2GGSA

Crystal structure of hypothetical dtdp-4-dehydrorhamnose reductase from sulfolobus tokodaii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
MRTLITGASGQLGIELSRLLSERHEVIKVYNSSEIQGGYKLDLTDFPRLEDFIIKKRPDVIINAAAMTDVDKCEIEKEKAYKINAEAVRHIVRAGKVIDSYIVHISTDYVFDGEKGNYKEEDIPNPINYYGLSKLLGETFALQDDSLIIRTSGIFRNKGFPIYVYKTLKEGKTVFAFKGYYSPISARKLASAILELLELRKTGIIHVAGERISRFELALKIKEKFNLPGEVKEVDEVRGWIAKRPYDSSLDSSRARKILSTDFYTLDLDGMVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 273aa long hypothetical dTDP-4-dehydrorhamnose reductase
publication title crystal structure of hypothetical dTDP-4-dehydrorhamnose reductase from sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Oxidoreductase
total genus 95
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ggsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2ggsA02
3OJEA 2EKPA 1PJSA 3JQBC 2Z1MA 4Z9XA 5JC1A 1EK5A 2C7GA 3ZWNA 4D79A 5KKAA 1IB6A 3C8MA 2ZTUA 1H6BA 4CLHA 1KY5A 3P5SA 1E1NA 4J1TA 4TRNA 3KHUA 5DULA 4WUVA 3VTFA 1B16A 1HT0A 3VZQA 4MKRA 3TFQA 4ALNA 1I30A 3NJ4A 4XZ3A 4DBZA 2G0TA 4NBVA 3E1KA 1JQBA 3JQGA 4HBGA 1B0AA 2HO5A 4MVJG 3ZWWA 4EJ0A 3U4IA 2QQ5A 3F4BA 1O9BA 4QQRA 3GVPA 2GF2A 4XJSA 4CM1A 3OIDA 1VLLA 5J23A 4TWRA 4RPGA 4UEJA 4B4UA 2X0RA 4PLGA 3GZNB 3JQAA 2AQIA 3ZH2A 1IOLA 2JHFA 3V2UA 1CRWG 1PJ2A 3GAZA 1LSOA 5H81A 5TJ9A 5BR7A 2RCYA 5CDYA 2YQ5A 3TL3A 1DPGA 3UF0A 3GHHA 3QJ5A 3C24A 3MTJA 4UULA 3FI9A 1RM5A 4MVJE 4BNTA 2C82A 4BKUA 3FTPA 1NNUA 4OKNA 4TROA 3WB9A 4ONEA 2O7QA 4H15A 3DONA 4PZDA 3C3XA 3GMSA 3ST7A 5G0TA 4C4OA 1ARZA 1YL5A 5IZCC 4NR0A 4OOEA 2WTBA 1PJBA 3EW7A 4M87A 4B8ZA 5KOIA 4QFDA 2TMGA 4K26A 5FI5A 5L95A 4F6CA 1K3TA 1T4BA 2QW8A 4NJOA 1YQGA 3IJPA 4L4SA 3U4DA 4AJLA 3B1FA 3DL2A 1ZK1A 5L3ZA 4NFYA 3PJDA 1YKFA 4XDYA 1DOHA 4ROSA 3OIFA 3OETA 3W8FA 2AG8A 4BS9A 4WKGA 3W6ZA 2CF5A 1A71A 5AXCA 1H6DA 1YOVA 1R16A 5JAMA 4WOJA 3PRJA 1R0LA 1HZJA 1NX6A 4L4RA 3INTA 2WDZA 4E5KA 3NDRA 