2GGRA

Solution structure of the c-terminal sh3 domain of c-crkii
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
GPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure and Folding Characteristics of the C-Terminal SH3 Domain of c-Crk-II
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Proto-oncogene C-crk
total genus 9
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ggrA00
1AD5A 1X6GA 2ENMA 1K4US 1UECA 2DL3A 3I35A 1KJWA 1TG0A 2DBKA 4OMNA 2DRKA 2KXDA 1VA7A 2DLPA 3TSZA 2XMFA 1WLPB 1BBZA 1UJ0A 2CUBA 1GCQC 1YN8A 1U06A 2DL8A 1Y0MA 1ZSGA 1WI7A 2L3SA 1UG1A 1E7OA 1WA7A 1I1JA 2IIMA 3M0RA 1KIKA 2A28A 2EPDA 3EHRA 3ULRB 2EYZA 1M3BA 3VS1A 2KEAA 2BZ8A 1H92A 2M51A 1PHTA 1SRLA 2DL7A 4OMPA 4RTZA 2LQNA 2CSIA 3SEMA 1KSWA 2LNHB 1WFWA 1UGVA 2M0YA 2V1RA 2LJ0A 5IHNA 1GCQA 2BTTA 2DBMA 3TVTA 1YCSB 1FYNA 3GBQA 2HDAA 1UE9A 3REBB 1PRLC 2DL5A 1G2BA 1GBQA 2J6OA 3KFVA 1NYGA 2KRNA 2YUPA 2EGCA 2MCNA 3QWYA 4OMLA 4LUDA 4WCIA 5IXFA 1JXOA 1N5ZA 1ZLMA 3H0HA 1SHFA 1WDXA 1QKWA 2CT3A 3UA7A 2P4RA 3H0IA 1OPKA 2VVKA 4A63B 3VS0A 2K6DA 5IH2A 1NLOC 1JO8A 5I11A 2L3QA 2D0NA 2ROLA 2KBTA 5L23A 5IHIA 2RQRA 1K1ZA 2LQWA 1PNJA 1A0NB 3REAB 1WXTA 2KE9A 2CH4A 1UJYA 2ED0A 2O31A 3VRYA 1I0CA 2SEMA 2NWMA 2V1QA 4FSSA 2SRCA 1K76A 2DF6A 2PNIA 2K2MA 1Y57A 3EG1A 2FRWA 1B3QA 2F2VA 2DM1A 3NPFA 4LN2A 1NLPC 1UHCA 2JM9A 2JMAA 4J9DA 2X3WD 1EFNA 2J7IA 3M0SA 1SRMA 2KGTA 4AFZC 3RNJA 2VWFA 3UA6A 1NEGA 1ZBJA 3TSWA 1QWEA 2RF0A 1PWTA 2K7AA 2A37A 1GL5A 1B07A 1FMKA 2LCSA 3M0QA 3O5ZA 4J9IA 3VS2A 1PKTA 3EGUA 4RTWA 4J9FA 2JW4A 1JEGA 2MIOA 2ECZA 1CKAA 2LP5A 2KR3A 1JQQA 1QKXA 3SHWA 2O88A 2EYYA 1NEBA 1I07A 2OI3A 1WX6A 1M30A 1Z9ZA 1UFFA 1NG2A 1X43A 4F16A 1W1FA 2W10A 2PTKA 1AZGB 4CC4B 2FPDA 1JU5C 3M0UA 3EG3A 4D8KA 5IHKA 2ESWA 4HVWA 4RTVA 1M27C 2FG0A 3IQLA 2AZSA 1LCKA 4AFQC 2DYBA 3I5SA 2DJQA 2KYBA 2ABLA 3ZL7C 4IIOA 3FJ5A 1UHFA 2DE0X 2FPFA 4OMMA 4ZNXA 2GTJA 3C0CA 4RUGA 2KRSA 2EBPA 2RQVA 1OEBA 1ZUYA 2FRYA 1YNZA 4GLMA 1AZEA 1QLYA 1J3TA 4Z89A 1X6BA 1YP5A 1WYXA 2AZVA 1HSQA 5GJVB 2HSPA 3EG0A 3UATA 4IIMA 4J9EA 4KRTA 1K9AA 5EC7A 2AKLA 1X2QA 2QDLA 5FWCA 2GGRA 3VS4A 2NUZA 2PZ1A 3JV3A 4AFSC 2F2XA 1E6GA 2C0IA 2LMJA 3M0PA 1X2KA 1GCPA 1ABQA 2F2WA 1TUDA 4Z88A 2KYMA 1H8KA 3NGPA 2RNAA 2D8JA 3I9QA 2ED1A 4DEXA 2W0ZA 1T0JA 1SHGA 3M0TA 4RTXA 1AOJA 1MV3A 1QCFA 3THKA 2DA9A 2EQIA 1HD3A 1JXMA 2RQTA 4F17A 1WXBA 3PVLA 4Y92A 2YT6A 1T3LA 2D1XA 2RPNA 5FW9A 1ZX6A 1HJDA 2JMCA 1MUZA 4RTUA 2CSQA 2GTOA 1PKSA 1GFCA 4DEYA 1U5SA 4JJCA 1X69A 2JM8A 2I0NA 1RUWA 2HEQA 4X1VA 2O9SA 2BZYA 3LH5A 2A08A 2EYWA 2J6FA 1ABOA 1BU1A 1BB9A 4J9CA 1VYTA 4OMOA 2DX1A 2MOXA 3I5RA 2KNBB 4JPBW 2O2OA 1VYVA 1E6HA 4GBQA 3NMZC 4CC2A 2EGEA 5ECAA 3R6NA 3VS3A 4AG1C 1YWPA 1G83A 2YSQA 2J6KA 2B86A 4J9BA 2FEIA 4AG2C 1GBRA 2H8HA 2KROA 2GBQA 2OJ2A 1AEYA 1UUEA 2CUDA 2EGAA 1SEMA 4ESRA 2DL4A 3VS7A 1W6XA 2D8HA 1M3AA 4EIKA 1TUCA 3UF4A 2OAWA 1X27A 5IXBA 1BK2A 4HXJA 1CSKA 3EHQA 1AVZC 2YUNA 3EG2A 3RBBB 1S1NA 2RQWA 2JXBA 1YWOA 2DRMA 2JS2A 3VS5A 2G6FX 1PRMC 4E6RA 1ZUKA 1ZUUA 1T3SA 1OV3A 2JS0A 1GFDA 4ORZA 2C0OA 4HCKA 2K9GA 2YDLA 2J05A 1QWFA 2A36A 2RQUA 2FPEA 4HVUA 1RLPC 1XOVA 2RN8A 2EVRA 1UDLA 1SSHA 4JJBA 4RTYA 3VS6A 1V1CA 1W70A 3PE0A 2EKHA 4JZ3A 1WXUA 1T0HA 1H3HA 2DMOA 2EYXA 2ROTA 1OOTA 5GJWB 2KT1A 2YUQA 4LE9A 3VRZA 1IO6A 2K79A 3H41A 2LJ3A 1GRIA 1UTIA 2HBWA 5HCKA 2AKKA 2O9VA 2J06A 2K3BA 2E5KA 1AWWA 4CC3A 1M8MA 2AK5A 2GNCA 1ARKA 2KXCA 4CC7A 2DVJA 2JTEA 2HCKA 2BZXA 1K0SA 2GQIA 1M3CA 4AFUC 4R0KA 1AWXA 3H0FA 3CQTA 2DILA 3A98A 1RI9A 1WIEA 3PVQA 1K0XA 4OMQA 4F14A 1NYFA 4K11A 1SPKA 4JJDA 1CKBA 1MV0B 5I22A 2LX7A 2LZ6B 2KT8A 4J9GA 2FO0A 2X3XD 4LNPA 2CT4A 4RTTA 2CH4W 4D8DA 4QT7A 1NM7A 1KFZA 1RLQC 2LJ1A 1AWOA 2L0AA 2YUOA 4J9HA 2JT4A 2DNUA 4M4ZA 3QWXX 4JZ4A 2KRMA 2CREA 4Z8AA 2L2PA 5FWBA 2VKNA 4LUEA 1U3OA 1VYUA 2CDTA 2EW3A 1Z9QA 2L3PA 3U23A 1OPLA 3NHNA 2C0TA 4HVVA 2RMOA 1AWJA
chains in the Genus database with same CATH superfamily
3OS5A 2ENMA 2P0PA 1EZZB 1B7TA 3CC2Q 4EDUA 1IGUA 3E1SA 4QQGA 4BY6B 1K9MC 3A8OB 4N4GA 1WLPB 3V8KA 3CBOA 3CMAQ 2KSSA 1GCQC 3UWNA 3CMET 1YJ9T 3FJPA 1VQ9Q 2A28A 4XTZA 3V7RA 4LDVA 3G6ET 2X35A 1M3BA 1WNLA 2KEAA 4LDWA 1PCXA 7AT1B 5I21A 2DL7A 4OMPA 4PLLA 4RTZA 2LQNA 2V1RA 4C8QB 4L5GA 1BYMA 4DBFA 1FYNA 2NUPB 4A4HA 2DEQA 1G3TA 4M78E 2J6OA 2KI7A 2KRNA 3GPLA 2EGCA 1NPPA 2MCNA 3LWHA 1D0XA 3QDRB 3CCLQ 2QTXA 4Q5WA 1ZLMA 2XI9A 3HP9A 4ZN1A 5GMKi 3M56A 3OYHA 1SHFA 1TTHB 2CT3A 3UA7A 2P4RA 3OY9A 2K4YA 3C94A 2VVKA 2WSFE 1TUGB 3CMAT 3GIBA 1NLOC 1JO8A 5I11A 4M7AA 1TXQA 1WHHA 1KC8C 4M7DE 3HRTA 1M1KU 1M1KR 4C0DB 1YHQT 1PNJA 1A0NB 2RJCA 3TEEA 3OS1A 4KGXB 4PJJA 2ED0A 5LJ5e 3TU4K 2V8IA 3M5AA 2NWMA 3WXMB 2LVMA 3V7SA 3G7ZA 1K76A 2PNIA 1YI2Q 4FYVB 4LN2A 5DM7R 3VJPA 1YIJT 1UGSB 3QZ9B 2JJ9A 2X3WD 3M53A 1XQHA 2XDPA 4PJOD 3OA6A 1HYOA 1OZ3A 3JCMV 5HKCA 1VQOA 2E41A 3BE3A 1ZBJA 1QWEA 3QYGB 1Q82U 2OTLQ 3S3OA 2K7AA 4M77C 1B07A 3PT9A 2LCSA 3O5ZA 3CCST 1D09B 1HK9A 3TCJA 2XHCA 1N6AA 2A0FB 4J9FA 1UEBA 2JW4A 4BD3A 1QVFP 2RB6A 4FW1A 2ECZA 3I56Q 1ZHIA 4EPCA 1KD1U 3CCMA 4GY5A 3CBMA 4NOYA 1V76A 1VQ6A 3LWIA 1I07A 3CCVA 1Z9ZA 1NG2A 2DD5A 4DBQA 2DJZA 4AMCA 1WJQA 4JRKA 1MMDA 2A7YA 2DAQA 2QYZA 2LT1A 1K8AC 3L2RA 3PMTA 4FW2A 5GAN7 1G8XA 2HSEB 2AZSA 4AFQC 3MP8A 3LGLA 3JB9J 3QIIA 1D0ZA 5IAYA 5KYUA 1RAHB 4BI8B 2GTJA 2ZPHB 3JB9I 4RUGA 3RMQA 1QLYA 4M77E 1J3TA 2E64A 3ZBDA 4Z89A 1WHJA 1X6BA 1WYXA 2AZVA 2OTJQ 1WHMA 4RCBA 2HSPA 3EG0A 3UATA 4C92B 1VQ5T 3QUIA 4A4KA 3CXCS 4KRTA 4M78F 1U8RA 5I2SA 2VYTA 4KULA 2RHZA 1OU9A 1D1AA 1PD1A 2DETA 2PZ1A 2F2XA 1MNDA 1X2KA 2F2WA 1D1CA 3HFOA 3VYGA 5GAN2 3NTIA 2RJDA 3UDCA 5FU6C 2EFIA 1SHGA 2E10A 1QCNA 1QCFA 2K5IA 4A4GA 2EQIA 1JXMA 2E4HA 2YXYA 5IT9E 9ATCB 2G3RA 2E65A 3PVLA 1T3LA 2DO3A 2M0OA 4C92E 2L5QA 1KC8U 1BI1A 1KD1R 5FW9A 1HJDA 1MUZA 2CSQA 1VQLQ 3BFMA 1OZ2A 4VUBA 3JRZA 1X69A 4KH0B 4RG2A 3GNFB 2BE7D 5KYWA 2BZYA 2JNGA 1O9SA 2A08A 4XTVA 2J6FA 1ABOA 1FWZA 2CP0A 4OMOA 3I5RA 4M78C 2MYSA 3DLMA 4JPBW 5GAN6 2O01E 2B8AA 1JBMA 3BDLA 2KY9A 4DBHA 4J5YA 2YSQA 2XG8D 5KE2A 4DA4A 2ZZDA 2B86A 4BUGA 5KE3A 2MF2A 4J9BA 3PIPA 4AG2C 1YJWQ 2H8HA 5HK0A 2GBQA 2OJ2A 1WQ7A 1QVPA 1SEMA 