2GGRA

Solution structure of the c-terminal sh3 domain of c-crkii
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
GPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure and Folding Characteristics of the C-Terminal SH3 Domain of c-Crk-II
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Proto-oncogene C-crk
total genus 9
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ggrA00
1G2BA 2CUBA 2EQIA 1AZGB 1WA7A 2CSQA 1VA7A 4K11A 1GCQA 3TSWA 2HDAA 2PZ1A 2OJ2A 3H0FA 1HSQA 1LCKA 1J3TA 1E6GA 2JMCA 2EYZA 3VS3A 2RMOA 2KR3A 2MOXA 2YSQA 3VRZA 5IH2A 1UJ0A 2M0YA 3I9QA 2JW4A 1JO8A 2A28A 2JXBA 2C0IA 3M0RA 3EHRA 4OMLA 2V1QA 1V1CA 2JT4A 1ZUUA 1OPLA 4A63B 1ZLMA 4OMPA 5FWCA 3I5SA 2YDLA 2J7IA 2NUZA 3UA6A 1PKTA 2D8HA 2DBKA 2A37A 4J9CA 4RTTA 2L0AA 1GCPA 3NMZC 3TVTA 1YP5A 2KXDA 2LZ6B 4Z8AA 2K79A 1MV3A 1UHCA 4AFUC 1ARKA 1H92A 1ABQA 1GBQA 3REAB 4AFSC 1EFNA 1MUZA 2EBPA 3REBB 4RTYA 3M0SA 2LP5A 1YN8A 2FG0A 2LJ0A 1ZX6A 1AVZC 4OMOA 1OPKA 4IIMA 1TUCA 2ABLA 4JZ3A 2A08A 4J9IA 2CUDA 3EG3A 2GNCA 1SPKA 1UFFA 5FW9A 2AKLA 2BTTA 2D0NA 4J9BA 4E6RA 1WIEA 2EYWA 2DYBA 1OEBA 1JU5C 2RQUA 1PRMC 4J9HA 3RBBB 3H0HA 4AG1C 1X2KA 4LE9A 4RUGA 4CC3A 1UHFA 4GBQA 1CKBA 2CT4A 1QWEA 2D1XA 3IQLA 4HVVA 2V1RA 3VS5A 4Z89A 3ULRB 2FPDA 2DLPA 1WI7A 1WX6A 1QKWA 2K9GA 2EGEA 1PWTA 3SHWA 1ZSGA 2RPNA 2O9SA 2DBMA 4OMQA 3VS6A 3VS1A 1NYGA 1QLYA 4J9DA 1KIKA 3O5ZA 1X2QA 1VYUA 2CH4W 4HCKA 1BK2A 1GCQC 2EYXA 3LH5A 4Y92A 5ECAA 4X1VA 4AFQC 5EC7A 1RI9A 2DL3A 2YUOA 5IXFA 2KBTA 1I07A 1SRLA 2EGCA 1UECA 2MIOA 2J06A 1AWJA 1NG2A 1UE9A 4IIOA 4F14A 3CQTA 1NLOC 2DL8A 2ED1A 2L3SA 1GRIA 3NHNA 4LUEA 5IXBA 2CT3A 3I5RA 2EW3A 1AWXA 1NLPC 2FRWA 3VS2A 1W6XA 1GBRA 4CC7A 1B07A 1KSWA 2F2WA 2KYMA 2KGTA 5L23A 4CC4B 2M51A 2DRMA 2KROA 1K4US 1FYNA 1G83A 2RN8A 3I35A 3SEMA 1QCFA 3PE0A 1VYVA 2KRMA 5IHNA 1T0JA 2MCNA 2ESWA 2GQIA 2GGRA 2RF0A 4LUDA 1IO6A 2J05A 2KE9A 4HXJA 2DA9A 1N5ZA 1W70A 3VS4A 2EGAA 3U23A 2LX7A 2CREA 4D8KA 2LNHB 1NM7A 2D8JA 1ABOA 2OAWA 3JV3A 1TUDA 1M30A 3EG0A 2VKNA 1FMKA 1X27A 2W10A 1YCSB 4J9FA 1SHGA 1TG0A 2G6FX 2KXCA 2FO0A 1AWWA 3EGUA 2JTEA 2AZVA 2JM8A 2DX1A 3EG1A 1X6BA 1T3SA 1WYXA 3EG2A 1Y57A 2KRSA 2I0NA 1E7OA 2JS0A 2XMFA 1T3LA 1ZUYA 2P4RA 2DL7A 1BB9A 2AK5A 3C0CA 2JM9A 3VS7A 3QWXX 4M4ZA 3A98A 1OV3A 2LMJA 4HVWA 3ZL7C 4ESRA 4KRTA 2DJQA 2X3WD 2EKHA 2BZ8A 2EYYA 2DF6A 1SRMA 2DILA 2LJ1A 2RQWA 4DEXA 2YUPA 2CDTA 1PHTA 2KEAA 3FJ5A 4CC2A 5I11A 1Z9QA 2GTOA 1WFWA 1XOVA 1JEGA 2RQTA 4AFZC 2H8HA 5I22A 2KT1A 2RQVA 1BU1A 1K76A 1S1NA 1JQQA 4AG2C 4RTVA 1PNJA 3KFVA 2EVRA 1CKAA 1RLQC 1UG1A 1WLPB 2AKKA 1AEYA 1KJWA 2DL5A 2FRYA 4D8DA 4JJCA 1UJYA 1CSKA 5FWBA 1QWFA 2GBQA 3UF4A 1PKSA 2ENMA 2DNUA 1JXOA 2KRNA 4RTWA 1GFDA 1WXTA 2LJ3A 1WXBA 2FPEA 1VYTA 2HEQA 1BBZA 1K0SA 1OOTA 2DM1A 2OI3A 1SHFA 2PNIA 2EPDA 4ORZA 1U5SA 1E6HA 2L2PA 1WDXA 1GL5A 1W1FA 2JS2A 4QT7A 1AWOA 1HD3A 1X43A 4HVUA 3PVQA 4RTZA 2HCKA 2HBWA 1YWOA 2NWMA 3NGPA 4ZNXA 2VWFA 4JPBW 1AZEA 2F2XA 2DVJA 2FPFA 4F17A 1ZUKA 2FEIA 1M3BA 1QKXA 1Z9ZA 2DMOA 1K1ZA 1NEBA 1M27C 1X69A 1RLPC 1AD5A 2DRKA 1JXMA 3H41A 2JMAA 4J9EA 1PRLC 5HCKA 4RTXA 3VRYA 1UGVA 2J6FA 2BZYA 3R6NA 5IHIA 3M0QA 1NEGA 1UTIA 2K7AA 2KYBA 4J9GA 1MV0B 1RUWA 1GFCA 1SEMA 1ZBJA 4OMMA 4F16A 2KNBB 2J6OA 2L3PA 2SEMA 2LCSA 1H8KA 2LQNA 1K9AA 1UUEA 1T0HA 4JJDA 4GLMA 1NYFA 2IIMA 3M0UA 4FSSA 2DL4A 2O88A 2RNAA 3NPFA 1SSHA 3EHQA 2ECZA 1M3AA 2CSIA 2K2MA 2B86A 2ROLA 3UATA 4RTUA 3THKA 2DE0X 1X6GA 2GTJA 2K3BA 1M8MA 4JZ4A 2ED0A 4LN2A 1Y0MA 1U3OA 1M3CA 2K6DA 2YT6A 2QDLA 1U06A 2SRCA 2BZXA 2W0ZA 2AZSA 4Z88A 2O2OA 4OMNA 2F2VA 3PVLA 4EIKA 1KFZA 5GJWB 2KT8A 4LNPA 5GJVB 3VS0A 2C0TA 2YUQA 3RNJA 3UA7A 4R0KA 1YNZA 1B3QA 2PTKA 3M0PA 3GBQA 1WXUA 2C0OA 2RQRA 4JJBA 3QWYA 1YWPA 2VVKA 4WCIA 2CH4A 5IHKA 1UDLA 3M0TA 3H0IA 1I0CA 1K0XA 2HSPA 1H3HA 2L3QA 1I1JA 2X3XD 1AOJA 2O9VA 3TSZA 1A0NB 2O31A 2ROTA 2J6KA 1HJDA 2YUNA 2E5KA 2A36A 4DEYA 2LQWA
chains in the Genus database with same CATH superfamily
1G2BA 2QQ9A 8AT1B 2DJZA 2EQIA 1TSFA 1VA7A 3TSWA 2PZ1A 2K2VA 1R0CB 1VQMQ 1RAAB 1E6GA 1IB8A 4M7AB 2V26A 2MOXA 3JB9D 1RAGB 1IZ6A 3L42A 3BDLA 2A28A 3JB9G 1BIBA 4C92A 1YCYA 2JXBA 3M0RA 4PFPA 1WJQA 2V1QA 3HKSA 2R5MA 4JRKA 4KH1B 1ZLMA 3CCSA 4L6V5 5GAN7 4ELYC 1MMDA 2ZPEB 2NUZA 3GF5A 1PKTA 4WTOB 2CZ6B 2LNVA 1VQ6T 2DBKA 4RTTA 1IGUA 1OX8A 3NMZC 2XDPA 2OTLA 3CXCA 2FZGB 2LZ6B 2VV5A 2OX7A 4M78B 5LL6S 1RI0A 3RR6A 1H92A 1D0XA 1GBQA 3REAB 5GAOl 1MUZA 2H3EB 1VQNA 2LP5A 4M78F 4QQDA 1D1BA 2LJ0A 1BKBA 3CMAQ 1VQMT 3DB4A 1AVZC 4OMOA 2RHYA 3MP8A 4BDYA 3X20B 4JZ3A 1VQKA 4J9IA 2X35A 4PLLA 1UFFA 2AKLA 3JCMh 5CK9A 2D0NA 4J9BA 5GAOn 4E6RA 5CQXA 2HQHA 5HK3A 3MKDA 1OEBA 1JU5C 4ZN3A 4J9HA 1ACMB 1NBEB 3H0HA 5FU6C 1KHIA 3I56T 2E5QA 3L2QA 2LRQA 4LE9A 1UHFA 2FZCB 1XQHA 1CKBA 1YJNA 4RG8A 2DXBA 3IQLA 4HVVA 4M7DA 4C5HA 1K8AC 3VS5A 4B9WA 5EG2A 3HFNA 1QKWA 3CC7T 1ZSGA 4M77A 1YJWA 4C8QC 2O9SA 4KBMB 1KG1A 5DM7R 4OMQA 1QLYA 3O5ZA 4UC4A 1VYUA 2CH4W 4ZTJA 2RK1A 4F7UA 3AHUA 3CCST 3V8LA 2KAFA 4J6YA 2ZPBB 4HT9A 4M75B 2AT1B 1SSFA 1I07A 2L5QA 2DEQA 2OTLT 1VQ9Q 4XU1A 2J06A 5D6WA 4IIOA 1NLOC 4JS5A 1GRIA 4LUEA 1D0YA 4FL6A 1VQNT 4JDSA 1ZQ1A 3GIBA 4J6WA 5C0MA 3VS2A 3JCMQ 1GBRA 2DTIA 5GAN2 1ZBXA 1B07A 1KSWA 1OZ2A 5GMKh 5GANf 1VQOA 2KGTA 2OAUA 4DBFA 1FYNA 3MEVA 3J81E 4KULA 2XG8D 1MMNA 4N0AC 4PJJA 3ER0A 3EGDA 4PKCC 1YJ9A 1I5LA 2MCNA 3CCET 5GMKe 2RF0A 2K3YA 3KUFA 1D3BB 1K9MC 1QVPA 2JTFA 3X28B 2KE9A 1XNIA 1Q82R 1N5ZA 1W70A 3G71Q 1WGSA 2LX7A 3HSBA 4BD3A 2CYZB 3C94A 4Y91A 2HZYA 2A7YA 2PVDB 2K57A 6AT1B 4M7AF 2LVMA 4N0AA 3EG0A 1VQ6A 3X25B 1YCSB 1SHGA 4F04B 1Q81R 3FIFA 3G4SA 4F7UB 5LJ3h 1KQSS 8ATCB 2L89A 2LQKA 3M5AA 3EGUA 1G5VA 3OYFA 1X6BA 1T3SA 2EQJA 1WHJA 4M75G 1QW1A 3EG2A 5KH6A 1BIAA 5J26A 1Y57A 2EWNA 2I0NA 4DBQA 4FIBA 1JB0E 3UT1A 1YI2A 3CCJQ 5DY9A 1M2VB 3V7CA 3L2RA 4M4ZA 5LJ5h 4HVWA 4IUVA 5A0GA 3PIPA 2X3WD 2EYYA 2D0QB 4BI8B 1SRMA 2LJ1A 2RQWA 2QTVA 3CCUA 2ZPIB 2YUPA 1PHTA 2KEAA 1WHGA 2QK0A 4PFOA 1K9MR 1Q7YC 2KQWA 1BI2A 4AFZC 2H8HA 3CC4Q 1JQQA 4AG2C 4OGCA 1CKAA 3M58A 4C92F 1WLPB 2AKKA 1KJWA 2DL5A 2MK5A 3P8DA 3P8HA 4PJOA 3LW5E 4JJCA 5GAOq 1CSKA 5GAOp 1ZSZC 2JZ2A 1PKSA 2ENMA 1JXOA 2MYSA 3CXCS 