2GGPB

Solution structure of the atx1-cu(i)-ccc2a complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
AREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIEDCGFDCEILRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal homeostasis factor ATX1
publication title The Atx1-Ccc2 complex is a metal-mediated protein-protein interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone, metal transport
total genus 14
structure length 72
sequence length 72
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ggpB00
3BGUA 2HQIA 4Y2MA 1RJJA 2QIFA 2EW9A 3CJKB 2K7JA 3HX9A 2BUNA 2XMMA 3T9NA 1Q53A 1OQ6A 2OKQA 3I9ZA 4DL0C 2K1RB 3FGVA 1K0VA 2K7KA 1S6OA 5B0BA 2XMVA 1YJUA 2N4CA 2ROEA 1SB6A 2JDJA 2OP5A 4NL5A 4QOTA 5KAKA 2XMTA 1AFJA 4YEAA 3UDCA 1URRA 1JK9B 4DPOA 1AW0A 2ZDPA 2BJDA 1VQSA 4OIXA 2L3MA 4OJ3A 3MZIA 2BJEA 2LXFA 3F44A 5B0FA 2Q3PA 1TUVA 2IFXA 3HFKA 2GO8A 1YRXA 1S6UA 3VTIA 1TL4A 4A47A 4OJGA 3CJKA 5B09A 2LQ9A 3DCAA 4OJHA 3LO3A 5B0CA 5A6WA 1YJRA 2K1RA 1Q4RA 2ACYA 2VV5A 2PGCA 1GXUA 1TR0A 2GGPA 1N5SA 2LDIA 4HH0A 1V3ZA 4F67A 1IUJA 5F0UA 2HLTA 3MCSA 2OAUA 2GGPB 5T7LB 1Q8LA 1YJTA 2N4DA 3KG0A 3HDSA 2FIUA 3TNVA 1X0PA 4HI1A 3HHLA 4HL9A 3HHLD 5B08A 1FEEA 2KKHA 4Q2LA 2HFNA 4HH1A 1OPZA 1Y3KA 3HHLB 2W4PA 1P8GA 1Y3JA 5F0WA 2RMLA 1Y0HA 1FE4A 2KT2A 5IXUA 1OQ3A 3K7RA 4ZOSA 2AJ1A 4HI2A 1YJVA 2ZDOA 1N5QA 4Y2IA 2LQBA 1ULRA 1XBWA 1MWZA 2OFGX 2PD1A 2ASYA 5B0EA 1X8DA 3WDOA 3DXSX 1YG0A 1APSA 2W4CA 3KKFA 2XMKA 3IWXA 2GCFA 5B0AA 4YDXA 2QLXA 3FRYA 4DN9A 1U7LA 5T7LA 3HF5A 3KNGA 1OSDA 1CC8A 2QYCA 3HHLC 4ZA1A 2HIQA 3BF4A 5B0GA 4A46A 2AW0A 4A4JA 1QUPA 2ROGA 4NPOA 2CRLA 2HLUA 5K9FA 1SI9A 2IYIA 2XMUA 1CPZA 1MWYA 1FE0A 1KVIA 3TRGA 1W2IA 2FHMA 1VQYA 3QGPA 2GFFA 2OFHX 2W4DA 1N5VA 1FVQA 2ROPA 1Y9OA 1FESA 1GXTA 2VH7A 4Q2MA 2AJ0A 2OMOA 1CC7A 4A48A 2K2PA 3QMQA 1N5TA 2RSQA 2AP6A 5B0DA 3BDEA 2BYCA 4EFAC 3BN7A 3IWLA 1JWWA 1TL5A 1P6TA 2GA7A 1LQ9A 1WD6A 2HFOA 2XMJA 3E8OA 1SQEA 2BBEA 2N7YA 3LGNA 2G9OA 3FMBA 4FNIA 2GV1A 2IYGA 3LGMA 1X7VA 2XMWA 2OD6A 1KVJA 3KG1A 2FTRA 3BB5A 1FD8A 1AFIA 3BR8A 1TZ0A 2RU9A 3GZ7A 1KQKA 4OJ1A 1FVSA 2KT3A 5A6PA 1R6YA 1Q8BA 2KYZA 2OD4A 4FNHA 4U9RA 3TOQA 2RILA 2FB0A 3BM7A 2QLWA 4Y2KA
chains in the Genus database with same CATH superfamily
1SC4B 3M6WA 2MZ1A 3FQKA 3RAQA 4DL0C 2IBOA 2FUG9 3HJVA 2AGPA 1HPZA 2XLKA 1IKYA 3IAM9 3C2PA 1S1XA 2OPRA 3P3DA 3CJKA 2FVQA 4I0WA 4TQSA 4NCGB 2PN6A 4KSEB 4NCBA 3FZBA 3MM6B 3TO8A 1TL7B 2RDDA 1D9FA 2PMZD 2CNOB 2VFVA 1C1CB 1PYTA 1YBAA 2AKWB 1U25A 2B51A 2X7IA 3OL8A 2PA8D 4PPDA 1N34J 1FWKA 3C6TA 1OWXA 1HNZJ 5E3PA 3A8KA 2KO1A 4QZVB 6AT1B 3P5TL 5A2QU 4LFAF 3O3LA 1HQUB 5ITHA 1KNZA 2EG2A 3MPYA 4JI1J 3TX8A 1RKIA 3AJDA 1KN6A 3FSYA 2ZZTA 4ECQA 1PBAA 3VAIA 4M63A 1P27B 2JEIA 4ANDA 3OVAA 4HH0A 4OYWA 2DGQA 4J91A 1TVRB 4DPTA 3PRBA 4N77A 1NHKL 3CJTA 2AYEA 2DY1A 1RTJB 3OTCA 2CKWA 5C7PA 3ZZYA 5ETSA 1CJVB 1YTYA 4U6PA 4ED4A 5K9FA 1IBMF 5C25B 1HBOA 2ZNYA 3B4MA 2I1RA 3DLJA 4Q2MA 4I56A 3SCJE 2Y1JA 1WD6A 1J2VA 2Z0GA 1XMQF 1S5ZA 2E5IA 4ZCIA 2WSCC 1M5VC 4ZLNA 4F4XA 4OJ1A 2CPXA 3S8SA 3D67A 3GCXP 4M1KA 2GMLA 4DL6A 2R8GA 1IBLF 2AU0A 3O44A 1IKXB 4ZVTB 5GAHU 3VCDA 2AHOB 2HQCA 1D3WA 4TU7A 1JK9B 2LMIA 1HWIA 1AROP 5KFYA 3ZO7A 3THVA 8RUCA 2WK4A 1HMVA 1N33J 4L72B 5E3AA 1D9DA 5LMNF 3Q0AA 4PWWA 1B3TA 4Y0FA 2IAJB 1RT6A 2DR6A 2GHVC 2ZH1A 4KKOB 2H3EB 5HROB 2IC3B 3DFEA 2V68A 4LT6A 5CQGA 3PO4A 4LSLB 4TY8A 1MU2B 4K59A 3KK2B 5KG4A 2QMXA 2MLXA 4WP8A 5F41A 3LP1B 4ZJOA 1S59A 1ZYQA 5J2PB 4CWBA 4I67A 2VFSA 4OX6A 5H9EJ 1RTDB 3DRRA 3VWSA 1U1NA 4C8OA 2SXLA 1Q5VA 2PMHA 4DR7J 1S1VB 1QVGR 4C8MA 2OD4A 1KVKA 3J7YU 2PEBA 1K9MT 2HGLA 5DGBA 1PCAA 4DR2J 4DS5A 1DLOA 1LWFA 1H74A 1PC5A 2RAQA 2V2QA 4U96A 2IIHA 1X9MA 3CULA 1LEOA 4Q45A 2N4DA 4JV5J 5E41A 4NXMJ 1RCXB 1B70B 3I0RA 4WTYA 1EKSA 2RU3A 2ZWOA 2QL9B 3RR7A 5C24B 3DLEA 5EHHA 4ZK7M 1S1UA 2VG6A 2HFVA 3DHWC 4TQRA 2F8MA 1G1XA 1XR7A 1C0UA 2RKIB 3BREA 1EB0A 3CMAS 2OTJS 4OI4A 5KT6A 4KY3A 3CCVS 1U0SA 1P6TA 2AJ2A 4NEYA 2GVZB 2ZVIA 1URNA 3DHXA 1V9OA 1B64A 3IMQJ 2EBGA 2OO4A 2HVDA 4F0MA 1J5EJ 2RHQB 2VJUA 3HFZB 3M4XA 5EWGA 2HNYB 4X4RA 1HHQA 2PO4A 3ENQA 4EYHB 1U45A 3CDBA 3PM9A 4ZVQB 4L73A 4IOBA 2NS1B 2VA3A 2ZJQQ 1YRTA 4RW9B 1MN7A 3JSMB 2I2YA 4ZHRB 4L6V3 3ILOA 3CUNA 4DUYJ 2HRYA 5A8WA 2MLZA 1FNXH 3ENWA 2KJWA 4YMEA 4J90A 1XIQA 5D3GA 1T02A 4CNZA 2A10A 2VU5A 4URGA 2HAFA 2ZZMA 4R8UB 3T3FA 4KAIA 2OPPB 3DOMA 3IM8A 2IYIA 2UXDJ 2MKYA 5EUHA 1KOHA 4ID8A 2DITA 3PW0A 1B0TA 3G6ES 5B0DA 2M3DA 1JJ2R 3AXMA 1SQEA 3R5CA 3GV7B 2MQNA 4OMFG 2E1MC 3HFVA 1XNQF 4YR3A 2H4WB 2B3TB 2Y1RI 1GAOA 2XMMA 1NAQA 4PG5A 1Z2LA 1VISA 1S4FA 4LFBF 2ADBA 2B56A 4U8YA 4JI3F 3Q89A 4DR6J 4ZPDA 1V6HA 1UEKA 3R1HA 4CLTA 2QA2A 1GXUA 4LIRA 4J9KA 1NLKL 2HQGA 2G0CA 2B4PA 1MROA 3OUYA 2AYGA 1KFSA 1PBUA 1WHVA 3MFHA 3RGIA 2DEJA 1FNMA 1KONA 1RA7A 4A8WA 4F0HA 3Q24A 4OYOA 3DOKB 3I5AA 3JTOA 2XO7A 1RBLA 4YHHF 1WTFA 4IG3A 2YNFA 3D3CJ 3IAS9 4FN5A 1FJCA 3SCIE 2W4DA 1GTHA 4XO0A 1S1TA 3DN9A 4NA3A 3DDKA 3JQKA 1PC4A 4DUZF 4OX7A 1ZPVA 4IG0B 5F8JA 2R7SA 1GX6A 3DI6A 2DNGA 2OEKA 2MSSA 3CF5Q 1VJWA 2YX7A 2GW8A 4ZJQA 4LVOP 5HBMA 