3RQSA 1ADFA 5AXBA 3GVHA 3QSGA 1N7GA 4Q3DA 3RFVA 4HFNA 4KTTE 2C0CA 2ZYAA 2PWZA 1PJ4A 1IE3A 1UP6A 2PD3A 5KVVA 3OBBA 2E6UX 2UV8A 4JX8A 4BKQA 1GEEA 1A27A 2X5KO 4LISA 4YDRA 4E12A 2O48X 2HJSA 4ID9A 1MFPA 1KVUA 1YONA 4FGSA 4Y6PA 5FEUA 2Q2WA 3D0OA 3WQSB 3U5TA 3H2ZA 3ON5A 1U7TA 4BMSA 3DHNA 2X0IA 3C1TA 1PS8A 4IMPA 1LXCA 2AG5A 3PWZA 4R4JA 4Z9FA 2W4QA 3VZSA 4CL8A 1EFKA 3GQVA 3ZZNA 1YBAA 5A1TA 1ZEJA 3EGOA 4N54A 3VPXA 3GT0A 2SCUA 4BNXA 1UXKA 4EBFA 1NAIA 3IIEA 2P9GA 5A3JA 3OH8A 4TRRA 3D3WA 3BHMA 1PS9A 2O23A 5COBA 5B4TA 1HYHA 5BSEA 3QV1A 3G79A 3I4CA 1E3LA 4NMHA 1KETA 2O3QA 2X9VA 1IZ9A 2BGKA 2WD7A 4Z3DA 1P3DA 4DQVA 1B8UA 4UUMA 4GX1A 2CNBA 4OGWA 3WXBA 2B5VA 5HS4A 2DFVA 4R5HA 2Q45A 1EDZA 1C0KA 2J3IA 3E5RA 3ROPA 2RBEA 3K2EA 1SAYA 3DZJA 4E31A 2YY7A 1J49A 1J5PA 3NTQA 4YR9A 2DBVO 4BO7A 3JYLA 2B37A 4UVHA 1AE1A 1GZ3A 5MDHA 3F1KA 5ES3A 1SNYA 5TT0A 4ZGWA 3IP1A 2BGMA 2ZTLA 3AWDA 1NR7A 1SOVA 1UAYA 1BMDA 2QRKA 3ZV3A 1XR3A 1ORRA 2JD1A 1SOWA 2DM6A 3M2PA 1BG6A 3ZHYA 4J6FA 2EW8A 1I10A 3SLGA 5A3VA 2AEJA 2YFHA 4UUOA 4ND1A 1LC0A 5IFLA 4WOKA 5ILOA 1GCOA 2EW2A 2RIRA 3FCOA 4OL9A 3GLQA 2GD1O 3ROQA 1VL8A 3OHSX 1GD1O 3TZ6A 2EIHA 1PWZA 3O9ZA 3Q2IA 4GMGA 4FGWA 4RVUA 2HU2A 1UAGA 1LDBA 4P4GA 1EVJA 4EUEA 1EDOA 2BFMA 4KWIA 3BTVA 3I1JA 3VKUA 2C29D 2F1KA 5H82A 1XLTA 3L07A 5F21A 4LSMA 5LC1A 4YT4A 1WMBA 3MEQA 1UDBA 4IIVA 2ZTMA 5JYEA 2IEDA 2Y1CA 3WG9A 4BNLA 2QZ9A 2JL1A 2POQX 2HMUA 4RVSA 1OFGA 4LCJA 4BV9A 5EL0A 2Y0DA 1HE3A 1I36A 2AQKA 2EWMA 5A4DA 4FSHA 1SO8A 2CDAA 1X0VA 1AXGA 5TT1A 1PGJA 3ZDFA 2GRAA 1IUKA 5CPBA 4CLDA 4CR6A 4DTIA 3JQ6A 5K6AA 1H2HA 1BVUA 1M6HA 3OA2A 4FJ0A 3CZRA 3JSAA 4JJGA 5BNTA 4RJTA 3PGXA 3LZ6A 1Y8QB 3MJTA 3RI3A 4BNWA 3RUEA 3HWRA 4RPKA 3IUSA 1KERA 2D5CA 2EJVA 4CM8B 4JBIA 2W98A 3AOGA 4O63O 3F47A 5HS6A 3FSRA 3IJRA 1B3BA 3DBLA 4M86A 2AQ8A 3QWHA 4BKPA 3RC2A 4ZD6A 3GUCA 7MDHA 1VKOA 3HJAA 2VRCA 3ZWYA 1IPEA 4ALKA 2JFHA 2G82A 2P68A 4R1NA 1YXMA 4LGVA 1A7KA 1EVIA 