3CCEA 1YJ9T 1S72T 2DIGA 3SWNC 2FYKA 2OI3A 3CCQT 5KE3A 3DLMA 4II1A 4ORZA 2QGGA 3EH2A 3OW2A 2L2PA 1WDXA 2X51A 2EFIA 1W1FA 3RKXA 3CD6A 2JS2A 1VQPQ 1UB4A 3PVQA 3S3OA 3MO8A 2CP7A 1YWOA 4FM4B 1ZA1B 2VWFA 4JPBW 3GP8A 1AZEA 1VQ7A 1N27A 4A4EA 5GMKj 4PJOG 2M16A 1KC8C 4FYXB 2FEIA 3J7AF 1Z9ZA 4PJOD 2DMOA 1YIJQ 3OBWA 2RHXA 2DXUA 4NOYA 1NPPA 1JXMA 3H41A 4E7IA 3CCMA 2P0QA 3R6NA 1M8VA 2RHZA 1QVGP 3CBPA 3HHTB 1NEGA 2K5FA 5CKBA 5LJ5g 2KYBA 3VUZA 2CKKA 3G6ET 1FMWA 1MV0B 5CQYA 3JCMc 1RUWA 1SEMA 4OMMA 3CCQQ 2SEMA 1H8KA 3CCSQ 2LQNA 2XHCA 1UUEA 1T0HA 2ZCFB 4KGXB 4IUTA 4FSSA 4M75A 2RNAA 3NPFA 5LJ3d 4PK4A 4QW2A 3CCVT 4FSXA 3I55Q 1MHNA 4EMGA 4QVDA 2K3BA 4PLIA 3TEEA 4EPCA 4DOVA 4PJOE 5GAMd 5KYWB 2LT4A 2K6DA 1MMAA 1S72Q 4M7DB 2BZXA 3OYMA 3TCJA 3RMQA 1Y71A 5GMKl 2O2OA 3MP1A 4OMNA 1KFZA 3MJXA 1MMGA 5GJVB 2YUQA 3JB9I 3M55A 1TOVA 1B3QA 4Z02A 4FT2A 3J80E 4ZGDB 2C0OA 1NJIR 1M2OA 2RQRA 5GAMe 3H9NA 4JJBA 1JJ2A 1N9SA 1EIFA 1VQPA 5IHKA 1N6AA 2HD0A 3OYCA 2HQXA 1YITQ 2RH2A 4N4HA 2JN0A 4V2SA 2HSPA 2PVGB 2X3XD 3QYGB 5GAOr 4M77F 4C8QF 2O31A 3OSSC 2NUPB 2Y90A 2E5KA 2A36A 2LQWA 3G71T 2P84A 2DTHA 3JCMV 1VQKT 2HDAA 3E19A 3SD4A 4JUVA 2OJ2A 3H0FA 3PNWC 3ASKA 4X9DA 4HKEA 4KH0B 2RMOA 5GAN5 2KR3A 5IH2A 2JW4A 3RERA 3RKWA 3LWHA 4DBHA 2XDBA 4B9XA 4C8QB 2F1LA 2O4XA 1Q7YU 1JJ2P 3QIIA 1ZUUA 2QDYB 3WVDB 4OMPA 1C1AA 5FWCA 2J7IA 3UA6A 1YIJA 5IAYA 3CCRT 2L0AA 1VQLA 1QCNA 1YP5A 2DETA 2D9TA 2QQRA 4Z8AA 4M7DG 2XI9A 3M59A 1UHCA 4AFUC 1VQ5T 1ARKA 4OB2B 3I55A 4BE2A 3MHXA 2RB6A 2DXTA 4M77B 2LX9A 1BI3A 1EFNA 4JS4A 1Q7YR 4HCZA 2VXEA 4XQ3A 3QDRB 2Y4YA 4M7AA 2BIVA 2M9UA 4F7UE 1ZX6A 1B7TA 1WJSA 5HKCA 3JB9H 2DYIA 3EFRA 3BDUA 5CKFA 1FXXA 2CUDA 1OU8A 1BCOA 2YRDA 5FW9A 2BTTA 1OYXA 3RESA 2RJCA 2RM4A 3EH1A 2DYBA 1M4ZA 1PRMC 2P0PA 2HNIA 4VUBA 1IHWA 3CC7Q 5KYUA 4GBQA 1QWEA 2D1XA 2V1RA 2DO3A 2V8KA 4ZGEB 2FPDA 2WSFE 2GCXA 4AMCA 5KCOA 2EGEA 2F5TX 4EMKC 3SHWA 2EIFA 2RA2A 2EQMA 3G6EQ 1RAFB 3CC2A 1Q81U 1VQOQ 3JCMX 4J9DA 1X2QA 4JJNK 4DA4A 1GCQC 2EYXA 3HPWA 3FDRA 5ECAA 4Y92A 4X1VA 3AT1B 2RHUA 4RCBA 4EMKB 4C92G 3CPWA 5EC7A 1RI9A 4A54A 1TH7A 2ZGWA 3C95A 2KBTA 3VV0A 1P92A 3N5BB 2VUBA 1UECA 2KDSA 3PGGA 1OULA 1NG2A 2E41A 4F14A 2DIQA 4OB0B 2CZ0B 3LH0A 2L3SA 1ZSZA 1C0MA 3HRUA 5IXBA 1VQ9A 1AT1B 3CBOA 5CO7A 3V7RA 1IGQA 2GQVA 1VQ6Q 1AWXA 1ZSZB 2XU8A 2FRWA 1W6XA 4CC7A 4M77E 1NPRA 2ATCB 2KYMA 3QPHA 2QQAA 1KK7A 2QAZA 3EFOA 3QHSA 3FJPA 3RIRA 2KROA 3OY9A 1SKUB 4DOWA 2RN8A 3I35A 3QBYA 3SEMA 1QCFA 1WHMA 2Z0WA 3QYHB 3NFCA 2KRMA 1YJWT 2X4XA 1YHQQ 4MMKA 1T0JA 3H8ZA 4QQ6A 3L2UA 1TS9A 5GMKm 5KYWA 2CZ1B 4MMLA 2E1HA 5GANd 3FEOA 3KXTA 5IN1A 2V8JA 1IO6A 4M78A 2J05A 5GAMh 3CMEA 2DA9A 3JCMg 2MAMA 4QQGA 3CCLT 5KCHA 3CC2T 2BE9B 1KQSA 2D8JA 3JV3A 2OAWA 3LGFA 5LJ3g 3DKMA 2QXFA 1TUDA 4LD9K 4Y28E 2VKNA 2W10A 3MPUB 1RL2A 4M75C 1QVGS 2V8IA 1TG0A 3MEUA 3LLRA 3I56Q 2DX1A 1KQ1A 1WYXA 3KBGA 1IXDA 2JS0A 1T3LA 2DZ9A 4QVZA 2HQEA 2E6NA 3JCMb 2AK5A 1W2BS 1KD1U 2F5KA 2G3RA 2MF2A 3A98A 3QKJA 1OV3A 2HKNA 1U1TA 3ZL7C 4ESRA 4ELZC 4KRTA 2DJQA 3CC4T 2EKHA 4PJOB 1D1CA 2K4YA 2RD1A 5CKHA 2PUOB 3OYIA 1B34A 4DEXA 1UGPB 1VUBA 2DXCA 5I11A 1Z9QA 1WFWA 1Y96A 1XOVA 4A4FA 2KT1A 4XU2A 1BU1A 1K76A 1S1NA 4A4HA 1Q82C 4RTVA 4PJLA 3KFVA 1UG1A 1WPYA 1AEYA 4DQ2A 4M78C 1G8XA 3A8HB 1M1GA 2GBQA 1WXBA 2FPEA 1VYTA 2HEQA 2DVEA 2DM1A 3JCMd 4JRQA 4KUIA 3CCMQ 3QSUA 4PJOC 2DFUA 3CCQA 1VQKQ 1GL5A 3PFSA 4QT7A 2EJGA 1FX7A 3EFSA 3A8OB 2WSCE 4M78E 3RDVA 4M7DD 3TREA 2ZAEA 4F17A 4KUDK 3X26B 1VIEA 4M7DE 3CEYA 2LC4A 1K1ZA 1QCOA 4O5VA 5FROA 3BFMA 1PRLC 4RTXA 1UGVA 2CGHA 2HSEB 1WNLA 5IHIA 3M0QA 1VQMA 4OGEA 2XKOC 4J9GA 2QASA 5J3BA 1M1KC 1GFCA 1ZBJA 1PD0A 1OQKA 4PJOF 4F16A 2XK0A 4RCCA 5FLXE 4NL3A 2RHIA 1VIFA 4C5GA 3JCMf 1V29B 1QVFP 2GF7A 4GLMA 2O88A 1FWZA 1SSHA 1K9MU 1OZ3A 1M3AA 2K2MA 2B86A 1Y7XA 2ROLA 5FU7B 3RMSA 4CI0C 1UGRB 4OVAA 4BY6C 1I81A 2MWOA 3OYBA 2DE0X 1X6GA 4GLKA 3GOXA 3WXMB 5GANe 2KMTA 4BE1A 2YRVA 3LYIA 4C0ZA 1G3SA 4MDXA 5A2QE 1G3YA 2EKOA 5GAOm 3CCJA 2YT6A 2QDLA 4OF1A 5GAN4 1SF9A 3GNGA 4XTUA 3E1SA 3HRSA 3V7SA 1M5Q1 2QG9B 2W0ZA 4BDZA 2AZSA 4J5YA 4Z88A 1W2BP 3PVLA 4ZGJB 4J7IA 3UPUA 5GJWB 1WZOA 1PC0A 2C0TA 4IUQA 3RNJA 3CPWS 1YNZA 3FB9A 2PTKA 2C06A 1K73C 4N4IA 3URGA 1OI1A 2NUTA 2VVKA 4XTYA 2MWPA 1PG5B 2QA4T 4M75E 1UDLA 3H6ZA 1G3TA 4C8QE 1AHJB 1I1JA 3JCMP 1R77A 2RI5A 3TSZA 2CP6A 5KYXB 1W2BA 2YUNA 5I2MA 1KQ2A 1X01A 2E3IA 2DERA 2CSQA 4K11A 1GCQA 1JBMA 4P5NA 4HT8A 1HSQA 1LCKA 1J3TA 2JMCA 4FW1A 3VS3A 4JLIA 4C8QG 1M9SA 2M0YA 3C12A 1JO8A 2QQSA 3EHRA 4XK8E 4OMLA 3META 4R55A 2H3JA 2RJEA 1OPLA 1YIJT 5GAN6 1K73R 1UEBA 3OB9A 2D8HA 4J9CA 4A4GA 5FU7C 3L2WA 4ZTFA 4PJMA 2K79A 1N9RA 4A53A 4E7KA 4YTLA 4OB3B 4M7DF 1BI0A 3LWIA 1VQ5A 5KYXA 3I55T 4TVRA 2JVVA 4MZPA 3REBB 4NL2A 1YN8A 2GFAA 4C0FA 1NZ9A 1D1AA 4FYWB 2NLUA 1N8RR 1OPKA 2VXFA 4AT1B 4BUGA 3OMGA 3EG3A 2GNCA 1SPKA 3MCAB 4MDWA 4C92D 3DLLA 1WIEA 2RQUA 3RBBB 3VU3C 1VQ8Q 4AG1C 1R0BG 1X2KA 4RUGA 4E7LA 3E9FA 3NTIA 4XTXA 1X6OA 4Z89A 1X75C 2DLPA 1WHLA 2K9GA 1YJNQ 3A5ZB 1PWTA 2CZ7B 2RPNA 1QMCA 1KC8U 3CMAA 2EQUA 3CPFA 3GPLA 3TQ7P 1WHHA 2DTOA 4XU0A 2DBMA 4C92B 5KYNA 3VS1A 1NYGA 3QUIA 1VQNQ 2EJ9A 1KIKA 2IPOB 4HCKA 1YJWQ 3LH5A 3CMET 4LDXA 1EZZB 2DZCA 3OYLA 3CBMA 3QXEB 2DL3A 4IUUA 3CCUQ 2M0OA 5IXFA 2E12A 1UGSB 4C8QA 4LDVA 1SRLA 1VQ7T 2EGCA 4KGZB 4IUPA 5DLOA 3UDCA 2MIOA 1VQ8A 1XTDA 4C92E 1QP2A 1AWJA 1UE9A 2IVWA 2IG0A 3CD6Q 2FZKB 2ED1A 3NHNA 1PSFA 2KVQG 3I5RA 3VUBA 2OTLQ 1C6VX 4FCYA 1NLPC 3G6EA 3PMTA 2COZA 1NJIC 2F2WA 4PFZA 1PM3A 2Y4XA 2M51A 2DRMA 1OU9A 1N8RC 3X24B 3OYAA 2FB7A 2OTJQ 1VQ4Q 5IHNA 5GAMg 3SB2A 3OMCA 3BE3A 1QVFA 1VQ4A 1M1FA 5A0LA 3OS1A 1K73U 3D7SB 2PU9B 1I8FA 3CC7A 4HXJA 2EGAA 2CREA 4D8KA 2LNHB 3CD6T 4M77C 1ABOA 2QTXA 3LX7A 1M30A 2YLCA 1FMKA 3OYEA 4J9FA 4NS5A 2G6FX 2YXYA 3SFMA 5GANg 1Q86C 2COWA 2FO0A 3A8LB 1HK9A 4RG2A 4A4KA 2KRSA 2D6FA 2JJ9A 1YFNA 2XMFA 1ZUYA 2P4RA 5GAN8 4HCCA 2DL7A 2LQ8A 3C0CA 3VS7A 2JM9A 2YWWA 3OYDA 3QWXX 3OW2P 1VOMA 2RO0A 5D7UA 1SG5A 4XTWA 2DF6A 2DILA 3CC4A 1QQJA 1HYOA 2DK3A 5CCAA 1Q95G 2GTOA 1JEGA 1JJ2S 2MMPA 2RQVA 3I56A 1PNJA 2CS7A 4ANJA 5FU6B 2FRYA 2WSEE 4D8DA 2DEUA 2XICA 4IKFA 2KY9A 5FWBA 1QWFA 1O75A 4BB7A 5CIUA 