2ALZA 3UQSA 3ZZZA 1TUWA 2IM2A 2IM1A 2GAHC 4YY3J 2VASA 2VG7A 2B4OA 3AOBA 3OQ2A 1WEYA 4WFBQ 1U6FA 1NJXA 1NB2A 4X64F 3S1TA 5F0UA 5D77A 1JNZB 3CD5A 3PW7A 3NNCA 1M5KC 5DGAA 3FZ2A 6FDRA 4M8LA 1RE1B 2OLWA 4P10A 2J6TA 1HYSA 1WG1A 1U6BA 3BQ0A 2E1CA 3MEDB 4PQAA 5KT7A 3FDSA 3KK1A 3M2UB 9RUBA 2CA9A 1O0PA 1VHIA 1ZM9A 1KOOA 4OHVA 2CJBA 2BJ3A 1ZA1B 2OD6A 4WE1A 4GC6A 2QYGA 3D54A 1OYDA 1WHYA 4GKKF 2V8DA 2CDQA 2DNLA 2EW9A 3MMAB 2BUNA 2QMWA 1NO8A 1JKHA 4WJBA 4QU6A 4FPRA 4CIOA 3PW2A 1XJWB 1CJUB 3FCWA 3ZXWA 1WOOA 2HQDA 3L9ZA 1QLNA 3JSBA 4EYIB 1X4CA 4ZVGA 1YRXA 1TAUA 1E6VA 1S77D 5D0EA 2LP4A 3NWRA 2BKOA 1BQNA 2VL1A 2OAUA 5HANA 2HZCA 4PPZA 4TYBA 4CLYA 4GVBB 2XYGB 4LRBA 1U0HA 4BWMA 5BXIA 1VQOS 2MMYA 1LW0A 4DG1B 5ETRA 2XCAA 3NP5A 1FE0A 1NDPA 4USVA 4JI7F 1XMOF 4Q8FA 4ZKAA 5AXMA 2FGCA 2I5JB 4AQYF 1CLFA 1U09A 3AD7C 1TKZB 2KU7A 1R8HA 2G0IA 4OI3A 2GJIA 3EZ5A 3H5YA 4RNMA 5KG2A 3CDAA 1LFPA 1VQ5S 1UEUA 4F36A 4M5HA 3ILIA 3MPWA 2UP1A 2BJDA 2V8HA 4USTA 5KFTA 3FBCA 3QT5A 3BH6B 5AE1A 5E3RA 2MZQA 4PWDA 5GMDA 5D6GA 4NLRA 3ISND 2W1BA 2DPIA 2PC6A 2VFUA 4J9PA 1TKTB 1S79A 5ETNA 2ZVSA 1CULA 4WKYA 3V6DB 3IBFB 2E5JA 2Q6CA 5IT9U 3KLIA 3BKUA 3F0NA 2KRBA 2CQCA 5KFNA 3IWLA 3M1VB 4H54A 3Q22A 3ZZUA 1RSCA 3LGMA 5D4PA 2FC9A 4K5RA 1RT2B 1YJWS 1KQFB 1BE4A 3TYTA 3V81A 2QFIA 2NZCA 3H2UB 2MQOA 4HACA 3T5HA 1YHQS 2HVEA 1RTHA 4B3OA 2IVYA 4PUOB 2WBMA 3PEJA 4C0HA 3KHHA 4RW6B 2L9NA 1DARA 5KFKA 1HBNB 4WTOB 5D0RA 2IA0A 3JSRA 1WI6A 2V2VA 2BJ1A 3CCSS 4X4NA 2DRBA 4TN2A 3H4BA 3TI0A 4IOAQ 2IHR1 3HHKA 2FD2A 5DQHA 2R8IA 3KNGA 5KT4A 4CT8A 2QYCA 4JI6J 2FZCB 2ZH8A 2PFDA 1X4FA 4DL2A 1SJ4P 1H6KX 4M95A 2XHWA 4YQWA 4GKJJ 3N6MA 4ZS6A 4MJKA 5C42B 5F8MA 2X1FA 3C16A 3HULA 3PG9A 1U48A 3N79A 2AMCB 2LU2A 2LQ5A 3CC7S 1NNDA 3N01A 1UJ4A 5CZXA 3T9NA 2ZHAA 1PKUA 4ZPWR 1NDLA 1DTTA 1T9WA 2LQ8A 2BJ8A 1T9YA 4MIBA 4NLYA 4FF4A 3GE9A 2VQEF 2I8EA 3QIPB 3BJYA 2A18A 4KPYA 4P2MA 4Y2AA 4N5SA 1ZAXA 2N3OA 2C2EA 4RUHA 3M6UA 3KK3B 4JBCA 3H2VE 1JJCB 2GIQA 4J9RA 4QYRA 4AE5A 2H5IB 3EM1A 2R2RA 2YQ1A 1F9HA 3P45B 3ISNC 2YKNB 2QLXA 4DU7A 4WF9Q 1ZA2B 2NQPA 2BOPA 1RT3A 4QWEA 1HNVA 5HLFB 2ZC3A 2X1BA 3H98A 4O44B 3E01B 3R5GA 2ZE2A 5E3CA 4DFMA 1FK9A 3I31A 3PHTA 2ZHOA 3IRXA 3PFEA 2C2OB 3W64A 3AOAA 4EU0A 3UVJB 5IC6B 2V8GA 1WI8A 2NCKL 2OKQA 2R7RA 2B6AA 1S0MA 4FF2A 2QRRA 1X5OA 2ZEJA 3JYTA 1IWGA 3E51A 1RWMB 3I6PA 4C7QA 2VFTA 2LDYA 1I94J 5L38A 2FLOA 1VLOA 4F25A 2H48B 3G8TA 3ILLA 5HK4A 4K7QA 1DY3A 3MECB 1V3ZA 3G82A 2PFFB 2D9PA 3R2CJ 3ZZ0A 4OHZA 3RBEA 4HL9A 4URSA 5A0YB 4QIWD 3IR7B 2B4VA 1KQGB 2DNQA 4U7UD 1WF0A 3PW5A 2PD1A 1TQLA 5KFMA 3GFYA 4OI0A 3JTPA 3QGIA 4N8NA 2QG9B 2V6AA 2HG4A 4FYYB 3IR5B 2FZKB 3P49B 2A1BA 1TL3A 3H90A 5JJBA 2VC0A 2FHJA 1T95A 2P5VA 1GXTA 2P9EA 2FLNA 1NMEB 4ECZA 1TMJA 1GXLA 1IKWA 1FKOB 2C42A 1U1MA 2VQFF 4NLWA 1SL1A 3SCKE 2VBWA 2BA9A 3MI7X 5DLGA 2K7JA 4DS4A 2XY7A 4C98A 4LSNA 3POTA 4O3NA 2HRTA 5B0BA 3TQEA 4LF4F 1Z2ZA 5BYQA 4RU2A 3BPDA 3OV7A 1BQMB 3MM8B 1S4EA 4C3KA 2Q1LA 4RJVA 5BYSA 4OYBA 2H54B 3MPDA 2XS2A 5FIIA 4DX6A 3HMJG 4WP3A 4Q0BB 4BLGA 1WKLA 2DGOA 3MD3A 3MMBB 4JI2F 3AXKA 3QRRA 4ALZA 4IRCA 4J9OA 1S1WA 1Y3JA 3S6EA 1BHNA 3VVTA 3AB4B 3OL6A 1L3TA 4F02A 4DV1F 4ZA1A 1UJ6A 3L7UA 2IVMA 3W8PA 3HVTB 3VAMA 5HQLA 4ES1A 4GC7A 1YK9A 4WKRA 4ENOA 3H20A 3OHBA 5BR8J 2UUCF 3DOLB 3JB9k 3WX4A 4QU7A 2KT3A 2V4RA 4Z7CA 1W2BR 3BBBA 4I69A 3SEOA 4L75A 2IRXA 4CO2A 4KHPJ 4X4PA 3BGRA 3TA0A 1HBUB 3JAMU 2A2DA 4MK7A 4OX9F 2HMIA 5KTQA 1FDBA 2F4VF 3Q8SB 4A8FA 1VDHA 4TY9A 5KFRA 3MPVA 1HD0A 1UFKA 5J2QA 3OR1A 2IRYA 2WVEA 1KC8T 3M2VA 1VRTA 2Q43A 2MGZB 4BDPA 2LKZA 2FJEB 2C2NA 2RQ4A 1SI9A 4QR2A 4ZDNA 4NWBA 1U26A 3UD3P 5K8MA 4ZVPB 1VFJA 4PWUA 2QV6A 2KXNB 3BGLA 2GV1A 4KR0B 3QSYB 1CS4A 4LR7A 1WF1A 3K5PA 4V19J 2D3O1 2YPYA 2K1RB 3FGVA 3PV8A 5LSRA 3EMTA 1QAIA 5H1SV 1S7IA 3PVXA 1Q78A 3DGPA 5LXRA 3KDNA 2LA4A 1RI7A 3NGSA 3TA2A 2E1PA 2KFYA 3MM7B 4UOFA 3CCQS 4YS2A 2JL9A 2E9TA 2J0QD 4HHUA 5E3QA 3GTYX 2ZFHA 5E0OA 1MWZA 1H98A 2U2FA 1RAOA 1AZSB 1Q95G 2M88A 4MYUA 5DM7Q 3D6MB 4FKXA 2D74B 1XTZA 2WW8A 5D8HB 4K4ZA 3KNAA 4RL1A 2BE2A 1PO6A 5F9NA 4R0EA 2AZ1A 4QWAA 4NEZA 4DQPA 3MMJA 3Q83A 3G8SA 4DR5F 5HVHA 4DOZA 3G6YA 4B3SJ 1F2GA 3L7OA 4X62F 4ECRA 3L4BC 2RNEA 3DLLQ 3MUTP 3J81U 1N0VC 2LXFA 2DR5A 1JLGA 5CABA 1SKWA 2AQ4A 1I5OB 3WX8A 1M90T 2D1CA 2XY5A 3KLVA 3LUYA 3B78A 1TK0A 2RQKA 2JFDA 2YNIB 1FRXA 2ZOFA 3KJVA 4USKA 4NLUA 1FWLA 3CJ0A 2RQMA 5F9LA 4JV0A 5IT9Y 4ECXA 4A46A 2NYHA 2M7SA 2PA3A 4MFBA 4EGLA 2YKMB 2EK1A 4M5DA 3TEHB 3AOCA 3GYGA 3FK4A 2RSQA 3ZZOA 3NXZA 3BN7A 2FZGB 4UF4A 4CO1A 2YWEA 5JMNA 2VBZA 4MTPA 4LF7J 2R2TA 4NLOA 3NRBA 1NSQA 1WF2A 4FPIA 1B99A 3CMQA 4NMLA 5KAKA 1XERA 4UUWA 2VHGA 3FEZA 1IM4A 4ERDA 2C2MB 4F0KA 3MGJA 2UXCJ 4K4SA 3PJ9A 3ENAA 3OFEA 1HMVB 2XTJP 2CQBA 3MCNA 1WOPA 1QAYA 3DM2A 3W5XA 3LA0A 2DH9A 2LU1A 4DL5A 1YLXA 2CQ0A 1S48A 1RT6B 2YQ0A 1K47A 3HD1A 4XPEA 3RAMA 2DPJA 4QIEA 2DNHA 1E6YB 2W2NP 4FKYA 1FWPA 4MT1A 2KB2A 1NPKA 1LWXA 3PTWA 3BO2A 2BRKA 3KFWX 4Q7AA 2WAQD 5J1EA 3H42A 3T9ZA 2KZMA 1OSCA 1H2UX 2JC1A 3QO9B 4DR3F 2NYIA 4P9SA 3I4HX 4EFAC 2E9ZA 1FKPB 3G9CA 5IV3A 3DRRB 3M9NB 3KMSA 3GIKA 2L08A 1S9GB 