2GGRA

Solution structure of the c-terminal sh3 domain of c-crkii
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
GPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene C-crk
publication title Solution Structure and Folding Characteristics of the C-Terminal SH3 Domain of c-Crk-II
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 9
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ggrA00
2FO0A 2I0NA 4OMLA 2FRYA 2PNIA 3CQTA 5IXBA 2DLPA 1I1JA 2VKNA 2DMOA 4RTZA 3REBB 2MOXA 4QT7A 2KNBB 4DEYA 2A36A 2KE9A 2BZYA 2P4RA 2E5KA 1U06A 5GJVB 1PKSA 2D0NA 2ROLA 3EG1A 2RN8A 4IIOA 3H0HA 5ECAA 4DEXA 2FPDA 2JM9A 2FPFA 2ED1A 4M4ZA 1G83A 1N5ZA 3TVTA 3VS2A 2JT4A 1M3BA 2B86A 4JZ3A 2K2MA 1AZEA 1CKAA 3EG2A 2KEAA 3UATA 1X6BA 2CSQA 2A08A 2DRMA 1AEYA 2DVJA 2OAWA 5L23A 1M27C 1GCQC 1K9AA 1X2QA 1WXTA 4J9DA 4AFSC 2K3BA 2BZ8A 2V1RA 1OPKA 4D8KA 2GTJA 1W6XA 2C0TA 1PKTA 4AG2C 2FPEA 1CSKA 2KXCA 3SEMA 3TSWA 1BU1A 3I9QA 4OMNA 2L3PA 1FMKA 1JEGA 4KRTA 4Z8AA 3M0TA 2LNHB 1V1CA 1AZGB 3NGPA 3QWXX 5GJWB 1NM7A 2L2PA 2RQRA 2CT3A 2OI3A 1ZUKA 1K1ZA 1Z9ZA 2KGTA 1S1NA 1TUDA 1GFDA 1NEBA 3VS0A 5FWBA 2PZ1A 2EQIA 2KYMA 4F16A 5I22A 2EBPA 1NYFA 2YUPA 2EW3A 2O9SA 1WA7A 1E6HA 4J9GA 1HJDA 4AG1C 1GBRA 4ESRA 5IXFA 4FSSA 4CC4B 1KIKA 2YSQA 1QKWA 2DF6A 2DL7A 2J05A 1T0JA 3THKA 2AZVA 2LZ6B 2J06A 1WYXA 2OJ2A 4D8DA 1UHCA 2VWFA 4RTTA 2X3WD 1X27A 1UG1A 1VA7A 1E6GA 1JQQA 2DL4A 2FEIA 3EHQA 1ARKA 3SHWA 4E6RA 4Z88A 4JJDA 2NUZA 4IIMA 1QKXA 1I07A 2LX7A 1T3SA 2JW4A 2SEMA 1ZUYA 2RMOA 2DL5A 1VYVA 1AWXA 2DE0X 2BZXA 3RNJA 1KSWA 3KFVA 2EPDA 1ZUUA 1UJYA 1Y0MA 2XMFA 3VS4A 2EKHA 3I5SA 4OMPA 2EGEA 1BK2A 3EG0A 2V1QA 1FYNA 2MCNA 2HEQA 1SPKA 1GCQA 2RNAA 2FRWA 3M0RA 1QCFA 1ABOA 1ZLMA 4J9EA 2MIOA 2D8JA 2FG0A 1YN8A 1SSHA 1PWTA 2JS0A 1RLPC 1T3LA 2O88A 2W10A 2LP5A 2HBWA 3RBBB 1X6GA 2GQIA 5FWCA 2EGAA 2QDLA 2L3SA 2KT8A 2DNUA 4RTVA 1HSQA 3A98A 1PRMC 2HDAA 1QWEA 1B07A 2DX1A 3LH5A 4OMOA 4LN2A 3VRZA 2KRNA 1G2BA 1X69A 4Z89A 3I5RA 4LUDA 1GFCA 2LQWA 4RTWA 3ZL7C 2KROA 5FW9A 1ZBJA 1AWWA 1AWJA 2JMAA 2LCSA 4RTYA 4JZ4A 3U23A 2YT6A 2K79A 1E7OA 3ULRB 5IHKA 2D8HA 4LUEA 3PE0A 2IIMA 4OMQA 5EC7A 2K7AA 1A0NB 1SHFA 2YUQA 2JS2A 2EYYA 2CT4A 2DILA 2GTOA 2GBQA 2DJQA 3NMZC 3M0SA 1UHFA 3VS6A 2ED0A 1IO6A 1UGVA 1YCSB 2F2XA 2KRSA 2X3XD 4AFZC 2RQTA 2F2VA 4JPBW 1EFNA 2CH4W 3O5ZA 4J9CA 2LMJA 1K4US 2ABLA 4WCIA 2CUDA 2BTTA 2EYWA 1TG0A 2C0OA 1OPLA 1YP5A 2ECZA 1UE9A 3VS1A 2DRKA 1H8KA 2CSIA 1SEMA 1K0XA 4JJBA 3EG3A 4HVUA 2CDTA 2M51A 2AK5A 2J7IA 4ORZA 3REAB 4J9FA 2DM1A 2EYXA 1WLPB 1MUZA 2RF0A 1H3HA 3NPFA 3UA7A 2JMCA 2KT1A 3VS7A 4HXJA 1UFFA 1GL5A 1UTIA 1MV3A 1CKBA 2DYBA 3I35A 2EYZA 2O9VA 4JJCA 1M3CA 1W70A 2K9GA 3TSZA 1X2KA 4J9IA 1AD5A 1M3AA 3QWYA 1U3OA 3GBQA 1ZX6A 5IHNA 1SRLA 4RTUA 2F2WA 3M0UA 1ABQA 1J3TA 1YNZA 5IH2A 1WDXA 1GCPA 1JXMA 2AKKA 3R6NA 2G6FX 2J6OA 1OOTA 1B3QA 2DL8A 3M0QA 5HCKA 2DBKA 3VS5A 3VRYA 2AKLA 2D1XA 2O2OA 2KXDA 3C0CA 1T0HA 1AOJA 3UA6A 2EGCA 1PHTA 1RLQC 4HCKA 2EVRA 1VYUA 1NG2A 1SHGA 2O31A 1W1FA 4GLMA 1UDLA 2YUOA 1ZSGA 1MV0B 1H92A 1JO8A 3H41A 4F14A 1LCKA 4J9HA 1XOVA 2C0IA 2A28A 3IQLA 3VS3A 1NLPC 3EHRA 1QLYA 1K0SA 1GBQA 1YWPA 1U5SA 2KR3A 1X43A 1JXOA 4OMMA 1JU5C 3UF4A 2PTKA 4AFQC 1RI9A 4Y92A 1VYTA 2J6KA 3PVLA 2RQVA 3JV3A 4J9BA 5IHIA 2CH4A 2JM8A 1AWOA 1UUEA 1WXUA 1M8MA 1WIEA 2YDLA 2HCKA 1PRLC 3H0IA 4R0KA 1K76A 2ENMA 2RPNA 1M30A 1WXBA 1WI7A 1QWFA 3M0PA 1NYGA 2KRMA 2DBMA 1HD3A 2GGRA 1YWOA 1OEBA 1BBZA 2KBTA 2RQUA 2ESWA 4CC2A 1UECA 5I11A 2DL3A 3H0FA 2VVKA 1TUCA 2GNCA 2DA9A 1WX6A 4HVWA 1GRIA 1SRMA 2NWMA 1NEGA 2HSPA 2ROTA 2H8HA 4CC3A 2JXBA 1AVZC 4RTXA 2L0AA 2SRCA 3NHNA 4GBQA 2KYBA 2L3QA 4AFUC 2A37A 2JTEA 4LE9A 3PVQA 4A63B 1I0CA 3FJ5A 4HVVA 1RUWA 2LJ1A 4ZNXA 4X1VA 1KFZA 1Z9QA 2K6DA 1NLOC 3EGUA 4RUGA 2AZSA 2J6FA 1PNJA 4K11A 1BB9A 1KJWA 1WFWA 4F17A 4CC7A 2RQWA 1OV3A 2LJ0A 2LJ3A 4LNPA 2M0YA 4EIKA 2CUBA 1UJ0A 2CREA 2LQNA 2W0ZA 1Y57A 2YUNA
chains in the Genus database with same CATH superfamily
4MZTA 2I0NA 2FRYA 2PNIA 5IT9E 4HT8A 5HK0A 2V8KA 2DMOA 4RTZA 4Y28E 2KNBB 2KY9A 4BDYA 3CEYA 1NJIC 2H3JA 2D0NA 3URGA 5CKDA 3E1SA 3UWNA 1VQNT 1C6VX 1FWZA 5GAMj 3G6EQ 3I55T 4M4ZA 1G83A 3TVTA 1KC8U 3CCVA 3ME9A 3HRUA 4PLIA 1M3BA 4N4GA 8AT1B 2CSQA 3QO3A 2ZPGB 2DEQA 2L89A 3CCLQ 3FB9A 2QA4T 1K9MR 1AEYA 1K8AR 5CKFA 2LQKA 5L23A 1BI0A 4PJMA 1GCQC 1WHJA 1VQKT 1YJNA 1K9AA 1X2QA 4A4HA 3DLMA 2CKKA 3OQ5A 1VQLT 2V1RA 1VQ8Q 3S3OA 3JCMW 4D8KA 1Q7YR 2NUTA 4AG2C 1VQPA 1CSKA 2DVEA 4MZPA 2L3PA 2BE9B 4PKCC 5KYXA 1V1CA 3QZ5B 3MO8A 4Z02A 3LYIA 5KYYB 4R55A 3QWXX 1YI2A 3VKIA 4XU2A 1NM7A 1PC0A 2RQRA 5KYUA 3OY9A 3SD4A 2EJFA 3RR6A 3JCMJ 3VS0A 3BFMA 2IPOB 1XJWB 2PZ1A 4HCZA 2EW3A 1O75A 2O9SA 4BDZA 3QYGB 2QGGA 4RG2A 2DXUA 4NOYA 3CPWA 4CC4B 3G4SA 2YSQA 1HXDA 4J6YA 2X4XA 3THKA 4JRKA 2CP0A 2LZ6B 4M75E 1UHCA 2VWFA 4ANJA 2X3WD 1TSFA 2FEIA 5KE3A 4FT4A 1ARKA 1K9MU 4Z88A 5GANh 2NUZA 1K8AU 2H3EB 1T3SA 2JW4A 1ZUYA 3CD6T 3KFVA 1UJYA 1YJ9T 2XMFA 2KI7A 4PJOD 1YIJT 1PCXA 1YJWQ 1RAEB 1SPKA 3CBMA 4KBMB 1U1TA 1W2BA 4XU1A 4II1A 1ZLMA 2XKOC 3SWNC 2FG0A 1YN8A 2RHIA 1JJ2S 4C5IA 3LH0A 5GANe 3M55A 2DTHA 4JLIA 1T3LA 3V8KA 2LP5A 1N9RA 2HBWA 3RBBB 5FWCA 2EGAA 2QDLA 2K4YA 2L3SA 4GY5A 4M75D 4RTVA 1K73C 4M7AG 2RHXA 3OYGA 3JSCA 1PRMC 1QMCA 2XICA 4N0AC 2KRNA 1VQ4A 2M1HA 1M90U 3OBWA 3ZL7C 3QUIA 5FW9A 1RAHB 2RJFA 5CKHA 2YRDA 3FJPA 3JRZA 2VGMA 1G3WA 4JZ4A 5GAMf 2YT6A 1JRIA 5IHKA 1YITT 3D7SB 4HT9A 2XG8D 4J6WA 4BUGA 4LXCA 3CCMA 1A0NB 4B6MA 2JS2A 2JN0A 3QPHA 1BI2A 3QYHB 4C8QG 2RJEA 4C92E 2DJQA 4A53A 3LX7A 3M0SA 2JOYA 3VS6A 2ED0A 3OMGA 1YCSB 2KRSA 1VQNQ 2X3XD 4AFZC 2RQTA 4JPBW 2CH4W 2LMJA 3I55Q 1K4US 3M57A 3OYJA 2E6NA 2CUDA 1OPLA 1N8RC 3VS1A 2LC4A 2DRKA 2P84A 5FU7B 5GAN4 1C1AA 3M54A 1K0XA 4M77D 4OB1B 2EQMA 2M51A 2XU8A 2IG0A 3EGXA 4X34A 3CCRT 1Y7XA 1VQKQ 2DM1A 2EYXA 5GANj 3CPWP 1TH7A 1VQLQ 2QEXA 1QVGS 2E3HA 3GP8A 3VS7A 3JCMg 4HXJA 1UFFA 3A8HB 3I35A 5A0GA 2P0PA 2QASA 4O5VA 4IUVA 4D6WA 2O9VA 4DBRA 3QBYA 1ZSZB 1X2KA 1M3AA 2YHTA 1QW1A 5IHNA 3FC3A 4RTUA 4XTYA 2F2WA 3HFOA 4PFPA 3A5ZB 1J3TA 4DA4A 1YNZA 1WDXA 3JB9G 4RMOA 3EFOA 3R6NA 3CBPA 2CZ7B 2AKLA 1QVFP 4PLLA 1YHQQ 1TUGB 3LWIA 1W2BP 2EVRA 4LDXA 3VYGA 