3PHIA 2P4QA 4OSOA 4YXFA 3TN7A 5DF1A 3FTNA 4RDHA 3E9NA 1HDYA 3TDKA 5DCYA 1QP8A 2Y1OA 3DZIA 5DNAA 4J4HA 2XF8A 1LSSA 1HWYA 1P1IA 4ZRMA 4YQZA 5L9AA 1XGKA 2IEBA 4J2HA 3MJVA 1PSDA 2VNAA 2X1HA 2BKAA 3MTGA 5T8KC 4ZICA 1RPNA 4YTEA 3KETA 2PD4A 2PKRA 2QG4A 1HL3A 2Y0CA 3ADPA 3RSHA 2YHIA 4P4NA 4PN3A 2PY6A 1Q1NA 5DCWA 1CQIA 3K8ZA 1ZJYA 2HRZA 4MPDA 5JYDA 1I8TA 3GEMA 4K6FA 1UH5A 2J3HA 3L4BA 4J2OA 3V1TC 1P0CA 3WNQA 3E8XA 5A9SA 3CMCO 3WLEA 1O5IA 4QX6A 5IN5A 4LSWA 4KWHA 2DLDA 3RJ9A 1DIBA 3T4EA 3PXXA 4PLWA 3EVNA 2VUSA 4ITUA 1UXGA 5B4VA 4GPD1 5JSFA 5KJEA 3MJEA 2FY8A 3WR5A 4JLWA 4E32A 4I5DA 4OXYA 1PJLA 3JD2A 4E2YA 2YV1A 1EBFA 4GGOA 3RBXA 1PZHA 1I2BA 1B8PA 5C5IA 1E7QA 1NQOA 3K92A 4W7IA 1TT5A 1WPQA 2EKQA 1N7HA 4L75A 3VH1A 4WPGA 3HQ4O 3TZKA 1GZ4A 3CE6A 1P9LA 2Q99A 2P9CA 2ILTA 3MJ4A 2FN7A 4BMNA 1HLPA 2NM0A 4FFLA 3GNQA 4YAEA 3TFOA 3EZYA 2AHRA 5CP8A 2F00A 3L4SO 3ICPA 2ZJ1A 5IJZA 1U4OA 4EDFA 1Y81A 2H1SA 2FZWA 3L6DA 4KQXA 4IS2A 4MIOA 3S55A 2ZYGA 3GGOA 1KY4A 3EZLA 5H83A 4AICA 3RJ5A 3ETEA 3U49A 3TWOA 1K5HA 3EAGA 4GAEA 5JCJA 3PWSA 2GGSA 3Q0EA 3R3SA 4D44A 1M67A 1PZFA 1Y1PA 1ZW1A 5C7LO 3AM5A 5IG2A 2C54A 2VNSA 1EE9A 3GVIA 1YBVA 4RF2A 3M1AA 3RASA 1H94A 3P7MA 3WTBA 1GTMA 3AW9A 2IRWA 4OOFA 4Y67A 3PHJA 1FDTA 1KC1A 3DAGA 1KEVA 3FNGA 4HFRA 4XDZA 4II3A 5LDHA 1NWCA 1T1SA 3LT0A 1JVSA 1B7GO 2X0JA 2FSVA 3QLJA 4E2XA 4ESOA 4J3FA 3HDJA 1NP3A 1ISGA 4NJMB 2DTXA 4XR4A 1E3SA 5GY7A 5BSGA 4ALJA 3RKRA 4L8VA 5CDSA 2C5AA 1Z6ZA 3L77A 3JYQA 1ML3A 2EEZA 2ZYDA 2OORA 4JROA 4JP2A 1Q7GA 2P5UA 2Q1WA 1LDMA 4GLOA 2GLXA 1IZ0A 2OFPA 1C14A 4E13A 4EW6A 4PLHA 4ZQGA 1NBOA 3ZHXA 4PLTA 3GNSA 3WS7A 4IPTA 2YW9A 3E18A 1PQPA 4NI5A 4EJMA 3JQDA 4PG7A 3SC4A 1VSVA 5JLAA 4CUJA 3WGYA 3NV9A 1CDOA 5JE8A 4M49A 1KS9A 2V6GA 3H9UA 4NQZA 4E5MA 4BNIA 5F1OA 3D5QA 3LC2O 1GDHA 1N9GB 2ZCVA 2WD8A 3LC7O 4DPLA 3STHA 4BL5A 2GN4A 1YWGO 3IP3A 4NH4A 4PLZA 1VJ0A 1V3TA 1O89A 4HFMA 4E6PA 4GLLA 2QHXA 4MJLA 3C7DB 3WJAA 4K28A 2GYYA 