2GGOA

Crystal structure of glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
401
structure length
401
Chain Sequence
MKAFILAAGSGERLEPITHTRPKAFVPILSKPLIEYQIEYLRKCGIRDITVIVSSKNKEYFEKKLKEISIVTQKDDIKGTGAAILSAKFNDEALIIYGDLFFSNEKEICNIITLKENAIIGVKVSNPKDYGVLVLDNQNNLSKIIEKPEIPPSNLINAGIYKLNSDIFTYLDKISISERGELELTDAINLMAKDHRVKVIEYEGYWMDIGKPWNIIDVNKWALDNLVFSQNLGNVEDNVKIKGKVIIEEDAEIKSGTYIEGPVYIGKGSEIGPNSYLRPYTILVEKNKIGASVEVKESVIMEGSKIPHLSYVGDSVIAEDVNFGAGTLIANLRFDEKEVKVNVKGKRISSGRRKLGAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFFKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of glucose-1-phosphate thymidylyltransferase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords 401aa long hypothetical glucose-1-phosphate thymidylyltransf
total genus 135
structure length 401
sequence length 401
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2ggoA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2ggoA01
1KGQA 4ISXA 3ST8A 2AGDA 4Y7TA 2P73A 1E5KA 1O7OA 2YC3A 4G3QA 1MP4A 4KC2A 4HO3A 3OW5A 3SXEA 3D5NA 4CVHA 3CKNA 4HOCA 4M4KA 1R7UA 5FV9A 5CMGX 4FCEA 4MFGA 1VGWA 3I0FA 2O1HA 4HO2A 2VSIA 5L6VA 1H7FA 2PA4A 1TW1A 3V90A 1VZXA 4DECA 1ZI3A 3DJ4A 1TDTA 3VBPA 1W57A 1HM0A 2OI5A 2BO4A 4M28A 1H5TA 3R3IA 2ICYA 1WT0A 2V0JA 3EEVA 2YQCA 1V83A 1MR9A 3K8EA 5E3RA 1LZIA 4YS8A 1S4OA 3BCVA 1GQ9A 2FYBA 1IINA 4K6RA 1FZWA 2RIYA 1ON6A 1YROB 3PNNA 2RJ6A 5CQMX 4DCLA 3R2WA 4D0ZA 3TZTA 2AE7A 3VBLA 1V3WA 2BO8A 4GBPA 1KK6A 1QGQA 2XWMA 1VH3A 3F1XA 2BO7A 1ZDFA 2X5SA 3O3PA 4MNDA 4Y62A 5AJPA 2O1GA 2WE9A 1GWVA 2FYDB 2WEEA 4ASJA 1NF5B 1WVCA 2QGIA 5CQNX 4E1KA 1O23B 4EE4A 5IDSA 2ZU9A 1MR7A 3IGJA 1J2ZA 1LZJA 4EA8A 3I0HA 1ZCVA 1JYLA 4Y7UA 3ZLKA 1FOAA 3ECTA 1KGTA 3BSSA 3CJ8A 4AYLA 3EG4A 2WLGA 2IU8A 1TZFA 5I1FA 3ZLLA 4N27A 4CJBA 1GQCA 4B42A 5J49A 4KQLA 2X65A 5AFUV 5JQQA 1NQIB 1FRWA 4HO4A 2PGVA 3BSYA 3VBKA 2JF3A 4EA7A 1NMMB 3TWDA 2BO6A 4KPXA 4AYJA 2PX7A 4KXOA 5C1GA 3I3XA 1FWYA 5ADXU 1ZI5A 3USRA 3NGWA 4E6UA 1WT1A 5C1HA 1LZ0A 5AJNA 1H7TA 3CU0A 1HM8A 1FO8A 1XHDA 1G97A 2V0LA 5IFYA 2YQSA 2VD4A 3GVDA 1HJJA 3OTMA 3FSYA 1XHBA 1SSTA 2W0WA 2WVKA 2JCLA 5DEMA 2Y4LA 3PKQA 1NWGB 4FRAA 4XWIA 3BXYA 3OH3A 1VGUA 2VHEA 2OI7A 1G23A 3USQA 3TV0A 1G3LA 1INJA 4KNRA 2VXLA 3R5DA 1HJLA 1ZIZA 1R7XA 3SX5A 2WVLA 3Q7UA 2YC5A 5C4FA 1THJA 1JVDA 3I0GA 1V67A 4HCQA 4BMAA 2RJ5A 1TVYA 4CJCA 5C4BA 4Y7VA 2Z87A 4M2BA 1H4EA 4EABA 2QIVX 1GX4A 4HZDA 4G3PA 1KWSA 3POLA 2V0KA 3Q80A 3SX7A 3V0PA 4MZUA 3VBMA 2Z86A 1FR9A 4EEOA 1R82A 3V8ZA 2WLCA 4E6TA 3OH1A 2PGYA 3RSBA 3OU9A 5CMIA 4NANA 1QG8A 4FRQA 4M2AA 3U0YA 4B4MA 2XATA 3FSXA 2VXMA 2FYCB 2RIXA 3IXCA 3OH0A 3U2UA 3GOSA 2JCKA 1ZDGA 3OC9A 5BXCA 3IOIA 4KNXA 2A8WA 3FWWA 1INIA 3RMVA 1OMZA 2E8BA 4DE7A 5C38A 4AC3A 1LL2A 1O7QA 2FYAA 4EGGA 4KC4A 2GGQA 1LL3A 1ZHJA 2AECA 2YQJA 4B2WA 4LW6A 4IRPA 2O1FA 1WSZA 1JYKA 1SS9A 3D8VA 4IHHA 1ZCTA 2APCA 3IOHA 3MQGA 3IOJA 3T57A 4FCUA 4HO9A 1PZTA 3U0XA 3C8VA 3R0SA 4N6AA 3FSBA 1S4NA 4R36A 3SXBA 5C49A 5CMFX 4AA7A 3DHOA 2Y4MA 1H7HA 4D11C 4B5BA 1R81A 4EEAA 2JCOA 1O0RA 1R7YA 1ZJPA 3KWEA 3SPTA 5CMHA 4FRPA 4E79A 2NXVA 2V0IA 1Z90A 3MQHA 3SXCA 3VNPA 4R37A 3NZ2A 3FS8A 4Y9XA 3SX3A 2FFVA 4D0TA 2DPWA 3V0NA 2XMEA 3F1YA 3BSWA 3P1BA 1LXAA 4Y64A 2RIJA 5IDTA 1YP3A 4IHFA 3T7NA 1TW5A 3R5BA 3I0EA 4HO8A 3BFPA 2RITA 2D7RA 4HG6A 1NHEB 1G0RA 2OEFA 5C3BA 5CMJA 4JISA 2GGOA 2RJ8A 2Y4JA 3CKVA 4G87A 3PMOA 5U2KA 1IIMA 1GWWA 1GA8A 1GX0A 2YESA 1KRUA 1FGGA 2XMHA 3Q1XA 5CQOA 1QRMA 4AAWA 4N6BA 2RJ0A 3HL3A 3OH4A 4LW3A 1ZCYA 3ZGGA 2RJ1A 1VZUA 4Y63A 1KQAA 2WLEA 5FTSA 3D98A 1EZIA 4KRVA 1H5SB 1H5RB 5FU8A 5C36A 3QVBA 4R7PA 4D11A 4KC1A 4HO6A 1SSMA 1FG5N 2AM4A 2QIAA 1ZJOA 4N69A 4IRQA 1KRRA 1V84A 4Y6NA 2VS3A 3VBNA 3V8YA 3FTTA 4FRMA 3JUJA 3GUEA 5CQLX 1VM8A 1G2VA 1H7LA 1LVWA 2YQHA 1FXOA 5C48A 4HO0A 3DUVA 4JD0A 3F1CA 4Y6UA 3E26A 4D48A 4B2XA 1ON8A 3V4EA 1ZJ2A 4E75A 3BRKX 2Y6PA 1QRFA 3TDTA 1OMXA 1H5SD 4ASYA 5AJOA 1G93A 5C47A 3OAMA 5C4DA 3R8YA 2QKXA 1LZ7A 1HV9A 1KK5A 2D0JA 2P6WA 2QH5A 4L41C 1S4PA 4EE5A 3VBJA 4P02A 5C8RA 5FUHA 1SSQA 5EJZA 4MYBA 3KWCA 4UEGA 2WAWA 2I7BA 4M9CA 4FREA 2FFUA 1S80A 2IU9A 3I0KA 3TK8A 2X5ZA 1W55A 1JV1A 4B4BA 4FRDA 4ECMA 5EJ1A 1VPAA 4B4GA 3I0LA 1OCXA 4EA9A 3PKPA 5C1LA 5DDVA 2OEGA 2JCJA 3V0LA 2A8UA 5FU0A 3OTZA 3Q4SA 2V0HA 4IHGA 1H5SC 3TISA 1H4CA 1VH1A 1NKHB 4KT7A 1FXJA 2TDTA 1H5TB 1FGXA 3ZGFA 1LL0A 3KWDA 5E3QA 4HUSA 4MYOA 4FRHA 3I0CA 5HS2A 5C4CA 1FO9A 2AESA 1XATA 5AFUU 4J18A 5C3DA 4G3SA 3SRTA 2Y4KA 4KPZA 2ZU8A 4Y7GA 2VSHA 1R80A 2AM5A 5DG3A 4M99A 4EEMA 3R1WA 2WLFA 2AM3A 2UX8A 4FRLA 2Y7AA 3I0JA 1H4DA 2RJ4A 4EVWA 5C3AA 3V0MA 1ZCUA 1HM9A 1KHRA 2OI6A 2WGZA 5C4EA 