4F7UB 3CMET 1Q86R 1VQNA 1UDLA 3ZFJA 1MV0B 5GMKl 3CMAT 4Y91A 3H41A 3OS0A 2DJZA 1BI3A 5GAMg 3MP1A 5GAOp 4J9HA 3WVEB 5KYNA 3ASKA 3KUFA 3NTHA 5LJ5d 3VS3A 3CC4T 1NLPC 5GAN3 1M90C 3CD6Q 3CCJQ 1YWPA 1U5SA 4M78A 2KR3A 2QI2A 2RJCA 4EPCA 1RI9A 2HQEA 2E64A 2QA4A 2GFAA 1YJ9Q 4LDUA 1WJQA 2RQVA 2YRVA 4J9BA 4X9CA 5LJ3f 4NS5A 1UUEA 1WXUA 1M8MA 2ZAEA 2HCKA 3H0IA 1K76A 2ZPBB 2CP3A 4LDVA 4F04B 1M30A 1WXBA 4OVAA 1D3BA 2DBMA 2PQWA 5A0LA 1HD3A 4M78C 1YWOA 1OEBA 2KBTA 2RQUA 3OW2S 2ESWA 4ME7A 4MDXA 5I11A 1QP3A 2DL3A 4A4FA 3L1AA 3OSVA 4PJOB 1TUCA 1NJIR 4HVWA 1S72Q 4L59A 1NEGA 2C06A 1EZZB 1C0MA 2ROTA 2VXEA 2MMPA 2CP7A 3J7AF 1AVZC 1WZOA 5J39A 2YLCA 2E6ZA 4GBQA 2MK5A 2L3QA 4QQGA 1RACB 2FB7A 2QQBA 1ZBXA 4P5NA 1ZA2B 1YITQ 2G3RA 2K5FA 3GPLA 1Z9QA 4A4KA 3PMTA 1WQ7A 4RUGA 2OTLQ 2DK3A 3MHXA 2KQWA 5FLXE 3H9NA 1IGQA 1EX4A 2RQWA 2X51A 4BE1A 1OV3A 3CCLT 2LJ0A 2M0YA 1LJOA 2PUKB 3EGDA 2HD0A 3TEEA 2X4YA 2GCXA 3CD6A 2CREA 2W0ZA 3QIIA 2RI2A 4M7AE 5J3BA 3V8LA 1PSFA 2ZPIB 4JLGA 1I1JA 1YJ9A 1KG1A 2MOXA 4QT7A 2LVMA 1YIJA 2FHDA 2A36A 2KE9A 3X26B 2P4RA 2E5KA 3MEVA 5GJVB 4E47A 1WHLA 4M7DB 4IIOA 1KQSA 3H0HA 4MMLA 5ECAA 4DEXA 2GQVA 1MMGA 2FPDA 4JS4A 2ED1A 3S3MA 2I2LA 2BKDN 2EQKA 4C8QE 2QQAA 2HMAA 2COYA 3A8MB 4IUQA 3X25B 2HKQB 1Y71A 4DBHA 2ZPFB 2B86A 4JDSA 5GAOl 5CO7A 4JZ3A 4ZGJB 1CKAA 3EG2A 2KEAA 5GAN2 3UATA 1UGSB 1TTHB 4M77B 1VQ6Q 2DVJA 2COZA 2F5KA 1M27C 1QQJA 2A0FB 1VQMQ 2GFUA 3RERA 4M7AD 5KYWA 1M1FA 3OBYA 3P8HA 2CP5A 4FL6A 2CZ0B 4J9DA 4AFSC 3GOXA 2K3BA 2BZ8A 1YITA 5FRMA 1PKTA 2K2VA 2KXCA 3SEMA 3TSWA 4JRPA 1BU1A 1I5OB 3I9QA 4QVZA 2OX7A 3CMEQ 2JVVA 1MNDA 4KRTA 4Z8AA 1B34B 2DYIA 3M0TA 2MPXC 1AZGB 3CMAQ 1N9SA 4OB3B 5GAN8 3CBOA 4C8QD 3BY7A 2CT3A 1BYMA 2OI3A 1YJWT 3FDRA 1R0CB 1S1NA 2CYZB 4ZN1A 1GFDA 1NEBA 1P92A 1AT1B 4QVCA 2EFIA 5A2QE 2EQUA 2PU9B 2WSFE 5FROA 4C92G 4KGVB 1HJDA 3CCRA 2JJ9A 2JTFA 4FSSA 2DFUA 1IXDA 2AZVA 1Q82C 2J06A 5IAYA 5GANg 1WYXA 1M5Q1 2X9HA 3OYBA 2OJ2A 1IB8A 2FZCB 4KGXB 1UG1A 1RI0A 1E6GA 2DL4A 2DXCA 1RABB 4IIMA 3DKMA 1QKXA 4FM4B 2LX7A 1VYVA 2RH2A 2BZXA 2RA2A 4IUTA 4L6V5 1Y0MA 1OU9A 3HPWA 2EKHA 1BK2A 3QJYA 3CC2T 5I21A 1FYNA 2HEQA 1GCQA 3NTIA 3MKDA 2E3IA 3M0RA 3G71A 1QCFA 2QDYB 1IREB 4J7IA 4RCBA 3GF5A 4J9EA 2MIOA 4M78F 3JB9D 4BE2A 4O6JA 3BW1A 2QXFA 4ZTJA 1RLPC 1WJRA 1LOJA 1QCNA 2O88A 2PUOB 2W10A 3OA6A 5CQXA 4HCCA 5LJ3h 3CXCA 4OB2B 4XK8E 3N5BB 2DX1A 1B07A 3TREA 4LN2A 1QP2A 3CC4A 1KHIA 1G2BA 4Z89A 1D1CA 2HAXA 1BCMA 2LQWA 2QQRA 1N6AA 2KROA 1KQ1A 2HBPA 1AWWA 4RTYA 2DEUA 2K79A 1E7OA 2AIRB 3ULRB 3CPFA 2D8HA 2O4XA 4LUEA 1SHFA 1M2OA 7AT1B 4JUVA 1RADB 2DILA 3BDUA 2GBQA 3NMZC 2NUPB 1PG5B 5LJ3e 1IO6A 2DD4A 1XTDA 1I8FA 1ZSZA 4J9CA 2QG9B 3EG9B 4ZTFA 1X01A 4QW2A 3M56A 1W4SA 5FU7C 5FRNA 2ABLA 1D0YA 2C0OA 3HHTB 1YP5A 3QG1A 5KE2A 2LX9A 2MF2A 1H8KA 1YCYA 1VQ5Q 1YHQT 3SDZA 3MEUA 4ORZA 5CQYA 3REAB 2PVGB 3V7RA 5GAN7 3SFMA 4KGZB 1QVFS 4XU3A 1MUZA 1H3HA 3G6EA 3LGLA 4F7UA 3CCUQ 3SWNA 5HY6A 1ZSZC 3CCST 2P4TA 2RHYA 1UTIA 4BB7A 2RK1A 1M1KC 4OP0A 3CCJT 2EYZA 4JJCA 1NZ9A 3C12A 2VB6A 2E5QA 1AD5A 1HYOA 3CCLA 5GMKm 1ZX6A 3LLRA 1Q7YU 1ABQA 4N0AA 1FMWA 1GCPA 3M53A 2QQ9A 4BY6B 5CCAA 4M7AB 1OOTA 1VQ8A 3M0QA 2RI3A 1H641 2EJGA 2D1XA 3TCJA 4FCYA 3HRSA 5DLQE 2FZKB 3UA6A 1LNXA 3OYEA 1PHTA 4QQDA 3QDRB 5LJ3j 1RLQC 1KC8C 4NL3A 2KMTA 5D6XA 2CP6A 3VUBA 2DAQA 4E7KA 3OYHA 1Y96A 1M2VB 3QDFA 4L5GA 5GMKh 2WACA 1S72T 2C0IA 3IQLA 1K0SA 1GBQA 2QQSA 1X43A 1JXOA 3OYDA 3JCMP 2K57A 4Y92A 5I2MA 5HK3A 3A1PA 2X4WA 2R57A 3JV3A 3CC2Q 2CH4A 2X35A 1AWOA 1TU0B 2OTLT 2ZCFB 4OF1A 3MJXA 2CP2A 1O9SA 1JJ2A 2RHUA 1KD1R 3UPUA 3OS1A 1WI7A 5GMKe 3M0PA 1BIBA 4C5GA 4ZN3A 4PJOC 4XAXB 5GAOn 1NBEB 2IVWA 1BBZA 2HQXA 4JRIA 4AMCA 4CC2A 1UECA 3CC7T 1OULA 2DZCA 2ZGWA 2VVKA 3H0FA 2LCCA 1YJWA 4M78E 1WX6A 4X9DA 4EMKC 3R6OA 2F1LA 3C4SA 2R58A 3HP9A 4CC3A 3CCEQ 4Q5WA 2DXTA 2YXYA 4JRQA 1VQ9Q 3C95A 2KYBA 4KH1B 4AFUC 4M7DA 4LE9A 3PVQA 4A63B 1I0CA 4KULA 2GF7A 3FJ5A 1RUWA 4ZNXA 1K9MC 4X1VA 4M75C 4E7LA 2DZ9A 1K8AC 3MCAB 3L2RA 1RAIB 2K6DA 1NLOC 4JJNK 4C92D 3V8JA 3P8DA 2NUTB 1WFWA 4F17A 4PNOA 2FYKA 5GAOr 2LJ3A 4LNPA 4EIKA 1VQ6T 1PM3A 2LNVA 1VQMT 1Y57A 2QGFB 1KHCA 1F1BB 2FO0A 2P0QA 3CQTA 5IXBA 2DLPA 1YBYA 3RIRA 1WGSA 4J5YA 3WVDB 4M7DC 3REBB 4HA8A 1YFNA 4DEYA 3CC2A 1KD1U 1M8VA 2QTXA 1HK9A 1U06A 1BKBA 3EG1A 2RN8A 1TOVA 3PNWC 5GMKj 1VIFA 2CZ6B 1QVGA 4BE0A 2KVQG 5KH6A 2JM9A 3I55A 3CCSQ 1R8OB 1N5ZA 3E19A 2AT1B 2V8IA 3VS2A 4M77C 2PVDB 1NPRA 5A0DA 1OU8A 3J80E 3LW5E 2LT1A 5AT1B 2K2MA 2K5IA 1X6BA 3HRTA 2YRCA 4EDUA 3JAME 1D0ZA 2E4HA 1VQKA 1RL2A 1IRXA 1VQLA 1WXTA 2VXFA 4FIBA 3JCMd 1X6OA 3DB3A 1OPKA 1TXQA 2GTJA 1W6XA 1Q81R 3S3NA 2FPEA 4PJNA 4C5EA 4PL6A 1JEGA 4JS5A 2Z0WA 1TWBA 2LNHB 3OYIA 3NGPA 4A4GA 1BCOA 5GJWB 2K3XA 2L2PA 4F7UF 3KXTA 1GXIE 1G8XA 1ZUKA 1Z9ZA 2KGTA 2HKNA 3E9GA 1TUDA 2Y90A 3H8ZA 1Q86U 3HL8A 5FWBA 4F16A 4EMKB 5I22A 2EBPA 1YHQA 2YUPA 2VGNA 4C0ZA 2QK0A 2KK4A 4J9GA 1UGQB 4FYYB 1GBRA 5IXFA 1G3SA 1KIKA 1QKWA 1WHKA 2DL7A 2J05A 1T0JA 5CVIA 3G4ST 4FT2A 4RKUE 5GAMd 3HSBA 1I4K1 4M75B 2LRQA 3CCSA 1X27A 1JQQA 2LT4A 2JZ2A 4E7IA 3SHWA 1B7TA 1QCOA 4E6RA 3CCJA 1N27A 1VIEA 3I56Q 2SEMA 3OW2A 1PSEA 3RNJA 1KSWA 2EPDA 3CC7Q 3EAEA 3VS4A 2QYZA 3I5SA 2EGEA 1Q81U 5LJ5e 5HKCA 2K3YA 2V1QA 2MCNA 2RM4A 2FRWA 2M0OA 1LVKA 3M9QA 4J8OA 8ATCB 3VV0A 1ABOA 4PJOF 5CKEA 3M4YA 3OYAA 3EGXB 1SSHA 3JCMX 2JS0A 2LQ8A 4KH0B 1NJIU 5LJ3g 5KYYA 1ZHIA 2XK0A 1UGPB 3EG9A 4PJJA 1X6GA 2M16A 2KT8A 1VQ5T 2DNUA 4AT1B 2KDSA 1HSQA 3A98A 3NFCA 2ZPHB 2L5QA 2YWWA 1QVPA 6AT1B 1S72A 4BACA 2HDAA 1QWEA 3OS5A 3VRZA 5D6YA 5D6WA 1X69A 1OYXA 3I5RA 4LUDA 1RAAB 4M75F 1MMAA 1IHWA 1SG5A 3CCUT 2AHJB 3RKXA 3EFOB 3Q1JA 2OTLA 4OMQA 5EC7A 2K7AA 2BIVA 2CT4A 2EYYA 3G1JA 2DTOA 3CCMT 3CCQT 2ZPEB 4C92B 4KUDK 1UHFA 1UGVA 2F2XA 4DQ2A 2K5LA 1EFNA 3O5ZA 2E12A 1SF9A 4M7DF 1G3TA 4WCIA 4PFOA 2CGHA 3DB4A 4FU6A 2ECZA 3CCVQ 1UE9A 5CK9A 4JJBA 1DJ7B 3EG3A 4HVUA 4IUUA 4RCCA 1D09B 2AK5A 4J9FA 1U8RA 1VQ7T 1KC8R 3RKWA 4BD3A 2D0QB 1U1SA 2VUBA 1WLPB 1K73R 1YJNQ 2RF0A 4M77F 2COWA 1Q95G 1OI1A 2JMCA 3RKYA 1AHJB 1CKBA 1MV3A 1WNLA 2DYBA 4OGEA 4MZMA 1VQPQ 4IURA 4M78G 1M2VA 4J9IA 2XIDA 3BDLA 4BY6C 3VU3C 3OYLA 3QWYA 1VQ6A 2VASA 4M7AC 