2DNUA 3L2ZA 4C8QD 1LOJA 4BE0A 4RTWA 1GFDA 1PCXA 1MNEA 2LJ3A 3BY7A 1BBZA 1K0SA 1OOTA 2COYA 3OQ5A 2AHJB 2E65A 1VQ4T 2QEXA 1SHFA 2PNIA 3HRTA 2M1HA 4PJNA 2JUFA 2QQBA 5LJ5j 3QZ5B 2R58A 2FVUA 4RTZA 2OTJT 5M9OA 2O01E 2EQKA 2NWMA 2P4TA 4ZNXA 3M56A 2XIDA 2ZZDA 1U8RA 4M75F 3PT9A 2VB6A 1M90R 2FPFA 2X4WA 1F1BB 1ZUKA 3EAEA 1QKXA 4LDUA 1RADB 3CCLQ 1X69A 1RLPC 3S6WA 2QGFB 2ZPFB 2JMAA 5HCKA 3M4YA 1PSEA 2GFUA 1K8AU 4MZMA 3EGXB 3EFOB 3JB9J 1WHKA 4LXCA 1M1KR 4J6XA 1U1SA 5AYFA 1ZHIA 1VQ5Q 4BACA 2E6ZA 4FYVB 2L3PA 2LCSA 3V8KA 3M9QA 4XAXB 4E2FB 3NTHA 2EJFA 1NYFA 2IIMA 3M0UA 1M2VA 2VGMA 4M7AC 2CSIA 5CR2A 4CRIA 5HK0A 4O6JA 2JOYA 1IREB 1MGQA 2GTJA 3QG1A 2RJFA 3R6OA 4X34A 2NUTB 4J8OA 2MI6A 1IRXA 2E4HA 4LN2A 3CCJT 3JAME 4FT4A 4XU3A 5I2SA 1M3CA 5GMKi 3CCRA 1U06A 2SRCA 4GY5A 1BI1A 3ZEHA 2BE7D 4E7JA 4EIKA 2F2VA 4HA8A 1YITT 2DPPB 3PIOA 3OYJA 4PL6A 1D09B 3M0PA 1KD1C 3Q1JA 4L5GA 4FW2A 1RAHB 2MPXC 3G7ZA 3QWYA 4WCIA 1YJ9Q 3DB3A 2FL7A 2CH4A 3P8BB 2JTMA 2QI2A 1B34B 4C5EA 4WF2A 4C0DC 3M0TA 1I5OB 1I0CA 3JCMW 2L3QA 1AOJA 5LJ5f 4BI4A 1A0NB 3QZ9B 1Q86U 2ROTA 1VQLQ 4C92C 2BKDN 2X4YA 4DEYA 4KGVB 3INZA 3JB9F 2CUBA 1AZGB 1WA7A 2RI2A 1RACB 1NJIU 2EAYA 3L1AA 5LJ3f 1D3BA 4XTVA 2EYZA 1M90U 2YSQA 3VRZA 3M57A 1UJ0A 3I9QA 1QVGA 3T9NA 3OYGA 3EGXA 2KI7A 2C0IA 3FLGA 3FRNA 1V1CA 2QEXT 2JT4A 1Y96B 4J83A 1PD1A 4A63B 1Q82U 1WJRA 2DKGA 3I5SA 3OYYA 2YDLA 2PQWA 2M02A 2A37A 1GCPA 3TVTA 3LGLA 2KXDA 1LNXA 3EG9B 1O9SA 3VJPA 1MV3A 1NE8A 3A8GB 3JSCA 1ABQA 1TXQA 4D6WA 4AFSC 2NUPA 5GANj 2EBPA 1WQWA 4RTYA 4C0DB 3M0SA 4RMOA 2RK2A 2FG0A 4IIMA 4OMFB 1TUCA 2ABLA 2A08A 5FRMA 1IHVA 3UWNA 2JNGA 2EYWA 4M7AD 1YJNT 1QP3A 3ME9A 4CC3A 3BW1A 1KHCA 1VQOT 1OX9A 2CT4A 4LD6A 2DAQA 5FRNA 3RKYA 3ULRB 5IT9E 2XD0A 1WI7A 1WX6A 3CMAT 2LT1A 1R8OB 2DD5A 1MNDA 4ZN1A 3OYHA 3GNFB 3VS6A 2X4JA 5LJ5e 3JCMJ 3OW2S 4Q5WA 1BK2A 3HL8A 3MEWA 1Q86R 4AFQC 2E3HA 2ZPHB 4E7ZA 1I4K1 2LCCA 1YITA 2YUOA 2HMAA 1KD1R 1K8AR 2O4XB 2HAXA 4ME7A 3O8VA 3QO3A 1DJ7B 3WVEB 2E70A 1H641 1HXDA 3JCMe 1VQ8T 1KC8R 2QYZA 4FU6A 5GAMj 3CQTA 2DL8A 3ZBDA 2CT3A 2FHDA 1ZA2B 1LJOA 1YI2T 3A8MB 3EG9A 2EW3A 1G3WA 2F69A 3S3NA 4OP0A 4X9CA 2EYQA 1YHQT 2A0FB 3GLXA 2VGNA 3CCRQ 5LJ3j 3VYGA 4L59A 3TU4K 3E2UA 5L23A 4CC4B 1KQSP 2B8AA 1BCMA 1K4US 2I2LA 4QVCA 1M1KU 4BY6B 1LPLA 1G83A 3OS5A 5CVIA 1UGQB 5CKDA 3PE0A 4LDYA 1VYVA 3M54A 4C5IA 2ESWA 2GQIA 2GGRA 3MP6A 5I21A 2ZPGB 4LUDA 7AT1B 3VS4A 3U23A 4PNOA 4OB1B 1NM7A 4FYYB 2HKQB 3JRZA 3PTAA 4JRIA 3NTKA 3CXCP 1X27A 2RJDA 1RAIB 3OS2A 2CP2A 1M90C 1VQLT 2KXCA 2L3RA 1AWWA 3CCVQ 3OA6A 2JTEA 3CC2Q 2AZVA 2JM8A 3EG1A 5CAIA 1RABB 2OTJA 2E10A 1TTHB 1E7OA 1LVKA 1QVFS 3A1PA 1BB9A 4M77G 4C0GA 2QA4A 2YRCA 2HL3A 1YBYA 4M77D 2LMJA 5C6SA 3E9GA 4E7HA 3CMEQ 5KYUB 2BZ8A 1VQ9T 2HBPA 5GAN3 1TU0B 2CDTA 3F70A 3HP9A 3FJ5A 5D6YA 4CC2A 4N4GA 1VQ7Q 3CCUT 2R57A 1V76A 2RQTA 5I22A 3SWNA 2EVRA 1RLQC 1FMVA 4KT0E 1UJYA 2CP0A 2P0KA 4M75D 1YI2Q 3UF4A 1S72A 2KRNA 1WXTA 3QJ6A 2NYSA 3OS0A 1BYMA 3QDFA 3VKIA 4QKUA 3G1JA 4F7UG 4R56A 2EPDA 9ATCB 2WACA 3G4ST 1U5SA 1E6HA 2RI3A 4RKUE 1H3ZA 3EGDB 1AWOA 1HD3A 1X43A 4HVUA 4BI3A 3S3MA 2HCKA 4ATOA 4EDUA 2HBWA 3PMIA 3NGPA 2LDMA 2F2XA 4DBRA 2DVJA 3HTRA 5LJ5d 4IURA 4J7FA 1Q81C 3SDZA 1RAEB 1M3BA 5CKEA 3M53A 1NEBA 3RUXA 1M27C 3CCMT 1AD5A 2DRKA 3C4SA 3OYNA 2YLBA 2PVOB 4J9EA 3VRYA 2J6FA 2BZYA 3SWNB 3HFOA 2K7AA 1UTIA 3MEAA 3V8JA 4LDWA 4E7SA 3G4SQ 1N8RU 4M7DC 4F7UF 1YHQA 5GANh 1GXIE 3OSVA 3VYHB 2KNBB 2J6OA 2K5IA 2L8DA 1K9AA 4M7AG 4B6MA 4E47A 1XJWB 5KYYB 2DD4A 4JJDA 2AIRB 5D6XA 3G71A 3CPWP 2VYTA 2DL4A 2R5AA 3L2VA 3EHQA 5KYYA 4EMHA 2ECZA 3UATA 4RTUA 3THKA 2YHTA 2KK4A 5J39A 3QJYA 1M8MA 2XDDA 4JZ4A 2LTOA 3CCVA 2ED0A 3CCLA 1Y0MA 3FC3A 1U3OA 2LCLA 4M7AE 3OBYA 2K5LA 4M78D 1WQ7A 5DLQE 2PUKB 5KE2A 4M78G 2QA4Q 3OYKA 2KT8A 2X9HA 4LNPA 3VS0A 1TWBA 2HL5C 3UA7A 4R0KA 2CP3A 3M4GA 5L8RE 4EMKA 2QEXQ 3CCEQ 4JLGA 3GBQA 3ZFJA 1WXUA 2E64A 1VQPT 2A3LA 2VASA 4MZTA 1YWPA 1JRIA 4HCBA 1TUGB 2K3XA 3H0IA 5A0DA 1K0XA 1W4SA 1D0ZA 1H3HA 5HY6A 4XTZA 5AT1B 5GAMf 2O9VA 4JRPA 2CP5A 2KSSA 5LJ3e 1Y07A 2J6KA 1HJDA 1EX4A 2BUDA 2VC8A
chains in the Genus database with same CATH topology
1G2BA 2CUBA 2EQIA 1AZGB 1WA7A 2CSQA 1VA7A 4K11A 1GCQA 3TSWA 2HDAA 2PZ1A 2OJ2A 3H0FA 1HSQA 1LCKA 1J3TA 1E6GA 2JMCA 2EYZA 3VS3A 2RMOA 2KR3A 2MOXA 2YSQA 3VRZA 5IH2A 1UJ0A 2M0YA 3I9QA 2JW4A 1JO8A 2A28A 2JXBA 2C0IA 3M0RA 3EHRA 4OMLA 2V1QA 1V1CA 2JT4A 1ZUUA 1OPLA 4A63B 1ZLMA 4OMPA 5FWCA 3I5SA 2YDLA 2J7IA 2NUZA 3UA6A 1PKTA 2D8HA 2DBKA 2A37A 4J9CA 4RTTA 2L0AA 1GCPA 3NMZC 3TVTA 1YP5A 2KXDA 2LZ6B 4Z8AA 2K79A 1MV3A 1UHCA 4AFUC 1ARKA 1H92A 1ABQA 1GBQA 3REAB 4AFSC 1EFNA 1MUZA 2EBPA 3REBB 4RTYA 3M0SA 2LP5A 1YN8A 2FG0A 2LJ0A 1ZX6A 1AVZC 4OMOA 1OPKA 4IIMA 1TUCA 2ABLA 4JZ3A 2A08A 4J9IA 2CUDA 3EG3A 2GNCA 1SPKA 1UFFA 5FW9A 2AKLA 2BTTA 2D0NA 4J9BA 4E6RA 1WIEA 2EYWA 2DYBA 1OEBA 1JU5C 2RQUA 1PRMC 4J9HA 3RBBB 3H0HA 4AG1C 1X2KA 4LE9A 4RUGA 4CC3A 1UHFA 4GBQA 1CKBA 2CT4A 1QWEA 2D1XA 3IQLA 4HVVA 2V1RA 3VS5A 4Z89A 3ULRB 2FPDA 2DLPA 1WI7A 1WX6A 1QKWA 2K9GA 2EGEA 1PWTA 3SHWA 1ZSGA 2RPNA 2O9SA 2DBMA 4OMQA 3VS6A 3VS1A 1NYGA 1QLYA 4J9DA 1KIKA 3O5ZA 1X2QA 1VYUA 2CH4W 4HCKA 1BK2A 1GCQC 2EYXA 3LH5A 4Y92A 5ECAA 4X1VA 4AFQC 5EC7A 1RI9A 2DL3A 2YUOA 5IXFA 2KBTA 1I07A 1SRLA 2EGCA 1UECA 2MIOA 2J06A 1AWJA 1NG2A 1UE9A 4IIOA 4F14A 3CQTA 1NLOC 2DL8A 2ED1A 2L3SA 1GRIA 3NHNA 4LUEA 5IXBA 2CT3A 3I5RA 2EW3A 1AWXA 1NLPC 2FRWA 3VS2A 1W6XA 1GBRA 4CC7A 1B07A 1KSWA 2F2WA 2KYMA 2KGTA 5L23A 4CC4B 2M51A 2DRMA 2KROA 1K4US 1FYNA 1G83A 2RN8A 3I35A 3SEMA 1QCFA 3PE0A 1VYVA 2KRMA 5IHNA 1T0JA 2MCNA 2ESWA 2GQIA 2GGRA 2RF0A 4LUDA 1IO6A 2J05A 2KE9A 4HXJA 2DA9A 1N5ZA 1W70A 3VS4A 2EGAA 3U23A 2LX7A 2CREA 4D8KA 2LNHB 1NM7A 2D8JA 1ABOA 2OAWA 3JV3A 1TUDA 1M30A 3EG0A 2VKNA 1FMKA 1X27A 2W10A 1YCSB 4J9FA 1SHGA 1TG0A 2G6FX 2KXCA 2FO0A 1AWWA 3EGUA 2JTEA 2AZVA 2JM8A 2DX1A 3EG1A 1X6BA 1T3SA 1WYXA 3EG2A 1Y57A 2KRSA 2I0NA 1E7OA 2JS0A 2XMFA 1T3LA 1ZUYA 2P4RA 2DL7A 1BB9A 2AK5A 3C0CA 2JM9A 3VS7A 3QWXX 4M4ZA 3A98A 1OV3A 2LMJA 4HVWA 3ZL7C 4ESRA 4KRTA 2DJQA 2X3WD 2EKHA 2BZ8A 2EYYA 2DF6A 1SRMA 2DILA 2LJ1A 2RQWA 4DEXA 2YUPA 2CDTA 1PHTA 2KEAA 3FJ5A 4CC2A 5I11A 