1W77A 4FROA 1ZI1A 3V0OA 3MC4A 1QGSA 2MZBA 2P2OA 1YP4A 3ZF8A 5E3PA 1H3MA 1ZJ1A 2I5EA 1H7QA 3R5CA 4ARWA 2FY7A 1VZTA 3I0DA 3OH2A 1MP3A 3OKRA 1VGTA 1T3DA 1H5SA 3SXGA 3CGXA 2X60A 3CKJA 3HSQA 1QQ0A 4BQHA 3HJJA 3U2TA 2AH9A 3JTJA 1KK4A 2WVMA 4J09A 1ZJ3A 3JUKA 1MC3A 2RJ7A 3K8DA 1KRVA 1WT3A 2VS4A 4EEGA 3P47A 5ADXV 4H7OA 3OUPA 3OGZA 3T7OA 2FKOA 1QRLA 3VBIA 2VFZA 2JF2A 4ZDQA 3R3RA 1FR8A 3T7MA 4FQWA 1PZYB 3CKQA 3U2VA 2VS5A 2WLDA 5F42A 1R7TA 3RMWA 3TIOA 1G8OA 1JVGA 3SX8A 2Q4JA 3FSCA 1R7VA 1I52A 4NAKA 3TQDA 3I3AA 1XZ6A 3CKOA 1H5RA 3N9WA 2XWLA 3SXDA 1G1LA 4HURA 4DDZA 1VICA 4M98A 2IUAA 5CQPA 1K4VA 5FTVA 1YP2A 1WT2A 1MP5A 2D7IA 2XWNA 4P00A 3DK5A 1ZJ0A 1QWJA 4FRBA 3JQYA 5FYEA 5EIYA 3V0QA 3I0IX 3LW6A 1OQMB 2IC7A 5DDTA 1G9RA 3EE5A 1MRLA 3V91A 3U2XA 1JV3A 1VGZA 2I5KA 1QRGA 2W0VA 3EH0A 2CU2A 2E3DA 1QREA 2ICXA 1G95A 5L6SA 1H7EA 3U2WA 3R5AA 3E25A 4NAIA 2AQ9A 2YCMA 2ZU7A 3KIAA 4EAAA 4CJ8A 4HO5A 1H7GA 4C2SA 4EE3A 3FOQA 1V82A 4B3UA 5DEPA 4NALA 4Y7FA 2P72A 4EQYA 4HZCA 1EYRA 3SXAA 2RJ9A 1ZI4A 2RIZA 2NPOA
chains in the Genus database with same CATH superfamily
1KGQA 4ISXA 3ST8A 2AGDA 4Y7TA 2P73A 1E5KA 1O7OA 2YC3A 4G3QA 1MP4A 4KC2A 4HO3A 3OW5A 3SXEA 3D5NA 4CVHA 3CKNA 4HOCA 4M4KA 1R7UA 5FV9A 5CMGX 4FCEA 4MFGA 1VGWA 3I0FA 2O1HA 4HO2A 2VSIA 5L6VA 1H7FA 2PA4A 1TW1A 3V90A 1VZXA 4DECA 1ZI3A 3DJ4A 1TDTA 3VBPA 1W57A 1HM0A 2OI5A 2BO4A 4M28A 1H5TA 3R3IA 2ICYA 1WT0A 2V0JA 3EEVA 2YQCA 1V83A 1MR9A 3K8EA 5E3RA 1LZIA 4YS8A 1S4OA 3BCVA 1GQ9A 2FYBA 1IINA 4K6RA 1FZWA 2RIYA 1ON6A 1YROB 3PNNA 2RJ6A 5CQMX 4DCLA 3R2WA 4D0ZA 3TZTA 2AE7A 3VBLA 1V3WA 2BO8A 4GBPA 1KK6A 1Z2FA 1QGQA 2XWMA 1VH3A 3F1XA 2BO7A 1ZDFA 2X5SA 3O3PA 4MNDA 4Y62A 5AJPA 2O1GA 2WE9A 1GWVA 2FYDB 2WEEA 4ASJA 1NF5B 1WVCA 2QGIA 5CQNX 4E1KA 1O23B 4EE4A 5IDSA 2ZU9A 1MR7A 3IGJA 1J2ZA 1LZJA 4EA8A 3I0HA 1ZCVA 1JYLA 4Y7UA 3ZLKA 1FOAA 3ECTA 1KGTA 3BSSA 3CJ8A 4AYLA 3EG4A 2WLGA 2IU8A 1TZFA 5I1FA 3ZLLA 4N27A 4CJBA 1GQCA 4B42A 5J49A 4KQLA 2X65A 5AFUV 5JQQA 1NQIB 1FRWA 4FIYA 2PGVA 3BSYA 4HO4A 3VBKA 2JF3A 4EA7A 1NMMB 3TWDA 2BO6A 4FIXA 4KPXA 4AYJA 2PX7A 4KXOA 5C1GA 3I3XA 1FWYA 5ADXU 1ZI5A 3USRA 1M8NA 4E6UA 3NGWA 1WT1A 5C1HA 1LZ0A 5AJNA 1H7TA 3CU0A 1HM8A 1FO8A 1XHDA 1G97A 2V0LA 5IFYA 2YQSA 2VD4A 3GVDA 1HJJA 4Q7CA 3OTMA 3FSYA 1XHBA 1SSTA 2W0WA 2WVKA 2JCLA 5DEMA 2Y4LA 3PKQA 1NWGB 1N4IA 4FRAA 4XWIA 3BXYA 3OH3A 1VGUA 2VHEA 2OI7A 1G23A 3USQA 3TV0A 1G3LA 3GQ8A 1INJA 4KNRA 2VXLA 3R5DA 1HJLA 1ZIZA 1R7XA 3SX5A 2WVLA 3Q7UA 2YC5A 5C4FA 1THJA 1JVDA 3SUCA 3I0GA 1L0SA 1V67A 4HCQA 4BMAA 2RJ5A 1TVYA 4CJCA 5C4BA 4Y7VA 2Z87A 4M2BA 1H4EA 4EABA 2QIVX 1GX4A 4HZDA 4G3PA 1KWSA 3POLA 2V0KA 3Q80A 3SX7A 3V0PA 4MZUA 3VBMA 2Z86A 1FR9A 4EEOA 1R82A 3V8ZA 2WLCA 4E6TA 3OH1A 2PGYA 3RSBA 3OU9A 5CMIA 4NANA 1QG8A 4FRQA 4M2AA 3U0YA 4B4MA 2XATA 3FSXA 2VXMA 2FYCB 2RIXA 3IXCA 3OH0A 3U2UA 3GOSA 2JCKA 1ZDGA 3OC9A 5BXCA 3IOIA 4KNXA 2A8WA 3FWWA 1INIA 3RMVA 1OMZA 2E8BA 4DE7A 5C38A 4AC3A 1LL2A 1O7QA 2FYAA 4EGGA 4KC4A 2GGQA 1LL3A 1ZHJA 2AECA 2YQJA 4B2WA 4LW6A 4IRPA 2O1FA 1WSZA 1JYKA 1SS9A 3D8VA 4IHHA 1ZCTA 2APCA 3IOHA 3MQGA 3IOJA 3T57A 4FCUA 4HO9A 1PZTA 3U0XA 3C8VA 3R0SA 4N6AA 3FSBA 1S4NA 4R36A 3SXBA 5C49A 5CMFX 4AA7A 3DHOA 2Y4MA 1H7HA 4D11C 4B5BA 1R81A 4EEAA 2JCOA 1O0RA 1R7YA 1ZJPA 3KWEA 3SPTA 5CMHA 4FRPA 4E79A 1EWWA 2NXVA 2V0IA 1Z90A 3MQHA 3SXCA 3VNPA 4R37A 3NZ2A 3FS8A 4Y9XA 3SX3A 2VK9A 2FFVA 4D0TA 2DPWA 3V0NA 2XMEA 2C0NA 3F1YA 3BSWA 3P1BA 1LXAA 4Y64A 2RIJA 5IDTA 1YP3A 4IHFA 3T7NA 1TW5A 3R5BA 3I0EA 4HO8A 3BFPA 2RITA 2D7RA 4HG6A 1NHEB 1G0RA 2OEFA 5C3BA 5CMJA 4JISA 4O6MA 2GGOA 2RJ8A 2Y4JA 3CKVA 4G87A 3PMOA 5U2KA 1IIMA 1GWWA 1GA8A 1GX0A 2YESA 1KRUA 1FGGA 2XMHA 3Q1XA 5CQOA 1QRMA 4AAWA 4N6BA 2RJ0A 3OH4A 3HL3A 4LW3A 1ZCYA 3ZGGA 2RJ1A 1VZUA 4Y63A 1KQAA 2WLEA 5FTSA 3D98A 1EZIA 4KRVA 1H5SB 1H5RB 5FU8A 5C36A 3QVBA 4R7PA 4D11A 4KC1A 4HO6A 1SSMA 1FG5N 2AM4A 2QIAA 1ZJOA 4N69A 4IRQA 1KRRA 1V84A 4Y6NA 2VS3A 3VBNA 3V8YA 3FTTA 4FRMA 3JUJA 3GUEA 5CQLX 1VM8A 1G2VA 1H7LA 1LVWA 2YQHA 1FXOA 5C48A 4HO0A 3DUVA 4JD0A 3F1CA 4Y6UA 3E26A 2J0BA 4D48A 4B2XA 1ON8A 3V4EA 1ZJ2A 4E75A 3BRKX 2Y6PA 1QRFA 3TDTA 1OMXA 1H5SD 4ASYA 5AJOA 1G93A 5C47A 3OAMA 5C4DA 3R8YA 2QKXA 1LZ7A 1HV9A 1KK5A 2D0JA 2P6WA 2QH5A 4L41C 3GQ9A 1S4PA 4EE5A 3VBJA 4P02A 5C8RA 5FUHA 5D92A 1SSQA 5EJZA 4MYBA 3KWCA 4UEGA 2WAWA 2I7BA 4M9CA 4FREA 2FFUA 1S80A 2IU9A 3I0KA 3TK8A 2X5ZA 1W55A 1JV1A 4B4BA 4FRDA 4ECMA 5EJ1A 1VPAA 4B4GA 3I0LA 1OCXA 4EA9A 3PKPA 5C1LA 5DDVA 2OEGA 2JCJA 3V0LA 2A8UA 5FU0A 3OTZA 3Q4SA 2V0HA 4IHGA 1H5SC 3TISA 1H4CA 1VH1A 1NKHB 4KT7A 1FXJA 2TDTA 1H5TB 1FGXA 3ZGFA 1LL0A 3KWDA 5E3QA 4HUSA 4MYOA 4FRHA 3I0CA 5HS2A 5C4CA 1FO9A 