3GBQA 3M0UA 1VQMA 3TQ7P 3SB2A 5IH2A 2NLUA 3RMSA 4RG8A 2AKKA 2G6FX 2J6OA 3MEAA 2OTJT 3VS5A 1WHHA 2DBKA 5HCKA 3VRYA 2O2OA 2KXDA 3C0CA 1KQSP 3CMEA 4E7JA 2DD5A 4HCKA 4KT0E 4WF2A 1VYUA 1NG2A 4F7UE 3VYHB 4XTWA 4C8QC 1N8RR 4ATOA 3CMAA 3G4SQ 2YUOA 4ZGEB 1ZSGA 3LWHA 4E7ZA 1JO8A 1I81A 3PT9A 4UC4A 4C5HA 1SKUB 4F14A 1LCKA 4B9XA 4J83A 4CRIA 1XOVA 1WPYA 4LDWA 2ZZDA 3EHRA 3CCET 1QLYA 2Y4YA 4PJLA 4YTLA 1D0XA 3ZBDA 1JU5C 2CS7A 3UF4A 1VQ9T 3EGDB 9ATCB 1K73U 3MP6A 2MWPA 4FYXB 1VYTA 2Y4XA 2HZYA 4C0GA 2JM8A 2XI9A 4EMGA 3CPWS 5GANd 2L8DA 3C94A 3T9NA 1WIEA 2YDLA 2V26A 1PRLC 2JNGA 4R0KA 2ENMA 1XQHA 1OZ2A 2CZ1B 3F70A 1NYGA 1VQOT 3S6WA 4IUPA 3OYNA 3L2UA 2PVOB 3A8OB 1OX8A 1ACMB 3OB9A 4FW2A 1MGQA 4PJOE 2KAFA 1IHVA 5GAN5 3P8BB 2NWMA 4IKFA 1KQ2A 1VQ4Q 2P0KA 1N8RU 3RMQA 2L0AA 2F69A 2SRCA 1NPPA 3JB9J 2E70A 2RHZA 1W2BS 3GNGA 2JTEA 5J26A 3J81E 5KYWB 2DO3A 4FYVB 1KFZA 1M90R 2XDPA 3EGUA 3EFRA 2AZSA 2J6FA 3QZ9B 3GIBA 4TVRA 1PNJA 4K11A 3E9FA 3CCMQ 4E7SA 5LJ5f 3CCQQ 1G3YA 3ER0A 2VC8A 3X28B 3MEWA 3GLXA 4J6XA 4BI3A 2CUBA 1UJ0A 2VYTA 3WXMB 4OMLA 3X20B 5CKBA 3OS2A 2VKNA 3DLLA 5DLOA 5FU6B 4QKUA 3JCMf 2BZYA 1NE8A 1RAGB 2EJ9A 4OGCA 2B8AA 3GNFB 1PD1A 1VQ7Q 1PKSA 1QVFA 2ROLA 4M7DE 5GAN6 4J7FA 3LGFA 2R5AA 3OYMA 3VUZA 1OZ3A 2FPFA 3EFSA 1TS9A 4QQ6A 4C8QB 2QEXQ 2DIGA 3X24B 2HL3A 3CXCP 3E2UA 1G5VA 2RI5A 1ZA1B 4PJOA 3UDCA 2JT4A 1VQ5A 3L2ZA 1AZEA 1VUBA 5KCHA 3FIFA 2RK2A 2A08A 4M77E 2DRMA 3PIOA 2OAWA 4EMKA 2LTOA 4V2SA 2L3RA 3V7CA 2EIFA 3CCUA 2OTJQ 3OYKA 4BI4A 2EAYA 2C0TA 4LDYA 4PFZA 3H6ZA 4M75A 3PFSA 4M7AF 1V29B 3I56T 4OMNA 1UGRB 1FMKA 1ZQ1A 2XDDA 3OSSC 3CCQA 4DOVA 2RJDA 4M7DD 5L8RE 3PIPA 4ELYC 2BUDA 1Y07A 2A3LA 4NL2A 4MDWA 3OYFA 3L2WA 4C0DC 2XDBA 4N4HA 1K1ZA 3UT1A 5LJ5g 1UB4A 1PD0A 2EQIA 2KYMA 1NYFA 4C8QF 2R5MA 5CIUA 1WA7A 1E6HA 5LL6S 1JBMA 2QA4Q 1VQ7A 2JTMA 4AG1C 2DPPB 4ESRA 4LD6A 3G7ZA 2DF6A 1BI1A 4OMFB 2LDMA 5CAIA 4D8DA 5EG2A 2O4XB 4RTTA 2VV5A 4CI0C 2EQJA 1VA7A 5DY9A 2E41A 2DXBA 3EHQA 1Q7YC 4JJDA 5KYXB 1VQOQ 1I07A 4M77A 2RMOA 3A8LB 2DL5A 1AWXA 2DE0X 3HKSA 1WHGA 4HCBA 2FZGB 1ZUUA 5GAOm 5KYUB 1KK7A 2DERA 2QAZA 5DM7R 1OQKA 4EMHA 4OMPA 4M78D 2V8JA 2MAMA 3EG0A 2EYQA 2KSSA 2OTJA 2RNAA 3L42A 1IZ6A 3KBGA 3MPUB 3G71T 1LPLA 2D8JA 1B34A 5C0MA 4C92A 1PWTA 2QTVA 2RD1A 3OYYA 2FVUA 2MWOA 3SWNB 3CCVT 1M1GA 2GQIA 2NYSA 2E65A 4XU0A 3JB9F 1FX7A 4A54A 1MNEA 3LH5A 3L2VA 4OMOA 3CCEA 3JCMb 1GFCA 4RTWA 1Q82R 1VQ9A 4A4EA 1YJNT 1V76A 4F7UG 1ZBJA 3AT1B 1AWJA 2JMAA 2LCSA 4DBQA 3PTAA 4C92C 3U23A 4DBFA 1XNIA 3JB9I 4XTZA 3HFNA 1OX9A 3O8VA 3PE0A 1YIJQ 2IIMA 1VQPT 2YUQA 2MYSA 1I5LA 1JJ2P 2GTOA 3RDVA 2D6FA 3ZEHA 4WTOB 2F2VA 4ZGDB 1VQOA 1YI2T 2BTTA 2EYWA 1TG0A 3OMCA 1Y96B 2XHCA 5I2SA 4C0DB 3RESA 1WQWA 2CSIA 4C0FA 1SEMA 1X75C 2A7YA 3QJ6A 2CDTA 5LJ5h 3L2QA 4LD9K 2ATCB 1WHMA 3EH2A 2J7IA 1MHNA 3FRNA 2DIQA 2BE7D 3NPFA 1KQSS 3UA7A 1D1BA 3G6ET 2KT1A 1GL5A 5M9OA 4ELZC 3VJPA 3JCMc 2DTIA 4PJOG 5C6SA 1RAFB 1M3CA 1W70A 2K9GA 3JCMh 3TSZA 2HNIA 1Q82U 1VOMA 4XQ3A 3QKJA 2XD0A 1U3OA 4E2FB 1R0BG 1SSFA 1SRLA 4OB0B 3FLGA 4HKEA 3PGGA 1KD1C 4N4IA 3JCMV 2MI6A 2EKOA 4GLKA 1JXMA 2M9UA 1B3QA 2DL8A 5GANf 5IN1A 1VQ8T 1T0HA 3EH1A 3M4GA 1R77A 1AOJA 3JB9H 2NUPA 5GAOq 1MMDA 3INZA 2EGCA 2HSEB 4M75G 1QVGP 4XTXA 2LCLA 1SHGA 1EIFA 3CCRQ 4MMKA 2WSCE 3A8GB 2O31A 3JCMe 1W1FA 4GLMA 1D1AA 5FU6C 1H92A 2F5TX 1WJSA 2E10A 3AHUA 3RUXA 3M59A 2HQHA 2JUFA 5CR2A 4R56A 2A28A 5D7UA 5AYFA 3PMIA 3QXEB 2HL5C 1VQ4T 2D9TA 2O01E 4DOWA 5GAMh 2RO0A 4OMMA 2PTKA 3HTRA 2E1HA 4AFQC 1UEBA 4M7DG 2YLBA 2J6KA 4PK4A 3M58A 3PVLA 5IHIA 1M1KR 2DKGA 4FYWB 1JB0E 3G71Q 2RPNA 3BE3A 3M5AA 1QWFA 4B9WA 3I56A 2KRMA 4M77G 4BI8B 2GGRA 5GAMe 2OAUA 1IGUA 5LJ5j 3CC7A 1Q86C 4FW1A 4VUBA 1H3ZA 4M7AA 3QSUA 5KCOA 2GNCA 1FMVA 4M78B 2DA9A 1M9SA 1GRIA 1SRMA 5GMKi 3FEOA 4XTVA 3JCMQ 2HSPA 2H8HA 3CC4Q 4XTUA 2WSEE 2JXBA 1MMNA 4RTXA 3NHNA 3QHSA 3OYCA 2M02A 4E7HA 2EWNA 2A37A 5LJ3d 2QEXT 4HVVA 2LJ1A 1FXXA 4C8QA 1BB9A 2FL7A 3MP8A 4FSXA 3V7SA 1KJWA 4QVDA 1D3BB 4CC7A 4KUIA 3OW2P 2DETA 3CXCS 2X4JA 1Q81C 3TU4K 3META 1YI2Q 2RB6A 3NTKA 2LQNA 1M1KU 1M4ZA 4C92F 2YUNA 1BIAA
chains in the Genus database with same CATH topology
2FO0A 2I0NA 4OMLA 2FRYA 2PNIA 3CQTA 5IXBA 2DLPA 1I1JA 2VKNA 2DMOA 4RTZA 3REBB 2MOXA 4QT7A 2KNBB 4DEYA 2A36A 2KE9A 2BZYA 2P4RA 2E5KA 1U06A 5GJVB 1PKSA 2D0NA 2ROLA 3EG1A 2RN8A 4IIOA 3H0HA 5ECAA 4DEXA 2FPDA 2JM9A 2FPFA 2ED1A 4M4ZA 1G83A 1N5ZA 3TVTA 3VS2A 2JT4A 1M3BA 2B86A 4JZ3A 2K2MA 1AZEA 1CKAA 3EG2A 2KEAA 3UATA 1X6BA 2CSQA 2A08A 2DRMA 1AEYA 2DVJA 2OAWA 5L23A 1M27C 1GCQC 1K9AA 1X2QA 1WXTA 4J9DA 4AFSC 2K3BA 2BZ8A 2V1RA 1OPKA 4D8KA 2GTJA 1W6XA 2C0TA 1PKTA 4AG2C 2FPEA 1CSKA 2KXCA 3SEMA 3TSWA 1BU1A 3I9QA 4OMNA 2L3PA 1FMKA 1JEGA 4KRTA 4Z8AA 3M0TA 2LNHB 1V1CA 1AZGB 3NGPA 3QWXX 5GJWB 1NM7A 2L2PA 2RQRA 2CT3A 2OI3A 1ZUKA 1K1ZA 1Z9ZA 2KGTA 1S1NA 1TUDA 1GFDA 1NEBA 3VS0A 5FWBA 2PZ1A 2EQIA 2KYMA 4F16A 5I22A 2EBPA 1NYFA 2YUPA 2EW3A 2O9SA 1WA7A 1E6HA 4J9GA 1HJDA 4AG1C 1GBRA 4ESRA 5IXFA 4FSSA 4CC4B 1KIKA 2YSQA 1QKWA 2DF6A 2DL7A 2J05A 1T0JA 3THKA 2AZVA 2LZ6B 2J06A 1WYXA 2OJ2A 4D8DA 1UHCA 2VWFA 4RTTA 2X3WD 1X27A 1UG1A 1VA7A 1E6GA 1JQQA 2DL4A 2FEIA 3EHQA 1ARKA 3SHWA 4E6RA 4Z88A 4JJDA 2NUZA 4IIMA 1QKXA 1I07A 2LX7A 1T3SA 2JW4A 2SEMA 1ZUYA 2RMOA 2DL5A 1VYVA 1AWXA 2DE0X 2BZXA 3RNJA 1KSWA 3KFVA 2EPDA 1ZUUA 1UJYA 1Y0MA 2XMFA 3VS4A 2EKHA 3I5SA 4OMPA 2EGEA 1BK2A 3EG0A 2V1QA 1FYNA 2MCNA 2HEQA 1SPKA 1GCQA 2RNAA 2FRWA 3M0RA 1QCFA 1ABOA 1ZLMA 4J9EA 2MIOA 2D8JA 2FG0A 1YN8A 1SSHA 1PWTA 2JS0A 1RLPC 1T3LA 2O88A 2W10A 2LP5A 2HBWA 3RBBB 1X6GA 2GQIA 5FWCA 2EGAA 2QDLA 2L3SA 2KT8A 2DNUA 4RTVA 1HSQA 3A98A 1PRMC 2HDAA 1QWEA 1B07A 2DX1A 3LH5A 4OMOA 4LN2A 3VRZA 2KRNA 1G2BA 1X69A 4Z89A 3I5RA 4LUDA 1GFCA 2LQWA 4RTWA 3ZL7C 2KROA 5FW9A 1ZBJA 1AWWA 1AWJA 2JMAA 2LCSA 4RTYA 4JZ4A 3U23A 2YT6A 2K79A 1E7OA 3ULRB 5IHKA 2D8HA 4LUEA 3PE0A 2IIMA 4OMQA 5EC7A 2K7AA 1A0NB 1SHFA 2YUQA 2JS2A 2EYYA 2CT4A 2DILA 2GTOA 2GBQA 2DJQA 3NMZC 3M0SA 1UHFA 3VS6A 2ED0A 1IO6A 1UGVA 1YCSB 2F2XA 2KRSA 2X3XD 4AFZC 2RQTA 2F2VA 4JPBW 1EFNA 2CH4W 3O5ZA 4J9CA 2LMJA 1K4US 2ABLA 4WCIA 2CUDA 2BTTA 2EYWA 1TG0A 2C0OA 1OPLA 1YP5A 2ECZA 1UE9A 3VS1A 2DRKA 