3SFGA 2QLBB 3W2WA 1SJQA 4EBDA 2DGTA 1TKXA 3QJPA 1RHRB 4JI4F 4CI0B 3OW2R 2RDIA 3PYFA 4AYBD 1URRA 3G96A 3HO1A 1VQSA 7FD1A 3GV5B 2F5GA 5CA5A 2V8VA 2EVZA 2OUGA 1KHWA 2J9EA 4URQU 2BE7D 1HBMA 1DLOB 3K89A 1VIXA 4AUKA 4NLDA 1ZAWA 5G0RA 3J7ZT 4Q43A 4DU8A 1GK8A 3HZGA 4ZP6A 3UCUP 2HURA 4EK2A 2CPDA 4OYXA 2ZH2A 5ETQA 3DKDA 4DFPA 3EGWB 5DO2A 1UZHA 3UD4P 5KFHA 5AJ3J 4W90B 3DRPA 1JLAA 3LW5C 3LWLA 1N52B 1T05A 1NH8A 3DLEB 5J2MB 1SBRA 3H5SA 2VG6B 3GR0A 4ZLPA 3MDFA 5KFQA 5CYJA 1C0UB 1FRHA 1U6ZA 5M2RA 5J2NA 1S9FA 3BPSP 4N7TA 1VOMA 1JIHA 4OZLA 1FCAA 1WOSA 4DFKA 2BM1A 4RKUC 4KFBA 3T6BA 1UA1A 3PX0A 2K06A 3BO4A 5CYQB 2CQ3A 2I38A 2FJVA 3I0SB 4ZVHA 4OZNA 4ANEA 2I6WA 2FJAB 4I2QB 2V67A 4O3PA 5FJ4A 1C0TA 1TL4A 5HMZA 3D3BJ 4ZJLA 4OJGA 4MKVA 5B09A 3ZZRA 2EPIA 1KP6A 1X31C 2DKOB 2H9ZA 2XMAA 2BXJA 3I96A 3QNWB 4I6WA 1FEEA 5A8WB 3OTBA 4H4MB 3W7BA 3FKBA 1X5PA 2KT2A 2DEIA 3ADAC 1N36F 5ETMA 5RUBA 2VG5A 4DR4F 3HCXA 2JEGA 4X65F 4YDXA 3FRYA 1SJ3P 4PXDA 2APOA 1U1RA 5CXTA 1EP4B 4LRDA 3VAFA 4USMA 1K1SA 2V69A 2ROPA 4F2RA 3UFCX 1RYSA 2BYCA 3N9UC 5H9FJ 4C6AA 2EC0A 2FTRA 3FNNA 4OYAA 2RF2B 4FBUA 4UUXA 1R31A 5H9EK 1H7XA 4G6VB 4I4BA 2M5YA 2V50A 3QYYA 2ZD1A 1Y00A 3NOGA 5LMUJ 1BXNA 1S9EA 4USHA 3SYZA 2IJFA 3H7HB 3FUYA 4XPCA 1PYSB 1MROB 2IDLA 2OSQA 4BCAA 5F0WA 1OQ3A 4F04B 4PZVA 2LQBA 4P71A 5E2QA 2F7VA 4L74A 1M5OC 5E33A 1HWLA 2ATLA 4DJBA 1FX2A 4P2FA 2WOMB 1SQFA 4KGZB 2YNFB 1ZS6A 2BM0A 1Y7PA 2BJ9A 2IM0A 1UPPA 1RISA 1N48A 3QMQA 4DL3A 5FDLB 1BD6A 1MNEA 1HNWJ 4X66F 1NCLA 2EFPA 3W5YA 3I32A 1NSKL 1YJ7A 1RLDA 3GSIA 3T19A 1CJTA 2RILA 5EX3A 3PXGa 3HX9A 3OVBA 3KOAA 2HGMA 3BKFA 5IWAF 4OZ2A 3JAMY 4B9LA 3RW7A 4RW8B 1D8ZA 3HT3A 2VZ9A 3TWZA 1Q0NA 1OYEA 1JLFA 4DX7A 3C14B 2VG7B 2UU9F 5B0CA 4ANCA 2MQPA 1RYRA 5KFEA 3E3XA 5DZ7A 2OPSA 3AB2B 4DSJA 5T7LB 1EQ0A 1EX8A 1UW9A 1GX5A 4KQZA 3A8JA 2JWNA 2WVBA 2Z2ZA 2XI3A 3HHNB 1KKHA 2YTCA 2RT3A 4DEZA 3X3UA 1UWBB 3FEXB 3N6NA 1NK5A 4ECVA 3V6HA 2DNKA 1R0CB 3CJSA 4A8MP 4DN0A 1LXNA 5T14A 3QGPA 4AD6A 2VH7A 2CNKB 1DTQB 1SH0A 3LP0B 5DQGA 2CQIA 4HT7A 3G71S 2UZAA 2YWKA 1K73T 1H2VZ 4IFVA 2L9DA 3KDOA 4WCEQ 2OI2A 3M32A 1WEZA 4WE1B 2FB0A 2R8HA 4KYZA 1NRKA 3R7NB 2WCXA 3DU5A 1NK4A 1WEXA 2UUAJ 3CD7A 3MEEB 1FI4A 4CLZA 4NA2A 1Q7LB 2Z8QA 1EZZB 3TVKA 4PQUA 5B0FA 2IBKA 2XSJB 3VTIA 1R8PA 4A8OA 1VHFA 3CSKA 2JFKA 2QC3A 2EG1A 2CWXA 4F4YA 3OBIA 1WACA 4B3TF 1HHSA 2Z2LA 5JXSA 5FD1A 2W9CA 5K8NA 3X1LB 2HNZA 2R7UA 2HVIA 2YKOA 3JQMA 1LW0B 1Q8KA 2V9KA 3F41A 4L3KA 4Q5VA 4NLXA 2AJFE 2XB2D 2J6UA 4NPOA 2CRLA 5K8PA 3F73A 4B9UA 3J7A1 1Q1KA 1KVIA 2CXEA 4K0KF 4HKQA 2K3IA 3FBFA 4N8OA 1HQ2A 1CJKA 5IM0A 3CIZA 1QTMA 4OX8A 2EEYA 3NBPA 3R5DA 3LH2S 1VQ8S 1X7VA 1JXLA 4ZIVA 3BKTA 4P52A 2KM8B 3CCRS 2UUBJ 4U95A 1RJJA 5HP1A 5J1PA 2VD3A 4IYQA 2OP5A 2UXBF 2M2BA 4RUAA 4E0DA 3MZIA 1U8SA 4IH5A 1C1BB 2YX4A 1G2EA 2LQJA 1QVFR 3THTA 4J9QA 3PKYA 4F7VA 2DHHA 2WTFA 1FNOA 2BVZA 3RG6A 3W5ZA 1AYEA 1WJ9A 2PDAA 3ET6B 2KVQE 5LJ5Y 3GMGA 2W4PA 2W8LA 5IV4A 5IZHA 4N41A 2AJ1A 3T5KA 1CULB 2R42A 2E7WA 3BH7B 3KTQA 1IR1A 2WONB 4KHMA 4TLRA 1N8RT 1JLQA 4CO5A 2Q79A 2G4BA 1YIJS 2C3PA 2V63A 3GG1A 3RRKA 1MWYA 3FQLA 2DH8A 2E9RX 3WQPA 4CM2A 3H25A 4LIWA 4LBHA 5EDWA 1PAEX 3TJ8A 4UY85 2LEPA 1GTEA 2AP6A 1T03B 1VI7A 3L09A 2R2UA 1DHMA 2G9OA 2XULA 3U1MA 1WELA 2IJRA 4ZP8A 1UVJA 2H4YB 2YXLA 3BR8A 1WTBA 1MWQA 1SVDA 3I55S 2DR7A 4GVLA 3TW0A 2YNHA 1NJZA 4C8ZA 3OXGA 2AYMA 4HACB 2HHPA 2BACA 1N32F 5LXYA 2HBQB 4JI8F 4QIFA 1IQZA 4CYUB 3HJFA 3W9IA 2EFGA 4BHQA 1NKEA 3QGHA 2DJWA 5AE2A 1O5JA 2J7UA 4RZRA 3JQJA 5LSLA 4ZVUB 4DV0F 4RNHA 4RWXA 4ED3A 4LFCF 3I87A 1VR6A 1X8DA 2GQCA 3D0IE 3ULHA 4DV7J 1RT7B 3CJ8A 2XEXA 4NCGA 1RBOB 1ZETA 2AIRB 3V6KA 1TL7A 2KVIA 1NUEA 4JYAJ 3TVZA 4J7CA 1C1CA 2MLYA 2Y1IA 4X4QA 2DNZA 1KVJA 2HS4A 3CGIA 3C16B 3GFZA 2DNMA 5A6PA 2XS7A 1LK7A 4U9RA 1EJ7L 2DXDA 1R6VA 2XLJA 1WWHA 2UVVA 2DIUA 4J9MA 1SCJB 2ACMA 1BMQB 5D0HA 1WDTA 2YNGB 2DR9A 3Q86A 1K8AT 1UZDA 3SMZA 4A47A 2M8DB 2H65B 1A7GE 4DPUA 3DGVA 5CD4A 1HQUA 4FYXB 1HNZF 2O5DA 3N6LA 4O0NA 2D41A 3NS7B 4ZVEA 5KG3A 3PCOB 4LRFA 3ZNJ1 1QE1B 2ZKTA 4F4WA 1SPBP 4LF9J 4UY8T 1S10A 2R4FA 2R8KA 2AD9A 3BF4A 1TVRA 1U02A 2PE8A 1U2CA 1WC5A 1HNVB 2RH3A 2VPZB 2AZ3A 1QAXA 3TP2A 3W1YC 3PNIA 2POKA 1S0VA 3MTJA 4YB6A 4NE9C 3SFUA 5C25A 3A3OB 3AFGA 3BO3A 5LJ3Y 2QLWA 3MUVP 3BGOP 1NKCA 3THPA 4NI2B 3R1LA 1IQTA 5IT0A 1FA0A 3I82A 2JDJA 4ZN3A 4OLOA 1H2TZ 2V4QA 2YKPA 4F3QA 1PAUB 2RIJA 4NRUA 5K14A 4ZVSB 1NHVA 5C5JA 3HLUA 4CO3A 2F63A 3US5A 3FRZA 1QSLA 1IKXA 2CPIA 4OQJA 1LW2B 2KKHA 1J5OB 5CCLA 1L3UA 4JP8A 1SV5B 1YG0A 1GMWD 5KFDA 2MDAA 2IAJA 3RB3A 3UO0A 2V2ZA 1OSDA 1TV6B 4KKOA 1I1GA 5HROA 2IC3A 1YBUA 3MMCB 3M6XA 1HNIB 5KFGA 4J9VA 3K0JA 4LSLA 2OFHX 1MU2A 1SJFA 2G2OA 3KK2A 3D1HA 1N33F 4LF4J 3IG1B 4C8LA 5HN0A 1TL5A 3LP1A 3DLKB 5CYMB 4Y2CA 3V4IA 4NX9A 1OPIA 2XYPB 3CMES 5J2PA 4B9NA 1R6YA 2YQ3A 2QA4S 2X51A 1RTIB 1QUVA 1RTDA 2MKSA 5GMEA 5IQQA 1K0VA 1O51A 5KG0A 5KFFA 4IO9Q 3POTB 4QIGA 2E7XA 4N47A 3CO0P 1S1VA 2V9WA 2YKQA 2FVCA 2MYFA 2N3LA 3ZC4A 4DUTA 2ZC4A 4WFAQ 4V19X 3M8WA 1Q4RA 1U8WA 3U7JA 1PJ6A 4DV1J 4RLEA 2HK2A 4DCOB 4MK8A 4FYWB 5KFOA 4DR7F 3M8YA 1MMLA 