2AESA 1XATA 5AFUU 4J18A 5C3DA 4G3SA 3SRTA 2Y4KA 4KPZA 2ZU8A 4Y7GA 2VSHA 1R80A 4O6NA 2AM5A 5DG3A 4M99A 4EEMA 3R1WA 2WLFA 2AM3A 2UX8A 4FRLA 2Y7AA 3I0JA 1H4DA 2RJ4A 4EVWA 5C3AA 3V0MA 1ZCUA 1HM9A 1KHRA 2OI6A 2WGZA 5C4EA 1W77A 4FROA 1ZI1A 3V0OA 3MC4A 1QGSA 2MZBA 2P2OA 4MIXA 1YP4A 3ZF8A 5E3PA 1H3MA 1ZJ1A 2I5EA 1H7QA 3R5CA 5D91A 4ARWA 2FY7A 1VZTA 3I0DA 3OH2A 1MP3A 3OKRA 1VGTA 1T3DA 1H5SA 3SXGA 3CGXA 2X60A 3CKJA 3HSQA 1QQ0A 4BQHA 3HJJA 3U2TA 2AH9A 3JTJA 1KK4A 2WVMA 4J09A 1ZJ3A 3JUKA 1MC3A 2RJ7A 3K8DA 1KRVA 1WT3A 2VS4A 4EEGA 3P47A 5ADXV 4H7OA 3OUPA 3OGZA 3T7OA 2J0AA 2FKOA 1QRLA 3VBIA 2VFZA 2JF2A 4ZDQA 3R3RA 1FR8A 3T7MA 4FQWA 1PZYB 3CKQA 3U2VA 2VS5A 2WLDA 3GQ7A 5F42A 1R7TA 3RMWA 3TIOA 1G8OA 1JVGA 3SX8A 2Q4JA 3FSCA 1R7VA 1I52A 4NAKA 3TQDA 3I3AA 1XZ6A 3CKOA 1H5RA 3N9WA 2XWLA 3SXDA 1G1LA 4HURA 4DDZA 1VICA 4M98A 2IUAA 5CQPA 1K4VA 5FTVA 1YP2A 1WT2A 1MP5A 2D7IA 2XWNA 4P00A 3DK5A 1ZJ0A 1QWJA 4FRBA 3JQYA 5FYEA 5EIYA 3V0QA 3I0IX 3LW6A 1OQMB 3GQAA 2IC7A 5DDTA 1G9RA 3EE5A 1MRLA 3V91A 3U2XA 1JV3A 1VGZA 2I5KA 1QRGA 2W0VA 3EH0A 2CU2A 2E3DA 1QREA 2ICXA 1G95A 5L6SA 1H7EA 3U2WA 3R5AA 3E25A 4NAIA 2AQ9A 2YCMA 2ZU7A 3KIAA 4EAAA 4CJ8A 4HO5A 1H7GA 4C2SA 4EE3A 3FOQA 1V82A 4B3UA 5DEPA 4NALA 4Y7FA 2P72A 4EQYA 4HZCA 1EYRA 3SXAA 2RJ9A 1ZI4A 2RIZA 2NPOA
chains in the Genus database with same CATH topology
1KGQA 4ISXA 3ST8A 2AGDA 4Y7TA 2P73A 1E5KA 1O7OA 2YC3A 4G3QA 1MP4A 4KC2A 4HO3A 3OW5A 3SXEA 3D5NA 4CVHA 3CKNA 4HOCA 4M4KA 1R7UA 5FV9A 5CMGX 4FCEA 4MFGA 1VGWA 3I0FA 2O1HA 4HO2A 2VSIA 5L6VA 1H7FA 2PA4A 1TW1A 3V90A 1VZXA 4DECA 1ZI3A 3DJ4A 1TDTA 3VBPA 1W57A 1HM0A 2OI5A 2BO4A 4M28A 1H5TA 3R3IA 2ICYA 1WT0A 2V0JA 3EEVA 2YQCA 1V83A 1MR9A 3K8EA 5E3RA 1LZIA 4YS8A 1S4OA 3BCVA 1GQ9A 2FYBA 1IINA 4K6RA 1FZWA 2RIYA 1ON6A 1YROB 3PNNA 2RJ6A 5CQMX 4DCLA 3R2WA 4D0ZA 3TZTA 2AE7A 3VBLA 1V3WA 2BO8A 4GBPA 1KK6A 1QGQA 2XWMA 1VH3A 3F1XA 2BO7A 1ZDFA 2X5SA 3O3PA 4MNDA 4Y62A 5AJPA 2O1GA 2WE9A 1GWVA 2FYDB 2WEEA 4ASJA 1NF5B 1WVCA 2QGIA 5CQNX 4E1KA 1O23B 4EE4A 5IDSA 2ZU9A 1MR7A 3IGJA 1J2ZA 1LZJA 4EA8A 3I0HA 1ZCVA 1JYLA 4Y7UA 3ZLKA 1FOAA 3ECTA 1KGTA 3BSSA 3CJ8A 4AYLA 3EG4A 2WLGA 2IU8A 1TZFA 5I1FA 3ZLLA 4N27A 4CJBA 1GQCA 4B42A 5J49A 4KQLA 2X65A 5AFUV 5JQQA 1NQIB 1FRWA 4FIYA 2PGVA 3BSYA 4HO4A 3VBKA 2JF3A 4EA7A 1NMMB 3TWDA 2BO6A 4FIXA 4KPXA 4AYJA 2PX7A 4KXOA 5C1GA 3I3XA 1FWYA 5ADXU 1ZI5A 3USRA 3NGWA 4E6UA 1WT1A 5C1HA 1LZ0A 5AJNA 1H7TA 3CU0A 1HM8A 1FO8A 1XHDA 1G97A 2V0LA 5IFYA 2YQSA 2VD4A 3GVDA 1HJJA 4Q7CA 3OTMA 3FSYA 1XHBA 1SSTA 2W0WA 2WVKA 2JCLA 5DEMA 2Y4LA 3PKQA 1NWGB 4FRAA 4XWIA 3BXYA 3OH3A 1VGUA 2VHEA 2OI7A 1G23A 3USQA 3TV0A 1G3LA 1INJA 4KNRA 2VXLA 3R5DA 1HJLA 1ZIZA 1R7XA 3SX5A 2WVLA 3Q7UA 2YC5A 5C4FA 1THJA 1JVDA 3I0GA 1V67A 4HCQA 4BMAA 2RJ5A 1TVYA 4CJCA 5C4BA 4Y7VA 2Z87A 4M2BA 1H4EA 4EABA 2QIVX 1GX4A 4HZDA 4G3PA 1KWSA 3POLA 2V0KA 3Q80A 3SX7A 3V0PA 4MZUA 3VBMA 2Z86A 1FR9A 4EEOA 1R82A 3V8ZA 2WLCA 4E6TA 3OH1A 2PGYA 3RSBA 3OU9A 5CMIA 4NANA 1QG8A 4FRQA 4M2AA 3U0YA 4B4MA 2XATA 3FSXA 2VXMA 2FYCB 2RIXA 3IXCA 3OH0A 3U2UA 3GOSA 2JCKA 1ZDGA 3OC9A 5BXCA 3IOIA 4KNXA 2A8WA 3FWWA 1INIA 3RMVA 1OMZA 2E8BA 4DE7A 5C38A 4AC3A 1LL2A 1O7QA 2FYAA 4EGGA 4KC4A 2GGQA 1LL3A 1ZHJA 2AECA 2YQJA 4B2WA 4LW6A 4IRPA 2O1FA 1WSZA 1JYKA 1SS9A 3D8VA 4IHHA 1ZCTA 2APCA 3IOHA 3MQGA 3IOJA 3T57A 4FCUA 4HO9A 1PZTA 3U0XA 3C8VA 3R0SA 4N6AA 3FSBA 1S4NA 4R36A 3SXBA 5C49A 5CMFX 4AA7A 3DHOA 2Y4MA 1H7HA 4D11C 4B5BA 1R81A 4EEAA 2JCOA 1O0RA 1R7YA 1ZJPA 3KWEA 3SPTA 5CMHA 4FRPA 4E79A 2NXVA 2V0IA 1Z90A 3MQHA 3SXCA 3VNPA 4R37A 3NZ2A 3FS8A 4Y9XA 3SX3A 2VK9A 2FFVA 4D0TA 2DPWA 3V0NA 2XMEA 2C0NA 3F1YA 3BSWA 3P1BA 1LXAA 4Y64A 2RIJA 5IDTA 1YP3A 4IHFA 3T7NA 1TW5A 3R5BA 3I0EA 4HO8A 3BFPA 2RITA 2D7RA 4HG6A 1NHEB 1G0RA 2OEFA 5C3BA 5CMJA 4JISA 4O6MA 2GGOA 2RJ8A 2Y4JA 3CKVA 4G87A 3PMOA 5U2KA 1IIMA 1GWWA 1GA8A 1GX0A 2YESA 1KRUA 1FGGA 2XMHA 3Q1XA 5CQOA 1QRMA 4AAWA 4N6BA 2RJ0A 3HL3A 3OH4A 4LW3A 1ZCYA 3ZGGA 2RJ1A 1VZUA 4Y63A 1KQAA 2WLEA 5FTSA 3D98A 1EZIA 4KRVA 1H5SB 1H5RB 5FU8A 5C36A 3QVBA 4R7PA 4D11A 4KC1A 4HO6A 1SSMA 1FG5N 2AM4A 2QIAA 1ZJOA 4N69A 4IRQA 1KRRA 1V84A 4Y6NA 2VS3A 3VBNA 3V8YA 3FTTA 4FRMA 3JUJA 3GUEA 5CQLX 1VM8A 1G2VA 1H7LA 1LVWA 2YQHA 1FXOA 5C48A 4HO0A 3DUVA 4JD0A 3F1CA 4Y6UA 3E26A 2J0BA 4D48A 4B2XA 1ON8A 3V4EA 1ZJ2A 4E75A 3BRKX 2Y6PA 1QRFA 3TDTA 1OMXA 1H5SD 4ASYA 5AJOA 1G93A 5C47A 3OAMA 5C4DA 3R8YA 2QKXA 1LZ7A 1HV9A 1KK5A 2D0JA 2P6WA 2QH5A 4L41C 1S4PA 4EE5A 3VBJA 4P02A 5C8RA 5FUHA 5D92A 1SSQA 5EJZA 4MYBA 3KWCA 4UEGA 2WAWA 2I7BA 4M9CA 4FREA 2FFUA 1S80A 2IU9A 3I0KA 3TK8A 2X5ZA 1W55A 1JV1A 4B4BA 4FRDA 4ECMA 5EJ1A 1VPAA 4B4GA 3I0LA 1OCXA 4EA9A 