1H8KA 2CSIA 1SEMA 1K0XA 4JJBA 3EG3A 4HVUA 2CDTA 2M51A 2AK5A 2J7IA 4ORZA 3REAB 4J9FA 2DM1A 2EYXA 1WLPB 1MUZA 2RF0A 1H3HA 3NPFA 3UA7A 2JMCA 2KT1A 3VS7A 4HXJA 1UFFA 1GL5A 1UTIA 1MV3A 1CKBA 2DYBA 3I35A 2EYZA 2O9VA 4JJCA 1M3CA 1W70A 2K9GA 3TSZA 1X2KA 4J9IA 1AD5A 1M3AA 3QWYA 1U3OA 3GBQA 1ZX6A 5IHNA 1SRLA 4RTUA 2F2WA 3M0UA 1ABQA 1J3TA 1YNZA 5IH2A 1WDXA 1GCPA 1JXMA 2AKKA 3R6NA 2G6FX 2J6OA 1OOTA 1B3QA 2DL8A 3M0QA 5HCKA 2DBKA 3VS5A 3VRYA 2AKLA 2D1XA 2O2OA 2KXDA 3C0CA 1T0HA 1AOJA 3UA6A 2EGCA 1PHTA 1RLQC 4HCKA 2EVRA 1VYUA 1NG2A 1SHGA 2O31A 1W1FA 4GLMA 1UDLA 2YUOA 1ZSGA 1MV0B 1H92A 1JO8A 3H41A 4F14A 1LCKA 4J9HA 1XOVA 2C0IA 2A28A 3IQLA 3VS3A 1NLPC 3EHRA 1QLYA 1K0SA 1GBQA 1YWPA 1U5SA 2KR3A 1X43A 1JXOA 4OMMA 1JU5C 3UF4A 2PTKA 4AFQC 1RI9A 4Y92A 1VYTA 2J6KA 3PVLA 2RQVA 3JV3A 4J9BA 5IHIA 2CH4A 2JM8A 1AWOA 1UUEA 1WXUA 1M8MA 1WIEA 2YDLA 2HCKA 1PRLC 3H0IA 4R0KA 1K76A 2ENMA 2RPNA 1M30A 1WXBA 1WI7A 1QWFA 3M0PA 1NYGA 2KRMA 2DBMA 1HD3A 2GGRA 1YWOA 1OEBA 1BBZA 2KBTA 2RQUA 2ESWA 4CC2A 1UECA 5I11A 2DL3A 3H0FA 2VVKA 1TUCA 2GNCA 2DA9A 1WX6A 4HVWA 1GRIA 1SRMA 2NWMA 1NEGA 2HSPA 2ROTA 2H8HA 4CC3A 2JXBA 1AVZC 4RTXA 2L0AA 2SRCA 3NHNA 4GBQA 2KYBA 2L3QA 4AFUC 2A37A 2JTEA 4LE9A 3PVQA 4A63B 1I0CA 3FJ5A 4HVVA 1RUWA 2LJ1A 4ZNXA 4X1VA 1KFZA 1Z9QA 2K6DA 1NLOC 3EGUA 4RUGA 2AZSA 2J6FA 1PNJA 4K11A 1BB9A 1KJWA 1WFWA 4F17A 4CC7A 2RQWA 1OV3A 2LJ0A 2LJ3A 4LNPA 2M0YA 4EIKA 2CUBA 1UJ0A 2CREA 2LQNA 2W0ZA 1Y57A 2YUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FO0 A;  2I0N A;  4OML A;  2FRY A;  2PNI A;  3CQT A;  5IXB A;  2DLP A;  1I1J A;  2VKN A;  2DMO A;  4RTZ A;  3REB B;  2MOX A;  4QT7 A;  2KNB B;  4DEY A;  2A36 A;  2KE9 A;  2BZY A;  2P4R A;  2E5K A;  1U06 A;  5GJV B;  1PKS A;  2D0N A;  2ROL A;  3EG1 A;  2RN8 A;  4IIO A;  3H0H A;  5ECA A;  4DEX A;  2FPD A;  2JM9 A;  2FPF A;  2ED1 A;  4M4Z A;  1G83 A;  1N5Z A;  3TVT A;  3VS2 A;  2JT4 A;  1M3B A;  2B86 A;  4JZ3 A;  2K2M A;  1AZE A;  1CKA A;  3EG2 A;  2KEA A;  3UAT A;  1X6B A;  2CSQ A;  2A08 A;  2DRM A;  1AEY A;  2DVJ A;  2OAW A;  5L23 A;  1M27 C;  1GCQ C;  1K9A A;  1X2Q A;  1WXT A;  4J9D A;  4AFS C;  2K3B A;  2BZ8 A;  2V1R A;  1OPK A;  4D8K A;  2GTJ A;  1W6X A;  2C0T A;  1PKT A;  4AG2 C;  2FPE A;  1CSK A;  2KXC A;  3SEM A;  3TSW A;  1BU1 A;  3I9Q A;  4OMN A;  2L3P A;  1FMK A;  1JEG A;  4KRT A;  4Z8A A;  3M0T A;  2LNH B;  1V1C A;  1AZG B;  3NGP A;  3QWX X;  5GJW B;  1NM7 A;  2L2P A;  2RQR A;  2CT3 A;  2OI3 A;  1ZUK A;  1K1Z A;  1Z9Z A;  2KGT A;  1S1N A;  1TUD A;  1GFD A;  1NEB A;  3VS0 A;  5FWB A;  2PZ1 A;  2EQI A;  2KYM A;  4F16 A;  5I22 A;  2EBP A;  1NYF A;  2YUP A;  2EW3 A;  2O9S A;  1WA7 A;  1E6H A;  4J9G A;  1HJD A;  4AG1 C;  1GBR A;  4ESR A;  5IXF A;  4FSS A;  4CC4 B;  1KIK A;  2YSQ A;  1QKW A;  2DF6 A;  2DL7 A;  2J05 A;  1T0J A;  3THK A;  2AZV A;  2LZ6 B;  2J06 A;  1WYX A;  2OJ2 A;  4D8D A;  1UHC A;  2VWF A;  4RTT A;  2X3W D;  1X27 A;  1UG1 A;  1VA7 A;  1E6G A;  1JQQ A;  2DL4 A;  2FEI A;  3EHQ A;  1ARK A;  3SHW A;  4E6R A;  4Z88 A;  4JJD A;  2NUZ A;  4IIM A;  1QKX A;  1I07 A;  2LX7 A;  1T3S A;  2JW4 A;  2SEM A;  1ZUY A;  2RMO A;  2DL5 A;  1VYV A;  1AWX A;  2DE0 X;  2BZX A;  3RNJ A;  1KSW A;  3KFV A;  2EPD A;  1ZUU A;  1UJY A;  1Y0M A;  2XMF A;  3VS4 A;  2EKH A;  3I5S A;  4OMP A;  2EGE A;  1BK2 A;  3EG0 A;  2V1Q A;  1FYN A;  2MCN A;  2HEQ A;  1SPK A;  1GCQ A;  2RNA A;  2FRW A;  3M0R A;  1QCF A;  1ABO A;  1ZLM A;  4J9E A;  2MIO A;  2D8J A;  2FG0 A;  1YN8 A;  1SSH A;  1PWT A;  2JS0 A;  1RLP C;  1T3L A;  2O88 A;  2W10 A;  2LP5 A;  2HBW A;  3RBB B;  1X6G A;  2GQI A;  5FWC A;  2EGA A;  2QDL A;  2L3S A;  2KT8 A;  2DNU A;  4RTV A;  1HSQ A;  3A98 A;  1PRM C;  2HDA A;  1QWE A;  1B07 A;  2DX1 A;  3LH5 A;  4OMO A;  4LN2 A;  3VRZ A;  2KRN A;  1G2B A;  1X69 A;  4Z89 A;  3I5R A;  4LUD A;  1GFC A;  2LQW A;  4RTW A;  3ZL7 C;  2KRO A;  5FW9 A;  1ZBJ A;  1AWW A;  1AWJ A;  2JMA A;  2LCS A;  4RTY A;  4JZ4 A;  3U23 A;  2YT6 A;  2K79 A;  1E7O A;  3ULR B;  5IHK A;  2D8H A;  4LUE A;  3PE0 A;  2IIM A;  4OMQ A;  5EC7 A;  2K7A A;  1A0N B;  1SHF A;  2YUQ A;  2JS2 A;  2EYY A;  2CT4 A;  2DIL A;  2GTO A;  2GBQ A;  2DJQ A;  3NMZ C;  3M0S A;  1UHF A;  3VS6 A;  2ED0 A;  1IO6 A;  1UGV A;  1YCS B;  2F2X A;  2KRS A;  2X3X D;  4AFZ C;  2RQT A;  2F2V A;  4JPB W;  1EFN A;  2CH4 W;  3O5Z A;  4J9C A;  2LMJ A;  1K4U S;  2ABL A;  4WCI A;  2CUD A;  2BTT A;  2EYW A;  1TG0 A;  2C0O A;  1OPL A;  1YP5 A;  2ECZ A;  1UE9 A;  3VS1 A;  2DRK A;  1H8K A;  2CSI A;  1SEM A;  1K0X A;  4JJB A;  3EG3 A;  4HVU A;  2CDT A;  2M51 A;  2AK5 A;  2J7I A;  4ORZ A;  3REA B;  4J9F A;  2DM1 A;  2EYX A;  1WLP B;  1MUZ A;  2RF0 A;  1H3H A;  3NPF A;  3UA7 A;  2JMC A;  2KT1 A;  3VS7 A;  4HXJ A;  1UFF A;  1GL5 A;  1UTI A;  1MV3 A;  1CKB A;  2DYB A;  3I35 A;  2EYZ A;  2O9V A;  4JJC A;  1M3C A;  1W70 A;  2K9G A;  3TSZ A;  1X2K A;  4J9I A;  1AD5 A;  1M3A A;  3QWY A;  1U3O A;  3GBQ A;  1ZX6 A;  5IHN A;  1SRL A;  4RTU A;  2F2W A;  3M0U A;  1ABQ A;  1J3T A;  1YNZ A;  5IH2 A;  1WDX A;  1GCP A;  1JXM A;  2AKK A;  3R6N A;  2G6F X;  2J6O A;  1OOT A;  1B3Q A;  2DL8 A;  3M0Q A;  5HCK A;  2DBK A;  3VS5 A;  3VRY A;  2AKL A;  2D1X A;  2O2O A;  2KXD A;  3C0C A;  1T0H A;  1AOJ A;  3UA6 A;  2EGC A;  1PHT A;  1RLQ C;  4HCK A;  2EVR A;  1VYU A;  1NG2 A;  1SHG A;  2O31 A;  1W1F A;  4GLM A;  1UDL A;  2YUO A;  1ZSG A;  1MV0 B;  1H92 A;  1JO8 A;  3H41 A;  4F14 A;  1LCK A;  4J9H A;  1XOV A;  2C0I A;  2A28 A;  3IQL A;  3VS3 A;  1NLP C;  3EHR A;  1QLY A;  1K0S A;  1GBQ A;  1YWP A;  1U5S A;  2KR3 A;  1X43 A;  1JXO A;  4OMM A;  1JU5 C;  3UF4 A;  2PTK A;  4AFQ C;  1RI9 A;  4Y92 A;  1VYT A;  2J6K A;  3PVL A;  2RQV A;  3JV3 A;  4J9B A;  5IHI A;  2CH4 A;  2JM8 A;  1AWO A;  1UUE A;  1WXU A;  1M8M A;  1WIE A;  2YDL A;  2HCK A;  1PRL C;  3H0I A;  4R0K A;  1K76 A;  2ENM A;  2RPN A;  1M30 A;  1WXB A;  1WI7 A;  1QWF A;  3M0P A;  1NYG A;  2KRM A;  2DBM A;  1HD3 A;  2GGR A;  1YWO A;  1OEB A;  1BBZ A;  2KBT A;  2RQU A;  2ESW A;  4CC2 A;  1UEC A;  5I11 A;  2DL3 A;  3H0F A;  2VVK A;  1TUC A;  2GNC A;  2DA9 A;  1WX6 A;  4HVW A;  1GRI A;  1SRM A;  2NWM A;  1NEG A;  2HSP A;  2ROT A;  2H8H A;  4CC3 A;  2JXB A;  1AVZ C;  4RTX A;  2L0A A;  2SRC A;  3NHN A;  4GBQ A;  2KYB A;  2L3Q A;  4AFU C;  2A37 A;  2JTE A;  4LE9 A;  3PVQ A;  4A63 B;  1I0C A;  3FJ5 A;  4HVV A;  1RUW A;  2LJ1 A;  4ZNX A;  4X1V A;  1KFZ A;  1Z9Q A;  2K6D A;  1NLO C;  3EGU A;  4RUG A;  2AZS A;  2J6F A;  1PNJ A;  4K11 A;  1BB9 A;  1KJW A;  1WFW A;  4F17 A;  4CC7 A;  2RQW A;  1OV3 A;  2LJ0 A;  2LJ3 A;  4LNP A;  2M0Y A;  4EIK A;  2CUB A;  1UJ0 A;  2CRE A;  2LQN A;  2W0Z A;  1Y57 A;  2YUN A; 