5I9NA 5G0WA 1K6JA 3UVEA 4P4LA 5EQDA 2AEFA 1YRLA 1BXZA 3NUGA 4BO6A 1ZXLA 3T7CA 3DQPA 4GKBA 3RUHA 1CQJA 4NK4A 2ZB7A 2AW5A 1KVSA 1MX3A 2B4QA 5KJCA 3GMDA 4FFMA 3OQ6A 4CLRA 1M2WA 1PR3A 5DCUA 2O3RA 4R9RA 1P1JA 5I8WA 5L4LA 3Q9NA 2NTNA 3PJGA 3ROMA 1ZKMA 3KUXA 1T24A 4D41A 5DBIA 1NFFA 3FR8A 1SC6A 2RH4A 3U4HA 1JKJA 1E3WB 2VZ0A 3HFSA 2V6FA 5KTKA 1ZUD1 2C2YA 2UUPA 3ASVA 4RGBA 3HFGA 3BHIA 1Z7EA 2B0JA 3AY6A 1F8FA 3SC6A 1NXQA 2CDBA 3OEYA 4AJJA 5JAZA 3WQRA 2PKQO 1H9BA 4IMRA 4NPCA 4BO0A 1ISFA 1V8BA 4Y98A 1RM0A 2EHDA 3UCEA 1HZZA 5CG1A 2Q3EA 4ZQFA 2PFGA 2CF6A 3A14A 2Q1SA 4IDGA 4I5GA 1NVGA 3GN2A 4WLFA 1V6AA 4XEHA 2Y05A 2PH5A 1DSSG 1DRWA 3Q11A 3QVWA 3O38A 3FNHA 4Z0TA 2QYTA 4CQLB 1PJ3A 2YHUA 5CHEA 3AI2A 5TJHA 1EVZA 4DMLA 1W8DA 1WVGA 1RWBA 3BMCA 4XQEA 3V1YA 4YAIA 1DIGA 2PZLA 3DXFA 3P2YA 2PZMA 4LMPA 3EK2A 1BVRA 3X2FA 3PHHA 3QA9A 1GYRA 3LDHA 3DOOA 1R4MB 3WGIA 3K9QO 4J1SA 5AYVA 3KB6A 5COAA 1LRLA 4CM7A 3SJUA 1B15A 4M54A 4CM4B 3QWIA 5L4SA 4J49A 4YRBA 2P9EA 2VOEA 3DTTA 2PK3A 1X7GA 2JKVA 1MG5A 3B1JA 1BXGB 4OKIA 3A9WA 3JQ7A 3GFGA 3E9QA 2VCYA 3JD4A 2PGLA 4CM3A 1C1XA 2WMDA 3WDSA 2YDYA 1N8KA 3ITKA 2CY0A 3ANNA 5DOZA 1GCUA 2B83A 4FFPA 4W4TA 3ZNQA 2HDHA 2JHGA 3RUDA 4D46A 5L45A 1P1FA 4XB2A 1MA0A 1PL8A 4OXKA 2ZQYA 3RU7A 2AA3A 1YGYA 5TLSA 3PDUA 2DPHA 4WECA 1QORA 2GSDA 1EK6A 2OUIA 1GAEO 2GUGA 3ZW8A 3BMOA 4L4XA 3VZPA 1ENPA 1U8FO 4TVBA 4D0SA 2Z95A 2I3AA 3QHAA 5A5FA 5B12A 3RU9A 5KVCA 4RQUA 1PJTA 2EV9A 4PRLA 1L7DA 2B35A 1GL3A 4DPMA 3GEDA 5BSHA 2DKNA 1LBEA 2J5QA 3KRTA 1EQ2A 1V3VA 4IZIA 2I9PA 2NLOA 1C0PA 1H2BA 4URFA 3OQBA 4E3ZA 5ICSA 2HMSA 1EQUA 3HN7A 1XU7A 4E21A 5I9LA 1GEGA 1D7OA 1T2FA 2Z5LA 3F4LA 1LTHR 3VH3A 1BW9A 1U28A 4XR9A 2FR0A 3UW3A 4BQPA 4IJUA 4CODB 3I3OA 1PL7A 2WE7A 2Q2QA 3AY3A 1PQWA 1GU7A 1MV8A 4ZQHA 3W6UA 2WYVA 4FCCA 2VHXA 3E48A 5CPFA 1IPFA 3ASUA 2RH8A 3NDIA 5KKCA 3WWYA 2FWMX 1XWFA 1XQ6A 1ZVMA 5C37A 1ZMTA 2C07A 5B4UA 2YQ4A 3LF1A 3NJ8A 4GKVA 1OZAA 1PS0A 