3PKPA 5C1LA 5DDVA 2OEGA 2JCJA 3V0LA 2A8UA 5FU0A 3OTZA 3Q4SA 2V0HA 4IHGA 1H5SC 3TISA 1H4CA 1VH1A 1NKHB 4KT7A 1FXJA 2TDTA 1H5TB 1FGXA 3ZGFA 1LL0A 3KWDA 5E3QA 4HUSA 4MYOA 4FRHA 3I0CA 5HS2A 5C4CA 1FO9A 2AESA 1XATA 5AFUU 4J18A 5C3DA 4G3SA 3SRTA 2Y4KA 4KPZA 2ZU8A 4Y7GA 2VSHA 1R80A 4O6NA 2AM5A 5DG3A 4M99A 4EEMA 3R1WA 2WLFA 2AM3A 2UX8A 4FRLA 2Y7AA 3I0JA 1H4DA 2RJ4A 4EVWA 5C3AA 3V0MA 1ZCUA 1HM9A 1KHRA 2OI6A 2WGZA 5C4EA 1W77A 4FROA 1ZI1A 3V0OA 3MC4A 1QGSA 2MZBA 2P2OA 4MIXA 1YP4A 3ZF8A 5E3PA 1H3MA 1ZJ1A 2I5EA 1H7QA 3R5CA 5D91A 4ARWA 2FY7A 1VZTA 3I0DA 3OH2A 1MP3A 3OKRA 1VGTA 1T3DA 1H5SA 3SXGA 3CGXA 2X60A 3CKJA 3HSQA 1QQ0A 4BQHA 3HJJA 3U2TA 2AH9A 3JTJA 1KK4A 2WVMA 4J09A 1ZJ3A 3JUKA 1MC3A 2RJ7A 3K8DA 1KRVA 1WT3A 2VS4A 4EEGA 3P47A 5ADXV 4H7OA 3OUPA 3OGZA 3T7OA 2J0AA 2FKOA 1QRLA 3VBIA 2VFZA 2JF2A 4ZDQA 3R3RA 1FR8A 3T7MA 4FQWA 1PZYB 3CKQA 3U2VA 2VS5A 2WLDA 5F42A 1R7TA 3RMWA 3TIOA 1G8OA 1JVGA 3SX8A 2Q4JA 3FSCA 1R7VA 1I52A 4NAKA 3TQDA 3I3AA 1XZ6A 3CKOA 1H5RA 3N9WA 2XWLA 3SXDA 1G1LA 4HURA 4DDZA 1VICA 4M98A 2IUAA 5CQPA 1K4VA 5FTVA 1YP2A 1WT2A 1MP5A 2D7IA 2XWNA 4P00A 3DK5A 1ZJ0A 1QWJA 4FRBA 3JQYA 5FYEA 5EIYA 3V0QA 3I0IX 3LW6A 1OQMB 2IC7A 5DDTA 1G9RA 3EE5A 1MRLA 3V91A 3U2XA 1JV3A 1VGZA 2I5KA 1QRGA 2W0VA 3EH0A 2CU2A 2E3DA 1QREA 2ICXA 1G95A 5L6SA 1H7EA 3U2WA 3R5AA 3E25A 4NAIA 2AQ9A 2YCMA 2ZU7A 3KIAA 4EAAA 4CJ8A 4HO5A 1H7GA 4C2SA 4EE3A 3FOQA 1V82A 4B3UA 5DEPA 4NALA 4Y7FA 2P72A 4EQYA 4HZCA 1EYRA 3SXAA 2RJ9A 1ZI4A 2RIZA 2NPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KGQ A;  4ISX A;  3ST8 A;  2AGD A;  4Y7T A;  2P73 A;  1E5K A;  1O7O A;  2YC3 A;  4G3Q A;  1MP4 A;  4KC2 A;  4HO3 A;  3OW5 A;  3SXE A;  3D5N A;  4CVH A;  3CKN A;  4HOC A;  4M4K A;  1R7U A;  5FV9 A;  5CMG X;  4FCE A;  4MFG A;  1VGW A;  3I0F A;  2O1H A;  4HO2 A;  2VSI A;  5L6V A;  1H7F A;  2PA4 A;  1TW1 A;  3V90 A;  1VZX A;  4DEC A;  1ZI3 A;  3DJ4 A;  1TDT A;  3VBP A;  1W57 A;  1HM0 A;  2OI5 A;  2BO4 A;  4M28 A;  1H5T A;  3R3I A;  2ICY A;  1WT0 A;  2V0J A;  3EEV A;  2YQC A;  1V83 A;  1MR9 A;  3K8E A;  5E3R A;  1LZI A;  4YS8 A;  1S4O A;  3BCV A;  1GQ9 A;  2FYB A;  1IIN A;  4K6R A;  1FZW A;  2RIY A;  1ON6 A;  1YRO B;  3PNN A;  2RJ6 A;  5CQM X;  4DCL A;  3R2W A;  4D0Z A;  3TZT A;  2AE7 A;  3VBL A;  1V3W A;  2BO8 A;  4GBP A;  1KK6 A;  1QGQ A;  2XWM A;  1VH3 A;  3F1X A;  2BO7 A;  1ZDF A;  2X5S A;  3O3P A;  4MND A;  4Y62 A;  5AJP A;  2O1G A;  2WE9 A;  1GWV A;  2FYD B;  2WEE A;  4ASJ A;  1NF5 B;  1WVC A;  2QGI A;  5CQN X;  4E1K A;  1O23 B;  4EE4 A;  5IDS A;  2ZU9 A;  1MR7 A;  3IGJ A;  1J2Z A;  1LZJ A;  4EA8 A;  3I0H A;  1ZCV A;  1JYL A;  4Y7U A;  3ZLK A;  1FOA A;  3ECT A;  1KGT A;  3BSS A;  3CJ8 A;  4AYL A;  3EG4 A;  2WLG A;  2IU8 A;  1TZF A;  5I1F A;  3ZLL A;  4N27 A;  4CJB A;  1GQC A;  4B42 A;  5J49 A;  4KQL A;  2X65 A;  5AFU V;  5JQQ A;  1NQI B;  1FRW A;  4HO4 A;  2PGV A;  3BSY A;  3VBK A;  2JF3 A;  4EA7 A;  1NMM B;  3TWD A;  2BO6 A;  4KPX A;  4AYJ A;  2PX7 A;  4KXO A;  5C1G A;  3I3X A;  1FWY A;  5ADX U;  1ZI5 A;  3USR A;  3NGW A;  4E6U A;  1WT1 A;  5C1H A;  1LZ0 A;  5AJN A;  1H7T A;  3CU0 A;  1HM8 A;  1FO8 A;  1XHD A;  1G97 A;  2V0L A;  5IFY A;  2YQS A;  2VD4 A;  3GVD A;  1HJJ A;  3OTM A;  3FSY A;  1XHB A;  1SST A;  2W0W A;  2WVK A;  2JCL A;  5DEM A;  2Y4L A;  3PKQ A;  1NWG B;  4FRA A;  4XWI A;  3BXY A;  3OH3 A;  1VGU A;  2VHE A;  2OI7 A;  1G23 A;  3USQ A;  3TV0 A;  1G3L A;  1INJ A;  4KNR A;  2VXL A;  3R5D A;  1HJL A;  1ZIZ A;  1R7X A;  3SX5 A;  2WVL A;  3Q7U A;  2YC5 A;  5C4F A;  1THJ A;  1JVD A;  3I0G A;  1V67 A;  4HCQ A;  4BMA A;  2RJ5 A;  1TVY A;  4CJC A;  5C4B A;  4Y7V A;  2Z87 A;  4M2B A;  1H4E A;  4EAB A;  2QIV X;  1GX4 A;  4HZD A;  4G3P A;  1KWS A;  3POL A;  2V0K A;  3Q80 A;  3SX7 A;  3V0P A;  4MZU A;  3VBM A;  2Z86 A;  1FR9 A;  4EEO A;  1R82 A;  3V8Z A;  2WLC A;  4E6T A;  3OH1 A;  2PGY A;  3RSB A;  3OU9 A;  5CMI A;  4NAN A;  1QG8 A;  4FRQ A;  4M2A A;  3U0Y A;  4B4M A;  2XAT A;  3FSX A;  2VXM A;  2FYC B;  2RIX A;  3IXC A;  3OH0 A;  3U2U A;  3GOS A;  2JCK A;  1ZDG A;  3OC9 A;  5BXC A;  3IOI A;  4KNX A;  2A8W A;  3FWW A;  1INI A;  3RMV A;  1OMZ A;  2E8B A;  4DE7 A;  5C38 A;  4AC3 A;  1LL2 A;  1O7Q A;  2FYA A;  4EGG A;  4KC4 A;  2GGQ A;  1LL3 A;  1ZHJ A;  2AEC A;  2YQJ A;  4B2W A;  4LW6 A;  4IRP A;  2O1F A;  1WSZ A;  1JYK A;  1SS9 A;  3D8V A;  4IHH A;  1ZCT A;  2APC A;  3IOH A;  3MQG A;  3IOJ A;  3T57 A;  4FCU A;  4HO9 A;  1PZT A;  3U0X A;  3C8V A;  3R0S A;  4N6A A;  3FSB A;  1S4N A;  4R36 A;  3SXB A;  5C49 A;  5CMF X;  4AA7 A;  3DHO A;  2Y4M A;  1H7H A;  4D11 C;  4B5B A;  1R81 