#chains in the Genus database with same CATH topology
 4MZT A;  2I0N A;  2FRY A;  2PNI A;  5IT9 E;  4HT8 A;  5HK0 A;  2V8K A;  2DMO A;  4RTZ A;  4Y28 E;  2KNB B;  2KY9 A;  4BDY A;  3CEY A;  1NJI C;  2H3J A;  2D0N A;  3URG A;  5CKD A;  3E1S A;  3UWN A;  1VQN T;  1C6V X;  1FWZ A;  5GAM j;  3G6E Q;  3I55 T;  4M4Z A;  1G83 A;  3TVT A;  1KC8 U;  3CCV A;  3ME9 A;  3HRU A;  4PLI A;  1M3B A;  4N4G A;  8AT1 B;  2CSQ A;  3QO3 A;  2ZPG B;  2DEQ A;  2L89 A;  3CCL Q;  3FB9 A;  2QA4 T;  1K9M R;  1AEY A;  1K8A R;  5CKF A;  2LQK A;  5L23 A;  1BI0 A;  4PJM A;  1GCQ C;  1WHJ A;  1VQK T;  1YJN A;  1K9A A;  1X2Q A;  4A4H A;  3DLM A;  2CKK A;  3OQ5 A;  1VQL T;  2V1R A;  1VQ8 Q;  3S3O A;  3JCM W;  4D8K A;  1Q7Y R;  2NUT A;  4AG2 C;  1VQP A;  1CSK A;  2DVE A;  4MZP A;  2L3P A;  2BE9 B;  4PKC C;  5KYX A;  1V1C A;  3QZ5 B;  3MO8 A;  4Z02 A;  3LYI A;  5KYY B;  4R55 A;  3QWX X;  1YI2 A;  3VKI A;  4XU2 A;  1NM7 A;  1PC0 A;  2RQR A;  5KYU A;  3OY9 A;  3SD4 A;  2EJF A;  3RR6 A;  3JCM J;  3VS0 A;  3BFM A;  2IPO B;  1XJW B;  2PZ1 A;  4HCZ A;  2EW3 A;  1O75 A;  2O9S A;  4BDZ A;  3QYG B;  2QGG A;  4RG2 A;  2DXU A;  4NOY A;  3CPW A;  4CC4 B;  3G4S A;  2YSQ A;  1HXD A;  4J6Y A;  2X4X A;  3THK A;  4JRK A;  2CP0 A;  2LZ6 B;  4M75 E;  1UHC A;  2VWF A;  4ANJ A;  2X3W D;  1TSF A;  2FEI A;  5KE3 A;  4FT4 A;  1ARK A;  1K9M U;  4Z88 A;  5GAN h;  2NUZ A;  1K8A U;  2H3E B;  1T3S A;  2JW4 A;  1ZUY A;  3CD6 T;  3KFV A;  1UJY A;  1YJ9 T;  2XMF A;  2KI7 A;  4PJO D;  1YIJ T;  1PCX A;  1YJW Q;  1RAE B;  1SPK A;  3CBM A;  4KBM B;  1U1T A;  1W2B A;  4XU1 A;  4II1 A;  1ZLM A;  2XKO C;  3SWN C;  2FG0 A;  1YN8 A;  2RHI A;  1JJ2 S;  4C5I A;  3LH0 A;  5GAN e;  3M55 A;  2DTH A;  4JLI A;  1T3L A;  3V8K A;  2LP5 A;  1N9R A;  2HBW A;  3RBB B;  5FWC A;  2EGA A;  2QDL A;  2K4Y A;  2L3S A;  4GY5 A;  4M75 D;  4RTV A;  1K73 C;  4M7A G;  2RHX A;  3OYG A;  3JSC A;  1PRM C;  1QMC A;  2XIC A;  4N0A C;  2KRN A;  1VQ4 A;  2M1H A;  1M90 U;  3OBW A;  3ZL7 C;  3QUI A;  5FW9 A;  1RAH B;  2RJF A;  5CKH A;  2YRD A;  3FJP A;  3JRZ A;  2VGM A;  1G3W A;  4JZ4 A;  5GAM f;  2YT6 A;  1JRI A;  5IHK A;  1YIT T;  3D7S B;  4HT9 A;  2XG8 D;  4J6W A;  4BUG A;  4LXC A;  3CCM A;  1A0N B;  4B6M A;  2JS2 A;  2JN0 A;  3QPH A;  1BI2 A;  3QYH B;  4C8Q G;  2RJE A;  4C92 E;  2DJQ A;  4A53 A;  3LX7 A;  3M0S A;  2JOY A;  3VS6 A;  2ED0 A;  3OMG A;  1YCS B;  2KRS A;  1VQN Q;  2X3X D;  4AFZ C;  2RQT A;  4JPB W;  2CH4 W;  2LMJ A;  3I55 Q;  1K4U S;  3M57 A;  3OYJ A;  2E6N A;  2CUD A;  1OPL A;  1N8R C;  3VS1 A;  2LC4 A;  2DRK A;  2P84 A;  5FU7 B;  5GAN 4;  1C1A A;  3M54 A;  1K0X A;  4M77 D;  4OB1 B;  2EQM A;  2M51 A;  2XU8 A;  2IG0 A;  3EGX A;  4X34 A;  3CCR T;  1Y7X A;  1VQK Q;  2DM1 A;  2EYX A;  5GAN j;  3CPW P;  1TH7 A;  1VQL Q;  2QEX A;  1QVG S;  2E3H A;  3GP8 A;  3VS7 A;  3JCM g;  4HXJ A;  1UFF A;  3A8H B;  3I35 A;  5A0G A;  2P0P A;  2QAS A;  4O5V A;  4IUV A;  4D6W A;  2O9V A;  4DBR A;  3QBY A;  1ZSZ B;  1X2K A;  1M3A A;  2YHT A;  1QW1 A;  5IHN A;  3FC3 A;  4RTU A;  4XTY A;  2F2W A;  3HFO A;  4PFP A;  3A5Z B;  1J3T A;  4DA4 A;  1YNZ A;  1WDX A;  3JB9 G;  4RMO A;  3EFO A;  3R6N A;  3CBP A;  2CZ7 B;  2AKL A;  1QVF P;  4PLL A;  1YHQ Q;  1TUG B;  3LWI A;  1W2B P;  2EVR A;  4LDX A;  3VYG A;  4F7U B;  3CME T;  1Q86 R;  1VQN A;  1UDL A;  3ZFJ A;  1MV0 B;  5GMK l;  3CMA T;  4Y91 A;  3H41 A;  3OS0 A;  2DJZ A;  1BI3 A;  5GAM g;  3MP1 A;  5GAO p;  4J9H A;  3WVE B;  5KYN A;  3ASK A;  3KUF A;  3NTH A;  5LJ5 d;  3VS3 A;  3CC4 T;  1NLP C;  5GAN 3;  1M90 C;  3CD6 Q;  3CCJ Q;  1YWP A;  1U5S A;  4M78 A;  2KR3 A;  2QI2 A;  2RJC A;  4EPC A;  1RI9 A;  2HQE A;  2E64 A;  2QA4 A;  2GFA A;  1YJ9 Q;  4LDU A;  1WJQ A;  2RQV A;  2YRV A;  4J9B A;  4X9C A;  5LJ3 f;  4NS5 A;  1UUE A;  1WXU A;  1M8M A;  2ZAE A;  2HCK A;  3H0I A;  1K76 A;  2ZPB B;  2CP3 A;  4LDV A;  4F04 B;  1M30 A;  1WXB A;  4OVA A;  1D3B A;  2DBM A;  2PQW A;  5A0L A;  1HD3 A;  4M78 C;  1YWO A;  1OEB A;  2KBT A;  2RQU A;  3OW2 S;  2ESW A;  4ME7 A;  4MDX A;  5I11 A;  1QP3 A;  2DL3 A;  4A4F A;  3L1A A;  3OSV A;  4PJO B;  1TUC A;  1NJI R;  4HVW A;  1S72 Q;  4L59 A;  1NEG A;  2C06 A;  1EZZ B;  1C0M A;  2ROT A;  2VXE A;  2MMP A;  2CP7 A;  3J7A F;  1AVZ C;  1WZO A;  5J39 A;  2YLC A;  2E6Z A;  4GBQ A;  2MK5 A;  2L3Q A;  4QQG A;  1RAC B;  2FB7 A;  2QQB A;  1ZBX A;  4P5N A;  1ZA2 B;  1YIT Q;  2G3R A;  2K5F A;  3GPL A;  1Z9Q A;  4A4K A;  3PMT A;  1WQ7 A;  4RUG A;  2OTL Q;  2DK3 A;  3MHX A;  2KQW A;  5FLX E;  3H9N A;  1IGQ A;  1EX4 A;  2RQW A;  2X51 A;  4BE1 A;  1OV3 A;  3CCL T;  2LJ0 A;  2M0Y A;  1LJO A;  2PUK B;  3EGD A;  2HD0 A;  3TEE A;  2X4Y A;  2GCX A;  3CD6 A;  2CRE A;  2W0Z A;  3QII A;  2RI2 A;  4M7A E;  5J3B A;  3V8L A;  1PSF A;  2ZPI B;  4JLG A;  1I1J A;  1YJ9 A;  1KG1 A;  2MOX A;  4QT7 A;  2LVM A;  1YIJ A;  2FHD A;  2A36 A;  2KE9 A;  3X26 B;  2P4R A;  2E5K A;  3MEV A;  5GJV B;  4E47 A;  1WHL A;  4M7D B;  4IIO A;  1KQS A;  3H0H A;  4MML A;  5ECA A;  4DEX A;  2GQV A;  1MMG A;  2FPD A;  4JS4 A;  2ED1 A;  3S3M A;  2I2L A;  2BKD N;  2EQK A;  4C8Q E;  2QQA A;  2HMA A;  2COY A;  3A8M B;  4IUQ A;  3X25 B;  2HKQ B;  1Y71 A;  4DBH A;  2ZPF B;  2B86 A;  4JDS A;  5GAO l;  5CO7 A;  4JZ3 A;  4ZGJ B;  1CKA A;  3EG2 A;  2KEA A;  5GAN 2;  3UAT A;  1UGS B;  1TTH B;  4M77 B;  1VQ6 Q;  2DVJ A;  2COZ A;  2F5K A;  1M27 C;  1QQJ A;  2A0F B;  1VQM Q;  2GFU A;  3RER A;  4M7A D;  5KYW A;  1M1F A;  3OBY A;  3P8H A;  2CP5 A;  4FL6 A;  2CZ0 