2GQVA 2P84A 4M75C 4ESRA 3D7SB 2D8HA 4EIKA 4F7UG 1OYXA 2LTOA 1Y07A 2H3EB 3VUZA 4LXCA 2IG0A 3EG2A 3EGXB 3M9QA 3RBBB 4B9XA 4ZGJB 2RQWA 3CCVQ 2JXBA 2MWOA 1NZ9A 3CPFA 2VB6A 3VS5A 1PRMC 5GAMf 1TSFA 3M55A 3G6EQ 4E7HA 2R58A 1GFDA 2C0OA 5KYNA 2M16A 1ZSZA 2RQUA 2EVRA 1R77A 1SSHA 4JJBA 2LDMA 2HBPA 1WXUA 1VQ6T 1T0HA 4ZTJA 1WJRA 2YRVA 2DMOA 2XICA 2KT1A 3MP6A 2IPOB 1BI3A 2VV5A 2YUQA 4D6WA 4R56A 3H41A 2E12A 1GRIA 1M8VA 2K3BA 2E5KA 1AWWA 4M77F 5CCAA 1G3YA 1W2BA 3QXEB 4M77G 1ARKA 4MDWA 2KXCA 4IUUA 3S3NA 1VQ8A 1P92A 5D7UA 1M3CA 3OMCA 1S72A 3CQTA 4M77A 4IKFA 1RI9A 1KK7A 1K0XA 2DTIA 1M1KC 5GAOq 3JCMg 2OX7A 3OBYA 5KYYA 3MKDA 1VQOQ 3A8LB 5KYWB 3CD6Q 4J9GA 3QHSA 8AT1B 2AT1B 4PJNA 2QG9B 4FT2A 3EGDA 3OYYA 2ZAEA 5CK9A 1Q7YR 3OSSC 5EG2A 3I55Q 1AWOA 2L0AA 5GANg 2DKGA 4OP0A 2KRMA 2CREA 5GAOm 3MJXA 3CCUQ 5FWBA 4F7UF 1NPRA 1QVGS 1M90C 4LD6A 4HA8A 1IRXA 5GANd 3U23A 4OMFB 2K5FA 3NHNA 4E47A 3CCQQ 4ANJA 1QVGA 2HKQB 1X6GA 1K4US 2DL3A 2V8KA 3I35A 4X9DA 2E1HA 1TG0A 2DBKA 5HK3A 2RK1A 2KXDA 1FXXA 2FYKA 2QQRA 4CRIA 1BBZA 4QVCA 4F7UA 1N9RA 1UJ0A 1D0YA 1NBEB 1MMGA 4N0AC 3CCUT 1YN8A 1U06A 3GP8A 4CI0C 1WI7A 2ZCFB 5LJ5g 1VQMA 1I1JA 3H9NA 1KIKA 2OTJA 4C92A 3VS1A 1N9SA 3F70A 2V8JA 2BZ8A 2M51A 3JB9G 3SEMA 1KSWA 2M0YA 3OW2A 3V8JA 1GCQA 5GANe 3TVTA 1YCSB 2O4XB 2RO0A 3GNGA 2NLUA 3GBQA 2P4TA 3MCAB 4NS5A 2HDAA 3REBB 3INZA 1PRLC 4Y28E 2JTMA 2YUPA 3QWYA 3LX7A 4WCIA 5IXFA 5FRNA 4N0AA 1N5ZA 2PQWA 2CP6A 1WZOA 2Z0WA 3ZFJA 1IREB 1QKWA 4II1A 3A8HB 4PFZA 1N8RC 1Q7YC 2BIVA 4A63B 3VS0A 5FU6B 5CQYA 5KYYB 2K57A 1YHQA 2L3QA 3TREA 2D0NA 3N5BB 4J7FA 1M1GA 5KCOA 2KBTA 2QGGA 5L23A 8ATCB 2LQWA 1Y96B 2RHXA 3L1AA 1VQNT 3BY7A 3JB9D 3J7AF 4HKEA 3H8ZA 3VRYA 4C0GA 2HMAA 5GAOl 4C92C 4M7AC 2DF6A 3CPWA 3KBGA 2FZKB 1S72Q 2FRWA 2F2VA 3NPFA 5GANf 2XDBA 3JCMc 1NLPC 1UHCA 4LDXA 3OQ5A 2HAXA 3M0SA 4BE1A 1VQNA 2KGTA 4AFZC 3RNJA 2DIGA 2K2VA 1Q82C 4IUVA 2D9TA 2L8DA 2LQ8A 2QA4T 4PK4A 4Y91A 2RI3A 2NUTA 3M0QA 2VGNA 5AT1B 3I55A 2KK4A 4JRQA 1PKTA 3EGUA 3QPHA 1S72T 1OULA 1LOJA 2FZCB 5GMKl 4EMHA 2GFAA 4QVZA 3M57A 1CKAA 3G6EA 2LP5A 3FB9A 4FIBA 5C6SA 3OYFA 3CCQA 1QKXA 4M75E 3G1JA 2XIDA 1FMVA 1UFFA 1X43A 1VQ7A 1W1FA 2W10A 2PTKA 1LNXA 2E3IA 2LRQA 1OI1A 2CGHA 4P5NA 2OAUA 4OB3B 4D8KA 5IHKA 5I2MA 3PNWC 1KHCA 4E7JA 4RTVA 2FG0A 1VQMQ 1LCKA 2DYBA 2EAYA 4IIOA 5D6YA 3OYAA 2XKOC 4OMMA 2KRSA 3JCMe 1YITT 1OEBA 2DZCA 1YNZA 1AZEA 4HCCA 2F1LA 3OYDA 4C5HA 1YP5A 4OF1A 1HSQA 5FLXE 3OW2S 1UGRB 1VQKQ 3GOXA 1K73R 3OYIA 3WVDB 2DYIA 1Y96A 4F7UE 2QDLA 2KQWA 4AFSC 2RHUA 3JV3A 2AHJB 4XTUA 4A54A 2LMJA 3S6WA 2GCXA 1TUDA 2KYMA 1H8KA 1VQ4T 4LDYA 2RNAA 2RJEA 1VQ4Q 1MHNA 4XTXA 1T0JA 3X20B 4J83A 4UC4A 3SDZA 1BI2A 3M0TA 4QVDA 2EQKA 3CCRT 1AOJA 3THKA 2IVWA 2DA9A 1HD3A 2ZPFB 2RQTA 1G5VA 3FRNA 1WXBA 1VQ9T 2YT6A 1PC0A 1SSFA 5GANj 3CCVT 2ZGWA 1RACB 1QP3A 3MEWA 4RTUA 1Q81U 2GTOA 1YJNT 1NJIU 2H3JA 2HD0A 5CIUA 3JCMf 1SKUB 2CYZB 1GFCA 4IURA 2E5QA 2HEQA 5A2QE 3L2UA 1MMAA 3LH5A 4M75B 2EYWA 2KNBB 1QQJA 2WACA 1HXDA 1VQ9A 4FCYA 5A0GA 2O2OA 1VYVA 1E6HA 3X28B 4EMKC 3RUXA 2EQUA 3SWNB 4LDUA 4OB0B 1G83A 1NJIC 1YJ9A 1GBRA 1RAFB 3A1PA 3EFOB 2EGAA 4V2SA 3EH2A 3C95A 5KH6A 4A53A 1M3AA 4JLIA 5KYXB 3OBWA 3SD4A 4ME7A 5IXBA 3EHQA 2YUNA 3SFMA 1S1NA 4J8OA 4M75F 4J6WA 1YWOA 2DRMA 1EIFA 3QO3A 3SWNA 1RL2A 4E6RA 4ZGDB 1K9MR 4C92G 2CZ1B 2JS0A 2FHDA 2VXFA 4ORZA 1YI2T 1QWFA 1PSFA 2A36A 1M2VB 1EX4A 3RERA 2OTJT 5CQXA 4RTYA 3G4ST 1V1CA 1W70A 3PE0A 3JCMd 3C4SA 1OX9A 2K3YA 1KC8R 2MI6A 1YFNA 4AT1B 3JSCA 4O5VA 2LJ3A 4M77D 2HBWA 2EYQA 5HCKA 2BUDA 1C6VX 3HSBA 4M75A 3HTRA 2X4JA 1YI2A 4BDZA 2WSCE 2AK5A 2GNCA 1K8AU 1VQOT 5FU7B 2CS7A 1VQ7T 2K5LA 1DJ7B 1JB0E 3CC7A 2DERA 2YLCA 2DVJA 3FLGA 2JVVA 1K0SA 3CC2A 4AFUC 4R0KA 5GMKm 3H0FA 1O75A 2ZPGB 3A98A 1WIEA 2K3XA 3CMEQ 4F14A 3QZ5B 4KGZB 1MV0B 1JJ2A 2LX7A 2P0KA 4BB7A 2O4XA 2FO0A 2QGFB 5M9OA 4RTTA 4HCZA 4QT7A 3CC2T 3DKMA 3C12A 3OYCA 5GAMj 3VYHB 2DNUA 2V26A 2E70A 4M4ZA 3QWXX 4JZ4A 1ZQ1A 2L2PA 3JCMJ 3HRUA 2VKNA 5KYUB 1VYUA 2EW3A 3OYNA 1M9SA 1Z9QA 4M7DG 3G71Q 2ZPIB 4KGVB 2RMOA 3CCLA 1AD5A 1Y7XA 1GXIE 2HQEA 2JTFA 5C0MA 1KJWA 3QG1A 3URGA 1VA7A 2DLPA 1XTDA 2E6NA 2XMFA 3HHTB 4M77B 3L42A 3ER0A 3CEYA 1YHQQ 2L3SA 1UG1A 3OYBA 2DXTA 1VIEA 3A8GB 2IIMA 3CCEA 4LD9K 1OQKA 2R5AA 3RR6A 3CD6T 4PJLA 2RHYA 3X24B 3L2WA 2CSIA 2LNHB 1UGVA 4BI3A 2LJ0A 4RCCA 2BTTA 1AHJB 4J7IA 3JB9F 3CCJQ 1UE9A 3VUBA 2X9HA 1G2BA 4KH1B 1GBQA 3RKWA 2JUFA 3HKSA 3HPWA 1VUBA 4C0DC 4F04B 1JXOA 4PJOC 3CXCP 3H0HA 1D3BA 4HCBA 3BDUA 3OYMA 1WDXA 2R5MA 1WHGA 3G4SA 3J81E 4M7DC 1QVFA 3CPWP 1OPKA 4KBMB 1K8AR 4JUVA 2K6DA 2D0QB 5IH2A 4IUQA 4DOWA 3MEVA 5DLQE 1X6OA 5GAMd 4JLGA 4E2FB 5GMKh 5IHIA 2KVQG 5KCHA 5GAN5 2RQRA 1H3ZA 4M7AE 3OS2A 2EIFA 4RG8A 3REAB 1WXTA 2KE9A 4M7DA 2CH4A 1UJYA 2O31A 3P8BB 4M75D 2DTOA 1M2VA 2SEMA 3A5ZB 1N8RR 2LQKA 2SRCA 4EMKB 5AYFA 2K2MA 3EG1A 1B3QA 4FM4B 2Y4XA 4FYYB 3RESA 2JM9A 2JMAA 3QDFA 2RD1A 1EFNA 2J7IA 1YJ9Q 1SRMA 1VQMT 5GAOp 4FYWB 2VWFA 1NEGA 3TSWA 2QQAA 1I4K1 2QAZA 1M90U 4MZTA 2A37A 1GL5A 3LGFA 2GF7A 5A0LA 3DB3A 4J9IA 4IUTA 3J80E 3Q1JA 2KAFA 2EJ9A 4QKUA 1IB8A 4KT0E 3EFOA 1JEGA 4A4FA 1PM3A 4WTOB 2F69A 2KR3A 2X4WA 3OB9A 1JQQA 4PFPA 3G71A 1BIBA 5GAN4 4C8QG 1VQPA 2EYYA 1NEBA 2OI3A 2QK0A 1M30A 3RKYA 3VU3C 4WF2A 5GAMg 3MP1A 4F16A 4BE2A 5LJ5h 3CCQT 4OGCA 1JU5C 5GAOn 1JJ2P 4PJOG 2NYSA 1IZ6A 3CCJT 4HVWA 2JN0A 1M27C 1Q81R 3QKJA 2X4YA 3I5SA 2HL5C 2ABLA 1Y71A 3CCLT 3ZL7C 3FJ5A 4XQ3A 4XU2A 3EGXA 3JAME 3T9NA 2R57A 3C0CA 1RI0A 2EBPA 1H641 2RQVA 5D6WA 1ZUYA 4GLMA 4MMKA 5GAMe 1PG5B 2DPPB 3M4GA 3EFSA 3FC3A 3TQ7P 3CCMQ 4PNOA 3JCMX 1YCYA 1X2QA 4C5IA 5IN1A 4OB2B 4EMGA 1QCOA 3CD6A 2QQ9A 1E6GA 3PGGA 3M0PA 2L3RA 1UB4A 4Z88A 1MMNA 3EAEA 3VKIA 5HY6A 2DTHA 3CBPA 4DEXA 2W0ZA 3DB4A 3EG9A 1QMCA 1W2BP 3CCUA 2EQJA 3JCMP 4N4IA 4QW2A 4Y92A 3CCRA 4M7DD 5CKFA 1ZX6A 5LJ3j 2JMCA 3JCMb 3L2QA 1KQ2A 3LLRA 1PKSA 5CVIA 4ZN3A 4HT9A 3S3MA 1U5SA 3UPUA 1RUWA 4X1VA 1TWBA 1U1TA 5LL6S 3M4YA 1R0CB 2QEXT 1BU1A 1BB9A 2FL7A 2DX1A 4JS4A 1ZBXA 2ATCB 3M59A 4CC2A 1KHIA 4M7AB 4E7LA 5FU7C 4AG1C 3OYEA 4DOVA 5LJ3d 2FEIA 2KROA 3CCSQ 4XU1A 4E7IA 1AEYA 3A8MB 2CUDA 4M78G 1M4ZA 4X9CA 1YIJA 3CCEQ 2C06A 2EWNA 2DXBA 4PJMA 3UF4A 2HZYA 