A;  4EEA A;  2JCO A;  1O0R A;  1R7Y A;  1ZJP A;  3KWE A;  3SPT A;  5CMH A;  4FRP A;  4E79 A;  2NXV A;  2V0I A;  1Z90 A;  3MQH A;  3SXC A;  3VNP A;  4R37 A;  3NZ2 A;  3FS8 A;  4Y9X A;  3SX3 A;  2FFV A;  4D0T A;  2DPW A;  3V0N A;  2XME A;  3F1Y A;  3BSW A;  3P1B A;  1LXA A;  4Y64 A;  2RIJ A;  5IDT A;  1YP3 A;  4IHF A;  3T7N A;  1TW5 A;  3R5B A;  3I0E A;  4HO8 A;  3BFP A;  2RIT A;  2D7R A;  4HG6 A;  1NHE B;  1G0R A;  2OEF A;  5C3B A;  5CMJ A;  4JIS A;  2GGO A;  2RJ8 A;  2Y4J A;  3CKV A;  4G87 A;  3PMO A;  5U2K A;  1IIM A;  1GWW A;  1GA8 A;  1GX0 A;  2YES A;  1KRU A;  1FGG A;  2XMH A;  3Q1X A;  5CQO A;  1QRM A;  4AAW A;  4N6B A;  2RJ0 A;  3HL3 A;  3OH4 A;  4LW3 A;  1ZCY A;  3ZGG A;  2RJ1 A;  1VZU A;  4Y63 A;  1KQA A;  2WLE A;  5FTS A;  3D98 A;  1EZI A;  4KRV A;  1H5S B;  1H5R B;  5FU8 A;  5C36 A;  3QVB A;  4R7P A;  4D11 A;  4KC1 A;  4HO6 A;  1SSM A;  1FG5 N;  2AM4 A;  2QIA A;  1ZJO A;  4N69 A;  4IRQ A;  1KRR A;  1V84 A;  4Y6N A;  2VS3 A;  3VBN A;  3V8Y A;  3FTT A;  4FRM A;  3JUJ A;  3GUE A;  5CQL X;  1VM8 A;  1G2V A;  1H7L A;  1LVW A;  2YQH A;  1FXO A;  5C48 A;  4HO0 A;  3DUV A;  4JD0 A;  3F1C A;  4Y6U A;  3E26 A;  4D48 A;  4B2X A;  1ON8 A;  3V4E A;  1ZJ2 A;  4E75 A;  3BRK X;  2Y6P A;  1QRF A;  3TDT A;  1OMX A;  1H5S D;  4ASY A;  5AJO A;  1G93 A;  5C47 A;  3OAM A;  5C4D A;  3R8Y A;  2QKX A;  1LZ7 A;  1HV9 A;  1KK5 A;  2D0J A;  2P6W A;  2QH5 A;  4L41 C;  1S4P A;  4EE5 A;  3VBJ A;  4P02 A;  5C8R A;  5FUH A;  1SSQ A;  5EJZ A;  4MYB A;  3KWC A;  4UEG A;  2WAW A;  2I7B A;  4M9C A;  4FRE A;  2FFU A;  1S80 A;  2IU9 A;  3I0K A;  3TK8 A;  2X5Z A;  1W55 A;  1JV1 A;  4B4B A;  4FRD A;  4ECM A;  5EJ1 A;  1VPA A;  4B4G A;  3I0L A;  1OCX A;  4EA9 A;  3PKP A;  5C1L A;  5DDV A;  2OEG A;  2JCJ A;  3V0L A;  2A8U A;  5FU0 A;  3OTZ A;  3Q4S A;  2V0H A;  4IHG A;  1H5S C;  3TIS A;  1H4C A;  1VH1 A;  1NKH B;  4KT7 A;  1FXJ A;  2TDT A;  1H5T B;  1FGX A;  3ZGF A;  1LL0 A;  3KWD A;  5E3Q A;  4HUS A;  4MYO A;  4FRH A;  3I0C A;  5HS2 A;  5C4C A;  1FO9 A;  2AES A;  1XAT A;  5AFU U;  4J18 A;  5C3D A;  4G3S A;  3SRT A;  2Y4K A;  4KPZ A;  2ZU8 A;  4Y7G A;  2VSH A;  1R80 A;  2AM5 A;  5DG3 A;  4M99 A;  4EEM A;  3R1W A;  2WLF A;  2AM3 A;  2UX8 A;  4FRL A;  2Y7A A;  3I0J A;  1H4D A;  2RJ4 A;  4EVW A;  5C3A A;  3V0M A;  1ZCU A;  1HM9 A;  1KHR A;  2OI6 A;  2WGZ A;  5C4E A;  1W77 A;  4FRO A;  1ZI1 A;  3V0O A;  3MC4 A;  1QGS A;  2MZB A;  2P2O A;  1YP4 A;  3ZF8 A;  5E3P A;  1H3M A;  1ZJ1 A;  2I5E A;  1H7Q A;  3R5C A;  4ARW A;  2FY7 A;  1VZT A;  3I0D A;  3OH2 A;  1MP3 A;  3OKR A;  1VGT A;  1T3D A;  1H5S A;  3SXG A;  3CGX A;  2X60 A;  3CKJ A;  3HSQ A;  1QQ0 A;  4BQH A;  3HJJ A;  3U2T A;  2AH9 A;  3JTJ A;  1KK4 A;  2WVM A;  4J09 A;  1ZJ3 A;  3JUK A;  1MC3 A;  2RJ7 A;  3K8D A;  1KRV A;  1WT3 A;  2VS4 A;  4EEG A;  3P47 A;  5ADX V;  4H7O A;  3OUP A;  3OGZ A;  3T7O A;  2FKO A;  1QRL A;  3VBI A;  2VFZ A;  2JF2 A;  4ZDQ A;  3R3R A;  1FR8 A;  3T7M A;  4FQW A;  1PZY B;  3CKQ A;  3U2V A;  2VS5 A;  2WLD A;  5F42 A;  1R7T A;  3RMW A;  3TIO A;  1G8O A;  1JVG A;  3SX8 A;  2Q4J A;  3FSC A;  1R7V A;  1I52 A;  4NAK A;  3TQD A;  3I3A A;  1XZ6 A;  3CKO A;  1H5R A;  3N9W A;  2XWL A;  3SXD A;  1G1L A;  4HUR A;  4DDZ A;  1VIC A;  4M98 A;  2IUA A;  5CQP A;  1K4V A;  5FTV A;  1YP2 A;  1WT2 A;  1MP5 A;  2D7I A;  2XWN A;  4P00 A;  3DK5 A;  1ZJ0 A;  1QWJ A;  4FRB A;  3JQY A;  5FYE A;  5EIY A;  3V0Q A;  3I0I X;  3LW6 A;  1OQM B;  2IC7 A;  5DDT A;  1G9R A;  3EE5 A;  1MRL A;  3V91 A;  3U2X A;  1JV3 A;  1VGZ A;  2I5K A;  1QRG A;  2W0V A;  3EH0 A;  2CU2 A;  2E3D A;  1QRE A;  2ICX A;  1G95 A;  5L6S A;  1H7E A;  3U2W A;  3R5A A;  3E25 A;  4NAI A;  2AQ9 A;  2YCM A;  2ZU7 A;  3KIA A;  4EAA A;  4CJ8 A;  4HO5 A;  1H7G A;  4C2S A;  4EE3 A;  3FOQ A;  1V82 A;  4B3U A;  5DEP A;  4NAL A;  4Y7F A;  2P72 A;  4EQY A;  4HZC A;  1EYR A;  3SXA A;  2RJ9 A;  1ZI4 A;  2RIZ A;  2NPO A; 
#chains in the Genus database with same CATH topology