B;  4J9D A;  4AFS C;  3GOX A;  2K3B A;  2BZ8 A;  1YIT A;  5FRM A;  1PKT A;  2K2V A;  2KXC A;  3SEM A;  3TSW A;  4JRP A;  1BU1 A;  1I5O B;  3I9Q A;  4QVZ A;  2OX7 A;  3CME Q;  2JVV A;  1MND A;  4KRT A;  4Z8A A;  1B34 B;  2DYI A;  3M0T A;  2MPX C;  1AZG B;  3CMA Q;  1N9S A;  4OB3 B;  5GAN 8;  3CBO A;  4C8Q D;  3BY7 A;  2CT3 A;  1BYM A;  2OI3 A;  1YJW T;  3FDR A;  1R0C B;  1S1N A;  2CYZ B;  4ZN1 A;  1GFD A;  1NEB A;  1P92 A;  1AT1 B;  4QVC A;  2EFI A;  5A2Q E;  2EQU A;  2PU9 B;  2WSF E;  5FRO A;  4C92 G;  4KGV B;  1HJD A;  3CCR A;  2JJ9 A;  2JTF A;  4FSS A;  2DFU A;  1IXD A;  2AZV A;  1Q82 C;  2J06 A;  5IAY A;  5GAN g;  1WYX A;  1M5Q 1;  2X9H A;  3OYB A;  2OJ2 A;  1IB8 A;  2FZC B;  4KGX B;  1UG1 A;  1RI0 A;  1E6G A;  2DL4 A;  2DXC A;  1RAB B;  4IIM A;  3DKM A;  1QKX A;  4FM4 B;  2LX7 A;  1VYV A;  2RH2 A;  2BZX A;  2RA2 A;  4IUT A;  4L6V 5;  1Y0M A;  1OU9 A;  3HPW A;  2EKH A;  1BK2 A;  3QJY A;  3CC2 T;  5I21 A;  1FYN A;  2HEQ A;  1GCQ A;  3NTI A;  3MKD A;  2E3I A;  3M0R A;  3G71 A;  1QCF A;  2QDY B;  1IRE B;  4J7I A;  4RCB A;  3GF5 A;  4J9E A;  2MIO A;  4M78 F;  3JB9 D;  4BE2 A;  4O6J A;  3BW1 A;  2QXF A;  4ZTJ A;  1RLP C;  1WJR A;  1LOJ A;  1QCN A;  2O88 A;  2PUO B;  2W10 A;  3OA6 A;  5CQX A;  4HCC A;  5LJ3 h;  3CXC A;  4OB2 B;  4XK8 E;  3N5B B;  2DX1 A;  1B07 A;  3TRE A;  4LN2 A;  1QP2 A;  3CC4 A;  1KHI A;  1G2B A;  4Z89 A;  1D1C A;  2HAX A;  1BCM A;  2LQW A;  2QQR A;  1N6A A;  2KRO A;  1KQ1 A;  2HBP A;  1AWW A;  4RTY A;  2DEU A;  2K79 A;  1E7O A;  2AIR B;  3ULR B;  3CPF A;  2D8H A;  2O4X A;  4LUE A;  1SHF A;  1M2O A;  7AT1 B;  4JUV A;  1RAD B;  2DIL A;  3BDU A;  2GBQ A;  3NMZ C;  2NUP B;  1PG5 B;  5LJ3 e;  1IO6 A;  2DD4 A;  1XTD A;  1I8F A;  1ZSZ A;  4J9C A;  2QG9 B;  3EG9 B;  4ZTF A;  1X01 A;  4QW2 A;  3M56 A;  1W4S A;  5FU7 C;  5FRN A;  2ABL A;  1D0Y A;  2C0O A;  3HHT B;  1YP5 A;  3QG1 A;  5KE2 A;  2LX9 A;  2MF2 A;  1H8K A;  1YCY A;  1VQ5 Q;  1YHQ T;  3SDZ A;  3MEU A;  4ORZ A;  5CQY A;  3REA B;  2PVG B;  3V7R A;  5GAN 7;  3SFM A;  4KGZ B;  1QVF S;  4XU3 A;  1MUZ A;  1H3H A;  3G6E A;  3LGL A;  4F7U A;  3CCU Q;  3SWN A;  5HY6 A;  1ZSZ C;  3CCS T;  2P4T A;  2RHY A;  1UTI A;  4BB7 A;  2RK1 A;  1M1K C;  4OP0 A;  3CCJ T;  2EYZ A;  4JJC A;  1NZ9 A;  3C12 A;  2VB6 A;  2E5Q A;  1AD5 A;  1HYO A;  3CCL A;  5GMK m;  1ZX6 A;  3LLR A;  1Q7Y U;  1ABQ A;  4N0A A;  1FMW A;  1GCP A;  3M53 A;  2QQ9 A;  4BY6 B;  5CCA A;  4M7A B;  1OOT A;  1VQ8 A;  3M0Q A;  2RI3 A;  1H64 1;  2EJG A;  2D1X A;  3TCJ A;  4FCY A;  3HRS A;  5DLQ E;  2FZK B;  3UA6 A;  1LNX A;  3OYE A;  1PHT A;  4QQD A;  3QDR B;  5LJ3 j;  1RLQ C;  1KC8 C;  4NL3 A;  2KMT A;  5D6X A;  2CP6 A;  3VUB A;  2DAQ A;  4E7K A;  3OYH A;  1Y96 A;  1M2V B;  3QDF A;  4L5G A;  5GMK h;  2WAC A;  1S72 T;  2C0I A;  3IQL A;  1K0S A;  1GBQ A;  2QQS A;  1X43 A;  1JXO A;  3OYD A;  3JCM P;  2K57 A;  4Y92 A;  5I2M A;  5HK3 A;  3A1P A;  2X4W A;  2R57 A;  3JV3 A;  3CC2 Q;  2CH4 A;  2X35 A;  1AWO A;  1TU0 B;  2OTL T;  2ZCF B;  4OF1 A;  3MJX A;  2CP2 A;  1O9S A;  1JJ2 A;  2RHU A;  1KD1 R;  3UPU A;  3OS1 A;  1WI7 A;  5GMK e;  3M0P A;  1BIB A;  4C5G A;  4ZN3 A;  4PJO C;  4XAX B;  5GAO n;  1NBE B;  2IVW A;  1BBZ A;  2HQX A;  4JRI A;  4AMC A;  4CC2 A;  1UEC A;  3CC7 T;  1OUL A;  2DZC A;  2ZGW A;  2VVK A;  3H0F A;  2LCC A;  1YJW A;  4M78 E;  1WX6 A;  4X9D A;  4EMK C;  3R6O A;  2F1L A;  3C4S A;  2R58 A;  3HP9 A;  4CC3 A;  3CCE Q;  4Q5W A;  2DXT A;  2YXY A;  4JRQ A;  1VQ9 Q;  3C95 A;  2KYB A;  4KH1 B;  4AFU C;  4M7D A;  4LE9 A;  3PVQ A;  4A63 B;  1I0C A;  4KUL A;  2GF7 A;  3FJ5 A;  1RUW A;  4ZNX A;  1K9M C;  4X1V A;  4M75 C;  4E7L A;  2DZ9 A;  1K8A C;  3MCA B;  3L2R A;  1RAI B;  2K6D A;  1NLO C;  4JJN K;  4C92 D;  3V8J A;  3P8D A;  2NUT B;  1WFW A;  4F17 A;  4PNO A;  2FYK A;  5GAO r;  2LJ3 A;  4LNP A;  4EIK A;  1VQ6 T;  1PM3 A;  2LNV A;  1VQM T;  1Y57 A;  2QGF B;  1KHC A;  1F1B B;  2FO0 A;  2P0Q A;  3CQT A;  5IXB A;  2DLP A;  1YBY A;  3RIR A;  1WGS A;  4J5Y A;  3WVD B;  4M7D C;  3REB B;  4HA8 A;  1YFN A;  4DEY A;  3CC2 A;  1KD1 U;  1M8V A;  2QTX A;  1HK9 A;  1U06 A;  1BKB A;  3EG1 A;  2RN8 A;  1TOV A;  3PNW C;  5GMK j;  1VIF A;  2CZ6 B;  1QVG A;  4BE0 A;  2KVQ G;  5KH6 A;  2JM9 A;  3I55 A;  3CCS Q;  1R8O B;  1N5Z A;  3E19 A;  2AT1 B;  2V8I A;  3VS2 A;  4M77 C;  2PVD B;  1NPR A;  5A0D A;  1OU8 A;  3J80 E;  3LW5 E;  2LT1 A;  5AT1 B;  2K2M A;  2K5I A;  1X6B A;  3HRT A;  2YRC A;  4EDU A;  3JAM E;  1D0Z A;  2E4H A;  1VQK A;  1RL2 A;  1IRX A;  1VQL A;  1WXT A;  2VXF A;  4FIB A;  3JCM d;  1X6O A;  3DB3 A;  1OPK A;  1TXQ A;  2GTJ A;  1W6X A;  1Q81 R;  3S3N A;  2FPE A;  4PJN A;  4C5E A;  4PL6 A;  1JEG A;  4JS5 A;  2Z0W A;  1TWB A;  2LNH B;  3OYI A;  3NGP A;  4A4G A;  1BCO A;  5GJW B;  2K3X A;  2L2P A;  4F7U F;  3KXT A;  1GXI E;  1G8X A;  1ZUK A;  1Z9Z A;  2KGT A;  2HKN A;  3E9G A;  1TUD A;  2Y90 A;  3H8Z A;  1Q86 U;  3HL8 A;  5FWB A;  4F16 A;  4EMK B;  5I22 A;  2EBP A;  1YHQ A;  2YUP A;  2VGN A;  4C0Z A;  2QK0 A;  2KK4 A;  4J9G A;  1UGQ B;  4FYY B;  1GBR A;  5IXF A;  1G3S A;  1KIK A;  1QKW A;  1WHK A;  2DL7 A;  2J05 A;  1T0J A;  5CVI A;  3G4S T;  4FT2 A;  4RKU E;  5GAM d;  3HSB A;  1I4K 1;  4M75 B;  2LRQ A;  3CCS A;  1X27 A;  1JQQ A;  2LT4 A;  2JZ2 A;  4E7I A;  3SHW A;  1B7T A;  1QCO A;  4E6R A;  3CCJ A;  1N27 A;  1VIE A;  3I56 Q;  2SEM A;  3OW2 A;  1PSE A;  3RNJ A;  1KSW A;  2EPD A;  3CC7 Q;  3EAE A;  3VS4 A;  2QYZ A;  3I5S A;  2EGE A;  1Q81 U;  5LJ5 e;  5HKC A;  2K3Y A;  2V1Q A;  2MCN A;  2RM4 A;  2FRW A;  2M0O A;  1LVK A;  3M9Q A;  4J8O A;  8ATC B;  3VV0 A;  1ABO A;  4PJO F;  5CKE A;  3M4Y A;  3OYA A;  3EGX B;  1SSH A;  3JCM X;  2JS0 A;  2LQ8 A;  4KH0 B;  1NJI U;  5LJ3 g;  5KYY A;  1ZHI A;  2XK0 A;  1UGP B;  3EG9 A;  4PJJ A;  1X6G A;  2M16 A;  2KT8 A;  1VQ5 T;  2DNU A;  4AT1 B;  2KDS A;  1HSQ A;  3A98 A;  3NFC A;  2ZPH B;  2L5Q A;  2YWW A;  1QVP A;  6AT1 B;  1S72 A;  4BAC A;  2HDA A;  1QWE A;  3OS5 A;  3VRZ A;  5D6Y A;  5D6W A;  1X69 A;  1OYX A;  3I5R A;  4LUD A;  1RAA B;  4M75 F;  1MMA A;  1IHW