3GJQB 2AEFA 4K8RA 2GCFA 2XGPA 3NEKA 2BV3A 4QIVA 2UUCJ 3Q8VA 4USUA 2OEJA 4A4JA 3V2UC 4DR2F 2XS5A 1EETB 1D9AA 2N7CA 3NGUA 3T1AA 3HP6A 3W60A 4KO0B 2L41A 2OMOA 3IM9A 1VBZA 5KFIA 2KZZA 3B8HA 4OX9J 2RKIA 3SQGB 3M9OB 1R0AB 3RAXA 1UFLA 1KQKA 4JV5F 2F4VJ 4NXMF 5KFLA 3T6JA 5JVHQ 3KLHA 1SC3B 2Y0BB 2BANB 1KEKA 4NL5A 2GVZA 2HHXA 1PYOB 3CJRA 3G6VA 5G4DA 4CNYA 2V4JB 5L9NA 2HWTA 3NGRA 3CB4A 2CZ4A 4YN3B 1X4EA 2AF6A 2HNYA 4LF6F 3SV3A 3TJ9A 1WG5A 3S7RA 1N0UA 2FHJD 1Y3KA 3OR2A 3SSQA 1U1QA 3HT0A 2CJQA 3EGVA 1VRTB 4CLPA 4RW9A 3DXSX 3PY8A 1B0VA 2Z2MA 4ZHRA 3M2RA 4UQTA 2Y8WA 4G3IA 2E44A 3HHEA 4K50A 3M7VA 1J5EF 4PXBA 1DQ9A 1JLCA 3IBWA 5ETOA 3K59A 1JNRB 1SC1B 4WFNQ 2BR0A 5EN1A 3M8QB 2G0JA 3LPYA 1R0BG 4ID5B 1D0EA 1D1UA 3SIPB 4R8UA 2J7KA 2OPPA 2UUTA 1HA1A 1XNRF 4DUYF 1YGYA 4CLUA 1S7HA 3O2IA 4ED2A 2Z58B 8ATCB 4PG7A 4DR1F 5D78A 3LAKA 3M30B 3GJSB 4QOTA 3EYZA 3MCMA 3K58A 1XN9A 1AW0A 2MZSA 3UE2A 2UXDF 3QT8A 5HMWA 2WW4A 1VIOA 3HVAA 3D68A 3CCJS 1VS3A 4C8NA 1I3OB 4B9TA 4IO1A 3EPGA 2R7OA 5HAOA 2JH3A 5HVFA 2OFGX 2HS0A 2ZHBA 4P2XA 1VQ7S 3TUPA 1NK7A 2AW0A 2F9DA 2MKCA 4YOEA 4CRJA 2FLLA 2IMWP 1FFSB 3UNYA 1NZ8A 4DR6F 3MR7A 3C3LA 3MOJB 5CCMA 4G1PA 2XSFA 3PYGA 2BE2B 2D9OA 3T1HJ 1O8BA 1F2HA 3PX4A 3BB5A 3QFWA 3OFHA 4Z7YA 3KLEB 3N4WA 3DC2A 1X9SA 1NJWA 3EVOA 3ETMA 3SQOP 2F65A 4DV4J 2XMVA 4CO4A 1KTQA 1AB8A 2J8AA 3NKYA 1IVZA 3LGHA 1S0NA 3DXBA 2ZH4A 2E5GA 4TVAB 1JLGB 2GVDB 5A6WA 1R27B 4C8YA 4UZCA 3HSGA 1UVLA 2RVJA 2G1DA 4R0JA 3TNVA 1RT1A 1NJYA 1IBKF 1UVIA 2E29A 4ILRA 2OIHA 2DR8A 1NDKA 5THWA 1KBRA 3CIMA 4M5NA 8AT1B 5F3ZA 4LSZB 2VFRA 4UTGA 3P6YC 3HVRA 4A8QA 3K5LA 4YY3F 4PR6A 2GFFA 2J0SD 4M5DB 4HR2A 4B3MJ 3IA0A 4OYPA 2GAGC 3GQCA 3WIVA 1NSPA 4NLPA 5L1KA 2CZ9A 1MMNA 3ITHB 3EDQB 5L9XA 4QYZJ 3K5MA 4LF5J 3MEDA 2YBVA 2CJKA 1REVA 1FKAF 2F1FA 4UT4A 1LKZA 4ELTA 2EC2A 3M2UA 1ZTTA 1WNEA 3MM5B 1K1QA 5L8RC 4Y00A 4ZVRB 1CBKA 2DGVA 3BR9A 2HQFA 3Q8RB 1CJUA 1P9YA 3RUBL 5C2GA 1TP7A 1BWVA 1F60B 3NL0A 5ETVA 5B08A 2FJWA 1TU0B 1FJEB 4FDFA 3K17A 4DL7A 4CLKA 4CH0S 1BUXA 2VJVA 3SSRA 5GAEI 4WZQA 1APSA 2Y0SD 4L76A 1U7LA 1F9EB 2VBYA 4HHHA 3DRXA 5B0GA 4GVBA 4CCHA 2MEWA 1U1PA 3QPIA 4DBQA 1X0FA 4LBPA 4U7UK 1OIAA 1IXKA 4ZCKA 2QGFB 2NXEA 4JI4J 2NXUA 3CCMS 3GB0A 4LUBA 4DQRA 4KB7A 1F1BB 1VRQC 3M9MB 2I5JA 2VPYB 2VICA 1NEEA 3VZHA 3AA9A 1TKZA 2ILZA 1VQNS 3OFFA 1SIZA 2L48A 1RT4B 5HVGA 1RQ0A 4JOUA 4GO7X 1TUVA 2P6SA 1FX4A 3OPKA 2Z2YB 4TU9A 1UETA 3MAAA 2BKNA 1H7WA 1HBMB 2F8HA 5KFPA 3HKWA 2M52A 2MQMA 4ED1A 2JLGA 5FLXU 3O1LA 4MIAA 1V3SA 4QWBA 3FFIB 3ZTPA 4PCQA 1XWLA 3TR5A 3CCTA 1TKTA 4A8YA 4MMOA 1GH8A 1SUQB 1R7IA 2CZVC 5HSPA 1CVJA 3V6DA 9ATCB 1S97A 3GP9A 3BDEA 1NKBA 1X9WA 3PDNA 2ZBIA 4ED5A 3ZTQA 3QLHB 4DV2J 1Q8BA 2IVFB 3QBCA 1S99A 3W66A 3MR5A 2QIFA 3EICA 4KV8B 3M1VA 4C0OC 4EWTA 2R2SA 4X4SA 2RRNA 2QA1A 3OTOF 2J9CA 4G1QA 1HKAA 3F44A 2UVUA 2P9CA 1M1KT 1XK8A 1RT2A 4WXOA 1NH7A 3GILA 3K2YA 2RUGA 4KGKA 2X3DA 3CO9A 3IFEA 4OZ3A 5DZ6A 1IUJA 2HNDB 3HSJA 4IR9A 1RWUA 1QM9A 2GQ2A 4RW6A 4OZJA 3GIIA 2BE9B 2XYHB 1HBNA 1N6QB 4OHWA 1N5YB 1REGX 1FRJA 1S6QB 2MXYA 3VAHA 3RB0A 3C15B 4IDKB 1R43A 3R9LA 5MLCV 2FHMA 2MB0B 2IJNA 1TK8A 1N5VA 2GHWA 1NU4A 2P6TA 3D0HE 3KXDA 1EKRA 3M8ZA 4FVCA 1VRUA 2H51B 2CNLB 1TL1B 3GIRA 1RWVB 3C66A 2HHWA 4LF8J 1VYAA 4YP3A 2LFVA 3J80U 2FGOA 2VC1A 2R8JA 3NOCA 1HIYA 3EUNA 3CEDA 1RAFB 5C42A 1JLBA 2HVZA 5A8KB 1SB6A 4ECYA 4A8XA 1PJ7A 2B5JB 1JJHA 3IRWP 4JI6F 2QT7A 3SBMA 1TMMA 2ZD1B 3Q2TC 4QR0A 4DPWA 2J5AA 4GKJF 3G6XA 2CVIA 3EDRB 4DI6A 1PSDA 2BKPA 3QIPA 4ECWA 4ZPTR 4HH1A 3D1QA 4LREA 5T41A 1NM2A 2CJXB 2C2KB 3KK3A 4LR8A 4O3RA 2YX1A 3D28A 4LMZA 4X66J 2HIQA 4IH6A 1L3KA 1HL6A 3LQVA 1FDDA 4FP9A 4ICLB 4O4GB 1RP5A 4DF4A 4P72A 4A48A 2K2PA 2YKNA 1MW7A 2RJZA 1S0OA 4K4XA 3W9HA 5ETKA 5HLFA 1RHKB 2B7CB 4WWSA 1FD8A 2DCUB 3E01A 3G8QA 2E66A 3BM7A 2B9EA 3CCWA 3KLFB 3SDEB 2KXFA 4ZVFA 3LF0A 3UVJA 1GQEA 2IFXA 3UW1A 1RWPB 1JLFB 3OT9A 4OV6A 4WU3A 2Z57B 2BX6A 2ACYA 2ZH9A 1T9UA 5KG7A 5C2CA 4RUCA 2ASDA 3NCRA 2OPSB 3HHLD 3EPIA 2XNQA 2CVEA 4IFYB 1KRPA 1LXJA 2COLA 3WIUA 4OZ1A 1TELA 3MECA 1K0TA 4RUBA 2W2MP 4CTAB 1F3FA 1U1KA 5IC4B 2CQGA 4G1IA 5DG8A 3LWMA 1UAWA 2GZOA 2WZ1A 3VF0B 4B17A 3RBXA 3AJ2A 5A2QY 1I94F 3Q8YA 3CT9A 2DXEA 3UD5A 5U47A 1U2RA 5KFUA 5HJXA 2IMOA 3KYLA 2C1EB 2DGSA 4TNOA 4R5PB 3MURP 3KHGA 2HBZB 2RU9A 3SV4A 1DQAA 3RRHA 4DX8H 4O3SA 1HR0F 4TXSA 2BMBA 3JTNA 1R8BA 1ELOA 5K5MA 2X3GA 4Y65A 5KFXA 4RNFA 2HVHA 5H9FK 1T9TA 4LRCA 1AFJA 1F9FA 4YEAA 2X1AA 5MAOA 2VKZG 1FJGJ 3EGNA 5DQIA 1LOUA 1A0OB 2AV5A 3GCWP 4RNNA 2CPYA 3VGSA 3C46A 2RDJA 2XM3A 3DLGB 3CDEA 1BQMA 3JS9A 2JNJA 4OYMA 1RUSA 1UJ5A 3I9V9 4FZVA 3Q8QB 1D8YA 5IQ6A 2HNZB 1NK0A 4B3RJ 4Q0BA 1GMUA 4HTIA 4M5KA 1HW8A 2ZJPQ 3MMBA 4ER8A 3MWBA 4HYKA 2EFNA 4AL7A 3ONQA 1CPZA 3GG0A 4NMXA 1VQPS 2DY9A 5ETTA 4DV5J 4NOHA 3R5BA 3LAMA 3TAMB 2KI2A 5E5NA 2R9LA 1JWWA 2GA7A 1VJQA 3QGGA 3NBPB 4PG6A 3IP0A 3TZZA 3D6TB 1HQEB 2W2OP 3DRSB 3VQTA 2DT9A 2HHHF 1FHTA 2DIVA 1RABB 3FCVA 6FD1A 4K4WA 2OHDA 2ZBCA 2K7KA 2XG8A 1YJUA 4HVZA 3DOLA 4O4RA 1HNXJ 3BYRA 5HMXA 4OIXA 1FXDA 2NR0A 2AGQA 3FBEA 2HPUA 4EZ9A 2D3ZA 2VBXA 4A8SA 5HMYA 1FF2A 1HBUA 3PIOQ 