 1KGQ A;  4ISX A;  3ST8 A;  2AGD A;  4Y7T A;  2P73 A;  1E5K A;  1O7O A;  2YC3 A;  4G3Q A;  1MP4 A;  4KC2 A;  4HO3 A;  3OW5 A;  3SXE A;  3D5N A;  4CVH A;  3CKN A;  4HOC A;  4M4K A;  1R7U A;  5FV9 A;  5CMG X;  4FCE A;  4MFG A;  1VGW A;  3I0F A;  2O1H A;  4HO2 A;  2VSI A;  5L6V A;  1H7F A;  2PA4 A;  1TW1 A;  3V90 A;  1VZX A;  4DEC A;  1ZI3 A;  3DJ4 A;  1TDT A;  3VBP A;  1W57 A;  1HM0 A;  2OI5 A;  2BO4 A;  4M28 A;  1H5T A;  3R3I A;  2ICY A;  1WT0 A;  2V0J A;  3EEV A;  2YQC A;  1V83 A;  1MR9 A;  3K8E A;  5E3R A;  1LZI A;  4YS8 A;  1S4O A;  3BCV A;  1GQ9 A;  2FYB A;  1IIN A;  4K6R A;  1FZW A;  2RIY A;  1ON6 A;  1YRO B;  3PNN A;  2RJ6 A;  5CQM X;  4DCL A;  3R2W A;  4D0Z A;  3TZT A;  2AE7 A;  3VBL A;  1V3W A;  2BO8 A;  4GBP A;  1KK6 A;  1Z2F A;  1QGQ A;  2XWM A;  1VH3 A;  3F1X A;  2BO7 A;  1ZDF A;  2X5S A;  3O3P A;  4MND A;  4Y62 A;  5AJP A;  2O1G A;  2WE9 A;  1GWV A;  2FYD B;  2WEE A;  4ASJ A;  1NF5 B;  1WVC A;  2QGI A;  5CQN X;  4E1K A;  1O23 B;  4EE4 A;  5IDS A;  2ZU9 A;  1MR7 A;  3IGJ A;  1J2Z A;  1LZJ A;  4EA8 A;  3I0H A;  1ZCV A;  1JYL A;  4Y7U A;  3ZLK A;  1FOA A;  3ECT A;  1KGT A;  3BSS A;  3CJ8 A;  4AYL A;  3EG4 A;  2WLG A;  2IU8 A;  1TZF A;  5I1F A;  3ZLL A;  4N27 A;  4CJB A;  1GQC A;  4B42 A;  5J49 A;  4KQL A;  2X65 A;  5AFU V;  5JQQ A;  1NQI B;  1FRW A;  4FIY A;  2PGV A;  3BSY A;  4HO4 A;  3VBK A;  2JF3 A;  4EA7 A;  1NMM B;  3TWD A;  2BO6 A;  4FIX A;  4KPX A;  4AYJ A;  2PX7 A;  4KXO A;  5C1G A;  3I3X A;  1FWY A;  5ADX U;  1ZI5 A;  3USR A;  1M8N A;  4E6U A;  3NGW A;  1WT1 A;  5C1H A;  1LZ0 A;  5AJN A;  1H7T A;  3CU0 A;  1HM8 A;  1FO8 A;  1XHD A;  1G97 A;  2V0L A;  5IFY A;  2YQS A;  2VD4 A;  3GVD A;  1HJJ A;  4Q7C A;  3OTM A;  3FSY A;  1XHB A;  1SST A;  2W0W A;  2WVK A;  2JCL A;  5DEM A;  2Y4L A;  3PKQ A;  1NWG B;  1N4I A;  4FRA A;  4XWI A;  3BXY A;  3OH3 A;  1VGU A;  2VHE A;  2OI7 A;  1G23 A;  3USQ A;  3TV0 A;  1G3L A;  3GQ8 A;  1INJ A;  4KNR A;  2VXL A;  3R5D A;  1HJL A;  1ZIZ A;  1R7X A;  3SX5 A;  2WVL A;  3Q7U A;  2YC5 A;  5C4F A;  1THJ A;  1JVD A;  3SUC A;  3I0G A;  1L0S A;  1V67 A;  4HCQ A;  4BMA A;  2RJ5 A;  1TVY A;  4CJC A;  5C4B A;  4Y7V A;  2Z87 A;  4M2B A;  1H4E A;  4EAB A;  2QIV X;  1GX4 A;  4HZD A;  4G3P A;  1KWS A;  3POL A;  2V0K A;  3Q80 A;  3SX7 A;  3V0P A;  4MZU A;  3VBM A;  2Z86 A;  1FR9 A;  4EEO A;  1R82 A;  3V8Z A;  2WLC A;  4E6T A;  3OH1 A;  2PGY A;  3RSB A;  3OU9 A;  5CMI A;  4NAN A;  1QG8 A;  4FRQ A;  4M2A A;  3U0Y A;  4B4M A;  2XAT A;  3FSX A;  2VXM A;  2FYC B;  2RIX A;  3IXC A;  3OH0 A;  3U2U A;  3GOS A;  2JCK A;  1ZDG A;  3OC9 A;  5BXC A;  3IOI A;  4KNX A;  2A8W A;  3FWW A;  1INI A;  3RMV A;  1OMZ A;  2E8B A;  4DE7 A;  5C38 A;  4AC3 A;  1LL2 A;  1O7Q A;  2FYA A;  4EGG A;  4KC4 A;  2GGQ A;  1LL3 A;  1ZHJ A;  2AEC A;  2YQJ A;  4B2W A;  4LW6 A;  4IRP A;  2O1F A;  1WSZ A;  1JYK A;  1SS9 A;  3D8V A;  4IHH A;  1ZCT A;  2APC A;  3IOH A;  3MQG A;  3IOJ A;  3T57 A;  4FCU A;  4HO9 A;  1PZT A;  3U0X A;  3C8V A;  3R0S A;  4N6A A;  3FSB A;  1S4N A;  4R36 A;  3SXB A;  5C49 A;  5CMF X;  4AA7 A;  3DHO A;  2Y4M A;  1H7H A;  4D11 C;  4B5B A;  1R81 A;  4EEA A;  2JCO A;  1O0R A;  1R7Y A;  1ZJP A;  3KWE A;  3SPT A;  5CMH A;  4FRP A;  4E79 A;  1EWW A;  2NXV A;  2V0I A;  1Z90 A;  3MQH A;  3SXC A;  3VNP A;  4R37 A;  3NZ2 A;  3FS8 A;  4Y9X A;  3SX3 A;  2VK9 A;  2FFV A;  4D0T A;  2DPW A;  3V0N A;  2XME A;  2C0N A;  3F1Y A;  3BSW A;  3P1B A;  1LXA A;  4Y64 A;  2RIJ A;  5IDT A;  1YP3 A;  4IHF A;  3T7N A;  1TW5 A;  3R5B A;  3I0E A;  4HO8 A;  3BFP A;  2RIT A;  2D7R A;  4HG6 A;  1NHE B;  1G0R A;  2OEF A;  5C3B A;  5CMJ A;  4JIS A;  4O6M A;  2GGO A;  2RJ8 A;  2Y4J A;  3CKV A;  4G87 A;  3PMO A;  5U2K A;  1IIM A;  1GWW A;  1GA8 A;  1GX0 A;  2YES A;  1KRU A;  1FGG A;  2XMH A;  3Q1X A;  5CQO A;  1QRM A;  4AAW A;  4N6B A;  2RJ0 A;  3OH4 A;  3HL3 A;  4LW3 A;  1ZCY A;  3ZGG A;  2RJ1 A;  1VZU A;  4Y63 A;  1KQA A;  2WLE A;  5FTS A;  3D98 A;  1EZI A;  4KRV A;  1H5S B;  1H5R B;  5FU8 A;  5C36 A;  3QVB A;  4R7P A;  4D11 A;  4KC1 A;  4HO6 A;  1SSM A;  1FG5 N;  2AM4 A;  2QIA A;  1ZJO A;  4N69 A;  4IRQ A;  1KRR A;  1V84 A;  4Y6N A;  2VS3 A;  3VBN A;  3V8Y A;  3FTT A;  4FRM A;  3JUJ A;  3GUE A;  5CQL X;  1VM8 A;  1G2V A;  1H7L A;  1LVW A;  2YQH A;  1FXO A;  5C48 A;  4HO0 A;  3DUV A;  4JD0 A;  3F1C A;  4Y6U A;  3E26 A;  2J0B A;  4D48 A;  4B2X A;  1ON8 A;  3V4E A;  1ZJ2 A;  4E75 A;  3BRK X;  2Y6P A;  1QRF A;  3TDT A;  1OMX A;  1H5S D;  4ASY A;  5AJO A;  1G93 A;  5C47 A;  3OAM A;  5C4D A;  3R8Y A;  2QKX A;  1LZ7 A;  1HV9 A;  1KK5 A;  2D0J A;  2P6W A;  2QH5 A;  4L41 C;  3GQ9 A;  1S4P A;  4EE5 A;  3VBJ A;  4P02 A;  5C8R A;  5FUH A;  5D92 A;  1SSQ A;  5EJZ A;  4MYB A;  3KWC A;  4UEG A;  2WAW A;  2I7B A;  4M9C A;  4FRE A;  2FFU A;  1S80 A;  2IU9 A;  3I0K A;  3TK8 A;  2X5Z A;  1W55 A;  1JV1 A;  4B4B A;  4FRD A;  4ECM A;  5EJ1 A;  1VPA A;  4B4G A;  3I0L A;  1OCX A;  4EA9 A;  3PKP A;  5C1L A;  5DDV A;  2OEG A;  2JCJ A;  3V0L A;  2A8U A;  5FU0 A;  3OTZ A;  3Q4S A;  2V0H A;  4IHG A;  1H5S C;  3TIS A;  1H4C A;  1VH1 A;  1NKH B;  4KT7 A;  1FXJ A;  2TDT A;  1H5T B;  1FGX A;  3ZGF A;  1LL0 A;  3KWD A;  5E3Q A;  4HUS A;  4MYO A;  