A;  1SG5 A;  3CCU T;  2AHJ B;  3RKX A;  3EFO B;  3Q1J A;  2OTL A;  4OMQ A;  5EC7 A;  2K7A A;  2BIV A;  2CT4 A;  2EYY A;  3G1J A;  2DTO A;  3CCM T;  3CCQ T;  2ZPE B;  4C92 B;  4KUD K;  1UHF A;  1UGV A;  2F2X A;  4DQ2 A;  2K5L A;  1EFN A;  3O5Z A;  2E12 A;  1SF9 A;  4M7D F;  1G3T A;  4WCI A;  4PFO A;  2CGH A;  3DB4 A;  4FU6 A;  2ECZ A;  3CCV Q;  1UE9 A;  5CK9 A;  4JJB A;  1DJ7 B;  3EG3 A;  4HVU A;  4IUU A;  4RCC A;  1D09 B;  2AK5 A;  4J9F A;  1U8R A;  1VQ7 T;  1KC8 R;  3RKW A;  4BD3 A;  2D0Q B;  1U1S A;  2VUB A;  1WLP B;  1K73 R;  1YJN Q;  2RF0 A;  4M77 F;  2COW A;  1Q95 G;  1OI1 A;  2JMC A;  3RKY A;  1AHJ B;  1CKB A;  1MV3 A;  1WNL A;  2DYB A;  4OGE A;  4MZM A;  1VQP Q;  4IUR A;  4M78 G;  1M2V A;  4J9I A;  2XID A;  3BDL A;  4BY6 C;  3VU3 C;  3OYL A;  3QWY A;  1VQ6 A;  2VAS A;  4M7A C;  3GBQ A;  3M0U A;  1VQM A;  3TQ7 P;  3SB2 A;  5IH2 A;  2NLU A;  3RMS A;  4RG8 A;  2AKK A;  2G6F X;  2J6O A;  3MEA A;  2OTJ T;  3VS5 A;  1WHH A;  2DBK A;  5HCK A;  3VRY A;  2O2O A;  2KXD A;  3C0C A;  1KQS P;  3CME A;  4E7J A;  2DD5 A;  4HCK A;  4KT0 E;  4WF2 A;  1VYU A;  1NG2 A;  4F7U E;  3VYH B;  4XTW A;  4C8Q C;  1N8R R;  4ATO A;  3CMA A;  3G4S Q;  2YUO A;  4ZGE B;  1ZSG A;  3LWH A;  4E7Z A;  1JO8 A;  1I81 A;  3PT9 A;  4UC4 A;  4C5H A;  1SKU B;  4F14 A;  1LCK A;  4B9X A;  4J83 A;  4CRI A;  1XOV A;  1WPY A;  4LDW A;  2ZZD A;  3EHR A;  3CCE T;  1QLY A;  2Y4Y A;  4PJL A;  4YTL A;  1D0X A;  3ZBD A;  1JU5 C;  2CS7 A;  3UF4 A;  1VQ9 T;  3EGD B;  9ATC B;  1K73 U;  3MP6 A;  2MWP A;  4FYX B;  1VYT A;  2Y4X A;  2HZY A;  4C0G A;  2JM8 A;  2XI9 A;  4EMG A;  3CPW S;  5GAN d;  2L8D A;  3C94 A;  3T9N A;  1WIE A;  2YDL A;  2V26 A;  1PRL C;  2JNG A;  4R0K A;  2ENM A;  1XQH A;  1OZ2 A;  2CZ1 B;  3F70 A;  1NYG A;  1VQO T;  3S6W A;  4IUP A;  3OYN A;  3L2U A;  2PVO B;  3A8O B;  1OX8 A;  1ACM B;  3OB9 A;  4FW2 A;  1MGQ A;  4PJO E;  2KAF A;  1IHV A;  5GAN 5;  3P8B B;  2NWM A;  4IKF A;  1KQ2 A;  1VQ4 Q;  2P0K A;  1N8R U;  3RMQ A;  2L0A A;  2F69 A;  2SRC A;  1NPP A;  3JB9 J;  2E70 A;  2RHZ A;  1W2B S;  3GNG A;  2JTE A;  5J26 A;  3J81 E;  5KYW B;  2DO3 A;  4FYV B;  1KFZ A;  1M90 R;  2XDP A;  3EGU A;  3EFR A;  2AZS A;  2J6F A;  3QZ9 B;  3GIB A;  4TVR A;  1PNJ A;  4K11 A;  3E9F A;  3CCM Q;  4E7S A;  5LJ5 f;  3CCQ Q;  1G3Y A;  3ER0 A;  2VC8 A;  3X28 B;  3MEW A;  3GLX A;  4J6X A;  4BI3 A;  2CUB A;  1UJ0 A;  2VYT A;  3WXM B;  4OML A;  3X20 B;  5CKB A;  3OS2 A;  2VKN A;  3DLL A;  5DLO A;  5FU6 B;  4QKU A;  3JCM f;  2BZY A;  1NE8 A;  1RAG B;  2EJ9 A;  4OGC A;  2B8A A;  3GNF B;  1PD1 A;  1VQ7 Q;  1PKS A;  1QVF A;  2ROL A;  4M7D E;  5GAN 6;  4J7F A;  3LGF A;  2R5A A;  3OYM A;  3VUZ A;  1OZ3 A;  2FPF A;  3EFS A;  1TS9 A;  4QQ6 A;  4C8Q B;  2QEX Q;  2DIG A;  3X24 B;  2HL3 A;  3CXC P;  3E2U A;  1G5V A;  2RI5 A;  1ZA1 B;  4PJO A;  3UDC A;  2JT4 A;  1VQ5 A;  3L2Z A;  1AZE A;  1VUB A;  5KCH A;  3FIF A;  2RK2 A;  2A08 A;  4M77 E;  2DRM A;  3PIO A;  2OAW A;  4EMK A;  2LTO A;  4V2S A;  2L3R A;  3V7C A;  2EIF A;  3CCU A;  2OTJ Q;  3OYK A;  4BI4 A;  2EAY A;  2C0T A;  4LDY A;  4PFZ A;  3H6Z A;  4M75 A;  3PFS A;  4M7A F;  1V29 B;  3I56 T;  4OMN A;  1UGR B;  1FMK A;  1ZQ1 A;  2XDD A;  3OSS C;  3CCQ A;  4DOV A;  2RJD A;  4M7D D;  5L8R E;  3PIP A;  4ELY C;  2BUD A;  1Y07 A;  2A3L A;  4NL2 A;  4MDW A;  3OYF A;  3L2W A;  4C0D C;  2XDB A;  4N4H A;  1K1Z A;  3UT1 A;  5LJ5 g;  1UB4 A;  1PD0 A;  2EQI A;  2KYM A;  1NYF A;  4C8Q F;  2R5M A;  5CIU A;  1WA7 A;  1E6H A;  5LL6 S;  1JBM A;  2QA4 Q;  1VQ7 A;  2JTM A;  4AG1 C;  2DPP B;  4ESR A;  4LD6 A;  3G7Z A;  2DF6 A;  1BI1 A;  4OMF B;  2LDM A;  5CAI A;  4D8D A;  5EG2 A;  2O4X B;  4RTT A;  2VV5 A;  4CI0 C;  2EQJ A;  1VA7 A;  5DY9 A;  2E41 A;  2DXB A;  3EHQ A;  1Q7Y C;  4JJD A;  5KYX B;  1VQO Q;  1I07 A;  4M77 A;  2RMO A;  3A8L B;  2DL5 A;  1AWX A;  2DE0 X;  3HKS A;  1WHG A;  4HCB A;  2FZG B;  1ZUU A;  5GAO m;  5KYU B;  1KK7 A;  2DER A;  2QAZ A;  5DM7 R;  1OQK A;  4EMH A;  4OMP A;  4M78 D;  2V8J A;  2MAM A;  3EG0 A;  2EYQ A;  2KSS A;  2OTJ A;  2RNA A;  3L42 A;  1IZ6 A;  3KBG A;  3MPU B;  3G71 T;  1LPL A;  2D8J A;  1B34 A;  5C0M A;  4C92 A;  1PWT A;  2QTV A;  2RD1 A;  3OYY A;  2FVU A;  2MWO A;  3SWN B;  3CCV T;  1M1G A;  2GQI A;  2NYS A;  2E65 A;  4XU0 A;  3JB9 F;  1FX7 A;  4A54 A;  1MNE A;  3LH5 A;  3L2V A;  4OMO A;  3CCE A;  3JCM b;  1GFC A;  4RTW A;  1Q82 R;  1VQ9 A;  4A4E A;  1YJN T;  1V76 A;  4F7U G;  1ZBJ A;  3AT1 B;  1AWJ A;  2JMA A;  2LCS A;  4DBQ A;  3PTA A;  4C92 C;  3U23 A;  4DBF A;  1XNI A;  3JB9 I;  4XTZ A;  3HFN A;  1OX9 A;  3O8V A;  3PE0 A;  1YIJ Q;  2IIM A;  1VQP T;  2YUQ A;  2MYS A;  1I5L A;  1JJ2 P;  2GTO A;  3RDV A;  2D6F A;  3ZEH A;  4WTO B;  2F2V A;  4ZGD B;  1VQO A;  1YI2 T;  2BTT A;  2EYW A;  1TG0 A;  3OMC A;  1Y96 B;  2XHC A;  5I2S A;  4C0D B;  3RES A;  1WQW A;  2CSI A;  4C0F A;  1SEM A;  1X75 C;  2A7Y A;  3QJ6 A;  2CDT A;  5LJ5 h;  3L2Q A;  4LD9 K;  2ATC B;  1WHM A;  3EH2 A;  2J7I A;  1MHN A;  3FRN A;  2DIQ A;  2BE7 D;  3NPF A;  1KQS S;  3UA7 A;  1D1B A;  3G6E T;  2KT1 A;  1GL5 A;  5M9O A;  4ELZ C;  3VJP A;  3JCM c;  2DTI A;  4PJO G;  5C6S A;  1RAF B;  1M3C A;  1W70 A;  2K9G A;  3JCM h;  3TSZ A;  2HNI A;  1Q82 U;  1VOM A;  4XQ3 A;  3QKJ A;  2XD0 A;  1U3O A;  4E2F B;  1R0B G;  1SSF A;  1SRL A;  4OB0 B;  3FLG A;  4HKE A;  3PGG A;  1KD1 C;  4N4I A;  3JCM V;  2MI6 A;  2EKO A;  4GLK A;  1JXM A;  2M9U A;  1B3Q A;  2DL8 A;  5GAN f;  5IN1 A;  1VQ8 T;  1T0H A;  3EH1 A;  3M4G A;  1R77 A;  1AOJ A;  3JB9 H;  2NUP A;  5GAO q;  1MMD A;  3INZ A;  2EGC A;  2HSE B;  4M75 G;  1QVG P;  4XTX A;  2LCL A;  1SHG A;  1EIF A;  3CCR Q;  4MMK A;  2WSC E;  3A8G B;  2O31 A;  3JCM e;  1W1F A;  4GLM A;  1D1A A;  5FU6 C;  1H92 A;  2F5T X;  1WJS A;  2E10 A;  3AHU A;  3RUX A;  3M59 A;  2HQH A;  2JUF A;  5CR2 A;  4R56 A;  2A28 A;  5D7U A;  5AYF A;  3PMI A;  3QXE B;  2HL5 C;  1VQ4 T;  2D9T A;  2O01 E;  4DOW A;  5GAM h;  2RO0 A;  4OMM A;  2PTK A;  3HTR A;  2E1H A;  4AFQ C;  1UEB A;  4M7D G;  2YLB A;  2J6K A;  4PK4 A;  3M58 A;  3PVL A;  5IHI A;  1M1K R;  2DKG A;  4FYW B;  1JB0 E;  3G71 Q;  2RPN A;  3BE3 A;  3M5A A;  1QWF A;  4B9W A;  3I56 A;  2KRM A;  4M77 G;  4BI8 B;  2GGR A;  5GAM e;  2OAU A;  1IGU A;  5LJ5 j;  3CC7 A;  1Q86 C;  4FW1 A;  4VUB A;  1H3Z A;  4M7A A;  3QSU A;  5KCO A;  2GNC A;  1FMV A;  4M78 B;  2DA9 A;  1M9S A;  1GRI A;  1SRM A;  5GMK i;  3FEO A;  4XTV A;  3JCM Q;  2HSP A;  2H8H A;  3CC4 Q;  4XTU A;  2WSE E;  2JXB A;  1MMN A;  4RTX A;  3NHN A;  3QHS A;  3OYC A;  2M02 A;  4E7H A;  2EWN A;  2A37 A;  5LJ3 d;  2QEX T;  4HVV A;  2LJ1 A;  1FXX A;  4C8Q A;  1BB9 A;  2FL7 A;  3MP8 A;  4FSX A;  3V7S A;  1KJW A;  4QVD A;  1D3B B;  4CC7 A;  4KUI A;  3OW2 P;  2DET A;  3CXC S;  2X4J A;  1Q81 C;  3TU4 K;  3MET A;  1YI2 Q;  2RB6 A;  3NTK A;  2LQN A;  1M1K U;  1M4Z A;  4C92 F;  2YUN A;  1BIA A; 