2E5HA 3L95X 1DZ5A 2J76E 2ASJA 5BR8F 5EWFA 1RLCL 2V94A 3GJRB 1M5PC 3AJ1A 1GMWA 3W2VB 4DSFA 3HHLC 2JJ4D 4I7FB 3W8GA 4FBTA 1FFWB 2B4UA 3O5TB 2D69A 4ED7A 2FVPA 1VGYA 5E7OB 2EFOA 2W7AA 1L3VA 4S0MA 2F4FA 5GMKa 1QDUB 4Y3CA 2KFNA 3GFXA 2JZ5A 3CWJA 1R89A 1H73A 1B7FA 4KH0B 2RS2A 1KDNA 2FLPA 1IKVA 1QSYA 2ZBRA 2DHXA 5KFSA 2KL8A 1TK5A 3WBZA 1S57A 1DRZA 2LECA 3UDLA 7FDRA 2K1RA 2VF3A 5CHCB 4EBEA 2GGPA 3NG8A 5D0GA 5DDRC 1S6PB 2HHVA 1VLYA 2AT1B 3C6UB 1VBXA 3DYAA 5SZTA 5M2PA 1N56A 3D1OA 2MZJA 5B0AA 5GADI 3WZ0A 1D09B 2BJ7A 3B82A 4CLSA 2ROGA 4WP9A 3QATA 2C3OA 3MM7A 2NSCA 2QJ3A 2YWHA 3DNCA 2AJ0A 2ALYB 3CDUA 1JLEB 1RHMB 2W8KA 1AZSA 2WVFA 2FVRA 3MTKA 2OTLS 2GJFA 3VGUA 3KHLA 1N4LA 3T1YJ 4JUZA 5KFJA 3OSNA 4DHVA 2ZH6A 2UVWA 2CQHA 5A8RB 3G87A 2OPQB 4A8KA 1QAJA 1RWOB 1OO0B 4AL6A 1FDAA 2PI4A 3CXCR 3QZ7A 2FYXA 2YY3A 2XWXA 2C3MA 1JMTA 4EMDA 3H5XA 5FLXY 4LBIA 3QRPA 1UFWA 2A2CA 1KFDA 3NS5A 4CT9A 4XIUA 4CZCA 1XBWA 4B3SF 1HWUA 3FBBA 4JI5J 3MXHP 1DURA 2VPXB 2XO6A 2E5LJ 4M94A 2YNIA 4C11B 3TJAA 2ZBQA 4F4ZA 5CAAA 5ETLA 3CC2S 1LV5A 3GYNA 2NSBA 4QR1A 3U1LA 2AEMA 2YKMA 1X5SA 2F8EX 4FYVB 4EBCA 1PIEA 3A13A 4N56A 3N0VA 4E2FB 3QWUA 4ZMMA 5KFBA 3IXQA 2MY7A 3MR3A 4DPOA 4RW7B 2LXIA 5K8OA 5SUHA 2HHTA 5K14B 2BEFA 5LOQA 4NLTA 3D6HB 3GWCA 4ZITA 2HFSA 4Y28C 2JVOA 2HEKA 4ZLLA 2AX1A 3TUJC 4NLGA 1BC6A 4YR2A 1KLMB 4HI1A 4DV3F 2H1YA 2NXNA 2XC9A 2JVRA 4LF7F 1UPMB 3TUIC 2BDPA 3LOUA 5BJRA 3WDOA 1LFWA 1RHQB 3EJMA 4C4WA 2GS8A 1SKRA 1FJ7A 3DMJA 2VPWB 3W62A 1ZM3A 3PZPA 2EFVA 2IM3A 2P9GA 2QLFB 2UXCF 1E6YA 4DXLA 1TAQA 4DV6F 4QPXA 2DO4A 2ZKUA 3D5MA 5DETA 4JI0J 3FMBA 3U02A 2M9KA 3V4IB 2F9JA 4QJVA 3J80Y 3QZ8A 1VQ6S 5AT1B 1VC6A 2YVSA 3QO9A 1KR4A 1NB7A 1FKPA 3OTDA 3MEGB 3I5BA 2O66A 2WB4A 2CFXA 1S9GA 3MM9B 4PEOA 4ECSA 4BC9A 3VAGA 2ZZNA 3KLGA 3KJFB 1DBDA 4OJHA 2U1AA 1X4BA 3BSCA 4I6AA 2R3VA 4H4OB 1WC1A 1YJTA 2DCLA 1YZ7A 2RS8A 1ULRA 3HVWA 1F5AA 4YB7A 2QSFA 2DRDA 2W2PP 2J0XA 3R5JB 1H3DA 1ZZNA 3TZXA 4GRSA 2P2CB 2QO3A 2JRSA 3UPFA 1ZM4A 4W98A 2K8GA 3NNAA 2BW2A 3I5CA 2EI5A 1VQLS 4PXEA 3HKZD 2ZM6F 3W3SA 5J2MA 3I4PA 2N7YA 3O6QA 2NXCA 1HPZB 5JVGQ 1ZAVA 4K4VA 1HI0P 3CCES 1AFIA 3U1NA 1IKYB 4MK9A 1JXVA 1IJEB 4WZMA 1S1XB 2OPRB 3CJKB 4DCPB 1C4AA 3K8WA 5AJ3F 3CJ5A 3KLHB 2LCWA 3ILJA 4LF6J 4X4OA 4DF8A 4DQQA 1B4SA 5F3TA 3GIJA 2VA2A 2GMHA 1LWEA 3HFKA 2M4MA 5I42A 5CYQA 3LALA 1ZPWX 3N28A 3EX7B 2HHUA 1N5SA 5IT4A 3I0SA 2MQ8A 4I2QA 1ZM2A 3A1YG 2GIRA 5AXKA 1XEZA 2HFNA 1NPPA 4RBVA 2CADA 3OR2B 4LFAJ 1M1HA 3C6TB 4LRAA 1EHWA 1AUSL 3BGFA 2CUYA 3AA8A 3M2RB 2FJDB 1XNRJ 1UL3A 2MQQA 2JEJA 2BOAA 4H4MA 3DDIA 3VAKA 1A9NB 4DR1J 2BW7A 1JLCB 3MUMP 2KFZA 5GAEU 1F3VA 3BQ2A 4OYZA 4QCLA 3OFGA 2YWGA 1AA1B 3UWTA 4E98A 4KGMA 3QAEA 2CDRB 1EP4A 1Q81T 3PYDA 3AQOA 4ZPAA 1OS5A 2W9AA 1VBYA 3ETOA 1YSJA 4PYDA 1UVKA 3RZAA 4NCAA 1IBMJ 2RF2A 2YPZA 5F8NA 2GO8A 1W7WA 1S6UA 3W61A 1U1OA 1HI8A 3J7Z5 2R7XA 3NCPA 2KYXA 1XMQJ 2FVSA 4M5LA 2UV8G 1C2PA 5KG1A 5KFZA 4MKAA 2L9WA 1T11A 1U1LA 3RU0A 1HBOB 3VAJA 4QW8A 1IBLJ 3NAHA 3G4SS 4FF1A 3HHDA 1AUDA 4MKYA 1X4DA 4RO0A 2RRAA 1Y9OA 3LTOA 5LMNJ 5LMUF 2CAJA 1C4CA 1UMJA 5LL6d 3R27A 4IH7A 2WOMA 1U49A 1X4AA 5HJYA 3A8EA 1FVSA 1EIYB 5KFWA 1I6JA 4UOHA 3T5JA 2VIHA 3OXLA 2D3UA 5FDLA 2FY8A 1TFYA 1LK5A 1IBKJ 2ZUAA 4WIQA 4EZ6A 1RZMA 1RHJB 2QA4G 4F26A 4TY8B 2B43A 1SQGA 1WKKA 2JOQA 1XQIA 3TAPA 4RW8A 1ZH5A 3CJ3A 3R6LB 3HI9A 1HNWF 3C14A 1RT1B 4FXVA 2B8QA 1Y0HA 3CJQA 4RW4A 3R7SB 1M5HA 5T7LA 4DSEA 2KDOA 1VQMS 1LWCA 4PG4A 1YX2A 1ZZFA 5DDOC 1Q79A 4J9UE 1OY9A 1UWBA 4K2JA 4KGXB 4FNIA 2FDNA 2HKEA 2DNNA 2MHNA 3HSDA 4DDFA 2VONA 1REVB 1LWFB 3IN5A 1DTQA 3M8SA 5CZVA 1S76D 4UOCA 3LP0A 1HHTP 3PRDA 2CPJA 5F8HA 1UW4A 2CPEA 1FEHA 1Y5IB 3FMWA 3I0RB 3R97A 2P8IA 3NNHA 3UNGC 2B8PA 3MEEA 3R2DJ 2I0XA 3W9JA 1VK3A 2ATCB 2J7WA 1DJ0A 2XSJA 1S1UB 4K5SA 3RB4A 4F3MA 1QSSA 1QD1A 1YJVA 2RE1A 3PJXA 2DGXA 2UUAF 4MKBA 4CDIA 1NPRA 2DNRA 3IC1A 4M5MA 2CG4A 4B02A 1QTNB 1CC7A 3W63A 2O01C 3H40A 4X84A 2IRUA 4P73A 1SL2A 1RWKB 1WG4A 5L39A 3M8PA 2HK3A 2GC8A 1JB0C 4PABA 2KHDA 1S6OA 4WK1A 1T7PA 3GONA 3AT1B 4ED8A 1EQMA 3MCOA 3VV2B 2W2QP 2Q6BA 4LQ9A 3OHAA 1WSRA 3R8YA 3IO1A 1OMSA 4KIAA 3MAAB 5BYRA 2H5EA 3D66A 3ELHA 5D3GB 5KT2A 2BZ2A 3RRGA 2WSEC 3DOMB 2FIUA 4UW2A 1FXRA 3HHLA 1XNQJ 1C1BA 1SH3A 4NZ6A 4NYPA 2GX8A 3PRVA 2RMLA 1HARA 3QAUA 2IA6A 2UUBF 2XNRA 3CCLS 4ZIWA 4LFBJ 3NAIA 4MYTA 2Z4PA 5D4OA 3ET6A 2GNKA 4JI3J 1G3OA 2AX0A 2LXUA 2LYVA 4RU9A 4ED6A 4PRFA 1PILA 2WONA 3IS9A 3TVYA 2Y9HA 3AD8C 1H0HB 2QX0A 3HZEA 4HLBA 2BBEA 1XR5A 3VGTA 2DD8S 3OTOJ 1UVMA 2CQ4A 4K4UA 1CQMA 3CJ4A 4HHJA 3CPWR 4Y2MA 2Y1LB 1H72C 4NZ0A 1T03A 3I9ZA 4OV1A 4YHHJ 3MF5A 4QYZK 1FFGB 4OJ3A 3OUYB 1UCNA 4G1QB 2VOOA 2DTJA 4OYIA 1Y4ZB 1RT5A 3EXYA 4DUZJ 1YBTA 3H4DA 2CYYA 7AT1B 1QJHA 3HK2A 2KXHA 4CYUA 4IG3B 2B9YA 2GJ2A 2NZ4A 3R5AA 2A0FB 3QSIA 5GVQA 1S1TB 3W65A 4O0IA 4DQSA 3N5BA 3CC4S 3MR2A 1DAXA 2W9BA 3SCLE 2ZUGA 2V8PA 3GIMA 4X64J 1RT7A 3DI6B 2WVDA 5I3QA 1WC4A 4HTJA 3QT7A 5HBMB 1RU1A 1RWXB 4L3NA 1VRUB 3NGKA 2C2ZB 2C2RA 4NXNF 3GZ7A 4TU8A 4JB8B 3QJJA 3KWMA 1OQ6A 3FSXA 4PG8A 1V3RA 4DV7F 4U7CA 1JLBB 2OJ3A 2XBPA 4NYZA 1P1LA 2BJEA 1RK8A 1RAJA 4UZBA 