4FRH A;  3I0C A;  5HS2 A;  5C4C A;  1FO9 A;  2AES A;  1XAT A;  5AFU U;  4J18 A;  5C3D A;  4G3S A;  3SRT A;  2Y4K A;  4KPZ A;  2ZU8 A;  4Y7G A;  2VSH A;  1R80 A;  4O6N A;  2AM5 A;  5DG3 A;  4M99 A;  4EEM A;  3R1W A;  2WLF A;  2AM3 A;  2UX8 A;  4FRL A;  2Y7A A;  3I0J A;  1H4D A;  2RJ4 A;  4EVW A;  5C3A A;  3V0M A;  1ZCU A;  1HM9 A;  1KHR A;  2OI6 A;  2WGZ A;  5C4E A;  1W77 A;  4FRO A;  1ZI1 A;  3V0O A;  3MC4 A;  1QGS A;  2MZB A;  2P2O A;  4MIX A;  1YP4 A;  3ZF8 A;  5E3P A;  1H3M A;  1ZJ1 A;  2I5E A;  1H7Q A;  3R5C A;  5D91 A;  4ARW A;  2FY7 A;  1VZT A;  3I0D A;  3OH2 A;  1MP3 A;  3OKR A;  1VGT A;  1T3D A;  1H5S A;  3SXG A;  3CGX A;  2X60 A;  3CKJ A;  3HSQ A;  1QQ0 A;  4BQH A;  3HJJ A;  3U2T A;  2AH9 A;  3JTJ A;  1KK4 A;  2WVM A;  4J09 A;  1ZJ3 A;  3JUK A;  1MC3 A;  2RJ7 A;  3K8D A;  1KRV A;  1WT3 A;  2VS4 A;  4EEG A;  3P47 A;  5ADX V;  4H7O A;  3OUP A;  3OGZ A;  3T7O A;  2J0A A;  2FKO A;  1QRL A;  3VBI A;  2VFZ A;  2JF2 A;  4ZDQ A;  3R3R A;  1FR8 A;  3T7M A;  4FQW A;  1PZY B;  3CKQ A;  3U2V A;  2VS5 A;  2WLD A;  3GQ7 A;  5F42 A;  1R7T A;  3RMW A;  3TIO A;  1G8O A;  1JVG A;  3SX8 A;  2Q4J A;  3FSC A;  1R7V A;  1I52 A;  4NAK A;  3TQD A;  3I3A A;  1XZ6 A;  3CKO A;  1H5R A;  3N9W A;  2XWL A;  3SXD A;  1G1L A;  4HUR A;  4DDZ A;  1VIC A;  4M98 A;  2IUA A;  5CQP A;  1K4V A;  5FTV A;  1YP2 A;  1WT2 A;  1MP5 A;  2D7I A;  2XWN A;  4P00 A;  3DK5 A;  1ZJ0 A;  1QWJ A;  4FRB A;  3JQY A;  5FYE A;  5EIY A;  3V0Q A;  3I0I X;  3LW6 A;  1OQM B;  3GQA A;  2IC7 A;  5DDT A;  1G9R A;  3EE5 A;  1MRL A;  3V91 A;  3U2X A;  1JV3 A;  1VGZ A;  2I5K A;  1QRG A;  2W0V A;  3EH0 A;  2CU2 A;  2E3D A;  1QRE A;  2ICX A;  1G95 A;  5L6S A;  1H7E A;  3U2W A;  3R5A A;  3E25 A;  4NAI A;  2AQ9 A;  2YCM A;  2ZU7 A;  3KIA A;  4EAA A;  4CJ8 A;  4HO5 A;  1H7G A;  4C2S A;  4EE3 A;  3FOQ A;  1V82 A;  4B3U A;  5DEP A;  4NAL A;  4Y7F A;  2P72 A;  4EQY A;  4HZC A;  1EYR A;  3SXA A;  2RJ9 A;  1ZI4 A;  2RIZ A;  2NPO A; 
#chains in the Genus database with same CATH homology
 1KGQ A;  4ISX A;  3ST8 A;  2AGD A;  4Y7T A;  2P73 A;  1E5K A;  1O7O A;  2YC3 A;  4G3Q A;  1MP4 A;  4KC2 A;  4HO3 A;  3OW5 A;  3SXE A;  3D5N A;  4CVH A;  3CKN A;  4HOC A;  4M4K A;  1R7U A;  5FV9 A;  5CMG X;  4FCE A;  4MFG A;  1VGW A;  3I0F A;  2O1H A;  4HO2 A;  2VSI A;  5L6V A;  1H7F A;  2PA4 A;  1TW1 A;  3V90 A;  1VZX A;  4DEC A;  1ZI3 A;  3DJ4 A;  1TDT A;  3VBP A;  1W57 A;  1HM0 A;  2OI5 A;  2BO4 A;  4M28 A;  1H5T A;  3R3I A;  2ICY A;  1WT0 A;  2V0J A;  3EEV A;  2YQC A;  1V83 A;  1MR9 A;  3K8E A;  5E3R A;  1LZI A;  4YS8 A;  1S4O A;  3BCV A;  1GQ9 A;  2FYB A;  1IIN A;  4K6R A;  1FZW A;  2RIY A;  1ON6 A;  1YRO B;  3PNN A;  2RJ6 A;  5CQM X;  4DCL A;  3R2W A;  4D0Z A;  3TZT A;  2AE7 A;  3VBL A;  1V3W A;  2BO8 A;  4GBP A;  1KK6 A;  1QGQ A;  2XWM A;  1VH3 A;  3F1X A;  2BO7 A;  1ZDF A;  2X5S A;  3O3P A;  4MND A;  4Y62 A;  5AJP A;  2O1G A;  2WE9 A;  1GWV A;  2FYD B;  2WEE A;  4ASJ A;  1NF5 B;  1WVC A;  2QGI A;  5CQN X;  4E1K A;  1O23 B;  4EE4 A;  5IDS A;  2ZU9 A;  1MR7 A;  3IGJ A;  1J2Z A;  1LZJ A;  4EA8 A;  3I0H A;  1ZCV A;  1JYL A;  4Y7U A;  3ZLK A;  1FOA A;  3ECT A;  1KGT A;  3BSS A;  3CJ8 A;  4AYL A;  3EG4 A;  2WLG A;  2IU8 A;  1TZF A;  5I1F A;  3ZLL A;  4N27 A;  4CJB A;  1GQC A;  4B42 A;  5J49 A;  4KQL A;  2X65 A;  5AFU V;  5JQQ A;  1NQI B;  1FRW A;  4FIY A;  2PGV A;  3BSY A;  4HO4 A;  3VBK A;  2JF3 A;  4EA7 A;  1NMM B;  3TWD A;  2BO6 A;  4FIX A;  4KPX A;  4AYJ A;  2PX7 A;  4KXO A;  5C1G A;  3I3X A;  1FWY A;  5ADX U;  1ZI5 A;  3USR A;  3NGW A;  4E6U A;  1WT1 A;  5C1H A;  1LZ0 A;  5AJN A;  1H7T A;  3CU0 A;  1HM8 A;  1FO8 A;  1XHD A;  1G97 A;  2V0L A;  5IFY A;  2YQS A;  2VD4 A;  3GVD A;  1HJJ A;  4Q7C A;  3OTM A;  3FSY A;  1XHB A;  1SST A;  2W0W A;  2WVK A;  2JCL A;  5DEM A;  2Y4L A;  3PKQ A;  1NWG B;  4FRA A;  4XWI A;  3BXY A;  3OH3 A;  1VGU A;  2VHE A;  2OI7 A;  1G23 A;  3USQ A;  3TV0 A;  1G3L A;  1INJ A;  4KNR A;  2VXL A;  3R5D A;  1HJL A;  1ZIZ A;  1R7X A;  3SX5 A;  2WVL A;  3Q7U A;  2YC5 A;  5C4F A;  1THJ A;  1JVD A;  3I0G A;  1V67 A;  4HCQ A;  4BMA A;  2RJ5 A;  1TVY A;  4CJC A;  5C4B A;  4Y7V A;  2Z87 A;  4M2B A;  1H4E A;  4EAB A;  2QIV X;  1GX4 A;  4HZD A;  4G3P A;  1KWS A;  3POL A;  2V0K A;  3Q80 A;  3SX7 A;  3V0P A;  4MZU A;  3VBM A;  2Z86 A;  1FR9 A;  4EEO A;  1R82 A;  3V8Z A;  2WLC A;  4E6T A;  3OH1 A;  2PGY A;  3RSB A;  3OU9 A;  5CMI A;  4NAN A;  1QG8 A;  4FRQ A;  4M2A A;  3U0Y A;  4B4M A;  2XAT A;  3FSX A;  2VXM A;  2FYC B;  2RIX A;  3IXC A;  3OH0 A;  3U2U A;  3GOS A;  2JCK A;  1ZDG A;  3OC9 