1Z9QA 2GTOA 1WFWA 1XOVA 1JEGA 2RQTA 4AFZC 2H8HA 5I22A 2KT1A 2RQVA 1BU1A 1K76A 1S1NA 1JQQA 4AG2C 4RTVA 1PNJA 3KFVA 2EVRA 1CKAA 1RLQC 1UG1A 1WLPB 2AKKA 1AEYA 1KJWA 2DL5A 2FRYA 4D8DA 4JJCA 1UJYA 1CSKA 5FWBA 1QWFA 2GBQA 3UF4A 1PKSA 2ENMA 2DNUA 1JXOA 2KRNA 4RTWA 1GFDA 1WXTA 2LJ3A 1WXBA 2FPEA 1VYTA 2HEQA 1BBZA 1K0SA 1OOTA 2DM1A 2OI3A 1SHFA 2PNIA 2EPDA 4ORZA 1U5SA 1E6HA 2L2PA 1WDXA 1GL5A 1W1FA 2JS2A 4QT7A 1AWOA 1HD3A 1X43A 4HVUA 3PVQA 4RTZA 2HCKA 2HBWA 1YWOA 2NWMA 3NGPA 4ZNXA 2VWFA 4JPBW 1AZEA 2F2XA 2DVJA 2FPFA 4F17A 1ZUKA 2FEIA 1M3BA 1QKXA 1Z9ZA 2DMOA 1K1ZA 1NEBA 1M27C 1X69A 1RLPC 1AD5A 2DRKA 1JXMA 3H41A 2JMAA 4J9EA 1PRLC 5HCKA 4RTXA 3VRYA 1UGVA 2J6FA 2BZYA 3R6NA 5IHIA 3M0QA 1NEGA 1UTIA 2K7AA 2KYBA 4J9GA 1MV0B 1RUWA 1GFCA 1SEMA 1ZBJA 4OMMA 4F16A 2KNBB 2J6OA 2L3PA 2SEMA 2LCSA 1H8KA 2LQNA 1K9AA 1UUEA 1T0HA 4JJDA 4GLMA 1NYFA 2IIMA 3M0UA 4FSSA 2DL4A 2O88A 2RNAA 3NPFA 1SSHA 3EHQA 2ECZA 1M3AA 2CSIA 2K2MA 2B86A 2ROLA 3UATA 4RTUA 3THKA 2DE0X 1X6GA 2GTJA 2K3BA 1M8MA 4JZ4A 2ED0A 4LN2A 1Y0MA 1U3OA 1M3CA 2K6DA 2YT6A 2QDLA 1U06A 2SRCA 2BZXA 2W0ZA 2AZSA 4Z88A 2O2OA 4OMNA 2F2VA 3PVLA 4EIKA 1KFZA 5GJWB 2KT8A 4LNPA 5GJVB 3VS0A 2C0TA 2YUQA 3RNJA 3UA7A 4R0KA 1YNZA 1B3QA 2PTKA 3M0PA 3GBQA 1WXUA 2C0OA 2RQRA 4JJBA 3QWYA 1YWPA 2VVKA 4WCIA 2CH4A 5IHKA 1UDLA 3M0TA 3H0IA 1I0CA 1K0XA 2HSPA 1H3HA 2L3QA 1I1JA 2X3XD 1AOJA 2O9VA 3TSZA 1A0NB 2O31A 2ROTA 2J6KA 1HJDA 2YUNA 2E5KA 2A36A 4DEYA 2LQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2B A;  2CUB A;  2EQI A;  1AZG B;  1WA7 A;  2CSQ A;  1VA7 A;  4K11 A;  1GCQ A;  3TSW A;  2HDA A;  2PZ1 A;  2OJ2 A;  3H0F A;  1HSQ A;  1LCK A;  1J3T A;  1E6G A;  2JMC A;  2EYZ A;  3VS3 A;  2RMO A;  2KR3 A;  2MOX A;  2YSQ A;  3VRZ A;  5IH2 A;  1UJ0 A;  2M0Y A;  3I9Q A;  2JW4 A;  1JO8 A;  2A28 A;  2JXB A;  2C0I A;  3M0R A;  3EHR A;  4OML A;  2V1Q A;  1V1C A;  2JT4 A;  1ZUU A;  1OPL A;  4A63 B;  1ZLM A;  4OMP A;  5FWC A;  3I5S A;  2YDL A;  2J7I A;  2NUZ A;  3UA6 A;  1PKT A;  2D8H A;  2DBK A;  2A37 A;  4J9C A;  4RTT A;  2L0A A;  1GCP A;  3NMZ C;  3TVT A;  1YP5 A;  2KXD A;  2LZ6 B;  4Z8A A;  2K79 A;  1MV3 A;  1UHC A;  4AFU C;  1ARK A;  1H92 A;  1ABQ A;  1GBQ A;  3REA B;  4AFS C;  1EFN A;  1MUZ A;  2EBP A;  3REB B;  4RTY A;  3M0S A;  2LP5 A;  1YN8 A;  2FG0 A;  2LJ0 A;  1ZX6 A;  1AVZ C;  4OMO A;  1OPK A;  4IIM A;  1TUC A;  2ABL A;  4JZ3 A;  2A08 A;  4J9I A;  2CUD A;  3EG3 A;  2GNC A;  1SPK A;  1UFF A;  5FW9 A;  2AKL A;  2BTT A;  2D0N A;  4J9B A;  4E6R A;  1WIE A;  2EYW A;  2DYB A;  1OEB A;  1JU5 C;  2RQU A;  1PRM C;  4J9H A;  3RBB B;  3H0H A;  4AG1 C;  1X2K A;  4LE9 A;  4RUG A;  4CC3 A;  1UHF A;  4GBQ A;  1CKB A;  2CT4 A;  1QWE A;  2D1X A;  3IQL A;  4HVV A;  2V1R A;  3VS5 A;  4Z89 A;  3ULR B;  2FPD A;  2DLP A;  1WI7 A;  1WX6 A;  1QKW A;  2K9G A;  2EGE A;  1PWT A;  3SHW A;  1ZSG A;  2RPN A;  2O9S A;  2DBM A;  4OMQ A;  3VS6 A;  3VS1 A;  1NYG A;  1QLY A;  4J9D A;  1KIK A;  3O5Z A;  1X2Q A;  1VYU A;  2CH4 W;  4HCK A;  1BK2 A;  1GCQ C;  2EYX A;  3LH5 A;  4Y92 A;  5ECA A;  4X1V A;  4AFQ C;  5EC7 A;  1RI9 A;  2DL3 A;  2YUO A;  5IXF A;  2KBT A;  1I07 A;  1SRL A;  2EGC A;  1UEC A;  2MIO A;  2J06 A;  1AWJ A;  1NG2 A;  1UE9 A;  4IIO A;  4F14 A;  3CQT A;  1NLO C;  2DL8 A;  2ED1 A;  2L3S A;  1GRI A;  3NHN A;  4LUE A;  5IXB A;  2CT3 A;  3I5R A;  2EW3 A;  1AWX A;  1NLP C;  2FRW A;  3VS2 A;  1W6X A;  1GBR A;  4CC7 A;  1B07 A;  1KSW A;  2F2W A;  2KYM A;  2KGT A;  5L23 A;  4CC4 B;  2M51 A;  2DRM A;  2KRO A;  1K4U S;  1FYN A;  1G83 A;  2RN8 A;  3I35 A;  3SEM A;  1QCF A;  3PE0 A;  1VYV A;  2KRM A;  5IHN A;  1T0J A;  2MCN A;  2ESW A;  2GQI A;  2GGR A;  2RF0 A;  4LUD A;  1IO6 A;  2J05 A;  2KE9 A;  4HXJ A;  2DA9 A;  1N5Z A;  1W70 A;  3VS4 A;  2EGA A;  3U23 A;  2LX7 A;  2CRE A;  4D8K A;  2LNH B;  1NM7 A;  2D8J A;  1ABO A;  2OAW A;  3JV3 A;  1TUD A;  1M30 A;  3EG0 A;  2VKN A;  1FMK A;  1X27 A;  2W10 A;  1YCS B;  4J9F A;  1SHG A;  1TG0 A;  2G6F X;  2KXC A;  2FO0 A;  1AWW A;  3EGU A;  2JTE A;  2AZV A;  2JM8 A;  2DX1 A;  3EG1 A;  1X6B A;  1T3S A;  1WYX A;  3EG2 A;  1Y57 A;  2KRS A;  2I0N A;  1E7O A;  2JS0 A;  2XMF A;  1T3L A;  1ZUY A;  2P4R A;  2DL7 A;  1BB9 A;  2AK5 A;  3C0C A;  2JM9 A;  3VS7 A;  3QWX X;  4M4Z A;  3A98 A;  1OV3 A;  2LMJ A;  4HVW A;  3ZL7 C;  4ESR A;  4KRT A;  2DJQ A;  2X3W D;  2EKH A;  2BZ8 A;  2EYY A;  2DF6 A;  1SRM A;  2DIL A;  2LJ1 A;  2RQW A;  4DEX A;  2YUP A;  2CDT A;  1PHT A;  2KEA A;  3FJ5 A;  4CC2 A;  5I11 A;  1Z9Q A;  2GTO A;  1WFW A;  1XOV A;  1JEG A;  2RQT A;  4AFZ C;  2H8H A;  5I22 A;  2KT1 A;  2RQV A;  1BU1 A;  1K76 A;  1S1N A;  1JQQ A;  4AG2 C;  4RTV A;  1PNJ A;  3KFV A;  2EVR A;  1CKA A;  1RLQ C;  1UG1 A;  1WLP B;  2AKK A;  1AEY A;  1KJW A;  2DL5 A;  2FRY A;  4D8D A;  4JJC A;  1UJY A;  1CSK A;  5FWB A;  1QWF A;  2GBQ A;  3UF4 A;  1PKS A;  2ENM A;  2DNU A;  1JXO A;  2KRN A;  4RTW A;  1GFD A;  1WXT A;  2LJ3 A;  1WXB A;  2FPE A;  1VYT A;  2HEQ A;  1BBZ A;  1K0S A;  1OOT A;  2DM1 A;  2OI3 A;  1SHF A;  2PNI A;  2EPD A;  4ORZ A;  1U5S A;  1E6H A;  2L2P A;  1WDX A;  1GL5 A;  1W1F A;  2JS2 A;  4QT7 A;  1AWO A;  1HD3 A;  1X43 A;  4HVU A;  3PVQ A;  4RTZ A;  2HCK A;  2HBW A;  1YWO A;  2NWM A;  3NGP A;  4ZNX A;  2VWF A;  4JPB W;  1AZE A;  2F2X A;  2DVJ A;  2FPF A;  4F17 A;  1ZUK A;  2FEI A;  1M3B A;  1QKX A;  1Z9Z A;  2DMO A;  1K1Z A;  1NEB A;  1M27 C;  1X69 A;  1RLP C;  1AD5 A;  2DRK A;  1JXM A;  3H41 A;  2JMA A;  4J9E A;  1PRL C;  5HCK A;  4RTX A;  3VRY A;  1UGV A;  2J6F A;  2BZY A;  3R6N A;  5IHI A;  3M0Q A;  1NEG A;  1UTI A;  2K7A A;  2KYB A;  4J9G A;  1MV0 B;  1RUW A;  1GFC A;  1SEM A;  1ZBJ A;  4OMM A;  4F16 A;  2KNB B;  2J6O A;  2L3P A;  2SEM A;  2LCS A;  1H8K A;  2LQN A;  1K9A A;  1UUE A;  1T0H A;  4JJD A;  4GLM A;  1NYF A;  2IIM A;  3M0U A;  4FSS A;  2DL4 A;  2O88 A;  2RNA A;  3NPF A;  1SSH A;  3EHQ A;  2ECZ A;  1M3A A;  2CSI A;  2K2M A;  2B86 A;  2ROL A;  3UAT A;  4RTU A;  3THK A;  2DE0 X;  1X6G A;  2GTJ A;  2K3B A;  1M8M A;  4JZ4 A;  2ED0 A;  4LN2 A;  1Y0M A;  1U3O A;  1M3C A;  2K6D A;  2YT6 A;  2QDL A;  1U06 A;  2SRC A;  2BZX A;  2W0Z A;  2AZS A;  4Z88 A;  2O2O A;  4OMN A;  2F2V A;  3PVL A;  4EIK A;  1KFZ A;  5GJW B;  2KT8 A;  4LNP A;  5GJV B;  3VS0 A;  2C0T A;  2YUQ A;  3RNJ A;  3UA7 A;  4R0K A;  1YNZ A;  1B3Q A;  2PTK A;  3M0P A;  3GBQ A;  1WXU A;  2C0O A;  2RQR A;  4JJB A;  3QWY A;  1YWP A;  2VVK A;  4WCI A;  2CH4 A;  5IHK A;  1UDL A;  3M0T A;  3H0I A;  1I0C A;  1K0X A;  2HSP A;  1H3H A;  2L3Q A;  1I1J A;  2X3X D;  1AOJ A;  2O9V A;  3TSZ A;  1A0N B;  2O31 A;  2ROT A;  2J6K A;  1HJD A;  2YUN A;  2E5K A;  2A36 A;  4DEY A;  2LQW A; 