3DCAA 3KUHA 4JYAF 1TR0A 3BQ1A 1HYSB 3BBFA 4O3OA 2YNGA 3HD2A 2EWHA 1V5IB 4GKKJ 1FE4A 1RWNB 4P2SA 1X60A 3MD1A 2ASYA 3KK1B 3KKFA 1W25A 3MAQA 1NK9A 1BGXT 1QE1A 4AFFA 3QWPA 1W2IA 4EO8A 5IFMA 5AXLA 1RTZA 1JKHB 4FXDA 2DNPA 2KN4A 1SIWB 3LP2A 2OGUA 3FJ2A 1Q7YT 1U2FA 1RXOB 2N82B 3G2XA 1M0SA 3EWGA 3EGZA 1YJ9S 1BWEA 4WPAA 4DPYA 2EKYA 2R7VA 2KHCA 1RGVA 4LF9F 1E6VB 2WRMA 4V1Ak 4YB5A 4B08A 2N4CA 1ROFA 5KFVA 1S12A 1IJFB 1BQNB 2EKNA 3UDCA 4I1TA 2ERRA 4I2PA 4JI7J 4NLVA 1XMOJ 1X4HA 4AQYJ 2PI5A 4DPXA 2VB6A 4XK8C 3PACA 1U0HB 2C22A 4NI2A 3PR4A 2PGCA 3AHPA 3M8RA 2CWKA 1RHUB 5KG6A 4D3HA 1ZOTA 1X4GA 3Q2SC 4DSIA 2BRLA 2ZDOA 4ITSA 2AYBA 1Q82T 3VZIA 4FVMA 4ETZA 2KG1A 1LW2A 3PYEA 1J5OA 3FC9A 1HR0J 3P96A 4LQ3A 1UA0A 2HYIB 2XCPA 1SV5A 1RACB 2ASLA 5GADU 1N5TA 1TV6A 3J81Y 2XMJA 3MMCA 1NBEB 1HNIA 4TYAA 4J5OA 2XZWA 2OEMA 3BN4A 3IG1A 3EVMA 1NXIA 1AT1B 4PWDB 3K5NA 3DLKA 4BC7A 3KJQB 5CYMA 2LLZA 3EXCX 5KFAA 2E1RA 3VQSA 2ZDPA 2HWIA 2Q3PA 1T9XA 1HD1A 1SH2A 1RTIA 1I51B 2CQ1A 1KSPA 5I3UA 5EX0A 2CJ9A 1UKUA 2CNNB 3OXFA 1JJ4A 4W4MA 3OVSA 2HQ3A 3KLIB 1MG7A 3IBCB 3CE8A 4ECTA 4DQIA 3MAHA 3IR6B 4XAKA 1YZ6A 4P75A 2W4CA 2CQPA 1RWWB 2HAIA 1OJ4A 5KT3A 2HLUA 2MPUA 3MHYA 4USJC 2HHHJ 2H5JB 1TUGB 2BABA 3V81B 2Q66A 4D3GA 4C3LA 4B9VA 1RTHB 4B3OB 4C48A 1RAGB 2DNYA 1EETA 3QFHA 3BEGB 4Z37A 1NDCA 2VOPA 4KO0A 1F5BA 4EI2A 2CPHA 3SQGA 1R0AA 5KG5A 3GLJA 2MKKA 2WSFC 4J9SA 1F5CA 2PSZA 2O67A 3LO3A 2YKAA 4OZ5A 1QY7A 2BANA 4CH7A 1ACMB 3MM6A 3HDSA 3DDNA 2XY6A 2V4JA 3ZTSA 3NS6A 1G6BA 4Y2IA 3GR1A 3TA1A 2J9DA 3HXMA 1B0PA 2AJQA 2M0GB 3RW6A 4EEYA 2VQEJ 2MKIA 2D3OR 2DISA 1S72S 4FYDA 2OH2A 1VQYA 5JUMA 1YKWA 2CPFA 1FESA 2DVIA 4DLEA 2DGUA 2W25A 1OY8A 1R8AA 1MLAA 1GFWB 1NK8A 1DTTB 5EGYA 4OHYA 1ITPA 4P7VA 4ELUA 3TOQA 3M8QA 1N34F 3BGUA 4ID5A 2YWWA 3TAQA 2KH9A 1IKVB 1U24A 1IR2A 1FRMA 5IOLA 2YH1A 1XC9A 1IBCB 2ZITA 4CH1A 4IQMA 3PEHA 2HFZA 3QQCD 3M30A 2Y8YA 2GGPB 1Q8LA 4F8RA 5DG9A 1RT3B 2X1GA 1JXEA 4X2BA 1YJNS 2AGOA 1UP1A 4X4UA 1RTJA 3R7BB 4JI1F 2GQQA 3PHEA 2ZBPA 1MN9A 2VDIA 1SL0A 2Y3YA 2ZE2B 3DYAB 3BSNA 2F40A 4ZCLA 5GAGI 1CJVA 1FK9B 4AT1B 4ATNA 3EVWA 3IRXB 3RBZA 5AE3A 5I3PA 1BQXA 2VODA 3TRGA 4DSLA 3J7AN 2KT5A 1HI1A 3D9BA 4FS1A 4AXJA 4M5IA 2B6AB 3TZWA 4DMZA 1ZTWA 4I6YA 4HDHA 3KUGA 4NYOA 4WXWA 3JYTB 1RDRA 1RU2A 3OJUA 3OLAA 2FHOB 5CD4H 4FS2A 4KTQA 2CIMA 3TEGA 1WC3A 3B4DA 3H2LA 1B7YB 2ROEA 3ZZPA 3KJNB 3G82B 2XI2A 1MSWD 5HQ8A 2BQUA 1KQSR 3KLEA 3Q23A 2GIFA 2UVRA 2VKRA 2Z56B 4H4KC 4OHXA 2VQFJ 1UTAA 2HZVA 2HSEB 4NLSA 3T1HF 4FXWA 3RJMB 2C3UA 1TL3B 2PEHA 2GVDA 2NXJA 1N5QA 3OLBA 2E1AA 4DN9A 3TQ1A 2G1HA 4DV4F 2OSRA 1IKWB 2V5HG 3AAWB 1KHVA 3A4TA 4KT0C 3LANA 5HO4A 3U27A 2XZTB 4IRDA 3H59A 4LSNB 4WU2A 4JI2J 3LGNA 4YR0A 1RAIB 1WHWA 2A6MA 3RR8A 3BBCA 2RQCA 3PJWA 3H8YA 1Q5YA 2IPOB 3ITHA 1PGZA 2V2KA 3IGNA 4DV3J 1KLNA 5D4NA 3GV8B 1S1WB 4MIWA 4BBYA 3IWNC 3MM5A 4B3MF 1HLWA 4YUDA 5IS2A 4F2SA 3PO5A 1FERA 2B9XA 2NUUG 4LF5F 3E2EA 3CW2C 4I68A 4DV6J 5C24A 5B0EA 5DM6Q 3OTEA 1KS2A 1UEVA 4KPCA 3O8WA 3M05A 4WFZA 4DFJA 3DMJB 1DFDA 3GJTB 2R7QA 1FTCA 4C97A 2W7PA 1IN0A 2KRRA 3CCUS 1T9VA 1G7CB 3E8OA 3BGRB 4J37A 4P6QA 3KG1A 4QQBA 4EO6A 2MZRA 5LM7E 2HMIB 2MQLA 2B7BB 2HBRB 1T3OA 2QFJA 3BSAA 3NLCA 4QPTA 2YH0A 2JC0A 1PJ5A 2YWFA 3A8IA 2IY5B 1IR0A 2UV8A 5DG7A 2D7SA 5DLFA 1P9QC 1RBAA 3ZFVA 5J2QB 3OR1B 4LF2A 1NHUA 3FEYB 3M2VB 2J0WA 3KLGB 1VQKS 1YJRA 3V6JA 3JSMA 1RT4A 2WBRA 2MY8A 1Q8IA 1SJ1A 1HWJA 2NREA 3DRYA 2HLTA 4K4TA 3CJ2A 4USIA 2FJBB 2CPZA 4RR5A 2DYAA 4WFYA 1H38A 3NMAA 1T94A 4K2XA 4RPFA 2ZM6J 4ED0A 4IUFA 3HF5A 4WIIA 4U8VA 5F8IA 3FFIA 1CS4B 4CM0A 2ILYA 3RBDA 3UR0A 5DDQC 5AXNA 1VMBA 3CDWA 2V0NA 5GAHI 2CJYB 1SUQA 2CJAA 4CLFA 3DGPB 3BSOA 3QIDA 3AQPA 2NPFA 3N5FA 2IDEA 4LJMA 3QLHA 4CQ1A 2JHEA 2I9SA 1CSJA 1LWEB 1SC6A 2QEXS 5I42B 3BS9A 4KV8A 1T0TV 2O3DA 1FRLA 1VQ9S 2LVWA 2G2ZA 2RRBA 2LDIA 4RX6A 2CQ2A 3MCSA 4PXCA 3M6VA 1TFWA 3P8BB 4DR5J 4P74A 2B9WA 1TKDA 1YRUA 4CO0A 3OJSA 2DHSA 4X62J 3ZNUA 4DV2F 3QT6A 2FPHX 1OY6A 3DOKA 2NLWA 3UI3A 2DO0A 2HNDA 1PG5B 4IQXA 2XMUA 1NJIT 4J9NA 4E8UA 1N6QA 2AJ4A 3PW4A 4WYWA 1N5YA 2KJVA 2RD5C 3J7YI 1S6QA 5KOWA 2KTQA 4O3QA 2OMLA 3C15A 4WK3A 2EXUA 4O23A 4IDKA 4IG0A 2W7OA 1MMDA 3FCHA 4ES3A 2G13A 4KBIA 4Y6IA 1UVNA 4OI2A 1TL1A 3FVYA 2A3JA 5LSOA 1WHXA 4IR1A 1XR6A 2MJNA 2ZWPA 2PT0A 1HFEL 3K5OA 4KHRA 3KJVB 4NASA 2VV5A 3FSIA 5A8KA 3T41A 4AXIA 3MPUB 1O6XA 2B5JA 1IWAA 1M1GA 1Q16B 2ZJRQ 1Z1ZA 3NCQA 4MFBB 4LF8F 3KG4A 2QLJB 4WFXA 1BY9A 3S01A 2NUHA 1VC5A 3MEKA 3OSPA 5D4LA 1CC8A 2A6OA 2WVCA 5L1LA 2C2DA 4DWIA 5B7WA 3V5RA 5DJBA 2DXFA 2F3JA 1ICEB 3H5UA 4ZVOB 4KH1B 2K3KA 4RBUA 2HFOA 4F50A 4ZPVR 3EE3A 3GYXB 2J6SA 2XMWA 4FF3A 4ICLA 4O4GA 3VHQA 2PMWA 3I56S 3MMAA 4KGVB 1SKSA 3UCGA 3EZUA 1DQ8A 4C3MA 3PFOA 3ZTRA 2HBYB 3L7PA 3DM2B 2W01A 4Q44A 2L3MA 3ENVA 2ABYA 2MZTA 2XWYA 1VQ4S 1FRKA 3D2WA 1RB0A 2ZH7A 4DR3J 2HW3A 2BQRA 3KLFA 2DGWA 2FC8A 3SDEA 3D6FB 4LF1A 5L1IA 5J1EB 1P8GA 4AL5A 3K7RA 1JX4A 2DHGA 4DG1A 3P4UB 4RW4B 1RKJA 3SZ2A 1QUPA 2V34A 5F8LA 4X4VA 4CLWA 1LWCB 4IFYA 3VVUA 3TANA 3P5BP 3W2WB 4CTAA 1TKXB 2QE5A 2DHAA 2VUGA 1SJRA 4JV1A 1TTHB 2IYGA 3A3NB 2HHQA 3GFHA 4RWWA 5J1NA 