3L2ZA 5LJ5j 1WJSA 1D3BB 2PUOB 1RADB 1YITA 2PU9B 2BE9B 2DZ9A 4BI4A 1KD1C 1VQ8T 2LT4A 2JS2A 2DXUA 2DXCA 4C8QE 2CP7A 1T3SA 4KUDK 4PJOE 1KQSA 2J05A 2EJFA 2FPEA 1XOVA 3NTHA 1UDLA 3CCMT 1R0BG 2RHIA 5GAN8 2RI2A 3GF5A 3MHXA 5FRMA 2VC8A 2CZ0B 1LPLA 4J6YA 2D6FA 2EKHA 4MMLA 4JZ3A 3OMGA 1WHKA 3G4SQ 1I5LA 3JB9H 1H3HA 2EYXA 2ROTA 5J26A 2QQBA 1JJ2S 4OGEA 3L2VA 2CP2A 1IO6A 1TU0B 3AT1B 3PMIA 5CKDA 2AKKA 3G71T 1W2BS 5GAOr 2J06A 2MK5A 2YRCA 1Q81C 4CC3A 2FB7A 4JS5A 2HNIA 1Q95G 2Y4YA 1IGQA 1VQ5A 2XD0A 4C5EA 4ZGEB 1C0MA 4CC7A 2M1HA 4E7KA 2JTEA 2BZXA 2QASA 1FX7A 5L8RE 1G3WA 3I55T 3NTKA 2DFUA 3CXCA 1AWXA 2E3HA 4JJNK 2AIRB 1SG5A 4OMQA 4IUPA 1XJWB 3DLLA 1NYFA 4K11A 3QJ6A 4FL6A 1K73C 2LZ6B 1M2OA 2NUPA 4LNPA 2RJFA 4JRPA 2BKDN 2CH4W 4D8DA 3X25B 4XTYA 4M7AG 2XDDA 2MWPA 4J9HA 3CCRQ 2JT4A 4FSXA 4ATOA 3R6OA 5CO7A 4Z8AA 2RK2A 3I56T 3PFSA 1OX8A 4KUIA 2CDTA 1LVKA 1R8OB 2L3PA 3JCMQ 3CC4A 4X34A 2M9UA 1KQ1A 4C92D 1VQPQ 1X01A 2QEXQ 1UECA 2YLBA 2NUTB 3EH1A 1WPYA 1Q82R 4OMNA 3LW5E 2DRKA 1QVGP 3TSZA 1NJIR 2CUBA 3PTAA 5GAMh 2F5TX 2DL8A 4M78A 2PVDB 1Y0MA 1ZSGA 1V29B 2QQSA 2RH2A 2HQXA 3PIOA 1QVFS 1E7OA 1IHVA 1WA7A 3M0RA 2EPDA 2L89A 3EHRA 1U1SA 3QJYA 3ULRB 2EYZA 5KYXA 3M58A 3JCMW 1N8RU 3BW1A 1H92A 5CR2A 1PHTA 1SRLA 3OYKA 1WFWA 4YTLA 5IHNA 3M54A 5LJ3e 2DBMA 3LYIA 1MGQA 2I2LA 2DL5A 1WQWA 2LCCA 3QYHB 3KFVA 1NYGA 1RAIB 4MZPA 4OMLA 4LUDA 4NL3A 3E9FA 5GANh 1QW1A 2QA4Q 3SWNC 4BDYA 5J3BA 1BKBA 4OB1B 5FROA 1RAEB 3META 5LJ5f 4L59A 3H0IA 1G3SA 2KDSA 1KQSP 2DD4A 1WGSA 1FMWA 4XK8E 2RI5A 5GMKe 4QQ6A 4M7AD 2ROLA 4PJOA 4M7DF 4M7AF 1K1ZA 1PD0A 1NE8A 4HT8A 4A4EA 4J6XA 1LJOA 3HRSA 2VASA 2LC4A 3OSVA 2RM4A 3CPWS 3FIFA 1I0CA 4C8QA 2V1QA 4FSSA 1UGPB 4XTWA 2PVGB 5LJ5d 3MPUB 2DEUA 1Y57A 4PFOA 2DM1A 5LJ3f 1K9MU 5LJ3g 3E2UA 4M7DB 2ZPEB 4J9DA 4QQDA 1VQ8Q 4C8QF 4GLKA 3UA6A 4PJOF 1TS9A 3ZEHA 2RF0A 3OYJA 1PWTA 2ZPBB 1C1AA 4RKUE 1FMKA 1PSEA 2YRDA 4ELYC 4O6JA 3VS2A 3O8VA 3HL8A 1OU8A 4RTWA 3RIRA 4ZTFA 5CKEA 2JZ2A 2MIOA 2CP5A 1VQKA 2LX9A 3CC4Q 3OS0A 3E19A 2O88A 3SHWA 2VUBA 5CKBA 1YITQ 1VQNQ 1N27A 5CKHA 1ZSZC 1WX6A 5GMKj 4FT4A 3E9GA 4E7SA 5CAIA 4EMKA 4MZMA 1AZGB 1Q7YU 4CC4B 4C8QD 1VQPT 2X51A 2FPDA 1Q86C 3CMAA 3RKXA 1ACMB 1WHLA 3M0UA 1I81A 4FYXB 2WSEE 3EG3A 3EFRA 2ESWA 2YWWA 2LNVA 1VQ4A 4B9WA 1VQKT 2COWA 3IQLA 2MMPA 4RMOA 2EKOA 2DJQA 2KYBA 1YBYA 3CC7T 2JOYA 2HQHA 3QSUA 2OTLA 1UHFA 2DE0X 2FPFA 3MEAA 4ZNXA 4PL6A 5D6XA 2MPXC 1I5OB 4BE0A 5GAN3 2FRYA 1D1BA 4L6V5 4DQ2A 4ELZC 1BI0A 4R55A 2XU8A 5GJVB 3ME9A 2CZ6B 2P0QA 4B6MA 4IIMA 4J9EA 1K9AA 3MEUA 2DVEA 4BACA 4OVAA 5EC7A 2AKLA 1UGQB 5FWCA 1VIFA 2GGRA 3VS4A 2NUZA 4PKCC 1QP2A 2C0IA 1GCPA 1ABQA 4XU0A 3NGPA 1YJNA 3H6ZA 3QBYA 2CKKA 2D8JA 3I9QA 4C5GA 2ED1A 2QXFA 1BIAA 4XAXB 4RTXA 1YIJQ 1MV3A 1TH7A 4N4HA 3P8HA 4F17A 4PJOB 2DK3A 5A0DA 2D1XA 2RPNA 3UT1A 3OYGA 4BY6C 6AT1B 2M02A 3CCSA 3RMSA 3EG9B 4XU3A 3FDRA 4DEYA 4JJCA 3SB2A 1Q86R 2JM8A 2I0NA 2HKNA 2O9SA 4JRIA 1ZSZB 5LJ3h 2COYA 2E6ZA 2X4XA 4J9CA 1VYTA 2CZ7B 2MOXA 3KXTA 1KQSS 3VV0A 4GBQA 3NMZC 2EGEA 5ECAA 3R6NA 3VS3A 1YWPA 1I8FA 5DY9A 2J6KA 2PVOB 2Y90A 1B34B 3V8LA 2QI2A 3CCET 1UUEA 4NL2A 1Q86U 4C0ZA 3ASKA 2GFUA 3EGDB 2DL4A 3VS7A 3V7CA 1W6XA 1RAAB 1RAGB 1TUCA 3AHUA 1VQ5Q 1M90R 2F5KA 2OAWA 1X27A 1VQ6Q 1BK2A 4HXJA 1CSKA 2QA4A 1AVZC 2VXEA 3RDVA 1RABB 1KG1A 2VGMA 2G6FX 2MAMA 1ZUKA 1ZUUA 3I56A 2HL3A 3OYLA 1YJWT 1OV3A 4HCKA 2PUKB 2K9GA 2YDLA 1ZA2B 3X26B 1M5Q1 4HVUA 1RLPC 3P8DA 2FVUA 2RN8A 3VS6A 1B34A 1JRIA 1VQ7Q 1MNEA 1VOMA 4DBRA 1SF9A 4JDSA 1XNIA 1OOTA 5GJWB 4LE9A 4C8QC 3MO8A 3VRZA 2K79A 1TOVA 2YHTA 1UTIA 5J39A 1YJWA 1K73U 2QDYB 2O9VA 2EQMA 3OW2P 1VQLT 1M8MA 4Z02A 3NFCA 1ZA1B 2QTVA 1AT1B 2HCKA 2FZGB 4PLIA 2GQIA 4M78B 4C0FA 4C92F 2CP3A 2DILA 3PVQA 1BCMA 3GLXA 3HFNA 1YJNQ 4TVRA 4M75G 1SPKA 2A3LA 2OTLT 4JJDA 1CKBA 4MDXA 1BCOA 2RA2A 5I22A 2QEXA 4FU6A 4E7ZA 1W4SA 2KT8A 1F1BB 2X3XD 3JCMh 2CT4A 2KMTA 3KUFA 1M1FA 1NM7A 2EJGA 1KFZA 2LCLA 1RLQC 2LJ1A 3CC7Q 2YUOA 3LH0A 2COZA 1IXDA 3CC4T 3FEOA 1VQLA 2XK0A 5DLOA 3WVEB 3CCJA 2DIQA 4LUEA 4M78D 1U3OA 4F7UB 3CMEA 1IHWA 1OPLA 1X75C 2C0TA 4HVVA 1AWJA
chains in the Genus database with same CATH topology
1AD5A 1X6GA 2ENMA 1K4US 1UECA 2DL3A 3I35A 1KJWA 1TG0A 2DBKA 4OMNA 2DRKA 2KXDA 1VA7A 2DLPA 3TSZA 2XMFA 1WLPB 1BBZA 1UJ0A 2CUBA 1GCQC 1YN8A 1U06A 2DL8A 1Y0MA 1ZSGA 1WI7A 2L3SA 1UG1A 1E7OA 1WA7A 1I1JA 2IIMA 3M0RA 1KIKA 2A28A 2EPDA 3EHRA 3ULRB 2EYZA 1M3BA 3VS1A 2KEAA 2BZ8A 1H92A 2M51A 1PHTA 1SRLA 2DL7A 4OMPA 4RTZA 2LQNA 2CSIA 3SEMA 1KSWA 2LNHB 1WFWA 1UGVA 2M0YA 2V1RA 2LJ0A 5IHNA 1GCQA 2BTTA 2DBMA 3TVTA 1YCSB 1FYNA 3GBQA 2HDAA 1UE9A 3REBB 1PRLC 2DL5A 1G2BA 1GBQA 2J6OA 3KFVA 1NYGA 2KRNA 2YUPA 2EGCA 2MCNA 3QWYA 4OMLA 4LUDA 4WCIA 5IXFA 1JXOA 1N5ZA 1ZLMA 3H0HA 1SHFA 1WDXA 1QKWA 2CT3A 3UA7A 2P4RA 3H0IA 1OPKA 2VVKA 4A63B 3VS0A 2K6DA 5IH2A 1NLOC 1JO8A 5I11A 2L3QA 2D0NA 2ROLA 2KBTA 5L23A 5IHIA 2RQRA 1K1ZA 2LQWA 1PNJA 1A0NB 3REAB 1WXTA 2KE9A 2CH4A 1UJYA 2ED0A 2O31A 3VRYA 1I0CA 2SEMA 2NWMA 2V1QA 4FSSA 2SRCA 1K76A 2DF6A 2PNIA 2K2MA 1Y57A 3EG1A 2FRWA 1B3QA 2F2VA 2DM1A 3NPFA 4LN2A 1NLPC 1UHCA 2JM9A 2JMAA 4J9DA 2X3WD 1EFNA 2J7IA 3M0SA 1SRMA 2KGTA 4AFZC 3RNJA 2VWFA 3UA6A 1NEGA 1ZBJA 3TSWA 1QWEA 2RF0A 1PWTA 2K7AA 2A37A 1GL5A 1B07A 1FMKA 2LCSA 3M0QA 3O5ZA 4J9IA 3VS2A 1PKTA 3EGUA 4RTWA 4J9FA 2JW4A 1JEGA 2MIOA 2ECZA 1CKAA 2LP5A 2KR3A 1JQQA 1QKXA 3SHWA 2O88A 2EYYA 1NEBA 1I07A 2OI3A 1WX6A 1M30A 1Z9ZA 1UFFA 1NG2A 1X43A 4F16A 1W1FA 2W10A 2PTKA 1AZGB 4CC4B 2FPDA 1JU5C 3M0UA 3EG3A 4D8KA 5IHKA 2ESWA 4HVWA 4RTVA 1M27C 2FG0A 3IQLA 2AZSA 1LCKA 4AFQC 2DYBA 3I5SA 2DJQA 2KYBA 2ABLA 3ZL7C 4IIOA 3FJ5A 1UHFA 2DE0X 2FPFA 4OMMA 4ZNXA 2GTJA 3C0CA 4RUGA 2KRSA 2EBPA 2RQVA 1OEBA 1ZUYA 2FRYA 1YNZA 4GLMA 1AZEA 1QLYA 1J3TA 4Z89A 1X6BA 1YP5A 1WYXA 2AZVA 1HSQA 5GJVB 2HSPA 3EG0A 3UATA 4IIMA 4J9EA 4KRTA 1K9AA 5EC7A 2AKLA 1X2QA 2QDLA 5FWCA 2GGRA 3VS4A 2NUZA 2PZ1A 3JV3A 4AFSC 2F2XA 1E6GA 2C0IA 2LMJA 3M0PA 1X2KA 1GCPA 1ABQA 2F2WA 1TUDA 4Z88A 2KYMA 1H8KA 3NGPA 2RNAA 2D8JA 3I9QA 2ED1A 4DEXA 2W0ZA 1T0JA 1SHGA 3M0TA 4RTXA 1AOJA 1MV3A 1QCFA 3THKA 2DA9A 2EQIA 1HD3A 1JXMA 2RQTA 4F17A 1WXBA 3PVLA 4Y92A 2YT6A 1T3LA 2D1XA 2RPNA 5FW9A 