A;  5BXC A;  3IOI A;  4KNX A;  2A8W A;  3FWW A;  1INI A;  3RMV A;  1OMZ A;  2E8B A;  4DE7 A;  5C38 A;  4AC3 A;  1LL2 A;  1O7Q A;  2FYA A;  4EGG A;  4KC4 A;  2GGQ A;  1LL3 A;  1ZHJ A;  2AEC A;  2YQJ A;  4B2W A;  4LW6 A;  4IRP A;  2O1F A;  1WSZ A;  1JYK A;  1SS9 A;  3D8V A;  4IHH A;  1ZCT A;  2APC A;  3IOH A;  3MQG A;  3IOJ A;  3T57 A;  4FCU A;  4HO9 A;  1PZT A;  3U0X A;  3C8V A;  3R0S A;  4N6A A;  3FSB A;  1S4N A;  4R36 A;  3SXB A;  5C49 A;  5CMF X;  4AA7 A;  3DHO A;  2Y4M A;  1H7H A;  4D11 C;  4B5B A;  1R81 A;  4EEA A;  2JCO A;  1O0R A;  1R7Y A;  1ZJP A;  3KWE A;  3SPT A;  5CMH A;  4FRP A;  4E79 A;  2NXV A;  2V0I A;  1Z90 A;  3MQH A;  3SXC A;  3VNP A;  4R37 A;  3NZ2 A;  3FS8 A;  4Y9X A;  3SX3 A;  2VK9 A;  2FFV A;  4D0T A;  2DPW A;  3V0N A;  2XME A;  2C0N A;  3F1Y A;  3BSW A;  3P1B A;  1LXA A;  4Y64 A;  2RIJ A;  5IDT A;  1YP3 A;  4IHF A;  3T7N A;  1TW5 A;  3R5B A;  3I0E A;  4HO8 A;  3BFP A;  2RIT A;  2D7R A;  4HG6 A;  1NHE B;  1G0R A;  2OEF A;  5C3B A;  5CMJ A;  4JIS A;  4O6M A;  2GGO A;  2RJ8 A;  2Y4J A;  3CKV A;  4G87 A;  3PMO A;  5U2K A;  1IIM A;  1GWW A;  1GA8 A;  1GX0 A;  2YES A;  1KRU A;  1FGG A;  2XMH A;  3Q1X A;  5CQO A;  1QRM A;  4AAW A;  4N6B A;  2RJ0 A;  3HL3 A;  3OH4 A;  4LW3 A;  1ZCY A;  3ZGG A;  2RJ1 A;  1VZU A;  4Y63 A;  1KQA A;  2WLE A;  5FTS A;  3D98 A;  1EZI A;  4KRV A;  1H5S B;  1H5R B;  5FU8 A;  5C36 A;  3QVB A;  4R7P A;  4D11 A;  4KC1 A;  4HO6 A;  1SSM A;  1FG5 N;  2AM4 A;  2QIA A;  1ZJO A;  4N69 A;  4IRQ A;  1KRR A;  1V84 A;  4Y6N A;  2VS3 A;  3VBN A;  3V8Y A;  3FTT A;  4FRM A;  3JUJ A;  3GUE A;  5CQL X;  1VM8 A;  1G2V A;  1H7L A;  1LVW A;  2YQH A;  1FXO A;  5C48 A;  4HO0 A;  3DUV A;  4JD0 A;  3F1C A;  4Y6U A;  3E26 A;  2J0B A;  4D48 A;  4B2X A;  1ON8 A;  3V4E A;  1ZJ2 A;  4E75 A;  3BRK X;  2Y6P A;  1QRF A;  3TDT A;  1OMX A;  1H5S D;  4ASY A;  5AJO A;  1G93 A;  5C47 A;  3OAM A;  5C4D A;  3R8Y A;  2QKX A;  1LZ7 A;  1HV9 A;  1KK5 A;  2D0J A;  2P6W A;  2QH5 A;  4L41 C;  1S4P A;  4EE5 A;  3VBJ A;  4P02 A;  5C8R A;  5FUH A;  5D92 A;  1SSQ A;  5EJZ A;  4MYB A;  3KWC A;  4UEG A;  2WAW A;  2I7B A;  4M9C A;  4FRE A;  2FFU A;  1S80 A;  2IU9 A;  3I0K A;  3TK8 A;  2X5Z A;  1W55 A;  1JV1 A;  4B4B A;  4FRD A;  4ECM A;  5EJ1 A;  1VPA A;  4B4G A;  3I0L A;  1OCX A;  4EA9 A;  3PKP A;  5C1L A;  5DDV A;  2OEG A;  2JCJ A;  3V0L A;  2A8U A;  5FU0 A;  3OTZ A;  3Q4S A;  2V0H A;  4IHG A;  1H5S C;  3TIS A;  1H4C A;  1VH1 A;  1NKH B;  4KT7 A;  1FXJ A;  2TDT A;  1H5T B;  1FGX A;  3ZGF A;  1LL0 A;  3KWD A;  5E3Q A;  4HUS A;  4MYO A;  4FRH A;  3I0C A;  5HS2 A;  5C4C A;  1FO9 A;  2AES A;  1XAT A;  5AFU U;  4J18 A;  5C3D A;  4G3S A;  3SRT A;  2Y4K A;  4KPZ A;  2ZU8 A;  4Y7G A;  2VSH A;  1R80 A;  4O6N A;  2AM5 A;  5DG3 A;  4M99 A;  4EEM A;  3R1W A;  2WLF A;  2AM3 A;  2UX8 A;  4FRL A;  2Y7A A;  3I0J A;  1H4D A;  2RJ4 A;  4EVW A;  5C3A A;  3V0M A;  1ZCU A;  1HM9 A;  1KHR A;  2OI6 A;  2WGZ A;  5C4E A;  1W77 A;  4FRO A;  1ZI1 A;  3V0O A;  3MC4 A;  1QGS A;  2MZB A;  2P2O A;  4MIX A;  1YP4 A;  3ZF8 A;  5E3P A;  1H3M A;  1ZJ1 A;  2I5E A;  1H7Q A;  3R5C A;  5D91 A;  4ARW A;  2FY7 A;  1VZT A;  3I0D A;  3OH2 A;  1MP3 A;  3OKR A;  1VGT A;  1T3D A;  1H5S A;  3SXG A;  3CGX A;  2X60 A;  3CKJ A;  3HSQ A;  1QQ0 A;  4BQH A;  3HJJ A;  3U2T A;  2AH9 A;  3JTJ A;  1KK4 A;  2WVM A;  4J09 A;  1ZJ3 A;  3JUK A;  1MC3 A;  2RJ7 A;  3K8D A;  1KRV A;  1WT3 A;  2VS4 A;  4EEG A;  3P47 A;  5ADX V;  4H7O A;  3OUP A;  3OGZ A;  3T7O A;  2J0A A;  2FKO A;  1QRL A;  3VBI A;  2VFZ A;  2JF2 A;  4ZDQ A;  3R3R A;  1FR8 A;  3T7M A;  4FQW A;  1PZY B;  3CKQ A;  3U2V A;  2VS5 A;  2WLD A;  5F42 A;  1R7T A;  3RMW A;  3TIO A;  1G8O A;  1JVG A;  3SX8 A;  2Q4J A;  3FSC A;  1R7V A;  1I52 A;  4NAK A;  3TQD A;  3I3A A;  1XZ6 A;  3CKO A;  1H5R A;  3N9W A;  2XWL A;  3SXD A;  1G1L A;  4HUR A;  4DDZ A;  1VIC A;  4M98 A;  2IUA A;  5CQP A;  1K4V A;  5FTV A;  1YP2 A;  1WT2 A;  1MP5 A;  2D7I A;  2XWN A;  4P00 A;  3DK5 A;  1ZJ0 A;  1QWJ A;  4FRB A;  3JQY A;  5FYE A;  5EIY A;  3V0Q A;  3I0I X;  3LW6 A;  1OQM B;  2IC7 A;  5DDT A;  1G9R A;  3EE5 A;  1MRL A;  3V91 A;  3U2X A;  1JV3 A;  1VGZ A;  2I5K A;  1QRG A;  2W0V A;  3EH0 A;  2CU2 A;  2E3D A;  1QRE A;  2ICX A;  1G95 A;  5L6S A;  1H7E A;  3U2W A;  3R5A A;  3E25 A;  4NAI A;  2AQ9 A;  2YCM A;  2ZU7 A;  3KIA A;  4EAA A;  4CJ8 A;  4HO5 A;  1H7G A;  4C2S A;  4EE3 A;  3FOQ A;  1V82 A;  4B3U A;  5DEP A;  4NAL A;  4Y7F A;  2P72 A;  4EQY A;  4HZC A;  1EYR A;  3SXA A;  2RJ9 A;  1ZI4 A;  2RIZ A;  2NPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...