4USWA 4KE5A 4XDDA 3D0GE 2HQIA 3DLBA 3Q8PB 3D4JA 4K4YA 4M5JA 2HIYA 5G0RB 2KG0A 2HRUA 2XMTA 4R5PA 1WDDA 3ICLA 4C0BA 2ZOGA 2FQQB 4HDGA 3TUZC 1NZAA 3D7SB 1L3SA 1J27A 3DRPB 1YVFA 1JLAB 5KOXA 2WB1D 3SSSA 1WKJA 5F8GA 1FRIA 1T05B 3KG0A 4GO5X 2MHEA 3UCZP 1XMBA 2XQCA 1RAEB 1OPZA 3LPEA 4R25A 2ZH3A 1GT8A 5J2NB 3DLGA 3B54A 2PIIA 4NZ7A 5DDPC 4DL4A 3SI8A 4QWCA 3MR6A 1FJGF 4ZPCA 4DCJB 4KFBB 2M8HA 2GO9A 3NGTA 1RAAB 1CQNA 4DX5A 4CLLA 2HFUA 4N76A 2XGQA 2FY1A 3DLHA 1EARA 4ZP9A 1Y11A 4FNHA 1N36J 2XHCA 1C0TB 1NK6A 2RUSA 4DLGA 4DR4J 1ZBTA 3PX6A 4BWJA 3WC0A 3UDVA 4X65J 4F4KA 1CG2A 3TAMA 3M8PB 3K8VA 4B3RF 4PUOA 1A6LA 1HQEA 2MTLA 3DRSA 3KUEA 1VK8A 3ISZA 3A12A 3L3CA 3KHRA 2DNOA 1FD2A 2MKJA 3BDPA 3ZTOA 4DV5F 3J81j 1JQGA 2VG5B 3C8YA 4IOCQ 1WUUA 1X0PA 4OL8A 4Z2XA 1WSVA 3HHLB 4ZOSA 3QRQA 4HI2A 4U67Q 4ES2A 5LT5A 3GPAA 3C19A 4PAAA 4Y34A 4C2MA 4LR9A 2NPIA 4MH8A 1HNXF 1S49A 3VGVA 2E7VA 4PYAA 5HI7A 3W2VA 1FXLA 3GU0A 3IS9B 3HSZA 4C8KA 2DK2A 4I7FA 4Q8EA 2R7WA 2XZDB 3UR3C 2AEJA 1YDLA 2JLFA 1SKUB 3TZYA 3RTVA 1HW9A 2BQ3A 1S9EB 3UN3A 3HPOA 3JXOA 4RNOA 3OL9A 4ILLA 4RBTA 2JSXA 1Q86T 3A3PB 1RCOB 4UQGA 2QL5B 1U4BA 1RT5B 3CD6S 3AY0A 2J9DE 2FHKA 1NSAA 3MOZA 3ZZTA 2AWZA 5IXUA 1U47A 5IWAJ 4YB1P 4QW9A 4QBUA 2XMKA 3IWXA 1YQHA 1S6PA 3AH6A 4ILMA 2B0GA 4NXNJ 5L1JA 4O44A 2QN6B 3C6UA 5DS7A 3BYPA 2UU9J 2W9BB 4WBFA 2JLEA 1CJTB 1FVQA 2UUWA 3OL7A 3BV8A 1GNKA 4P7TA 4YDDB 2JEFA 4J9LA 4TKTA 2O1PA 5KT5A 2CQDA 3PR5B 2ZH5A 3T5LA 2KYZA 1JLEA 1P1TA 4OLPA 3K57A 3TARA 4F4AA 1F6TA 4UOGA 1F0XA 2JX2A 1BLUA 2HWHA 4H4KA 1N54B 1KTVA 2DB1A 1HWKA 2C28A 3WC2A 1CEZA 5A8RA 1WORA 3R3TA 4BS2A 1W26A 2RB7A 2OPQA 4ETXA 3PKMA 2OELA 5HATA 4DZDA 5A0YA 3AD9C 4ZN1A 4Q2LA 5CH7B 4F3OA 3T1YF 4LVNP 3GSDA 4KRWA 4TLQA 3PIPQ 5I4MA 5KFCA 3EZOA 2RHSB 4XTTA 3NY0A 4IFVB 4IKAA 2VDHA 1Y5LB 5HQMA 5ADZA 3IGVA 1V5VA 3M32B 2CG8A 1YITS 4B3TJ 4ZLJA 1Y10A 1SXLA 1FKOA 2Z30B 1FO1A 3H0PA 2EBEA 1N88A 3LP2B 5M2UA 4YFUA 3SXLA 4C11A 4PQUB 4MAKA 2MJUA 2MSTA 2ZNZA 5D15A 4OZ0A 3UN2A 2QL7B 1FDNA 3QJLA 1RA6A 3MM8A 1M5SA 3NMRA 4JI5F 4X4TA 4NLQA 5DRKA 3RYLA 2EK6A 1LNQA 3UN5A 1UWAA 1L5UA 4K0KJ 4ECUA 1Z4UA 2W9CB 4I2PB 1IM6A 2E5LF 3WHIA 3R6GB 4ZPBA 2LQ9A 2DRAA 4DSKA 1WC6A 2R7TA 5A76A 4GMKA 4F67A 2FJXA 4RW7A 5K20B 2GMJA 1GMVA 3DU6A 4CP5A 3JSYA 4I64A 3F56A 2W24A 4WYLA 2J8SA 3NGDA 2QTWA 2HZAA 4EUVA 4IRKA 1CJKB 1RADB 4HEA9 2UXBJ 3AODA 1R3NA 5IM0B 2QMUB 3VR1A 1KLMA 3HVTA 5L46A 4ZP7A 4G65A 1WC0A 5GAGU 1X5TA 5HP1B 1VCTA 3G86A 2M70A 1FT8A 2WHOA 4NRTA 3BZQA 4B9MA 1EAYC 3V4MA 1TZ0A 1Y5NB 4OI1A 3OD2A 1K44A 2LA6A 4KC5A 4C9DA 1Q53A 3HM9A 2EFQA 4JV2A 2LEAA 1GEHA 2DH7A 2KM8C 3CD0A 3CVKA 3MFIA 2C3YA 2GHPA 1T3NA 1FTRA 4OI6A 2QSWA 1T8EA 1R8CA 5EWEA 3MEGA 3NWGA 1RAHB 3Q8UA 4W92B 1JLQB 1AXQA 3UDEA 5I3UB 4KHPF 2QZ8A 3MM9A 1YWXA 3RB6A 4OFZA 4JI0F 4B9SA 2MGZA 2XLIA 4NA1A 2ZOMA 4M5GA 3KMQA 4KJIA 5HL7Q 2HHSA 1N32J 4H4OA 4PKDB 3VALA 1KD1T 1YI2S 3CTRA 2HS3A 4DZ6A 4JI8J 4ZCMA 2HGNA 1G4CA 1KWMA 4QWDA 5ETPA 2DBBA 1VBKA 2G2YA 2YNHB 1VC0A 1LQ9A 4HT5A 3CNQP 3B6BA 4DV0J 2ADCA 3CCZA 4XDCA 2MKHA 4ELVA 4LFCJ 3TX0A 2LEBA 4Y2KA
chains in the Genus database with same CATH topology
1S99A 3M6WA 2EKYA 3MR5A 2KHCA 2QIFA 2MZ1A 2R7VA 3FQKA 4NLOA 3RAQA 1RGVA 4KV8B 4LF9F 1E6VB 3NRBA 4DL0C 3M1VA 2WRMA 2IBOA 4YB5A 4B08A 1WF2A 4C0OC 4EWTA 2FUG9 1ROFA 2N4CA 5KFVA 2AGPA 2R2SA 4UUWA 4NMLA 5KAKA 1HPZA 1IJFB 1BQNB 1XERA 2RRNA 4X4SA 3FEZA 3UDCA 4I1TA 2XLKA 2QA1A 2ERRA 4I2PA 4NLVA 3OTOF 2J9CA 4G1QA 1IM4A 1IKYA 4ERDA 3F44A 3IAM9 3MGJA 1X4HA 4K4SA 2UVUA 2P9CA 1M1KT 1XK8A 2PI5A 1RT2A 2VB6A 4XK8C 3C2PA 1S1XA 3PACA 2OPRA 3P3DA 3CJKA 2C22A 2FVQA 3OFEA 4WXOA 3PR4A 1HMVB 1NH7A 3GILA 2CQBA 3K2YA 2PGCA 2RUGA 4I0WA 4KGKA 3AHPA 4TQSA 1QAYA 3DM2A 3M8RA 3CO9A 3IFEA 4NCGB 2DH9A 2LU1A 1IUJA 1ZOTA 2HNDB 5KG6A 2PN6A 4D3HA 4DL5A 2CQ0A 4KSEB 1S48A 4IR9A 1RWUA 1QM9A 4NCBA 3FZBA 1RT6B 3MM6B 2GQ2A 1X4GA 3TO8A 3Q2SC 4RW6A 4OZJA 3GIIA 1D9FA 1HBNA 4XPEA 4DSIA 1N6QB 2BRLA 3RAMA 2DPJA 2ZDOA 4QIEA 2DNHA 4OHWA 1E6YB 2PMZD 1N5YB 2VFVA 1C1CB 1FRJA 4ITSA 2KB2A 2AYBA 1Q82T 1S6QB 1YBAA 3VZIA 4FVMA 4ETZA 2MXYA 3VAHA 2KG1A 3RB0A 1U25A 2B51A 3BO2A 2BRKA 1LW2A 3KFWX 4Q7AA 4IDKB 2WAQD 1J5OA 1R43A 3OL8A 5J1EA 2PA8D 3T9ZA 2FHMA 5MLCV 2MB0B 3P96A 4PPDA 1OSCA 1UA0A 2HYIB 4LQ3A 2XCPA 2KZMA 1SV5A 2IJNA 1TK8A 1H2UX 3C6TA 1N5VA 2GHWA 2ASLA 2JC1A 1NU4A 1OWXA 2P6TA 3D0HE 3QO9B 2NYIA 5GADU 4DR3F 1N5TA 3I4HX 4FVCA 1TV6A 4EFAC 3J81Y 2E9ZA 1FKPB 5E3PA 1VRUA 2XMJA 3G9CA 3DRRB 3MMCA 3M9NB 3KMSA 1TL1B 3GIKA 1HNIA 2L08A 1S9GB 3C66A 2HHWA 4YP3A 2KO1A 4TYAA 4QZVB 3SFGA 2FGOA 2VC1A 3W2WA 4J5OA 2XZWA 1SJQA 2R8JA 3P5TL 4EBDA 2DGTA 3BN4A 3IG1A 1TKXA 3EUNA 3QJPA 3CEDA 5C42A 4LFAF 1JLBA 2HVZA 4JI4F 4PWDB 3O3LA 1HQUB 4CI0B 3DLKA 4BC7A 5A8KB 3K5NA 3OW2R 5CYMA 2LLZA 3EXCX 1SB6A 5KFAA 5ITHA 2EG2A 2E1RA 1KNZA 2RDIA 3MPYA 4AYBD 4ECYA 1URRA 3G96A 4A8XA 3VQSA 3HO1A 2B5JB 1JJHA 2ZDPA 1VQSA 2HWIA 7FD1A 3IRWP 3GV5B 4JI6F 5CA5A 2QT7A 1RKIA 2EVZA 2Q3PA 2V8VA 3TX8A 1HD1A 1KN6A 1KHWA 2J9EA 4URQU 1SH2A 1HBMA 1RTIA 3FSYA 1DLOB 2ZD1B 4ECQA 3Q2TC 4QR0A 3VAIA 1VIXA 4AUKA 4NLDA 1ZAWA 2CQ1A 2J5AA 5G0RA 