 A;  3CB5 A;  3PKA A;  4U71 A;  1QXZ A;  4ZWO A;  2BHA A;  2V3X A;  1YW9 A;  2OKN A;  2B3L A;  2BB7 A;  2Q92 A;  4FO8 A;  2ZSG A;  5JI6 A;  4S01 A;  1C24 A;  4IEC A;  1N51 A;  2GG3 A;  1QZY A;  1PV9 A;  4U6E A;  3FM3 A;  2GU4 A;  2Q8K A;  1WY2 A;  1XNZ A;  4FUK A;  4A6V A;  2GZ5 A;  4IKR A;  4RZZ A;  2EVM A;  2GU5 A;  3IG4 A;  4S2T P;  2EVC A;  1XGM A;  1BN5 A;  4U76 A;  1WL6 A;  2BWS A;  4IKT A;  1R5H A;  2GA2 A;  2GG9 A;  4U6Z A;  3L24 A;  1O0X A;  2BWT A;  2P9A A;  2BWX A;  2GGC A;  2GG2 A;  3RVA A;  4JUQ A;  2P98 A;  4IPA A;  4ZNG A;  2GG8 A;  3D27 A;  4OOK A;  2OAZ A;  4MAT A;  1B6A A;  3IU7 A;  2BWW A;  3IU9 A;  5CE6 A;  4U73 A;  4ZWP A;  1YJ3 A;  1YW7 A;  5D6E A;  4IKU A;  1B59 A;  3ROR A;  3IU8 A;  1A16 A;  2GU7 A;  4PNC A;  5JFR A;  4Z7M A;  2ADU A;  2BHC A;  4FKC A;  1WLR A;  4B28 A;  2BWV A;  5CDL A;  1XGS A;  3MAT A;  3TB5 A;  3PKE A;  1YW8 A;  1R5G A;  5JHU A;  3L7G A;  2HOW A;  3Q6D A;  5CDE A;  2GGB A;  4IKS A;  5FCH A;  2B3K A;  4QR8 A;  1C21 A;  4U1B A;  3TAV A;  1C27 A;  2V6C A;  2NQ6 A;  2P99 A;  2G6P A;  1W2M A;  2NQ7 A;  2Q95 A;  2EA2 A;  1CHM A;  3FMQ A;  3CTZ A;  1W7V A;  2Q93 A;  1JAW A;  2GU6 A;  4FLJ A;  1KQ0 A;  4U6W A;  1C23 A;  4ZWU A;  4IU6 A;  2V3Z A;  3BIQ A;  1M35 A;  4FLK A;  3MR1 A;  5D6F A;  2BWU A;  4S2R P;  4FLI A;  2V3Y A;  3PKC A;  3S6B A;  4IDY A;  1KQ9 A;  1C22 A;  4RGZ 1;  1XGN A; 
#chains in the Genus database with same CATH homology
 1YVM A;  5CDV A;  4U6C A;  1KP0 A;  2GTX A;  2EA4 A;  1WL9 A;  2MAT A;  2B3H A;  4HXX A;  4IF7 A;  2IW2 A;  1WN1 A;  1Y1N A;  1QXY A;  2GG5 A;  2BWY A;  1BOA A;  4U70 A;  5FCF A;  4FLL A;  1MAT A;  4U69 A;  2GG0 A;  2BHB A;  1WKM A;  4U75 A;  3BIT A;  2EVO A;  3BIP A;  2Q96 A;  5CIK A;  2Q94 A;  4RZY A;  2BHD A;  2BH3 A;  2BN7 A;  4PV4 A;  4S00 A;  4U6J A;  1WBQ A;  3FMR A;  1R58 A;  2GG7 A;  1QXW A;  3CB6 A;  5E5B A;  4A6W A;  3PKB A;  2DFI A;  4R60 A;  5CLS A;  4EGE A;  4FO7 A;  4KM3 A;  5CNX A;  3PKD A;  1XGO A;  3MX6 A;  3CB5 A;  3PKA A;  4U71 A;  1QXZ A;  4ZWO A;  2BHA A;  2V3X A;  1YW9 A;  2OKN A;  2B3L A;  2BB7 A;  2Q92 A;  4FO8 A;  2ZSG A;  5JI6 A;  4S01 A;  1C24 A;  4IEC A;  1N51 A;  2GG3 A;  1QZY A;  1PV9 A;  4U6E A;  3FM3 A;  2GU4 A;  2Q8K A;  1WY2 A;  1XNZ A;  4FUK A;  4A6V A;  2GZ5 A;  4IKR A;  4RZZ A;  2EVM A;  2GU5 A;  3IG4 A;  4S2T P;  2EVC A;  1XGM A;  1BN5 A;  4U76 A;  1WL6 A;  2BWS A;  4IKT A;  1R5H A;  2GA2 A;  2GG9 A;  4U6Z A;  3L24 A;  1O0X A;  2BWT A;  2P9A A;  2BWX A;  2GGC A;  2GG2 A;  3RVA A;  4JUQ A;  2P98 A;  4IPA A;  4ZNG A;  2GG8 A;  3D27 A;  4OOK A;  2OAZ A;  4MAT A;  1B6A A;  3IU7 A;  2BWW A;  3IU9 A;  5CE6 A;  4U73 A;  4ZWP A;  1YJ3 A;  1YW7 A;  5D6E A;  4IKU A;  1B59 A;  3ROR A;  3IU8 A;  1A16 A;  2GU7 A;  4PNC A;  5JFR A;  4Z7M A;  2ADU A;  2BHC A;  4FKC A;  1WLR A;  4B28 A;  2BWV A;  5CDL A;  1XGS A;  3MAT A;  3TB5 A;  3PKE A;  1YW8 A;  1R5G A;  5JHU A;  3L7G A;  2HOW A;  3Q6D A;  5CDE A;  2GGB A;  4IKS A;  5FCH A;  2B3K A;  4QR8 A;  1C21 A;  4U1B A;  3TAV A;  1C27 A;  2V6C A;  2NQ6 A;  2P99 A;  2G6P A;  1W2M A;  2NQ7 A;  2Q95 A;  2EA2 A;  1CHM A;  3FMQ A;  3CTZ A;  1W7V A;  2Q93 A;  1JAW A;  2GU6 A;  4FLJ A;  1KQ0 A;  4U6W A;  1C23 A;  4ZWU A;  4IU6 A;  2V3Z A;  3BIQ A;  1M35 A;  4FLK A;  3MR1 A;  5D6F A;  2BWU A;  4S2R P;  4FLI A;  2V3Y A;  3PKC A;  3S6B A;  4IDY A;  1KQ9 A;  1C22 A;  4RGZ 1;  1XGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...