#chains in the Genus database with same CATH topology
 1G2B A;  2QQ9 A;  8AT1 B;  2DJZ A;  2EQI A;  1TSF A;  1VA7 A;  3TSW A;  2PZ1 A;  2K2V A;  1R0C B;  1VQM Q;  1RAA B;  1E6G A;  1IB8 A;  4M7A B;  2V26 A;  2MOX A;  3JB9 D;  1RAG B;  1IZ6 A;  3L42 A;  3BDL A;  2A28 A;  3JB9 G;  1BIB A;  4C92 A;  1YCY A;  2JXB A;  3M0R A;  4PFP A;  1WJQ A;  2V1Q A;  3HKS A;  2R5M A;  4JRK A;  4KH1 B;  1ZLM A;  3CCS A;  4L6V 5;  5GAN 7;  4ELY C;  1MMD A;  2ZPE B;  2NUZ A;  3GF5 A;  1PKT A;  4WTO B;  2CZ6 B;  2LNV A;  1VQ6 T;  2DBK A;  4RTT A;  1IGU A;  1OX8 A;  3NMZ C;  2XDP A;  2OTL A;  3CXC A;  2FZG B;  2LZ6 B;  2VV5 A;  2OX7 A;  4M78 B;  5LL6 S;  1RI0 A;  3RR6 A;  1H92 A;  1D0X A;  1GBQ A;  3REA B;  5GAO l;  1MUZ A;  2H3E B;  1VQN A;  2LP5 A;  4M78 F;  4QQD A;  1D1B A;  2LJ0 A;  1BKB A;  3CMA Q;  1VQM T;  3DB4 A;  1AVZ C;  4OMO A;  2RHY A;  3MP8 A;  4BDY A;  3X20 B;  4JZ3 A;  1VQK A;  4J9I A;  2X35 A;  4PLL A;  1UFF A;  2AKL A;  3JCM h;  5CK9 A;  2D0N A;  4J9B A;  5GAO n;  4E6R A;  5CQX A;  2HQH A;  5HK3 A;  3MKD A;  1OEB A;  1JU5 C;  4ZN3 A;  4J9H A;  1ACM B;  1NBE B;  3H0H A;  5FU6 C;  1KHI A;  3I56 T;  2E5Q A;  3L2Q A;  2LRQ A;  4LE9 A;  1UHF A;  2FZC B;  1XQH A;  1CKB A;  1YJN A;  4RG8 A;  2DXB A;  3IQL A;  4HVV A;  4M7D A;  4C5H A;  1K8A C;  3VS5 A;  4B9W A;  5EG2 A;  3HFN A;  1QKW A;  3CC7 T;  1ZSG A;  4M77 A;  1YJW A;  4C8Q C;  2O9S A;  4KBM B;  1KG1 A;  5DM7 R;  4OMQ A;  1QLY A;  3O5Z A;  4UC4 A;  1VYU A;  2CH4 W;  4ZTJ A;  2RK1 A;  4F7U A;  3AHU A;  3CCS T;  3V8L A;  2KAF A;  4J6Y A;  2ZPB B;  4HT9 A;  4M75 B;  2AT1 B;  1SSF A;  1I07 A;  2L5Q A;  2DEQ A;  2OTL T;  1VQ9 Q;  4XU1 A;  2J06 A;  5D6W A;  4IIO A;  1NLO C;  4JS5 A;  1GRI A;  4LUE A;  1D0Y A;  4FL6 A;  1VQN T;  4JDS A;  1ZQ1 A;  3GIB A;  4J6W A;  5C0M A;  3VS2 A;  3JCM Q;  1GBR A;  2DTI A;  5GAN 2;  1ZBX A;  1B07 A;  1KSW A;  1OZ2 A;  5GMK h;  5GAN f;  1VQO A;  2KGT A;  2OAU A;  4DBF A;  1FYN A;  3MEV A;  3J81 E;  4KUL A;  2XG8 D;  1MMN A;  4N0A C;  4PJJ A;  3ER0 A;  3EGD A;  4PKC C;  1YJ9 A;  1I5L A;  2MCN A;  3CCE T;  5GMK e;  2RF0 A;  2K3Y A;  3KUF A;  1D3B B;  1K9M C;  1QVP A;  2JTF A;  3X28 B;  2KE9 A;  1XNI A;  1Q82 R;  1N5Z A;  1W70 A;  3G71 Q;  1WGS A;  2LX7 A;  3HSB A;  4BD3 A;  2CYZ B;  3C94 A;  4Y91 A;  2HZY A;  2A7Y A;  2PVD B;  2K57 A;  6AT1 B;  4M7A F;  2LVM A;  4N0A A;  3EG0 A;  1VQ6 A;  3X25 B;  1YCS B;  1SHG A;  4F04 B;  1Q81 R;  3FIF A;  3G4S A;  4F7U B;  5LJ3 h;  1KQS S;  8ATC B;  2L89 A;  2LQK A;  3M5A A;  3EGU A;  1G5V A;  3OYF A;  1X6B A;  1T3S A;  2EQJ A;  1WHJ A;  4M75 G;  1QW1 A;  3EG2 A;  5KH6 A;  1BIA A;  5J26 A;  1Y57 A;  2EWN A;  2I0N A;  4DBQ A;  4FIB A;  1JB0 E;  3UT1 A;  1YI2 A;  3CCJ Q;  5DY9 A;  1M2V B;  3V7C A;  3L2R A;  4M4Z A;  5LJ5 h;  4HVW A;  4IUV A;  5A0G A;  3PIP A;  2X3W D;  2EYY A;  2D0Q B;  4BI8 B;  1SRM A;  2LJ1 A;  2RQW A;  2QTV A;  3CCU A;  2ZPI B;  2YUP A;  1PHT A;  2KEA A;  1WHG A;  2QK0 A;  4PFO A;  1K9M R;  1Q7Y C;  2KQW A;  1BI2 A;  4AFZ C;  2H8H A;  3CC4 Q;  1JQQ A;  4AG2 C;  4OGC A;  1CKA A;  3M58 A;  4C92 F;  1WLP B;  2AKK A;  1KJW A;  2DL5 A;  2MK5 A;  3P8D A;  3P8H A;  4PJO A;  3LW5 E;  4JJC A;  5GAO q;  1CSK A;  5GAO p;  1ZSZ C;  2JZ2 A;  1PKS A;  2ENM A;  1JXO A;  2MYS A;  3CXC S;  3CCE A;  1YJ9 T;  1S72 T;  2DIG A;  3SWN C;  2FYK A;  2OI3 A;  3CCQ T;  5KE3 A;  3DLM A;  4II1 A;  4ORZ A;  2QGG A;  3EH2 A;  3OW2 A;  2L2P A;  1WDX A;  2X51 A;  2EFI A;  1W1F A;  3RKX A;  3CD6 A;  2JS2 A;  1VQP Q;  1UB4 A;  3PVQ A;  3S3O A;  3MO8 A;  2CP7 A;  1YWO A;  4FM4 B;  1ZA1 B;  2VWF A;  4JPB W;  3GP8 A;  1AZE A;  1VQ7 A;  1N27 A;  4A4E A;  5GMK j;  4PJO G;  2M16 A;  1KC8 C;  4FYX B;  2FEI A;  3J7A F;  1Z9Z A;  4PJO D;  2DMO A;  1YIJ Q;  3OBW A;  2RHX A;  2DXU A;  4NOY A;  1NPP A;  1JXM A;  3H41 A;  4E7I A;  3CCM A;  2P0Q A;  3R6N A;  1M8V A;  2RHZ A;  1QVG P;  3CBP A;  3HHT B;  1NEG A;  2K5F A;  5CKB A;  5LJ5 g;  2KYB A;  3VUZ A;  2CKK A;  3G6E T;  1FMW A;  1MV0 B;  5CQY A;  3JCM c;  1RUW A;  1SEM A;  4OMM A;  3CCQ Q;  2SEM A;  1H8K A;  3CCS Q;  2LQN A;  2XHC A;  1UUE A;  1T0H A;  2ZCF B;  4KGX B;  4IUT A;  4FSS A;  4M75 A;  2RNA A;  3NPF A;  5LJ3 d;  4PK4 A;  4QW2 A;  3CCV T;  4FSX A;  3I55 Q;  1MHN A;  4EMG A;  4QVD A;  2K3B A;  4PLI A;  3TEE A;  4EPC A;  4DOV A;  4PJO E;  5GAM d;  5KYW B;  2LT4 A;  2K6D A;  1MMA A;  1S72 Q;  4M7D B;  2BZX A;  3OYM A;  3TCJ A;  3RMQ A;  1Y71 A;  5GMK l;  2O2O A;  3MP1 A;  4OMN A;  1KFZ A;  3MJX A;  1MMG A;  5GJV B;  2YUQ A;  3JB9 I;  3M55 A;  1TOV A;  1B3Q A;  4Z02 A;  4FT2 A;  3J80 E;  4ZGD B;  2C0O A;  1NJI R;  1M2O A;  2RQR A;  5GAM e;  3H9N A;  4JJB A;  1JJ2 A;  1N9S A;  1EIF A;  1VQP A;  5IHK A;  1N6A A;  2HD0 A;  3OYC A;  2HQX A;  1YIT Q;  2RH2 A;  4N4H A;  2JN0 A;  4V2S A;  2HSP A;  2PVG B;  2X3X D;  3QYG B;  5GAO r;  4M77 F;  4C8Q F;  2O31 A;  3OSS C;  2NUP B;  2Y90 A;  2E5K A;  2A36 A;  2LQW A;  3G71 T;  2P84 A;  2DTH A;  3JCM V;  1VQK T;  2HDA A;  3E19 A;  3SD4 A;  4JUV A;  2OJ2 A;  3H0F A;  3PNW C;  3ASK A;  4X9D A;  4HKE A;  4KH0 B;  2RMO A;  5GAN 5;  2KR3 A;  5IH2 A;  2JW4 A;  3RER A;  3RKW A;  3LWH A;  4DBH A;  2XDB A;  4B9X A;  4C8Q B;  2F1L A;  2O4X A;  1Q7Y U;  1JJ2 P;  3QII A;  1ZUU A;  2QDY B;  3WVD B;  4OMP A;  1C1A A;  5FWC A;  2J7I A;  3UA6 A;  1YIJ A;  5IAY A;  3CCR T;  2L0A A;  1VQL A;  1QCN A;  1YP5 A;  2DET A;  2D9T A;  2QQR A;  4Z8A A;  4M7D G;  2XI9 A;  3M59 A;  1UHC A;  4AFU C;  1VQ5 T;  