4M63A 1P27B 3J7ZT 1KSPA 2JEIA 4Q43A 5I3UA 5EX0A 4GKJF 3OVAA 3G6XA 2CVIA 4HH0A 2CJ9A 1UKUA 2DGQA 3HZGA 4ZP6A 3UCUP 1PSDA 1TVRB 3QIPA 4ECWA 3OXFA 3PRBA 1JJ4A 4N77A 2CPDA 2ZH2A 3OVSA 2HQ3A 4ZPTR 4DFPA 4HH1A 3KLIB 3EGWB 5DO2A 3UD4P 3D1QA 5KFHA 3CE8A 4ECTA 2AYEA 1RTJB 5T41A 4DQIA 3OTCA 4W90B 3DRPA 3MAHA 2CKWA 1JLAA 3IR6B 4XAKA 3LW5C 3LWLA 3ZZYA 3KK3A 2W4CA 1N52B 2CQPA 4O3RA 2YX1A 3D28A 1T05A 1YTYA 1NH8A 4U6PA 4LMZA 2HIQA 3DLEB 2HAIA 4IH6A 5J2MB 1L3KA 5KT3A 2HLUA 2MPUA 5K9FA 1HL6A 1SBRA 3MHYA 3LQVA 1FDDA 3H5SA 4USJC 2VG6B 3GR0A 4ZLPA 4FP9A 3MDFA 5KFQA 5C25B 1IBMF 1HBOA 4ICLB 5CYJA 1C0UB 4O4GB 1FRHA 2ZNYA 1RP5A 4DF4A 1U6ZA 3B4MA 5M2RA 2I1RA 5J2NA 3DLJA 1S9FA 4Q2MA 4I56A 4A48A 2K2PA 2YKNA 1MW7A 2RJZA 2BABA 3V81B 1S0OA 3SCJE 4K4XA 1VOMA 2Q66A 1JIHA 4OZLA 1FCAA 4D3GA 2Y1JA 4C3LA 1WD6A 4B9VA 1J2VA 5HLFA 4DFKA 2Z0GA 1XMQF 1RTHB 2BM1A 4RKUC 2E5IA 4B3OB 2B7CB 4ZCIA 2WSCC 1M5VC 4KFBA 1FD8A 2DNYA 1EETA 3T6BA 2DCUB 4F4XA 3E01A 3BEGB 4OJ1A 1UA1A 2CPXA 4Z37A 3G8QA 3S8SA 2VOPA 2E66A 3BM7A 4KO0A 3PX0A 4M1KA 2GMLA 3CCWA 3BO4A 5CYQB 2CQ3A 4DL6A 2R8GA 3KLFB 1F5BA 1IBLF 2AU0A 3O44A 1IKXB 2I38A 5GAHU 2FJVA 3SDEB 3VCDA 3I0SB 2CPHA 3SQGA 4ZVHA 4OZNA 1D3WA 4TU7A 1JK9B 2KXFA 1R0AA 2LMIA 4ZVFA 2FJAB 3LF0A 5KG5A 1HWIA 4I2QB 1AROP 1GQEA 5KFYA 4O3PA 3THVA 2MKKA 2IFXA 2WSFC 3UW1A 5FJ4A 1C0TA 1TL4A 5HMZA 4J9SA 1JLFB 4OJGA 1F5CA 2WK4A 2PSZA 5B09A 1HMVA 3ZZRA 2O67A 2EPIA 3LO3A 4L72B 2YKAA 4WU3A 4OZ5A 5E3AA 2H9ZA 2BXJA 2ACYA 1QY7A 2ZH9A 1D9DA 3I96A 2BANA 5LMNF 3Q0AA 4CH7A 5KG7A 4Y0FA 2IAJB 4RUCA 1RT6A 3MM6A 2GHVC 3NCRA 2ZH1A 2ASDA 2OPSB 4KKOB 3HDSA 4I6WA 5HROB 2IC3B 3DFEA 3HHLD 3DDNA 1FEEA 3EPIA 5A8WB 3OTBA 2V4JA 4LT6A 4H4MB 2XY6A 3W7BA 1X5PA 5CQGA 2XNQA 1G6BA 3NS6A 2CVEA 2KT2A 4IFYB 4LSLB 4TY8A 3PO4A 1KRPA 1LXJA 2COLA 3GR1A 4Y2IA 1N36F 3TA1A 1MU2B 2J9DA 3HXMA 4OZ1A 2VG5A 4DR4F 1B0PA 2AJQA 3MECA 2M0GB 4K59A 2JEGA 4X65F 3KK2B 4YDXA 1K0TA 3FRYA 1SJ3P 4CTAB 5KG4A 2QMXA 4PXDA 3RW6A 4EEYA 5F41A 1U1KA 3LP1B 2APOA 1U1RA 2CQGA 2MKIA 4G1IA 2DISA 5DG8A 3LWMA 2D3OR 1S72S 5CXTA 4FYDA 1UAWA 1EP4B 3VAFA 1ZYQA 3VF0B 2OH2A 1VQYA 4B17A 5J2PB 1K1SA 5JUMA 3AJ2A 2CPFA 4I67A 5A2QY 2ROPA 1I94F 1FESA 2DVIA 4F2RA 4DLEA 2DGUA 3CT9A 2VFSA 4OX6A 5H9EJ 3UFCX 2W25A 1R8AA 1RYSA 1RTDB 2BYCA 3DRRA 3VWSA 1NK8A 3N9UC 1U1NA 5U47A 1U2RA 5KFUA 5H9FJ 4C8OA 2IMOA 3KYLA 1DTTB 5EGYA 2DGSA 4TNOA 2SXLA 4OHYA 4R5PB 3MURP 2PMHA 3KHGA 2EC0A 2FTRA 3FNNA 2RU9A 4P7VA 1S1VB 2RF2B 4ELUA 3SV4A 1DQAA 4C8MA 3RRHA 4DX8H 1QVGR 2OD4A 3TOQA 3M8QA 4O3SA 1HR0F 4TXSA 1N34F 4FBUA 3JTNA 1R8BA 3BGUA 1ELOA 4ID5A 3J7YU 5K5MA 2X3GA 4Y65A 1K9MT 2HGLA 4UUXA 5KFXA 4RNFA 1R31A 1H7XA 5DGBA 2HVHA 4G6VB 4I4BA 3TAQA 2M5YA 2KH9A 1IKVB 1U24A 1AFJA 1F9FA 1FRMA 4YEAA 2X1AA 5MAOA 2VKZG 3EGNA 5DQIA 4DS5A 1DLOA 3QYYA 1LWFA 2YH1A 2ZD1A 1XC9A 1LOUA 2AV5A 1Y00A 2ZITA 4CH1A 1PC5A 4IQMA 2CPYA 4RNNA 3PEHA 2HFZA 3M30A 1S9EA 3C46A 2RDJA 4USHA 1X9MA 3DLGB 3SYZA 2IJFA 3CULA 3CDEA 1BQMA 2GGPB 4Q45A 1Q8LA 2N4DA 4XPCA 4F8RA 1UJ5A 5DG9A 5E41A 1MROB 1RT3B 2X1GA 3I9V9 1JXEA 4X2BA 4FZVA 1YJNS 2AGOA 1UP1A 3Q8QB 2OSQA 4X4UA 4BCAA 1RTJA 4JI1F 2GQQA 3I0RA 3PHEA 4WTYA 5F0WA 1OQ3A 1D8YA 5IQ6A 2RU3A 2HNZB 2LQBA 1SL0A 1NK0A 2ZE2B 3DYAB 5E2QA 3BSNA 2F40A 4ZCLA 3RR7A 4Q0BA 5GAGI 1FK9B 5C24B 3DLEA 4HTIA 2F7VA 5EHHA 1HW8A 2ZJPQ 1M5OC 3MMBA 4ZK7M 5E33A 4ATNA 1HWLA 3IRXB 3MWBA 2ATLA 5AE3A 5I3PA 1BQXA 2EFNA 4DJBA 4HYKA 4AL7A 1S1UA 2VG6A 3DHWC 4TQRA 2VODA 2F8MA 1G1XA 1XR7A 2WOMB 3ONQA 1CPZA 1C0UA 2RKIB 3BREA 3GG0A 3CMAS 3TRGA 2OTJS 1VQPS 4OI4A 2YNFB 2BM0A 4DSLA 2KT5A 4NOHA 5KT6A 1Y7PA 2IM0A 1RISA 3R5BA 1HI1A 1N48A 3QMQA 3CCVS 4FS1A 3LAMA 4DL3A 4AXJA 3TAMB 2KI2A 5E5NA 2R9LA 1JWWA 1P6TA 5FDLB 2GA7A 1BD6A 2B6AB 4DMZA 1ZTWA 1MNEA 3QGGA 3NBPB 4I6YA 4PG6A 4HDHA 4X66F 4NYOA 2EFPA 4WXWA 3JYTB 1HQEB 3DHXA 1V9OA 3DRSB 3VQTA 1URNA 1RDRA 3I32A 3OJUA 1B64A 2DT9A 3OLAA 3T19A 4Y2KA 2HHHF 2RILA 1FHTA 5EX3A 2EBGA 2DIVA 3PXGa 2FHOB 5CD4H 3HX9A 4FS2A 6FD1A 4K4WA 2OO4A 4KTQA 2CIMA 3OVBA 3KOAA 2HGMA 5IWAF 2ZBCA 3JAMY 2K7KA 2XG8A 3B4DA 3H2LA 1YJUA 3RW7A 4B9LA 2ROEA 3ZZPA 4HVZA 4RW8B 1D8ZA 3DOLA 4O4RA 3HT3A 2VZ9A 2XI2A 3M4XA 1MSWD 5HQ8A 5HMXA 5EWGA 2BQUA 2HNYB 4OIXA 4X4RA 1FXDA 1KQSR 3KLEA 2PO4A 3Q23A 2NR0A 1JLFA 3ENQA 4EYHB 2AGQA 2UVRA 1U45A 2VKRA 3CDBA 3PM9A 2HPUA 4IOBA 4EZ9A 2VG7B 2UU9F 5B0CA 2D3ZA 2NS1B 2VBXA 2MQPA 1RYRA 4A8SA 5HMYA 5KFEA 2VA3A 2ZJQQ 1FF2A 1YRTA 4RW9B 3E3XA 1HBUA 3PIOQ 3JSMB 2OPSA 4H4KC 3AB2B 2I2YA 4ZHRB 2E5HA 3L95X 4OHXA 1DZ5A 4DSJA 4L6V3 5T7LB 3CUNA 2J76E 2HRYA 1GX5A 2ASJA 4NLSA 5A8WA 3T1HF 4KQZA 4FXWA 2C3UA 5BR8F 2JWNA 5EWFA 1TL3B 1FNXH 2XI3A 3HHNB 3ENWA 2KJWA 2PEHA 2V94A 1M5PC 1N5QA 3AJ1A 4YMEA 3OLBA 2YTCA 2RT3A 5D3GA 1T02A 4CNZA 4DEZA 2A10A 2E1AA 3W2VB 3X3UA 4URGA 1UWBB 4DN9A 3TQ1A 2ZZMA 4R8UB 3FEXB 3N6NA 4DSFA 3T3FA 1NK5A 3HHLC 4KAIA 2OPPB 3DOMA 4DV4F 2OSRA 4ECVA 3V6HA 2JJ4D 1IKWB 2DNKA 2V5HG 4I7FB 2IYIA 5EUHA 4A8MP 4FBTA 2B4UA 3AAWB 1LXNA 3O5TB 4DN0A 5T14A 4ED7A 2FVPA 3QGPA 1KHVA 1VGYA 4KT0C 1KOHA 2EFOA 5E7OB 3LANA 2W7AA 5HO4A 1L3VA 4ID8A 3U27A 2DITA 2VH7A 3PW0A 4IRDA 1B0TA 1DTQB