1ZX6A 1HJDA 2JMCA 1MUZA 4RTUA 2CSQA 2GTOA 1PKSA 1GFCA 4DEYA 1U5SA 4JJCA 1X69A 2JM8A 2I0NA 1RUWA 2HEQA 4X1VA 2O9SA 2BZYA 3LH5A 2A08A 2EYWA 2J6FA 1ABOA 1BU1A 1BB9A 4J9CA 1VYTA 4OMOA 2DX1A 2MOXA 3I5RA 2KNBB 4JPBW 2O2OA 1VYVA 1E6HA 4GBQA 3NMZC 4CC2A 2EGEA 5ECAA 3R6NA 3VS3A 4AG1C 1YWPA 1G83A 2YSQA 2J6KA 2B86A 4J9BA 2FEIA 4AG2C 1GBRA 2H8HA 2KROA 2GBQA 2OJ2A 1AEYA 1UUEA 2CUDA 2EGAA 1SEMA 4ESRA 2DL4A 3VS7A 1W6XA 2D8HA 1M3AA 4EIKA 1TUCA 3UF4A 2OAWA 1X27A 5IXBA 1BK2A 4HXJA 1CSKA 3EHQA 1AVZC 2YUNA 3EG2A 3RBBB 1S1NA 2RQWA 2JXBA 1YWOA 2DRMA 2JS2A 3VS5A 2G6FX 1PRMC 4E6RA 1ZUKA 1ZUUA 1T3SA 1OV3A 2JS0A 1GFDA 4ORZA 2C0OA 4HCKA 2K9GA 2YDLA 2J05A 1QWFA 2A36A 2RQUA 2FPEA 4HVUA 1RLPC 1XOVA 2RN8A 2EVRA 1UDLA 1SSHA 4JJBA 4RTYA 3VS6A 1V1CA 1W70A 3PE0A 2EKHA 4JZ3A 1WXUA 1T0HA 1H3HA 2DMOA 2EYXA 2ROTA 1OOTA 5GJWB 2KT1A 2YUQA 4LE9A 3VRZA 1IO6A 2K79A 3H41A 2LJ3A 1GRIA 1UTIA 2HBWA 5HCKA 2AKKA 2O9VA 2J06A 2K3BA 2E5KA 1AWWA 4CC3A 1M8MA 2AK5A 2GNCA 1ARKA 2KXCA 4CC7A 2DVJA 2JTEA 2HCKA 2BZXA 1K0SA 2GQIA 1M3CA 4AFUC 4R0KA 1AWXA 3H0FA 3CQTA 2DILA 3A98A 1RI9A 1WIEA 3PVQA 1K0XA 4OMQA 4F14A 1NYFA 4K11A 1SPKA 4JJDA 1CKBA 1MV0B 5I22A 2LX7A 2LZ6B 2KT8A 4J9GA 2FO0A 2X3XD 4LNPA 2CT4A 4RTTA 2CH4W 4D8DA 4QT7A 1NM7A 1KFZA 1RLQC 2LJ1A 1AWOA 2L0AA 2YUOA 4J9HA 2JT4A 2DNUA 4M4ZA 3QWXX 4JZ4A 2KRMA 2CREA 4Z8AA 2L2PA 5FWBA 2VKNA 4LUEA 1U3OA 1VYUA 2CDTA 2EW3A 1Z9QA 2L3PA 3U23A 1OPLA 3NHNA 2C0TA 4HVVA 2RMOA 1AWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AD5 A;  1X6G A;  2ENM A;  1K4U S;  1UEC A;  2DL3 A;  3I35 A;  1KJW A;  1TG0 A;  2DBK A;  4OMN A;  2DRK A;  2KXD A;  1VA7 A;  2DLP A;  3TSZ A;  2XMF A;  1WLP B;  1BBZ A;  1UJ0 A;  2CUB A;  1GCQ C;  1YN8 A;  1U06 A;  2DL8 A;  1Y0M A;  1ZSG A;  1WI7 A;  2L3S A;  1UG1 A;  1E7O A;  1WA7 A;  1I1J A;  2IIM A;  3M0R A;  1KIK A;  2A28 A;  2EPD A;  3EHR A;  3ULR B;  2EYZ A;  1M3B A;  3VS1 A;  2KEA A;  2BZ8 A;  1H92 A;  2M51 A;  1PHT A;  1SRL A;  2DL7 A;  4OMP A;  4RTZ A;  2LQN A;  2CSI A;  3SEM A;  1KSW A;  2LNH B;  1WFW A;  1UGV A;  2M0Y A;  2V1R A;  2LJ0 A;  5IHN A;  1GCQ A;  2BTT A;  2DBM A;  3TVT A;  1YCS B;  1FYN A;  3GBQ A;  2HDA A;  1UE9 A;  3REB B;  1PRL C;  2DL5 A;  1G2B A;  1GBQ A;  2J6O A;  3KFV A;  1NYG A;  2KRN A;  2YUP A;  2EGC A;  2MCN A;  3QWY A;  4OML A;  4LUD A;  4WCI A;  5IXF A;  1JXO A;  1N5Z A;  1ZLM A;  3H0H A;  1SHF A;  1WDX A;  1QKW A;  2CT3 A;  3UA7 A;  2P4R A;  3H0I A;  1OPK A;  2VVK A;  4A63 B;  3VS0 A;  2K6D A;  5IH2 A;  1NLO C;  1JO8 A;  5I11 A;  2L3Q A;  2D0N A;  2ROL A;  2KBT A;  5L23 A;  5IHI A;  2RQR A;  1K1Z A;  2LQW A;  1PNJ A;  1A0N B;  3REA B;  1WXT A;  2KE9 A;  2CH4 A;  1UJY A;  2ED0 A;  2O31 A;  3VRY A;  1I0C A;  2SEM A;  2NWM A;  2V1Q A;  4FSS A;  2SRC A;  1K76 A;  2DF6 A;  2PNI A;  2K2M A;  1Y57 A;  3EG1 A;  2FRW A;  1B3Q A;  2F2V A;  2DM1 A;  3NPF A;  4LN2 A;  1NLP C;  1UHC A;  2JM9 A;  2JMA A;  4J9D A;  2X3W D;  1EFN A;  2J7I A;  3M0S A;  1SRM A;  2KGT A;  4AFZ C;  3RNJ A;  2VWF A;  3UA6 A;  1NEG A;  1ZBJ A;  3TSW A;  1QWE A;  2RF0 A;  1PWT A;  2K7A A;  2A37 A;  1GL5 A;  1B07 A;  1FMK A;  2LCS A;  3M0Q A;  3O5Z A;  4J9I A;  3VS2 A;  1PKT A;  3EGU A;  4RTW A;  4J9F A;  2JW4 A;  1JEG A;  2MIO A;  2ECZ A;  1CKA A;  2LP5 A;  2KR3 A;  1JQQ A;  1QKX A;  3SHW A;  2O88 A;  2EYY A;  1NEB A;  1I07 A;  2OI3 A;  1WX6 A;  1M30 A;  1Z9Z A;  1UFF A;  1NG2 A;  1X43 A;  4F16 A;  1W1F A;  2W10 A;  2PTK A;  1AZG B;  4CC4 B;  2FPD A;  1JU5 C;  3M0U A;  3EG3 A;  4D8K A;  5IHK A;  2ESW A;  4HVW A;  4RTV A;  1M27 C;  2FG0 A;  3IQL A;  2AZS A;  1LCK A;  4AFQ C;  2DYB A;  3I5S A;  2DJQ A;  2KYB A;  2ABL A;  3ZL7 C;  4IIO A;  3FJ5 A;  1UHF A;  2DE0 X;  2FPF A;  4OMM A;  4ZNX A;  2GTJ A;  3C0C A;  4RUG A;  2KRS A;  2EBP A;  2RQV A;  1OEB A;  1ZUY A;  2FRY A;  1YNZ A;  4GLM A;  1AZE A;  1QLY A;  1J3T A;  4Z89 A;  1X6B A;  1YP5 A;  1WYX A;  2AZV A;  1HSQ A;  5GJV B;  2HSP A;  3EG0 A;  3UAT A;  4IIM A;  4J9E A;  4KRT A;  1K9A A;  5EC7 A;  2AKL A;  1X2Q A;  2QDL A;  5FWC A;  2GGR A;  3VS4 A;  2NUZ A;  2PZ1 A;  3JV3 A;  4AFS C;  2F2X A;  1E6G A;  2C0I A;  2LMJ A;  3M0P A;  1X2K A;  1GCP A;  1ABQ A;  2F2W A;  1TUD A;  4Z88 A;  2KYM A;  1H8K A;  3NGP A;  2RNA A;  2D8J A;  3I9Q A;  2ED1 A;  4DEX A;  2W0Z A;  1T0J A;  1SHG A;  3M0T A;  4RTX A;  1AOJ A;  1MV3 A;  1QCF A;  3THK A;  2DA9 A;  2EQI A;  1HD3 A;  1JXM A;  2RQT A;  4F17 A;  1WXB A;  3PVL A;  4Y92 A;  2YT6 A;  1T3L A;  2D1X A;  2RPN A;  5FW9 A;  1ZX6 A;  1HJD A;  2JMC A;  1MUZ A;  4RTU A;  2CSQ A;  2GTO A;  1PKS A;  1GFC A;  4DEY A;  1U5S A;  4JJC A;  1X69 A;  2JM8 A;  2I0N A;  1RUW A;  2HEQ A;  4X1V A;  2O9S A;  2BZY A;  3LH5 A;  2A08 A;  2EYW A;  2J6F A;  1ABO A;  1BU1 A;  1BB9 A;  4J9C A;  1VYT A;  4OMO A;  2DX1 A;  2MOX A;  3I5R A;  2KNB B;  4JPB W;  2O2O A;  1VYV A;  1E6H A;  4GBQ A;  3NMZ C;  4CC2 A;  2EGE A;  5ECA A;  3R6N A;  3VS3 A;  4AG1 C;  1YWP A;  1G83 A;  2YSQ A;  2J6K A;  2B86 A;  4J9B A;  2FEI A;  4AG2 C;  1GBR A;  2H8H A;  2KRO A;  2GBQ A;  2OJ2 A;  1AEY A;  1UUE A;  2CUD A;  2EGA A;  1SEM A;  4ESR A;  2DL4 A;  3VS7 A;  1W6X A;  2D8H A;  1M3A A;  4EIK A;  1TUC A;  3UF4 A;  2OAW A;  1X27 A;  5IXB A;  1BK2 A;  4HXJ A;  1CSK A;  3EHQ A;  1AVZ C;  2YUN A;  3EG2 A;  3RBB B;  1S1N A;  2RQW A;  2JXB A;  1YWO A;  2DRM A;  2JS2 A;  3VS5 A;  2G6F X;  1PRM C;  4E6R A;  1ZUK A;  1ZUU A;  1T3S A;  1OV3 A;  2JS0 A;  1GFD A;  4ORZ A;  2C0O A;  4HCK A;  2K9G A;  2YDL A;  2J05 A;  1QWF A;  2A36 A;  2RQU A;  2FPE A;  4HVU A;  1RLP C;  1XOV A;  2RN8 A;  2EVR A;  1UDL A;  1SSH A;  4JJB A;  4RTY A;  3VS6 A;  1V1C A;  1W70 A;  3PE0 A;  2EKH A;  4JZ3 A;  1WXU A;  1T0H A;  1H3H A;  2DMO A;  2EYX A;  2ROT A;  1OOT A;  5GJW B;  2KT1 A;  2YUQ A;  4LE9 A;  3VRZ A;  1IO6 A;  2K79 A;  3H41 A;  2LJ3 A;  1GRI A;  1UTI A;  2HBW A;  5HCK A;  2AKK A;  2O9V A;  2J06 A;  2K3B A;  2E5K A;  1AWW A;  4CC3 A;  1M8M A;  2AK5 A;  2GNC A;  1ARK A;  2KXC A;  4CC7 A;  2DVJ A;  2JTE A;  2HCK A;  2BZX A;  1K0S A;  2GQI A;  1M3C A;  4AFU C;  4R0K A;  1AWX A;  3H0F A;  3CQT A;  2DIL A;  3A98 A;  1RI9 A;  1WIE A;  3PVQ A;  1K0X A;  4OMQ A;  4F14 A;  1NYF A;  4K11 A;  1SPK A;  4JJD A;  1CKB A;  1MV0 B;  5I22 A;  2LX7 A;  2LZ6 B;  2KT8 A;  4J9G A;  2FO0 A;  2X3X D;  4LNP A;  2CT4 A;  4RTT A;  2CH4 W;  4D8D A;  4QT7 A;  1NM7 A;  1KFZ A;  1RLQ C;  2LJ1 A;  1AWO A;  2L0A A;  2YUO A;  4J9H A;  2JT4 A;  2DNU A;  4M4Z A;  3QWX X;  4JZ4 A;  2KRM A;  2CRE A;  4Z8A A;  2L2P A;  5FWB A;  2VKN A;  4LUE A;  1U3O A;  1VYU A;  2CDT A;  2EW3 A;  1Z9Q A;  2L3P A;  3U23 A;  1OPL A;  3NHN A;  2C0T A;  4HVV A;  2RMO A;  1AWJ A; 