#chains in the Genus database with same CATH homology
 2FO0 A;  2I0N A;  4OML A;  2FRY A;  2PNI A;  3CQT A;  5IXB A;  2DLP A;  1I1J A;  2VKN A;  2DMO A;  4RTZ A;  3REB B;  2MOX A;  4QT7 A;  2KNB B;  4DEY A;  2A36 A;  2KE9 A;  2BZY A;  2P4R A;  2E5K A;  1U06 A;  5GJV B;  1PKS A;  2D0N A;  2ROL A;  3EG1 A;  2RN8 A;  4IIO A;  3H0H A;  5ECA A;  4DEX A;  2FPD A;  2JM9 A;  2FPF A;  2ED1 A;  4M4Z A;  1G83 A;  1N5Z A;  3TVT A;  3VS2 A;  2JT4 A;  1M3B A;  2B86 A;  4JZ3 A;  2K2M A;  1AZE A;  1CKA A;  3EG2 A;  2KEA A;  3UAT A;  1X6B A;  2CSQ A;  2A08 A;  2DRM A;  1AEY A;  2DVJ A;  2OAW A;  5L23 A;  1M27 C;  1GCQ C;  1K9A A;  1X2Q A;  1WXT A;  4J9D A;  4AFS C;  2K3B A;  2BZ8 A;  2V1R A;  1OPK A;  4D8K A;  2GTJ A;  1W6X A;  2C0T A;  1PKT A;  4AG2 C;  2FPE A;  1CSK A;  2KXC A;  3SEM A;  3TSW A;  1BU1 A;  3I9Q A;  4OMN A;  2L3P A;  1FMK A;  1JEG A;  4KRT A;  4Z8A A;  3M0T A;  2LNH B;  1V1C A;  1AZG B;  3NGP A;  3QWX X;  5GJW B;  1NM7 A;  2L2P A;  2RQR A;  2CT3 A;  2OI3 A;  1ZUK A;  1K1Z A;  1Z9Z A;  2KGT A;  1S1N A;  1TUD A;  1GFD A;  1NEB A;  3VS0 A;  5FWB A;  2PZ1 A;  2EQI A;  2KYM A;  4F16 A;  5I22 A;  2EBP A;  1NYF A;  2YUP A;  2EW3 A;  2O9S A;  1WA7 A;  1E6H A;  4J9G A;  1HJD A;  4AG1 C;  1GBR A;  4ESR A;  5IXF A;  4FSS A;  4CC4 B;  1KIK A;  2YSQ A;  1QKW A;  2DF6 A;  2DL7 A;  2J05 A;  1T0J A;  3THK A;  2AZV A;  2LZ6 B;  2J06 A;  1WYX A;  2OJ2 A;  4D8D A;  1UHC A;  2VWF A;  4RTT A;  2X3W D;  1X27 A;  1UG1 A;  1VA7 A;  1E6G A;  1JQQ A;  2DL4 A;  2FEI A;  3EHQ A;  1ARK A;  3SHW A;  4E6R A;  4Z88 A;  4JJD A;  2NUZ A;  4IIM A;  1QKX A;  1I07 A;  2LX7 A;  1T3S A;  2JW4 A;  2SEM A;  1ZUY A;  2RMO A;  2DL5 A;  1VYV A;  1AWX A;  2DE0 X;  2BZX A;  3RNJ A;  1KSW A;  3KFV A;  2EPD A;  1ZUU A;  1UJY A;  1Y0M A;  2XMF A;  3VS4 A;  2EKH A;  3I5S A;  4OMP A;  2EGE A;  1BK2 A;  3EG0 A;  2V1Q A;  1FYN A;  2MCN A;  2HEQ A;  1SPK A;  1GCQ A;  2RNA A;  2FRW A;  3M0R A;  1QCF A;  1ABO A;  1ZLM A;  4J9E A;  2MIO A;  2D8J A;  2FG0 A;  1YN8 A;  1SSH A;  1PWT A;  2JS0 A;  1RLP C;  1T3L A;  2O88 A;  2W10 A;  2LP5 A;  2HBW A;  3RBB B;  1X6G A;  2GQI A;  5FWC A;  2EGA A;  2QDL A;  2L3S A;  2KT8 A;  2DNU A;  4RTV A;  1HSQ A;  3A98 A;  1PRM C;  2HDA A;  1QWE A;  1B07 A;  2DX1 A;  3LH5 A;  4OMO A;  4LN2 A;  3VRZ A;  2KRN A;  1G2B A;  1X69 A;  4Z89 A;  3I5R A;  4LUD A;  1GFC A;  2LQW A;  4RTW A;  3ZL7 C;  2KRO A;  5FW9 A;  1ZBJ A;  1AWW A;  1AWJ A;  2JMA A;  2LCS A;  4RTY A;  4JZ4 A;  3U23 A;  2YT6 A;  2K79 A;  1E7O A;  3ULR B;  5IHK A;  2D8H A;  4LUE A;  3PE0 A;  2IIM A;  4OMQ A;  5EC7 A;  2K7A A;  1A0N B;  1SHF A;  2YUQ A;  2JS2 A;  2EYY A;  2CT4 A;  2DIL A;  2GTO A;  2GBQ A;  2DJQ A;  3NMZ C;  3M0S A;  1UHF A;  3VS6 A;  2ED0 A;  1IO6 A;  1UGV A;  1YCS B;  2F2X A;  2KRS A;  2X3X D;  4AFZ C;  2RQT A;  2F2V A;  4JPB W;  1EFN A;  2CH4 W;  3O5Z A;  4J9C A;  2LMJ A;  1K4U S;  2ABL A;  4WCI A;  2CUD A;  2BTT A;  2EYW A;  1TG0 A;  2C0O A;  1OPL A;  1YP5 A;  2ECZ A;  1UE9 A;  3VS1 A;  2DRK A;  1H8K A;  2CSI A;  1SEM A;  1K0X A;  4JJB A;  3EG3 A;  4HVU A;  2CDT A;  2M51 A;  2AK5 A;  2J7I A;  4ORZ A;  3REA B;  4J9F A;  2DM1 A;  2EYX A;  1WLP B;  1MUZ A;  2RF0 A;  1H3H A;  3NPF A;  3UA7 A;  2JMC A;  2KT1 A;  3VS7 A;  4HXJ A;  1UFF A;  1GL5 A;  1UTI A;  1MV3 A;  1CKB A;  2DYB A;  3I35 A;  2EYZ A;  2O9V A;  4JJC A;  1M3C A;  1W70 A;  2K9G A;  3TSZ A;  1X2K A;  4J9I A;  1AD5 A;  1M3A A;  3QWY A;  1U3O A;  3GBQ A;  1ZX6 A;  5IHN A;  1SRL A;  4RTU A;  2F2W A;  3M0U A;  1ABQ A;  1J3T A;  1YNZ A;  5IH2 A;  1WDX A;  1GCP A;  1JXM A;  2AKK A;  3R6N A;  2G6F X;  2J6O A;  1OOT A;  1B3Q A;  2DL8 A;  3M0Q A;  5HCK A;  2DBK A;  3VS5 A;  3VRY A;  2AKL A;  2D1X A;  2O2O A;  2KXD A;  3C0C A;  1T0H A;  1AOJ A;  3UA6 A;  2EGC A;  1PHT A;  1RLQ C;  4HCK A;  2EVR A;  1VYU A;  1NG2 A;  1SHG A;  2O31 A;  1W1F A;  4GLM A;  1UDL A;  2YUO A;  1ZSG A;  1MV0 B;  1H92 A;  1JO8 A;  3H41 A;  4F14 A;  1LCK A;  4J9H A;  1XOV A;  2C0I A;  2A28 A;  3IQL A;  3VS3 A;  1NLP C;  3EHR A;  1QLY A;  1K0S A;  1GBQ A;  1YWP A;  1U5S A;  2KR3 A;  1X43 A;  1JXO A;  4OMM A;  1JU5 C;  3UF4 A;  2PTK A;  4AFQ C;  1RI9 A;  4Y92 A;  1VYT A;  2J6K A;  3PVL A;  2RQV A;  3JV3 A;  4J9B A;  5IHI A;  2CH4 A;  2JM8 A;  1AWO A;  1UUE A;  1WXU A;  1M8M A;  1WIE A;  2YDL A;  2HCK A;  1PRL C;  3H0I A;  4R0K A;  1K76 A;  2ENM A;  2RPN A;  1M30 A;  1WXB A;  1WI7 A;  1QWF A;  3M0P A;  1NYG A;  2KRM A;  2DBM A;  1HD3 A;  2GGR A;  1YWO A;  1OEB A;  1BBZ A;  2KBT A;  2RQU A;  2ESW A;  4CC2 A;  1UEC A;  5I11 A;  2DL3 A;  3H0F A;  2VVK A;  1TUC A;  2GNC A;  2DA9 A;  1WX6 A;  4HVW A;  1GRI A;  1SRM A;  2NWM A;  1NEG A;  2HSP A;  2ROT A;  2H8H A;  4CC3 A;  2JXB A;  1AVZ C;  4RTX A;  2L0A A;  2SRC A;  3NHN A;  4GBQ A;  2KYB A;  2L3Q A;  4AFU C;  2A37 A;  2JTE A;  4LE9 A;  3PVQ A;  4A63 B;  1I0C A;  3FJ5 A;  4HVV A;  1RUW A;  2LJ1 A;  4ZNX A;  4X1V A;  1KFZ A;  1Z9Q A;  2K6D A;  1NLO C;  3EGU A;  4RUG A;  2AZS A;  2J6F A;  1PNJ A;  4K11 A;  1BB9 A;  1KJW A;  1WFW A;  4F17 A;  4CC7 A;  2RQW A;  1OV3 A;  2LJ0 A;  2LJ3 A;  4LNP A;  2M0Y A;  4EIK A;  2CUB A;  1UJ0 A;  2CRE A;  2LQN A;  2W0Z A;  1Y57 A;  2YUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...