1ARK A;  4OB2 B;  3I55 A;  4BE2 A;  3MHX A;  2RB6 A;  2DXT A;  4M77 B;  2LX9 A;  1BI3 A;  1EFN A;  4JS4 A;  1Q7Y R;  4HCZ A;  2VXE A;  4XQ3 A;  3QDR B;  2Y4Y A;  4M7A A;  2BIV A;  2M9U A;  4F7U E;  1ZX6 A;  1B7T A;  1WJS A;  5HKC A;  3JB9 H;  2DYI A;  3EFR A;  3BDU A;  5CKF A;  1FXX A;  2CUD A;  1OU8 A;  1BCO A;  2YRD A;  5FW9 A;  2BTT A;  1OYX A;  3RES A;  2RJC A;  2RM4 A;  3EH1 A;  2DYB A;  1M4Z A;  1PRM C;  2P0P A;  2HNI A;  4VUB A;  1IHW A;  3CC7 Q;  5KYU A;  4GBQ A;  1QWE A;  2D1X A;  2V1R A;  2DO3 A;  2V8K A;  4ZGE B;  2FPD A;  2WSF E;  2GCX A;  4AMC A;  5KCO A;  2EGE A;  2F5T X;  4EMK C;  3SHW A;  2EIF A;  2RA2 A;  2EQM A;  3G6E Q;  1RAF B;  3CC2 A;  1Q81 U;  1VQO Q;  3JCM X;  4J9D A;  1X2Q A;  4JJN K;  4DA4 A;  1GCQ C;  2EYX A;  3HPW A;  3FDR A;  5ECA A;  4Y92 A;  4X1V A;  3AT1 B;  2RHU A;  4RCB A;  4EMK B;  4C92 G;  3CPW A;  5EC7 A;  1RI9 A;  4A54 A;  1TH7 A;  2ZGW A;  3C95 A;  2KBT A;  3VV0 A;  1P92 A;  3N5B B;  2VUB A;  1UEC A;  2KDS A;  3PGG A;  1OUL A;  1NG2 A;  2E41 A;  4F14 A;  2DIQ A;  4OB0 B;  2CZ0 B;  3LH0 A;  2L3S A;  1ZSZ A;  1C0M A;  3HRU A;  5IXB A;  1VQ9 A;  1AT1 B;  3CBO A;  5CO7 A;  3V7R A;  1IGQ A;  2GQV A;  1VQ6 Q;  1AWX A;  1ZSZ B;  2XU8 A;  2FRW A;  1W6X A;  4CC7 A;  4M77 E;  1NPR A;  2ATC B;  2KYM A;  3QPH A;  2QQA A;  1KK7 A;  2QAZ A;  3EFO A;  3QHS A;  3FJP A;  3RIR A;  2KRO A;  3OY9 A;  1SKU B;  4DOW A;  2RN8 A;  3I35 A;  3QBY A;  3SEM A;  1QCF A;  1WHM A;  2Z0W A;  3QYH B;  3NFC A;  2KRM A;  1YJW T;  2X4X A;  1YHQ Q;  4MMK A;  1T0J A;  3H8Z A;  4QQ6 A;  3L2U A;  1TS9 A;  5GMK m;  5KYW A;  2CZ1 B;  4MML A;  2E1H A;  5GAN d;  3FEO A;  3KXT A;  5IN1 A;  2V8J A;  1IO6 A;  4M78 A;  2J05 A;  5GAM h;  3CME A;  2DA9 A;  3JCM g;  2MAM A;  4QQG A;  3CCL T;  5KCH A;  3CC2 T;  2BE9 B;  1KQS A;  2D8J A;  3JV3 A;  2OAW A;  3LGF A;  5LJ3 g;  3DKM A;  2QXF A;  1TUD A;  4LD9 K;  4Y28 E;  2VKN A;  2W10 A;  3MPU B;  1RL2 A;  4M75 C;  1QVG S;  2V8I A;  1TG0 A;  3MEU A;  3LLR A;  3I56 Q;  2DX1 A;  1KQ1 A;  1WYX A;  3KBG A;  1IXD A;  2JS0 A;  1T3L A;  2DZ9 A;  4QVZ A;  2HQE A;  2E6N A;  3JCM b;  2AK5 A;  1W2B S;  1KD1 U;  2F5K A;  2G3R A;  2MF2 A;  3A98 A;  3QKJ A;  1OV3 A;  2HKN A;  1U1T A;  3ZL7 C;  4ESR A;  4ELZ C;  4KRT A;  2DJQ A;  3CC4 T;  2EKH A;  4PJO B;  1D1C A;  2K4Y A;  2RD1 A;  5CKH A;  2PUO B;  3OYI A;  1B34 A;  4DEX A;  1UGP B;  1VUB A;  2DXC A;  5I11 A;  1Z9Q A;  1WFW A;  1Y96 A;  1XOV A;  4A4F A;  2KT1 A;  4XU2 A;  1BU1 A;  1K76 A;  1S1N A;  4A4H A;  1Q82 C;  4RTV A;  4PJL A;  3KFV A;  1UG1 A;  1WPY A;  1AEY A;  4DQ2 A;  4M78 C;  1G8X A;  3A8H B;  1M1G A;  2GBQ A;  1WXB A;  2FPE A;  1VYT A;  2HEQ A;  2DVE A;  2DM1 A;  3JCM d;  4JRQ A;  4KUI A;  3CCM Q;  3QSU A;  4PJO C;  2DFU A;  3CCQ A;  1VQK Q;  1GL5 A;  3PFS A;  4QT7 A;  2EJG A;  1FX7 A;  3EFS A;  3A8O B;  2WSC E;  4M78 E;  3RDV A;  4M7D D;  3TRE A;  2ZAE A;  4F17 A;  4KUD K;  3X26 B;  1VIE A;  4M7D E;  3CEY A;  2LC4 A;  1K1Z A;  1QCO A;  4O5V A;  5FRO A;  3BFM A;  1PRL C;  4RTX A;  1UGV A;  2CGH A;  2HSE B;  1WNL A;  5IHI A;  3M0Q A;  1VQM A;  4OGE A;  2XKO C;  4J9G A;  2QAS A;  5J3B A;  1M1K C;  1GFC A;  1ZBJ A;  1PD0 A;  1OQK A;  4PJO F;  4F16 A;  2XK0 A;  4RCC A;  5FLX E;  4NL3 A;  2RHI A;  1VIF A;  4C5G A;  3JCM f;  1V29 B;  1QVF P;  2GF7 A;  4GLM A;  2O88 A;  1FWZ A;  1SSH A;  1K9M U;  1OZ3 A;  1M3A A;  2K2M A;  2B86 A;  1Y7X A;  2ROL A;  5FU7 B;  3RMS A;  4CI0 C;  1UGR B;  4OVA A;  4BY6 C;  1I81 A;  2MWO A;  3OYB A;  2DE0 X;  1X6G A;  4GLK A;  3GOX A;  3WXM B;  5GAN e;  2KMT A;  4BE1 A;  2YRV A;  3LYI A;  4C0Z A;  1G3S A;  4MDX A;  5A2Q E;  1G3Y A;  2EKO A;  5GAO m;  3CCJ A;  2YT6 A;  2QDL A;  4OF1 A;  5GAN 4;  1SF9 A;  3GNG A;  4XTU A;  3E1S A;  3HRS A;  3V7S A;  1M5Q 1;  2QG9 B;  2W0Z A;  4BDZ A;  2AZS A;  4J5Y A;  4Z88 A;  1W2B P;  3PVL A;  4ZGJ B;  4J7I A;  3UPU A;  5GJW B;  1WZO A;  1PC0 A;  2C0T A;  4IUQ A;  3RNJ A;  3CPW S;  1YNZ A;  3FB9 A;  2PTK A;  2C06 A;  1K73 C;  4N4I A;  3URG A;  1OI1 A;  2NUT A;  2VVK A;  4XTY A;  2MWP A;  1PG5 B;  2QA4 T;  4M75 E;  1UDL A;  3H6Z A;  1G3T A;  4C8Q E;  1AHJ B;  1I1J A;  3JCM P;  1R77 A;  2RI5 A;  3TSZ A;  2CP6 A;  5KYX B;  1W2B A;  2YUN A;  5I2M A;  1KQ2 A;  1X01 A;  2E3I A;  2DER A;  2CSQ A;  4K11 A;  1GCQ A;  1JBM A;  4P5N A;  4HT8 A;  1HSQ A;  1LCK A;  1J3T A;  2JMC A;  4FW1 A;  3VS3 A;  4JLI A;  4C8Q G;  1M9S A;  2M0Y A;  3C12 A;  1JO8 A;  2QQS A;  3EHR A;  4XK8 E;  4OML A;  3MET A;  4R55 A;  2H3J A;  2RJE A;  1OPL A;  1YIJ T;  5GAN 6;  1K73 R;  1UEB A;  3OB9 A;  2D8H A;  4J9C A;  4A4G A;  5FU7 C;  3L2W A;  4ZTF A;  4PJM A;  2K79 A;  1N9R A;  4A53 A;  4E7K A;  4YTL A;  4OB3 B;  4M7D F;  1BI0 A;  3LWI A;  1VQ5 A;  5KYX A;  3I55 T;  4TVR A;  2JVV A;  4MZP A;  3REB B;  4NL2 A;  1YN8 A;  2GFA A;  4C0F A;  1NZ9 A;  1D1A A;  4FYW B;  2NLU A;  1N8R R;  1OPK A;  2VXF A;  4AT1 B;  4BUG A;  3OMG A;  3EG3 A;  2GNC A;  1SPK A;  3MCA B;  4MDW A;  4C92 D;  3DLL A;  1WIE A;  2RQU A;  3RBB B;  3VU3 C;  1VQ8 Q;  4AG1 C;  1R0B G;  1X2K A;  4RUG A;  4E7L A;  3E9F A;  3NTI A;  4XTX A;  1X6O A;  4Z89 A;  1X75 C;  2DLP A;  1WHL A;  2K9G A;  1YJN Q;  3A5Z B;  1PWT A;  2CZ7 B;  2RPN A;  1QMC A;  1KC8 U;  3CMA A;  2EQU A;  3CPF A;  3GPL A;  3TQ7 P;  1WHH A;  2DTO A;  4XU0 A;  2DBM A;  4C92 B;  5KYN A;  3VS1 A;  1NYG A;  3QUI A;  1VQN Q;  2EJ9 A;  1KIK A;  2IPO B;  4HCK A;  1YJW Q;  3LH5 A;  3CME T;  4LDX A;  1EZZ B;  2DZC A;  3OYL A;  3CBM A;  3QXE B;  2DL3 A;  4IUU A;  3CCU Q;  2M0O A;  5IXF A;  2E12 A;  1UGS B;  4C8Q A;  4LDV A;  1SRL A;  1VQ7 T;  2EGC A;  4KGZ B;  4IUP A;  5DLO A;  3UDC A;  2MIO A;  1VQ8 A;  1XTD A;  4C92 E;  1QP2 A;  1AWJ A;  1UE9 A;  2IVW A;  2IG0 A;  3CD6 Q;  2FZK B;  2ED1 A;  3NHN A;  1PSF A;  2KVQ G;  3I5R A;  3VUB A;  2OTL Q;  1C6V X;  4FCY A;  1NLP C;  3G6E A;  3PMT A;  2COZ A;  1NJI C;  2F2W A;  4PFZ A;  1PM3 A;  2Y4X A;  2M51 A;  2DRM A;  1OU9 A;  1N8R C;  3X24 B;  3OYA A;  2FB7 A;  2OTJ Q;  1VQ4 Q;  5IHN A;  5GAM g;  3SB2 A;  3OMC A;  3BE3 A;  1QVF