#chains in the Genus database with same CATH topology
 3OS5 A;  2ENM A;  2P0P A;  1EZZ B;  1B7T A;  3CC2 Q;  4EDU A;  1IGU A;  3E1S A;  4QQG A;  4BY6 B;  1K9M C;  3A8O B;  4N4G A;  1WLP B;  3V8K A;  3CBO A;  3CMA Q;  2KSS A;  1GCQ C;  3UWN A;  3CME T;  1YJ9 T;  3FJP A;  1VQ9 Q;  2A28 A;  4XTZ A;  3V7R A;  4LDV A;  3G6E T;  2X35 A;  1M3B A;  1WNL A;  2KEA A;  4LDW A;  1PCX A;  7AT1 B;  5I21 A;  2DL7 A;  4OMP A;  4PLL A;  4RTZ A;  2LQN A;  2V1R A;  4C8Q B;  4L5G A;  1BYM A;  4DBF A;  1FYN A;  2NUP B;  4A4H A;  2DEQ A;  1G3T A;  4M78 E;  2J6O A;  2KI7 A;  2KRN A;  3GPL A;  2EGC A;  1NPP A;  2MCN A;  3LWH A;  1D0X A;  3QDR B;  3CCL Q;  2QTX A;  4Q5W A;  1ZLM A;  2XI9 A;  3HP9 A;  4ZN1 A;  5GMK i;  3M56 A;  3OYH A;  1SHF A;  1TTH B;  2CT3 A;  3UA7 A;  2P4R A;  3OY9 A;  2K4Y A;  3C94 A;  2VVK A;  2WSF E;  1TUG B;  3CMA T;  3GIB A;  1NLO C;  1JO8 A;  5I11 A;  4M7A A;  1TXQ A;  1WHH A;  1KC8 C;  4M7D E;  3HRT A;  1M1K U;  1M1K R;  4C0D B;  1YHQ T;  1PNJ A;  1A0N B;  2RJC A;  3TEE A;  3OS1 A;  4KGX B;  4PJJ A;  2ED0 A;  5LJ5 e;  3TU4 K;  2V8I A;  3M5A A;  2NWM A;  3WXM B;  2LVM A;  3V7S A;  3G7Z A;  1K76 A;  2PNI A;  1YI2 Q;  4FYV B;  4LN2 A;  5DM7 R;  3VJP A;  1YIJ T;  1UGS B;  3QZ9 B;  2JJ9 A;  2X3W D;  3M53 A;  1XQH A;  2XDP A;  4PJO D;  3OA6 A;  1HYO A;  1OZ3 A;  3JCM V;  5HKC A;  1VQO A;  2E41 A;  3BE3 A;  1ZBJ A;  1QWE A;  3QYG B;  1Q82 U;  2OTL Q;  3S3O A;  2K7A A;  4M77 C;  1B07 A;  3PT9 A;  2LCS A;  3O5Z A;  3CCS T;  1D09 B;  1HK9 A;  3TCJ A;  2XHC A;  1N6A A;  2A0F B;  4J9F A;  1UEB A;  2JW4 A;  4BD3 A;  1QVF P;  2RB6 A;  4FW1 A;  2ECZ A;  3I56 Q;  1ZHI A;  4EPC A;  1KD1 U;  3CCM A;  4GY5 A;  3CBM A;  4NOY A;  1V76 A;  1VQ6 A;  3LWI A;  1I07 A;  3CCV A;  1Z9Z A;  1NG2 A;  2DD5 A;  4DBQ A;  2DJZ A;  4AMC A;  1WJQ A;  4JRK A;  1MMD A;  2A7Y A;  2DAQ A;  2QYZ A;  2LT1 A;  1K8A C;  3L2R A;  3PMT A;  4FW2 A;  5GAN 7;  1G8X A;  2HSE B;  2AZS A;  4AFQ C;  3MP8 A;  3LGL A;  3JB9 J;  3QII A;  1D0Z A;  5IAY A;  5KYU A;  1RAH B;  4BI8 B;  2GTJ A;  2ZPH B;  3JB9 I;  4RUG A;  3RMQ A;  1QLY A;  4M77 E;  1J3T A;  2E64 A;  3ZBD A;  4Z89 A;  1WHJ A;  1X6B A;  1WYX A;  2AZV A;  2OTJ Q;  1WHM A;  4RCB A;  2HSP A;  3EG0 A;  3UAT A;  4C92 B;  1VQ5 T;  3QUI A;  4A4K A;  3CXC S;  4KRT A;  4M78 F;  1U8R A;  5I2S A;  2VYT A;  4KUL A;  2RHZ A;  1OU9 A;  1D1A A;  1PD1 A;  2DET A;  2PZ1 A;  2F2X A;  1MND A;  1X2K A;  2F2W A;  1D1C A;  3HFO A;  3VYG A;  5GAN 2;  3NTI A;  2RJD A;  3UDC A;  5FU6 C;  2EFI A;  1SHG A;  2E10 A;  1QCN A;  1QCF A;  2K5I A;  4A4G A;  2EQI A;  1JXM A;  2E4H A;  2YXY A;  5IT9 E;  9ATC B;  2G3R A;  2E65 A;  3PVL A;  1T3L A;  2DO3 A;  2M0O A;  4C92 E;  2L5Q A;  1KC8 U;  1BI1 A;  1KD1 R;  5FW9 A;  1HJD A;  1MUZ A;  2CSQ A;  1VQL Q;  3BFM A;  1OZ2 A;  4VUB A;  3JRZ A;  1X69 A;  4KH0 B;  4RG2 A;  3GNF B;  2BE7 D;  5KYW A;  2BZY A;  2JNG A;  1O9S A;  2A08 A;  4XTV A;  2J6F A;  1ABO A;  1FWZ A;  2CP0 A;  4OMO A;  3I5R A;  4M78 C;  2MYS A;  3DLM A;  4JPB W;  5GAN 6;  2O01 E;  2B8A A;  1JBM A;  3BDL A;  2KY9 A;  4DBH A;  4J5Y A;  2YSQ A;  2XG8 D;  5KE2 A;  4DA4 A;  2ZZD A;  2B86 A;  4BUG A;  5KE3 A;  2MF2 A;  4J9B A;  3PIP A;  4AG2 C;  1YJW Q;  2H8H A;  5HK0 A;  2GBQ A;  2OJ2 A;  1WQ7 A;  1QVP A;  1SEM A;  2GQV A;  2P84 A;  4M75 C;  4ESR A;  3D7S B;  2D8H A;  4EIK A;  4F7U G;  1OYX A;  2LTO A;  1Y07 A;  2H3E B;  3VUZ A;  4LXC A;  2IG0 A;  3EG2 A;  3EGX B;  3M9Q A;  3RBB B;  4B9X A;  4ZGJ B;  2RQW A;  3CCV Q;  2JXB A;  2MWO A;  1NZ9 A;  3CPF A;  2VB6 A;  3VS5 A;  1PRM C;  5GAM f;  1TSF A;  3M55 A;  3G6E Q;  4E7H A;  2R58 A;  1GFD A;  2C0O A;  5KYN A;  2M16 A;  1ZSZ A;  2RQU A;  2EVR A;  1R77 A;  1SSH A;  4JJB A;  2LDM A;  2HBP A;  1WXU A;  1VQ6 T;  1T0H A;  4ZTJ A;  1WJR A;  2YRV A;  2DMO A;  2XIC A;  2KT1 A;  3MP6 A;  2IPO B;  1BI3 A;  2VV5 A;  2YUQ A;  4D6W A;  4R56 A;  3H41 A;  2E12 A;  1GRI A;  1M8V A;  2K3B A;  2E5K A;  1AWW A;  4M77 F;  5CCA A;  1G3Y A;  1W2B A;  3QXE B;  4M77 G;  1ARK A;  4MDW A;  2KXC A;  4IUU A;  3S3N A;  1VQ8 A;  1P92 A;  5D7U A;  1M3C A;  3OMC A;  1S72 A;  3CQT A;  4M77 A;  4IKF A;  1RI9 A;  1KK7 A;  1K0X A;  2DTI A;  1M1K C;  5GAO q;  3JCM g;  2OX7 A;  3OBY A;  5KYY A;  3MKD A;  1VQO Q;  3A8L B;  5KYW B;  3CD6 Q;  4J9G A;  3QHS A;  8AT1 B;  2AT1 B;  4PJN A;  2QG9 B;  4FT2 A;  3EGD A;  3OYY A;  2ZAE A;  5CK9 A;  1Q7Y R;  3OSS C;  5EG2 A;  3I55 Q;  1AWO A;  2L0A A;  5GAN g;  2DKG A;  4OP0 A;  2KRM A;  2CRE A;  5GAO m;  3MJX A;  3CCU Q;  5FWB A;  4F7U F;  1NPR A;  1QVG S;  1M90 C;  4LD6 A;  4HA8 A;  1IRX A;  5GAN d;  3U23 A;  4OMF B;  2K5F A;  3NHN A;  4E47 A;  3CCQ Q;  4ANJ A;  1QVG A;  2HKQ B;  1X6G A;  1K4U S;  2DL3 A;  2V8K A;  3I35 A;  4X9D A;  2E1H A;  1TG0 A;  2DBK A;  5HK3 A;  2RK1 A;  2KXD A;  1FXX A;  2FYK A;  2QQR A;  4CRI A;  1BBZ A;  4QVC A;  4F7U A;  1N9R A;  1UJ0 A;  1D0Y A;  1NBE B;  1MMG A;  4N0A C;  3CCU T;  1YN8 A;  1U06 A;  3GP8 A;  4CI0 C;  1WI7 A;  2ZCF B;  5LJ5 g;  1VQM A;  1I1J A;  3H9N A;  1KIK A;  2OTJ A;  4C92 A;  3VS1 A;  1N9S A;  3F70 A;  2V8J A;  2BZ8 A;  2M51 A;  3JB9 G;  3SEM A;  1KSW A;  2M0Y A;  3OW2 A;  3V8J A;  1GCQ A;  5GAN e;  3TVT A;  1YCS B;  2O4X B;  2RO0 A;  3GNG A;  2NLU A;  3GBQ A;  2P4T A;  3MCA B;  4NS5 A;  2HDA A;  3REB B;  3INZ A;  1PRL C;  4Y28 E;  2JTM A;  2YUP A;  3QWY A;  3LX7 A;  4WCI A;  5IXF A;  5FRN A;  4N0A A;  1N5Z A;  2PQW A;  2CP6 A;  1WZO A;  2Z0W A;  3ZFJ A;  1IRE B;  1QKW A;  4II1 A;  3A8H B;  4PFZ A;  1N8R C;  1Q7Y C;  2BIV A;  4A63 B;  3VS0 A;  5FU6 B;  5CQY A;  5KYY B;  2K57 A;  1YHQ A;  2L3Q A;  3TRE A;  2D0N A;  3N5B B;  4J7F A;  1M1G A;  5KCO A;  2KBT A;  2QGG A;  5L23 A;  8ATC B;  2LQW A;  1Y96 B;  2RHX A;  3L1A A;  1VQN T;  3BY7 A;  3JB9 D;  3J7A F;  4HKE A;  3H8Z A;  3VRY A;  4C0G A;  2HMA A;  5GAO l;  4C92 C;  4M7A C;  2DF6 A;  3CPW A;  3KBG A;  2FZK B;  1S72 Q;  2FRW A;  2F2V A;  3NPF A;  5GAN f;  2XDB A;  3JCM c;  1NLP C;  1UHC A;  4LDX A;  3OQ5 A;  2HAX A;  3M0S A;  4BE1 A;  1VQN A;  2KGT A;  4AFZ C;  3RNJ A;  2DIG A;  2K2V A;  1Q82 C;  4IUV A;  2D9T A;  2L8D A;  2LQ8 A;  2QA4 T;  4PK4 A;  4Y91 A;  2RI3 A;  2NUT A;  3M0Q A;  2VGN A;  5AT1 B;  3I55 A;  2KK4 A;  4JRQ A;  1PKT A;  3EGU A;  3QPH A;  1S72 T;  1OUL A;  1LOJ A;  2FZC B;  5GMK l;  4EMH A;  2GFA A;  4QVZ A;  3M57 A;  1CKA A;  3G6E A;  2LP5 A;  3FB9 A;  4FIB A;  5C6S A;  3OYF A;  3CCQ A;  1QKX A;  4M75 E;  3G1J A;  2XID A;  1FMV A;  1UFF A;  1X43 A;  1VQ7 A;  1W1F A;  2W10 A;  2PTK A;  1LNX A;  2E3I A;  2LRQ A;  1OI1 A;  2CGH A;  4P5N A;  2OAU A;  4OB3 B;  4D8K A;  5IHK A;  5I2M A;  3PNW C;  1KHC A;  4E7J A;  4RTV A;  2FG0 A;  1VQM Q;  1LCK A;  2DYB A;  2EAY A;  4IIO A;  5D6Y A;  3OYA A;  2XKO C;  4OMM A;  2KRS A;  3JCM e;  1YIT T;  1OEB A;  2DZC A;  1YNZ A;  1AZE A;  4HCC A;  2F1L A;  3OYD A;  4C5H A;  1YP5 A;  4OF1 A;  1HSQ A;  5FLX E;  3OW2 S;  1UGR B;  1VQK Q;  3GOX A;  1K73 R;  3OYI A;  3WVD B;  2DYI A;  1Y96 A;  4F7U E;  2QDL A;  2KQW A;  4AFS C;  2RHU A;  3JV3 A;  2AHJ B;  4XTU A;  4A54 A;  2LMJ A;  3S6W A;  2GCX A;  1TUD A;  2KYM A;  1H8K A;  1VQ4 T;  4LDY A;  2RNA A;  2RJE A;  1VQ4 Q;  1MHN A;  4XTX A;  1T0J A;  3X20 B;  4J83 A;  4UC4 A;  3SDZ A;  1BI2 A;  3M0T A;  4QVD A;  2EQK A;  3CCR T;  1AOJ A;  3THK A;  2IVW A;  2DA9 A;  1HD3 A;  2ZPF B;  2RQT A;  1G5V A;  3FRN A;  1WXB A;  1VQ9 T;  2YT6 A;  1PC0 A;  1SSF A;  5GAN j;  3CCV T;  2ZGW A;  1RAC B;  1QP3 A;  3MEW A;  4RTU A;  1Q81 U;  2GTO A;  1YJN T;  1NJI U;  2H3J A;  2HD0 A;  5CIU A;  3JCM f;  1SKU B;  2CYZ B;  1GFC A;  4IUR A;  2E5Q A;  2HEQ A;  5A2Q E;  3L2U A;  1MMA A;  3LH5 A;  4M75 B;  2EYW A;  2KNB B;  1QQJ A;  2WAC A;  1HXD A;  1VQ9 A;  4FCY A;  5A0G A;  2O2O A;  1VYV A;  1E6H A;  3X28 B;  4EMK C;  3RUX A;  2EQU A;  3SWN B;  4LDU A;  4OB0 B;  1G83 A;  1NJI C;  1YJ9 A;  1GBR A;  1RAF B;  3A1P A;  3EFO B;  2EGA A;  4V2S A;  3EH2 A;  3C95 A;  5KH6 A;  4A53 A;  1M3A A;  4JLI A;  5KYX B;  3OBW A;  3SD4 A;  4ME7 A;  5IXB A;  3EHQ A;  2YUN A;  3SFM A;  1S1N A;  4J8O A;  4M75 F;  4J6W A;  1YWO A;  2DRM A;  1EIF A;  3QO3 A;  3SWN A;  1RL2 A;  4E6R A;  4ZGD B;  1K9M R;  4C92 G;  2CZ1 B;  2JS0 A;  2FHD A;  2VXF A;  4ORZ A;  1YI2 T;  1QWF A;  1PSF A;  2A36 A;  1M2V B;  1EX4 A;  3RER A;  2OTJ T;  5CQX A;  4RTY A;  3G4S T;  1V1C A;  1W70 A;  3PE0 A;  3JCM d;  3C4S A;  1OX9 A;  2K3Y A;  1KC8 R;  2MI6 A;  1YFN A;  4AT1 B;  3JSC A;  4O5V A;  2LJ3 A;  4M77 D;  2HBW A;  2EYQ A;  5HCK A;  2BUD A;  1C6V X;  3HSB A;  4M75 A;  3HTR A;  2X4J A;  1YI2 A;  4BDZ A;  2WSC E;  2AK5 A;  2GNC A;  1K8A U;  1VQO T;  5FU7 B;  2CS7 A;  1VQ7 T;  2K5L A;  1DJ7 B;  1JB0 E;  3CC7 A;  2DER A;  2YLC A;  2DVJ A;  3FLG A;  2JVV A;  1K0S A;  3CC2 A;  4AFU C;  4R0K A;  5GMK m;  3H0F A;  1O75 A;  2ZPG B;  3A98 A;  1WIE A;  2K3X A;  3CME Q;  4F14 A;  3QZ5 B;  4KGZ B;  1MV0 B;  1JJ2 A;  2LX7 A;  2P0K A;  4BB7 A;  2O4X A;  2FO0 A;  2QGF B;  5M9O A;  4RTT A;  4HCZ A;  4QT7 A;  3CC2 T;  3DKM A;  3C12 A;  3OYC A;  5GAM j;  3VYH B;  2DNU A;  2V26 A;  2E70 A;  4M4Z A;  3QWX X;  4JZ4 A;  1ZQ1 A;  2L2P A;  3JCM J;  3HRU A;  2VKN A;  5KYU B;  1VYU A;  2EW3 A;  3OYN A;  1M9S A;  1Z9Q A;  4M7D G;  3G71 Q;  2ZPI B;  4KGV B;  2RMO A;  3CCL A;  1AD5 A;  1Y7X A;  1GXI E;  2HQE A;  2JTF A;  5C0M A;  1KJW A;  3QG1 A;  3URG A;  1VA7 A;  2DLP A;  1XTD A;  2E6N A;  2XMF A;  3HHT B;  4M77 B;  3L42 A;  3ER0 A;  3CEY A;  1YHQ Q;  2L3S A;  1UG1 A;  3OYB A;  2DXT A;  1VIE A;  3A8G B;  2IIM A;  3CCE A;  4LD9 K;  1OQK A;  2R5A A;  3RR6 A;  3CD6 T;  4PJL A;  2RHY A;  3X24 B;  3L2W A;  2CSI A;  2LNH B;  1UGV A;  4BI3 A;  2LJ0 A;  4RCC A;  2BTT A;  1AHJ B;  4J7I A;  3JB9 F;  3CCJ Q;  1UE9 A;  3VUB A;  2X9H A;  1G2B A;  4KH1 B;  1GBQ A;  3RKW A;  2JUF A;  3HKS A;  3HPW A;  1VUB A;  4C0D C;  4F04 B;  1JXO A;  4PJO C;  3CXC P;  3H0H A;  1D3B A;  4HCB A;  3BDU A;  3OYM A;  1WDX A;  2R5M A;  1WHG A;  3G4S A;  3J81 E;  4M7D C;  1QVF A;  3CPW P;  1OPK A;  4KBM B;  1K8A R;  4JUV A;  2K6D A;  2D0Q B;  5IH2 A;  4IUQ A;  4DOW A;  3MEV A;  5DLQ E;  1X6O A;  5GAM d;  4JLG A;  4E2F B;  5GMK h;  5IHI A;  2KVQ G;  5KCH A;  5GAN 5;  2RQR A;  1H3Z A;  4M7A E;  3OS2 A;  2EIF A;  4RG8 A;  3REA B;  1WXT A;  2KE9 A;  4M7D A;  2CH4 A;  1UJY A;  2O31 A;  3P8B B;  4M75 D;  2DTO A;  1M2V A;  2SEM A;  3A5Z B;  1N8R R;  2LQK A;  2SRC A;  4EMK B;  5AYF A;  2K2M A;  3EG1 A;  1B3Q A;  4FM4 B;  2Y4X A;  4FYY B;  3RES A;  2JM9 A;  2JMA A;  3QDF A;  2RD1 A;  1EFN A;  2J7I A;  1YJ9 Q;  1SRM A;  1VQM T;  5GAO p;  4FYW B;  2VWF A;  1NEG A;  3TSW A;  2QQA A;  1I4K 1;  2QAZ A;  1M90 U;  4MZT A;  2A37 A;  1GL5 A;  3LGF A;  2GF7 A;  5A0L A;  3DB3 A;  4J9I A;  4IUT A;  3J80 E;  3Q1J A;  2KAF A;  2EJ9 A;  4QKU A;  1IB8 A;  4KT0 E;  3EFO A;  1JEG A;  4A4F A;  1PM3 A;  4WTO B;  2F69 A;  2KR3 A;  2X4W A;  3OB9 A;  1JQQ A;  4PFP A;  3G71 A;  1BIB A;  5GAN 4;  4C8Q G;  1VQP A;  2EYY A;  1NEB A;  2OI3 A;  2QK0 A;  1M30 A;  3RKY A;  3VU3 C;  4WF2 A;  5GAM g;  3MP1 A;  4F16 A;  4BE2 A;  5LJ5 h;  3CCQ T;  4OGC A;  1JU5 C;  5GAO n;  1JJ2 P;  4PJO G;  2NYS A;  1IZ6 A;  3CCJ T;  4HVW A;  2JN0 A;  1M27 C;  1Q81 R;  3QKJ A;  2X4Y A;  3I5S A;  2HL5 C;  2ABL A;  1Y71 A;  3CCL T;  3ZL7 C;  3FJ5 A;  4XQ3 A;  4XU2 A;  3EGX A;  3JAM E;  3T9N A;  2R57 A;  3C0C A;  1RI0 A;  2EBP A;  1H64 1;  2RQV A;  5D6W A;  1ZUY A;  4GLM A;  4MMK A;  5GAM e;  1PG5 B;  2DPP B;  3M4G A;  3EFS A;  3FC3 A;  3TQ7 P;  3CCM Q;  4PNO A;  3JCM X;  1YCY A;  1X2Q A;  4C5I A;  5IN1 A;  4OB2 