A;  1VQ4 A;  1M1F A;  5A0L A;  3OS1 A;  1K73 U;  3D7S B;  2PU9 B;  1I8F A;  3CC7 A;  4HXJ A;  2EGA A;  2CRE A;  4D8K A;  2LNH B;  3CD6 T;  4M77 C;  1ABO A;  2QTX A;  3LX7 A;  1M30 A;  2YLC A;  1FMK A;  3OYE A;  4J9F A;  4NS5 A;  2G6F X;  2YXY A;  3SFM A;  5GAN g;  1Q86 C;  2COW A;  2FO0 A;  3A8L B;  1HK9 A;  4RG2 A;  4A4K A;  2KRS A;  2D6F A;  2JJ9 A;  1YFN A;  2XMF A;  1ZUY A;  2P4R A;  5GAN 8;  4HCC A;  2DL7 A;  2LQ8 A;  3C0C A;  3VS7 A;  2JM9 A;  2YWW A;  3OYD A;  3QWX X;  3OW2 P;  1VOM A;  2RO0 A;  5D7U A;  1SG5 A;  4XTW A;  2DF6 A;  2DIL A;  3CC4 A;  1QQJ A;  1HYO A;  2DK3 A;  5CCA A;  1Q95 G;  2GTO A;  1JEG A;  1JJ2 S;  2MMP A;  2RQV A;  3I56 A;  1PNJ A;  2CS7 A;  4ANJ A;  5FU6 B;  2FRY A;  2WSE E;  4D8D A;  2DEU A;  2XIC A;  4IKF A;  2KY9 A;  5FWB A;  1QWF A;  1O75 A;  4BB7 A;  5CIU A;  2DNU A;  3L2Z A;  4C8Q D;  1LOJ A;  4BE0 A;  4RTW A;  1GFD A;  1PCX A;  1MNE A;  2LJ3 A;  3BY7 A;  1BBZ A;  1K0S A;  1OOT A;  2COY A;  3OQ5 A;  2AHJ B;  2E65 A;  1VQ4 T;  2QEX A;  1SHF A;  2PNI A;  3HRT A;  2M1H A;  4PJN A;  2JUF A;  2QQB A;  5LJ5 j;  3QZ5 B;  2R58 A;  2FVU A;  4RTZ A;  2OTJ T;  5M9O A;  2O01 E;  2EQK A;  2NWM A;  2P4T A;  4ZNX A;  3M56 A;  2XID A;  2ZZD A;  1U8R A;  4M75 F;  3PT9 A;  2VB6 A;  1M90 R;  2FPF A;  2X4W A;  1F1B B;  1ZUK A;  3EAE A;  1QKX A;  4LDU A;  1RAD B;  3CCL Q;  1X69 A;  1RLP C;  3S6W A;  2QGF B;  2ZPF B;  2JMA A;  5HCK A;  3M4Y A;  1PSE A;  2GFU A;  1K8A U;  4MZM A;  3EGX B;  3EFO B;  3JB9 J;  1WHK A;  4LXC A;  1M1K R;  4J6X A;  1U1S A;  5AYF A;  1ZHI A;  1VQ5 Q;  4BAC A;  2E6Z A;  4FYV B;  2L3P A;  2LCS A;  3V8K A;  3M9Q A;  4XAX B;  4E2F B;  3NTH A;  2EJF A;  1NYF A;  2IIM A;  3M0U A;  1M2V A;  2VGM A;  4M7A C;  2CSI A;  5CR2 A;  4CRI A;  5HK0 A;  4O6J A;  2JOY A;  1IRE B;  1MGQ A;  2GTJ A;  3QG1 A;  2RJF A;  3R6O A;  4X34 A;  2NUT B;  4J8O A;  2MI6 A;  1IRX A;  2E4H A;  4LN2 A;  3CCJ T;  3JAM E;  4FT4 A;  4XU3 A;  5I2S A;  1M3C A;  5GMK i;  3CCR A;  1U06 A;  2SRC A;  4GY5 A;  1BI1 A;  3ZEH A;  2BE7 D;  4E7J A;  4EIK A;  2F2V A;  4HA8 A;  1YIT T;  2DPP B;  3PIO A;  3OYJ A;  4PL6 A;  1D09 B;  3M0P A;  1KD1 C;  3Q1J A;  4L5G A;  4FW2 A;  1RAH B;  2MPX C;  3G7Z A;  3QWY A;  4WCI A;  1YJ9 Q;  3DB3 A;  2FL7 A;  2CH4 A;  3P8B B;  2JTM A;  2QI2 A;  1B34 B;  4C5E A;  4WF2 A;  4C0D C;  3M0T A;  1I5O B;  1I0C A;  3JCM W;  2L3Q A;  1AOJ A;  5LJ5 f;  4BI4 A;  1A0N B;  3QZ9 B;  1Q86 U;  2ROT A;  1VQL Q;  4C92 C;  2BKD N;  2X4Y A;  4DEY A;  4KGV B;  3INZ A;  3JB9 F;  2CUB A;  1AZG B;  1WA7 A;  2RI2 A;  1RAC B;  1NJI U;  2EAY A;  3L1A A;  5LJ3 f;  1D3B A;  4XTV A;  2EYZ A;  1M90 U;  2YSQ A;  3VRZ A;  3M57 A;  1UJ0 A;  3I9Q A;  1QVG A;  3T9N A;  3OYG A;  3EGX A;  2KI7 A;  2C0I A;  3FLG A;  3FRN A;  1V1C A;  2QEX T;  2JT4 A;  1Y96 B;  4J83 A;  1PD1 A;  4A63 B;  1Q82 U;  1WJR A;  2DKG A;  3I5S A;  3OYY A;  2YDL A;  2PQW A;  2M02 A;  2A37 A;  1GCP A;  3TVT A;  3LGL A;  2KXD A;  1LNX A;  3EG9 B;  1O9S A;  3VJP A;  1MV3 A;  1NE8 A;  3A8G B;  3JSC A;  1ABQ A;  1TXQ A;  4D6W A;  4AFS C;  2NUP A;  5GAN j;  2EBP A;  1WQW A;  4RTY A;  4C0D B;  3M0S A;  4RMO A;  2RK2 A;  2FG0 A;  4IIM A;  4OMF B;  1TUC A;  2ABL A;  2A08 A;  5FRM A;  1IHV A;  3UWN A;  2JNG A;  2EYW A;  4M7A D;  1YJN T;  1QP3 A;  3ME9 A;  4CC3 A;  3BW1 A;  1KHC A;  1VQO T;  1OX9 A;  2CT4 A;  4LD6 A;  2DAQ A;  5FRN A;  3RKY A;  3ULR B;  5IT9 E;  2XD0 A;  1WI7 A;  1WX6 A;  3CMA T;  2LT1 A;  1R8O B;  2DD5 A;  1MND A;  4ZN1 A;  3OYH A;  3GNF B;  3VS6 A;  2X4J A;  5LJ5 e;  3JCM J;  3OW2 S;  4Q5W A;  1BK2 A;  3HL8 A;  3MEW A;  1Q86 R;  4AFQ C;  2E3H A;  2ZPH B;  4E7Z A;  1I4K 1;  2LCC A;  1YIT A;  2YUO A;  2HMA A;  1KD1 R;  1K8A R;  2O4X B;  2HAX A;  4ME7 A;  3O8V A;  3QO3 A;  1DJ7 B;  3WVE B;  2E70 A;  1H64 1;  1HXD A;  3JCM e;  1VQ8 T;  1KC8 R;  2QYZ A;  4FU6 A;  5GAM j;  3CQT A;  2DL8 A;  3ZBD A;  2CT3 A;  2FHD A;  1ZA2 B;  1LJO A;  1YI2 T;  3A8M B;  3EG9 A;  2EW3 A;  1G3W A;  2F69 A;  3S3N A;  4OP0 A;  4X9C A;  2EYQ A;  1YHQ T;  2A0F B;  3GLX A;  2VGN A;  3CCR Q;  5LJ3 j;  3VYG A;  4L59 A;  3TU4 K;  3E2U A;  5L23 A;  4CC4 B;  1KQS P;  2B8A A;  1BCM A;  1K4U S;  2I2L A;  4QVC A;  1M1K U;  4BY6 B;  1LPL A;  1G83 A;  3OS5 A;  5CVI A;  1UGQ B;  5CKD A;  3PE0 A;  4LDY A;  1VYV A;  3M54 A;  4C5I A;  2ESW A;  2GQI A;  2GGR A;  3MP6 A;  5I21 A;  2ZPG B;  4LUD A;  7AT1 B;  3VS4 A;  3U23 A;  4PNO A;  4OB1 B;  1NM7 A;  4FYY B;  2HKQ B;  3JRZ A;  3PTA A;  4JRI A;  3NTK A;  3CXC P;  1X27 A;  2RJD A;  1RAI B;  3OS2 A;  2CP2 A;  1M90 C;  1VQL T;  2KXC A;  2L3R A;  1AWW A;  3CCV Q;  3OA6 A;  2JTE A;  3CC2 Q;  2AZV A;  2JM8 A;  3EG1 A;  5CAI A;  1RAB B;  2OTJ A;  2E10 A;  1TTH B;  1E7O A;  1LVK A;  1QVF S;  3A1P A;  1BB9 A;  4M77 G;  4C0G A;  2QA4 A;  2YRC A;  2HL3 A;  1YBY A;  4M77 D;  2LMJ A;  5C6S A;  3E9G A;  4E7H A;  3CME Q;  5KYU B;  2BZ8 A;  1VQ9 T;  2HBP A;  5GAN 3;  1TU0 B;  2CDT A;  3F70 A;  3HP9 A;  3FJ5 A;  5D6Y A;  4CC2 A;  4N4G A;  1VQ7 Q;  3CCU T;  2R57 A;  1V76 A;  2RQT A;  5I22 A;  3SWN A;  2EVR A;  1RLQ C;  1FMV A;  4KT0 E;  1UJY A;  2CP0 A;  2P0K A;  4M75 D;  1YI2 Q;  3UF4 A;  1S72 A;  2KRN A;  1WXT A;  3QJ6 A;  2NYS A;  3OS0 A;  1BYM A;  3QDF A;  3VKI A;  4QKU A;  3G1J A;  4F7U G;  4R56 A;  2EPD A;  9ATC B;  2WAC A;  3G4S T;  1U5S A;  1E6H A;  2RI3 A;  4RKU E;  1H3Z A;  3EGD B;  1AWO A;  1HD3 A;  1X43 A;  4HVU A;  4BI3 A;  3S3M A;  2HCK A;  4ATO A;  4EDU A;  2HBW A;  3PMI A;  3NGP A;  2LDM A;  2F2X A;  4DBR A;  2DVJ A;  3HTR A;  5LJ5 d;  4IUR A;  4J7F A;  1Q81 C;  3SDZ A;  1RAE B;  1M3B A;  5CKE A;  3M53 A;  1NEB A;  3RUX A;  1M27 C;  3CCM T;  1AD5 A;  2DRK A;  3C4S A;  3OYN A;  2YLB A;  2PVO B;  4J9E A;  3VRY A;  2J6F A;  2BZY A;  3SWN B;  3HFO A;  2K7A A;  1UTI A;  3MEA A;  3V8J A;  4LDW A;  4E7S A;  3G4S Q;  1N8R U;  4M7D C;  4F7U F;  1YHQ A;  5GAN h;  1GXI E;  3OSV A;  3VYH B;  2KNB B;  2J6O A;  2K5I A;  2L8D A;  1K9A A;  4M7A G;  4B6M A;  4E47 A;  1XJW B;  5KYY B;  2DD4 A;  4JJD A;  2AIR B;  5D6X A;  3G71 A;  3CPW P;  2VYT A;  2DL4 A;  2R5A A;  3L2V A;  3EHQ A;  5KYY A;  4EMH A;  2ECZ A;  3UAT A;  4RTU A;  3THK A;  2YHT A;  2KK4 A;  5J39 A;  3QJY A;  1M8M A;  2XDD A;  4JZ4 A;  2LTO A;  3CCV A;  2ED0 A;  3CCL A;  1Y0M A;  3FC3 A;  1U3O A;  2LCL A;  4M7A E;  3OBY A;  2K5L A;  4M78 D;  1WQ7 A;  5DLQ E;  2PUK B;  5KE2 A;  4M78 G;  2QA4 Q;  3OYK A;  2KT8 A;  2X9H A;  4LNP A;  3VS0 A;  1TWB A;  2HL5 C;  3UA7 A;  4R0K A;  2CP3 A;  3M4G A;  5L8R E;  4EMK A;  2QEX Q;  3CCE Q;  4JLG A;  3GBQ A;  3ZFJ A;  1WXU A;  2E64 A;  1VQP T;  2A3L A;  2VAS A;  4MZT A;  1YWP A;  1JRI A;  4HCB A;  1TUG B;  2K3X A;  3H0I A;  5A0D A;  1K0X A;  1W4S A;  1D0Z A;  1H3H A;  5HY6 A;  4XTZ A;  5AT1 B;  5GAM f;  2O9V A;  4JRP A;  2CP5 A;  2KSS A;  5LJ3 e;  1Y07 A;  2J6K A;  1HJD A;  1EX4 A;  2BUD A;  2VC8 A; 