B;  4EMG A;  1QCO A;  3CD6 A;  2QQ9 A;  1E6G A;  3PGG A;  3M0P A;  2L3R A;  1UB4 A;  4Z88 A;  1MMN A;  3EAE A;  3VKI A;  5HY6 A;  2DTH A;  3CBP A;  4DEX A;  2W0Z A;  3DB4 A;  3EG9 A;  1QMC A;  1W2B P;  3CCU A;  2EQJ A;  3JCM P;  4N4I A;  4QW2 A;  4Y92 A;  3CCR A;  4M7D D;  5CKF A;  1ZX6 A;  5LJ3 j;  2JMC A;  3JCM b;  3L2Q A;  1KQ2 A;  3LLR A;  1PKS A;  5CVI A;  4ZN3 A;  4HT9 A;  3S3M A;  1U5S A;  3UPU A;  1RUW A;  4X1V A;  1TWB A;  1U1T A;  5LL6 S;  3M4Y A;  1R0C B;  2QEX T;  1BU1 A;  1BB9 A;  2FL7 A;  2DX1 A;  4JS4 A;  1ZBX A;  2ATC B;  3M59 A;  4CC2 A;  1KHI A;  4M7A B;  4E7L A;  5FU7 C;  4AG1 C;  3OYE A;  4DOV A;  5LJ3 d;  2FEI A;  2KRO A;  3CCS Q;  4XU1 A;  4E7I A;  1AEY A;  3A8M B;  2CUD A;  4M78 G;  1M4Z A;  4X9C A;  1YIJ A;  3CCE Q;  2C06 A;  2EWN A;  2DXB A;  4PJM A;  3UF4 A;  2HZY A;  3L2Z A;  5LJ5 j;  1WJS A;  1D3B B;  2PUO B;  1RAD B;  1YIT A;  2PU9 B;  2BE9 B;  2DZ9 A;  4BI4 A;  1KD1 C;  1VQ8 T;  2LT4 A;  2JS2 A;  2DXU A;  2DXC A;  4C8Q E;  2CP7 A;  1T3S A;  4KUD K;  4PJO E;  1KQS A;  2J05 A;  2EJF A;  2FPE A;  1XOV A;  3NTH A;  1UDL A;  3CCM T;  1R0B G;  2RHI A;  5GAN 8;  2RI2 A;  3GF5 A;  3MHX A;  5FRM A;  2VC8 A;  2CZ0 B;  1LPL A;  4J6Y A;  2D6F A;  2EKH A;  4MML A;  4JZ3 A;  3OMG A;  1WHK A;  3G4S Q;  1I5L A;  3JB9 H;  1H3H A;  2EYX A;  2ROT A;  5J26 A;  2QQB A;  1JJ2 S;  4OGE A;  3L2V A;  2CP2 A;  1IO6 A;  1TU0 B;  3AT1 B;  3PMI A;  5CKD A;  2AKK A;  3G71 T;  1W2B S;  5GAO r;  2J06 A;  2MK5 A;  2YRC A;  1Q81 C;  4CC3 A;  2FB7 A;  4JS5 A;  2HNI A;  1Q95 G;  2Y4Y A;  1IGQ A;  1VQ5 A;  2XD0 A;  4C5E A;  4ZGE B;  1C0M A;  4CC7 A;  2M1H A;  4E7K A;  2JTE A;  2BZX A;  2QAS A;  1FX7 A;  5L8R E;  1G3W A;  3I55 T;  3NTK A;  2DFU A;  3CXC A;  1AWX A;  2E3H A;  4JJN K;  2AIR B;  1SG5 A;  4OMQ A;  4IUP A;  1XJW B;  3DLL A;  1NYF A;  4K11 A;  3QJ6 A;  4FL6 A;  1K73 C;  2LZ6 B;  1M2O A;  2NUP A;  4LNP A;  2RJF A;  4JRP A;  2BKD N;  2CH4 W;  4D8D A;  3X25 B;  4XTY A;  4M7A G;  2XDD A;  2MWP A;  4J9H A;  3CCR Q;  2JT4 A;  4FSX A;  4ATO A;  3R6O A;  5CO7 A;  4Z8A A;  2RK2 A;  3I56 T;  3PFS A;  1OX8 A;  4KUI A;  2CDT A;  1LVK A;  1R8O B;  2L3P A;  3JCM Q;  3CC4 A;  4X34 A;  2M9U A;  1KQ1 A;  4C92 D;  1VQP Q;  1X01 A;  2QEX Q;  1UEC A;  2YLB A;  2NUT B;  3EH1 A;  1WPY A;  1Q82 R;  4OMN A;  3LW5 E;  2DRK A;  1QVG P;  3TSZ A;  1NJI R;  2CUB A;  3PTA A;  5GAM h;  2F5T X;  2DL8 A;  4M78 A;  2PVD B;  1Y0M A;  1ZSG A;  1V29 B;  2QQS A;  2RH2 A;  2HQX A;  3PIO A;  1QVF S;  1E7O A;  1IHV A;  1WA7 A;  3M0R A;  2EPD A;  2L89 A;  3EHR A;  1U1S A;  3QJY A;  3ULR B;  2EYZ A;  5KYX A;  3M58 A;  3JCM W;  1N8R U;  3BW1 A;  1H92 A;  5CR2 A;  1PHT A;  1SRL A;  3OYK A;  1WFW A;  4YTL A;  5IHN A;  3M54 A;  5LJ3 e;  2DBM A;  3LYI A;  1MGQ A;  2I2L A;  2DL5 A;  1WQW A;  2LCC A;  3QYH B;  3KFV A;  1NYG A;  1RAI B;  4MZP A;  4OML A;  4LUD A;  4NL3 A;  3E9F A;  5GAN h;  1QW1 A;  2QA4 Q;  3SWN C;  4BDY A;  5J3B A;  1BKB A;  4OB1 B;  5FRO A;  1RAE B;  3MET A;  5LJ5 f;  4L59 A;  3H0I A;  1G3S A;  2KDS A;  1KQS P;  2DD4 A;  1WGS A;  1FMW A;  4XK8 E;  2RI5 A;  5GMK e;  4QQ6 A;  4M7A D;  2ROL A;  4PJO A;  4M7D F;  4M7A F;  1K1Z A;  1PD0 A;  1NE8 A;  4HT8 A;  4A4E A;  4J6X A;  1LJO A;  3HRS A;  2VAS A;  2LC4 A;  3OSV A;  2RM4 A;  3CPW S;  3FIF A;  1I0C A;  4C8Q A;  2V1Q A;  4FSS A;  1UGP B;  4XTW A;  2PVG B;  5LJ5 d;  3MPU B;  2DEU A;  1Y57 A;  4PFO A;  2DM1 A;  5LJ3 f;  1K9M U;  5LJ3 g;  3E2U A;  4M7D B;  2ZPE B;  4J9D A;  4QQD A;  1VQ8 Q;  4C8Q F;  4GLK A;  3UA6 A;  4PJO F;  1TS9 A;  3ZEH A;  2RF0 A;  3OYJ A;  1PWT A;  2ZPB B;  1C1A A;  4RKU E;  1FMK A;  1PSE A;  2YRD A;  4ELY C;  4O6J A;  3VS2 A;  3O8V A;  3HL8 A;  1OU8 A;  4RTW A;  3RIR A;  4ZTF A;  5CKE A;  2JZ2 A;  2MIO A;  2CP5 A;  1VQK A;  2LX9 A;  3CC4 Q;  3OS0 A;  3E19 A;  2O88 A;  3SHW A;  2VUB A;  5CKB A;  1YIT Q;  1VQN Q;  1N27 A;  5CKH A;  1ZSZ C;  1WX6 A;  5GMK j;  4FT4 A;  3E9G A;  4E7S A;  5CAI A;  4EMK A;  4MZM A;  1AZG B;  1Q7Y U;  4CC4 B;  4C8Q D;  1VQP T;  2X51 A;  2FPD A;  1Q86 C;  3CMA A;  3RKX A;  1ACM B;  1WHL A;  3M0U A;  1I81 A;  4FYX B;  2WSE E;  3EG3 A;  3EFR A;  2ESW A;  2YWW A;  2LNV A;  1VQ4 A;  4B9W A;  1VQK T;  2COW A;  3IQL A;  2MMP A;  4RMO A;  2EKO A;  2DJQ A;  2KYB A;  1YBY A;  3CC7 T;  2JOY A;  2HQH A;  3QSU A;  2OTL A;  1UHF A;  2DE0 X;  2FPF A;  3MEA A;  4ZNX A;  4PL6 A;  5D6X A;  2MPX C;  1I5O B;  4BE0 A;  5GAN 3;  2FRY A;  1D1B A;  4L6V 5;  4DQ2 A;  4ELZ C;  1BI0 A;  4R55 A;  2XU8 A;  5GJV B;  3ME9 A;  2CZ6 B;  2P0Q A;  4B6M A;  4IIM A;  4J9E A;  1K9A A;  3MEU A;  2DVE A;  4BAC A;  4OVA A;  5EC7 A;  2AKL A;  1UGQ B;  5FWC A;  1VIF A;  2GGR A;  3VS4 A;  2NUZ A;  4PKC C;  1QP2 A;  2C0I A;  1GCP A;  1ABQ A;  4XU0 A;  3NGP A;  1YJN A;  3H6Z A;  3QBY A;  2CKK A;  2D8J A;  3I9Q A;  4C5G A;  2ED1 A;  2QXF A;  1BIA A;  4XAX B;  4RTX A;  1YIJ Q;  1MV3 A;  1TH7 A;  4N4H A;  3P8H A;  4F17 A;  4PJO B;  2DK3 A;  5A0D A;  2D1X A;  2RPN A;  3UT1 A;  3OYG A;  4BY6 C;  6AT1 B;  2M02 A;  3CCS A;  3RMS A;  3EG9 B;  4XU3 A;  3FDR A;  4DEY A;  4JJC A;  3SB2 A;  1Q86 R;  2JM8 A;  2I0N A;  2HKN A;  2O9S A;  4JRI A;  1ZSZ B;  5LJ3 h;  2COY A;  2E6Z A;  2X4X A;  4J9C A;  1VYT A;  2CZ7 B;  2MOX A;  3KXT A;  1KQS S;  3VV0 A;  4GBQ A;  3NMZ C;  2EGE A;  5ECA A;  3R6N A;  3VS3 A;  1YWP A;  1I8F A;  5DY9 A;  2J6K A;  2PVO B;  2Y90 A;  1B34 B;  3V8L A;  2QI2 A;  3CCE T;  1UUE A;  4NL2 A;  1Q86 U;  4C0Z A;  3ASK A;  2GFU A;  3EGD B;  2DL4 A;  3VS7 A;  3V7C A;  1W6X A;  1RAA B;  1RAG B;  1TUC A;  3AHU A;  1VQ5 Q;  1M90 R;  2F5K A;  2OAW A;  1X27 A;  1VQ6 Q;  1BK2 A;  4HXJ A;  1CSK A;  2QA4 A;  1AVZ C;  2VXE A;  3RDV A;  1RAB B;  1KG1 A;  2VGM A;  2G6F X;  2MAM A;  1ZUK A;  1ZUU A;  3I56 A;  2HL3 A;  3OYL A;  1YJW T;  1OV3 A;  4HCK A;  2PUK B;  2K9G A;  2YDL A;  1ZA2 B;  3X26 B;  1M5Q 1;  4HVU A;  1RLP C;  3P8D A;  2FVU A;  2RN8 A;  3VS6 A;  1B34 A;  1JRI A;  1VQ7 Q;  1MNE A;  1VOM A;  4DBR A;  1SF9 A;  4JDS A;  1XNI A;  1OOT A;  5GJW B;  4LE9 A;  4C8Q C;  3MO8 A;  3VRZ A;  2K79 A;  1TOV A;  2YHT A;  1UTI A;  5J39 A;  1YJW A;  1K73 U;  2QDY B;  2O9V A;  2EQM A;  3OW2 P;  1VQL T;  1M8M A;  4Z02 A;  3NFC A;  1ZA1 B;  2QTV A;  1AT1 B;  2HCK A;  2FZG B;  4PLI A;  2GQI A;  4M78 B;  4C0F A;  4C92 F;  2CP3 A;  2DIL A;  3PVQ A;  1BCM A;  3GLX A;  3HFN A;  1YJN Q;  4TVR A;  4M75 G;  1SPK A;  2A3L A;  2OTL T;  4JJD A;  1CKB A;  4MDX A;  1BCO A;  2RA2 A;  5I22 A;  2QEX A;  4FU6 A;  4E7Z A;  1W4S A;  2KT8 A;  1F1B B;  2X3X D;  3JCM h;  2CT4 A;  2KMT A;  3KUF A;  1M1F A;  1NM7 A;  2EJG A;  1KFZ A;  2LCL A;  1RLQ C;  2LJ1 A;  3CC7 Q;  2YUO A;  3LH0 A;  2COZ A;  1IXD A;  3CC4 T;  3FEO A;  1VQL A;  2XK0 A;  5DLO A;  3WVE B;  3CCJ A;  2DIQ A;  4LUE A;  4M78 D;  1U3O A;  4F7U B;  3CME A;  1IHW A;  1OPL A;  1X75 C;  2C0T A;  4HVV A;  1AWJ A; 
#chains in the Genus database with same CATH homology
 1AD5 A;  1X6G A;  2ENM A;  1K4U S;  1UEC A;  2DL3 A;  3I35 A;  1KJW A;  1TG0 A;  2DBK A;  4OMN A;  2DRK A;  2KXD A;  1VA7 A;  2DLP A;  3TSZ A;  2XMF A;  1WLP B;  1BBZ A;  1UJ0 A;  2CUB A;  1GCQ C;  1YN8 A;  1U06 A;  2DL8 A;  1Y0M A;  1ZSG A;  1WI7 A;  2L3S A;  1UG1 A;  1E7O A;  1WA7 A;  1I1J A;  2IIM A;  3M0R A;  1KIK A;  2A28 A;  2EPD A;  3EHR A;  3ULR B;  2EYZ A;  1M3B A;  3VS1 A;  2KEA A;  2BZ8 A;  1H92 A;  2M51 A;  1PHT A;  1SRL A;  2DL7 A;  4OMP A;  4RTZ A;  2LQN A;  2CSI A;  3SEM A;  1KSW A;  2LNH B;  1WFW A;  1UGV A;  2M0Y A;  2V1R A;  2LJ0 A;  5IHN A;  1GCQ A;  2BTT A;  2DBM A;  3TVT A;  1YCS B;  1FYN A;  3GBQ A;  2HDA A;  1UE9 A;  3REB B;  1PRL C;  2DL5 A;  1G2B A;  1GBQ A;  2J6O A;  3KFV A;  1NYG A;  2KRN A;  2YUP A;  2EGC A;  2MCN A;  3QWY A;  4OML A;  4LUD A;  4WCI A;  5IXF A;  1JXO A;  1N5Z A;  1ZLM A;  3H0H A;  1SHF A;  1WDX A;  1QKW A;  2CT3 A;  3UA7 A;  2P4R A;  3H0I A;  1OPK A;  2VVK A;  4A63 B;  3VS0 A;  2K6D A;  5IH2 A;  1NLO C;  1JO8 A;  5I11 A;  2L3Q A;  2D0N A;  2ROL A;  2KBT A;  5L23 A;  5IHI A;  2RQR A;  1K1Z A;  2LQW A;  1PNJ A;  1A0N B;  3REA B;  1WXT A;  2KE9 A;  2CH4 A;  1UJY A;  2ED0 A;  2O31 A;  3VRY A;  1I0C A;  2SEM A;  2NWM A;  2V1Q A;  4FSS A;  2SRC A;  1K76 A;  2DF6 A;  2PNI A;  2K2M A;  1Y57 A;  3EG1 A;  2FRW A;  1B3Q A;  2F2V A;  2DM1 A;  3NPF A;  4LN2 A;  1NLP C;  1UHC A;  2JM9 A;  2JMA A;  4J9D A;  2X3W D;  1EFN A;  2J7I A;  3M0S A;  1SRM A;  2KGT A;  4AFZ C;  3RNJ A;  2VWF A;  3UA6 A;  1NEG A;  1ZBJ A;  3TSW A;  1QWE A;  2RF0 A;  1PWT A;  2K7A A;  2A37 A;  1GL5 A;  1B07 A;  1FMK A;  2LCS A;  3M0Q A;  3O5Z A;  4J9I A;  3VS2 A;  1PKT A;  3EGU A;  4RTW A;  4J9F A;  2JW4 A;  1JEG A;  2MIO A;  2ECZ A;  1CKA A;  2LP5 A;  2KR3 A;  1JQQ A;  1QKX A;  3SHW A;  2O88 A;  2EYY A;  1NEB A;  1I07 A;  2OI3 A;  1WX6 A;  1M30 A;  1Z9Z A;  1UFF A;  1NG2 A;  1X43 A;  4F16 A;  1W1F A;  2W10 A;  2PTK A;  1AZG B;  4CC4 B;  2FPD A;  1JU5 C;  3M0U A;  3EG3 A;  4D8K A;  5IHK A;  2ESW A;  4HVW A;  4RTV A;  1M27 C;  2FG0 A;  3IQL A;  2AZS A;  1LCK A;  4AFQ C;  2DYB A;  3I5S A;  2DJQ A;  2KYB A;  2ABL A;  3ZL7 C;  4IIO A;  3FJ5 A;  1UHF A;  2DE0 X;  2FPF A;  4OMM A;  4ZNX A;  2GTJ A;  3C0C A;  4RUG A;  2KRS A;  2EBP A;  2RQV A;  1OEB A;  1ZUY A;  2FRY A;  1YNZ A;  4GLM A;  1AZE A;  1QLY A;  1J3T A;  4Z89 A;  1X6B A;  1YP5 A;  1WYX A;  2AZV A;  1HSQ A;  5GJV B;  2HSP A;  3EG0 A;  3UAT A;  4IIM A;  4J9E A;  4KRT A;  1K9A A;  5EC7 A;  2AKL A;  1X2Q A;  2QDL A;  5FWC A;  2GGR A;  3VS4 A;  2NUZ A;  2PZ1 A;  3JV3 A;  4AFS C;  2F2X A;  1E6G A;  2C0I A;  2LMJ A;  3M0P A;  1X2K A;  1GCP A;  1ABQ A;  2F2W A;  1TUD A;  4Z88 A;  2KYM A;  1H8K A;  3NGP A;  2RNA A;  2D8J A;  3I9Q A;  2ED1 A;  4DEX A;  2W0Z A;  1T0J A;  1SHG A;  3M0T A;  4RTX A;  1AOJ A;  1MV3 A;  1QCF A;  3THK A;  2DA9 A;  2EQI A;  1HD3 A;  1JXM A;  2RQT A;  4F17 A;  1WXB A;  3PVL A;  4Y92 A;  2YT6 A;  1T3L A;  2D1X A;  2RPN A;  5FW9 A;  1ZX6 A;  1HJD A;  2JMC A;  1MUZ A;  4RTU A;  2CSQ A;  2GTO A;  1PKS A;  1GFC A;  4DEY A;  1U5S A;  4JJC A;  1X69 A;  2JM8 A;  2I0N A;  1RUW A;  2HEQ A;  4X1V A;  2O9S A;  2BZY A;  3LH5 A;  2A08 A;  2EYW A;  2J6F A;  1ABO A;  1BU1 A;  1BB9 A;  4J9C A;  1VYT A;  4OMO A;  2DX1 A;  2MOX A;  3I5R A;  2KNB B;  4JPB W;  2O2O A;  1VYV A;  1E6H A;  4GBQ A;  3NMZ C;  4CC2 A;  2EGE A;  5ECA A;  3R6N A;  3VS3 A;  4AG1 C;  1YWP A;  1G83 A;  2YSQ A;  2J6K A;  2B86 A;  4J9B A;  2FEI A;  4AG2 C;  1GBR A;  2H8H A;  2KRO A;  2GBQ A;  2OJ2 A;  1AEY A;  1UUE A;  2CUD A;  2EGA A;  1SEM A;  4ESR A;  2DL4 A;  3VS7 A;  1W6X A;  2D8H A;  1M3A A;  4EIK A;  1TUC A;  3UF4 A;  2OAW A;  1X27 A;  5IXB A;  1BK2 A;  4HXJ A;  1CSK A;  3EHQ A;  1AVZ C;  2YUN A;  3EG2 A;  3RBB B;  1S1N A;  2RQW A;  2JXB A;  1YWO A;  2DRM A;  2JS2 A;  3VS5 A;  2G6F X;  1PRM C;  4E6R A;  1ZUK A;  1ZUU A;  1T3S A;  1OV3 A;  2JS0 A;  1GFD A;  4ORZ A;  2C0O A;  4HCK A;  2K9G A;  2YDL A;  2J05 A;  1QWF A;  2A36 A;  2RQU A;  2FPE A;  4HVU A;  1RLP C;  1XOV A;  2RN8 A;  2EVR A;  1UDL A;  1SSH A;  4JJB A;  4RTY A;  3VS6 A;  1V1C A;  1W70 A;  3PE0 A;  2EKH A;  4JZ3 A;  1WXU A;  1T0H A;  1H3H A;  2DMO A;  2EYX A;  2ROT A;  1OOT A;  5GJW B;  2KT1 A;  2YUQ A;  4LE9 A;  3VRZ A;  1IO6 A;  2K79 A;  3H41 A;  2LJ3 A;  1GRI A;  1UTI A;  2HBW A;  5HCK A;  2AKK A;  2O9V A;  2J06 A;  2K3B A;  2E5K A;  1AWW A;  4CC3 A;  1M8M A;  2AK5 A;  2GNC A;  1ARK A;  2KXC A;  4CC7 A;  2DVJ A;  2JTE A;  2HCK A;  2BZX A;  1K0S A;  2GQI A;  1M3C A;  4AFU C;  4R0K A;  1AWX A;  3H0F A;  3CQT A;  2DIL A;  3A98 A;  1RI9 A;  1WIE A;  3PVQ A;  1K0X A;  4OMQ A;  4F14 A;  1NYF A;  4K11 A;  1SPK A;  4JJD A;  1CKB A;  1MV0 B;  5I22 A;  2LX7 A;  2LZ6 B;  2KT8 A;  4J9G A;  2FO0 A;  2X3X D;  4LNP A;  2CT4 A;  4RTT A;  2CH4 W;  4D8D A;  4QT7 A;  1NM7 A;  1KFZ A;  1RLQ C;  2LJ1 A;  1AWO A;  2L0A A;  2YUO A;  4J9H A;  2JT4 A;  2DNU A;  4M4Z A;  3QWX X;  4JZ4 A;  2KRM A;  2CRE A;  4Z8A A;  2L2P A;  5FWB A;  2VKN A;  4LUE A;  1U3O A;  1VYU A;  2CDT A;  2EW3 A;  1Z9Q A;  2L3P A;  3U23 A;  1OPL A;  3NHN A;  2C0T A;  4HVV A;  2RMO A;  1AWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...