#chains in the Genus database with same CATH homology
 1G2B A;  2CUB A;  2EQI A;  1AZG B;  1WA7 A;  2CSQ A;  1VA7 A;  4K11 A;  1GCQ A;  3TSW A;  2HDA A;  2PZ1 A;  2OJ2 A;  3H0F A;  1HSQ A;  1LCK A;  1J3T A;  1E6G A;  2JMC A;  2EYZ A;  3VS3 A;  2RMO A;  2KR3 A;  2MOX A;  2YSQ A;  3VRZ A;  5IH2 A;  1UJ0 A;  2M0Y A;  3I9Q A;  2JW4 A;  1JO8 A;  2A28 A;  2JXB A;  2C0I A;  3M0R A;  3EHR A;  4OML A;  2V1Q A;  1V1C A;  2JT4 A;  1ZUU A;  1OPL A;  4A63 B;  1ZLM A;  4OMP A;  5FWC A;  3I5S A;  2YDL A;  2J7I A;  2NUZ A;  3UA6 A;  1PKT A;  2D8H A;  2DBK A;  2A37 A;  4J9C A;  4RTT A;  2L0A A;  1GCP A;  3NMZ C;  3TVT A;  1YP5 A;  2KXD A;  2LZ6 B;  4Z8A A;  2K79 A;  1MV3 A;  1UHC A;  4AFU C;  1ARK A;  1H92 A;  1ABQ A;  1GBQ A;  3REA B;  4AFS C;  1EFN A;  1MUZ A;  2EBP A;  3REB B;  4RTY A;  3M0S A;  2LP5 A;  1YN8 A;  2FG0 A;  2LJ0 A;  1ZX6 A;  1AVZ C;  4OMO A;  1OPK A;  4IIM A;  1TUC A;  2ABL A;  4JZ3 A;  2A08 A;  4J9I A;  2CUD A;  3EG3 A;  2GNC A;  1SPK A;  1UFF A;  5FW9 A;  2AKL A;  2BTT A;  2D0N A;  4J9B A;  4E6R A;  1WIE A;  2EYW A;  2DYB A;  1OEB A;  1JU5 C;  2RQU A;  1PRM C;  4J9H A;  3RBB B;  3H0H A;  4AG1 C;  1X2K A;  4LE9 A;  4RUG A;  4CC3 A;  1UHF A;  4GBQ A;  1CKB A;  2CT4 A;  1QWE A;  2D1X A;  3IQL A;  4HVV A;  2V1R A;  3VS5 A;  4Z89 A;  3ULR B;  2FPD A;  2DLP A;  1WI7 A;  1WX6 A;  1QKW A;  2K9G A;  2EGE A;  1PWT A;  3SHW A;  1ZSG A;  2RPN A;  2O9S A;  2DBM A;  4OMQ A;  3VS6 A;  3VS1 A;  1NYG A;  1QLY A;  4J9D A;  1KIK A;  3O5Z A;  1X2Q A;  1VYU A;  2CH4 W;  4HCK A;  1BK2 A;  1GCQ C;  2EYX A;  3LH5 A;  4Y92 A;  5ECA A;  4X1V A;  4AFQ C;  5EC7 A;  1RI9 A;  2DL3 A;  2YUO A;  5IXF A;  2KBT A;  1I07 A;  1SRL A;  2EGC A;  1UEC A;  2MIO A;  2J06 A;  1AWJ A;  1NG2 A;  1UE9 A;  4IIO A;  4F14 A;  3CQT A;  1NLO C;  2DL8 A;  2ED1 A;  2L3S A;  1GRI A;  3NHN A;  4LUE A;  5IXB A;  2CT3 A;  3I5R A;  2EW3 A;  1AWX A;  1NLP C;  2FRW A;  3VS2 A;  1W6X A;  1GBR A;  4CC7 A;  1B07 A;  1KSW A;  2F2W A;  2KYM A;  2KGT A;  5L23 A;  4CC4 B;  2M51 A;  2DRM A;  2KRO A;  1K4U S;  1FYN A;  1G83 A;  2RN8 A;  3I35 A;  3SEM A;  1QCF A;  3PE0 A;  1VYV A;  2KRM A;  5IHN A;  1T0J A;  2MCN A;  2ESW A;  2GQI A;  2GGR A;  2RF0 A;  4LUD A;  1IO6 A;  2J05 A;  2KE9 A;  4HXJ A;  2DA9 A;  1N5Z A;  1W70 A;  3VS4 A;  2EGA A;  3U23 A;  2LX7 A;  2CRE A;  4D8K A;  2LNH B;  1NM7 A;  2D8J A;  1ABO A;  2OAW A;  3JV3 A;  1TUD A;  1M30 A;  3EG0 A;  2VKN A;  1FMK A;  1X27 A;  2W10 A;  1YCS B;  4J9F A;  1SHG A;  1TG0 A;  2G6F X;  2KXC A;  2FO0 A;  1AWW A;  3EGU A;  2JTE A;  2AZV A;  2JM8 A;  2DX1 A;  3EG1 A;  1X6B A;  1T3S A;  1WYX A;  3EG2 A;  1Y57 A;  2KRS A;  2I0N A;  1E7O A;  2JS0 A;  2XMF A;  1T3L A;  1ZUY A;  2P4R A;  2DL7 A;  1BB9 A;  2AK5 A;  3C0C A;  2JM9 A;  3VS7 A;  3QWX X;  4M4Z A;  3A98 A;  1OV3 A;  2LMJ A;  4HVW A;  3ZL7 C;  4ESR A;  4KRT A;  2DJQ A;  2X3W D;  2EKH A;  2BZ8 A;  2EYY A;  2DF6 A;  1SRM A;  2DIL A;  2LJ1 A;  2RQW A;  4DEX A;  2YUP A;  2CDT A;  1PHT A;  2KEA A;  3FJ5 A;  4CC2 A;  5I11 A;  1Z9Q A;  2GTO A;  1WFW A;  1XOV A;  1JEG A;  2RQT A;  4AFZ C;  2H8H A;  5I22 A;  2KT1 A;  2RQV A;  1BU1 A;  1K76 A;  1S1N A;  1JQQ A;  4AG2 C;  4RTV A;  1PNJ A;  3KFV A;  2EVR A;  1CKA A;  1RLQ C;  1UG1 A;  1WLP B;  2AKK A;  1AEY A;  1KJW A;  2DL5 A;  2FRY A;  4D8D A;  4JJC A;  1UJY A;  1CSK A;  5FWB A;  1QWF A;  2GBQ A;  3UF4 A;  1PKS A;  2ENM A;  2DNU A;  1JXO A;  2KRN A;  4RTW A;  1GFD A;  1WXT A;  2LJ3 A;  1WXB A;  2FPE A;  1VYT A;  2HEQ A;  1BBZ A;  1K0S A;  1OOT A;  2DM1 A;  2OI3 A;  1SHF A;  2PNI A;  2EPD A;  4ORZ A;  1U5S A;  1E6H A;  2L2P A;  1WDX A;  1GL5 A;  1W1F A;  2JS2 A;  4QT7 A;  1AWO A;  1HD3 A;  1X43 A;  4HVU A;  3PVQ A;  4RTZ A;  2HCK A;  2HBW A;  1YWO A;  2NWM A;  3NGP A;  4ZNX A;  2VWF A;  4JPB W;  1AZE A;  2F2X A;  2DVJ A;  2FPF A;  4F17 A;  1ZUK A;  2FEI A;  1M3B A;  1QKX A;  1Z9Z A;  2DMO A;  1K1Z A;  1NEB A;  1M27 C;  1X69 A;  1RLP C;  1AD5 A;  2DRK A;  1JXM A;  3H41 A;  2JMA A;  4J9E A;  1PRL C;  5HCK A;  4RTX A;  3VRY A;  1UGV A;  2J6F A;  2BZY A;  3R6N A;  5IHI A;  3M0Q A;  1NEG A;  1UTI A;  2K7A A;  2KYB A;  4J9G A;  1MV0 B;  1RUW A;  1GFC A;  1SEM A;  1ZBJ A;  4OMM A;  4F16 A;  2KNB B;  2J6O A;  2L3P A;  2SEM A;  2LCS A;  1H8K A;  2LQN A;  1K9A A;  1UUE A;  1T0H A;  4JJD A;  4GLM A;  1NYF A;  2IIM A;  3M0U A;  4FSS A;  2DL4 A;  2O88 A;  2RNA A;  3NPF A;  1SSH A;  3EHQ A;  2ECZ A;  1M3A A;  2CSI A;  2K2M A;  2B86 A;  2ROL A;  3UAT A;  4RTU A;  3THK A;  2DE0 X;  1X6G A;  2GTJ A;  2K3B A;  1M8M A;  4JZ4 A;  2ED0 A;  4LN2 A;  1Y0M A;  1U3O A;  1M3C A;  2K6D A;  2YT6 A;  2QDL A;  1U06 A;  2SRC A;  2BZX A;  2W0Z A;  2AZS A;  4Z88 A;  2O2O A;  4OMN A;  2F2V A;  3PVL A;  4EIK A;  1KFZ A;  5GJW B;  2KT8 A;  4LNP A;  5GJV B;  3VS0 A;  2C0T A;  2YUQ A;  3RNJ A;  3UA7 A;  4R0K A;  1YNZ A;  1B3Q A;  2PTK A;  3M0P A;  3GBQ A;  1WXU A;  2C0O A;  2RQR A;  4JJB A;  3QWY A;  1YWP A;  2VVK A;  4WCI A;  2CH4 A;  5IHK A;  1UDL A;  3M0T A;  3H0I A;  1I0C A;  1K0X A;  2HSP A;  1H3H A;  2L3Q A;  1I1J A;  2X3X D;  1AOJ A;  2O9V A;  3TSZ A;  1A0N B;  2O31 A;  2ROT A;  2J6K A;  1HJD A;  2YUN A;  2E5K A;  2A36 A;  4DEY A;  2LQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...