4DLAA 4ZU3A 3ONFA 1MGOA 1GV1A 1UZNA 1Q0LA 2HLPA 3DFUA 1GPDG 2Y1GA 1UXHA 4YRDA 1OC2A 2OBYA 3CEAA 2AE2A 4XGKA 4YJHB 3ETGA 4G65A 2H5LA 1U3WA 4XIYA 5TX7A 1LU9A 3WYEA 5A9TA 1EEHA 4I9NA 6LDHA 1P1HA 2HK9A 3COSA 1QYWA 2AE1A 3Q1LA 4R54A 3HADA 1ISMA 4R5MA 3JQ8A 4DL9A 3ZGYA 5KCZA 3OEWA 4BO9A 3RFTA 4GX5A 4YT8A 5I7VA 3B6ZA 3UCXA 2W2KA 3EVTA 9LDBA 4AJ2A 3VPGA 1EMDA 4RF4A 3JQAD 1JKIA 1KBZA 5K6AC 3MCVA 1AN9A 3D1LA 4GMFA 4YWJA 3GDOA 4XYMA 2GCGA 1A9ZA 3EYWA 3R3JA 3DZKA 1ID1A 1R4NA 1X1TA 1I0ZA 2HMWA 4RPHA 3WNVA 3WSWA 5HA5A 3AU8A 3BXXA 4DLLA 4I08A 3FBGA 3FPCA 4BNFA 1UJMA 4R01A 5KVQA 4E5NA 1B8VA 3AUUA 3HUDA 2HUNA 4PG6A 2VT3A 4YAGA 3NT5A 1HYGA 3KZVA 1T2EA 3DBHA 4BNMA 1S6YA 1YB1A 5JDCA 2A4KA 4H16A 4IM7A 2HKIA 4YJDA 4PLVA 1P31A 2YV2A 3TZQA 3X2EA 1NPYA 2X4GA 2ET6A 4A27A 2Y99A 4FOOA 4A5OA 1QLJA 2BI7A 1GADO 5C3MA 2EERA 2X6TA 2DC1A 1FDVA 1U3VA 3ANMA 3W4KA 5L7WA 3KEQA 3WIDA 3HHPA 2PZKA 1PZEA 3GG2A 3H5RA 4R3WA 3AI3A 3DB2A 1CEQA 1LDNA 4MVJI 5KNLA 1NASA 4AJOA 1D8AA 4R1UA 4CR7A 1HE4A 4DC1A 3N7UA 3L4BC 3JYNA 4BGVA 1JVBA 2JD0A 4N5MA 3NDJA 1YO6A 2R6JA 3R1IA 2Q1TA 3MWEB 1B14A 3EC7A 4IDCA 1IULA 3H7AA 1P33A 3CZMA 1CF2O 4I5EA 1Q2XA 3OJLA 4MOWA 4DIOA 3GEGA 4YJGA 1NFQA 2I65A 4NFHA 1HSZA 1U7HA 4K1LA 4O5OA 3T4XA 3ZHZA 1A5ZA 2HJRA 5G4LA 3SJ7A 5I8ZA 1I3KA 4JIGA 5HM8A 1DEHA 1JAXA 1PEDA 3N74A 1NM5A 3IMFA 3HDYA 3GUYA 1TLTA 4W6ZA 4Q3AA 2WM3A 2PR2A 3S8MA 3AY7A 4WE3A 5JDIA 3CXRA 4OMUA 4EUFA 3PJEA 3JQEA 4FIZA 3WJ7A 4Y6RA 5THKA 2BFOA 3UH1A 1I5RA 3DO5A 3DZGA 1ZK4A 4FC7A 3BMNA 4M89A 4CL3A 1CERA 1IY8A 3DEYX 3W4JA 5JFOA 1SBYA 2CVQA 1E6EA 3K2BA 3NT4A 2DUUA 1LA2A 3OM9A 3ONEA 1DRUA 4AFNA 1E3JA 1QSGA 4WGGA 4A73A 5ICMA 5ADHA 3KYDA 4GQAA 2C5EA 4J91A 1PR9A 4DGSA 1U3TA 4AJ1A 2IDZA 4PG8A 1I24A 1UXIA 1Z75A 3DC2A 2VHYA 3GH3A 4O1MA 3BMQA 1E7WA 2ZTVA 3OF2A 4ND3A 2FPIA 3KO8A 3DMYA 5DZSA 3L6OO 4IIUA 2D4AA 3E6AA 1I3NA 2VHZA 4YACA 3CMMA 4PLFA 2J5KA 3PQDA 3CKYA 3OA0A 3GGGA 3L6EA 1R6DA 4FDAA 4TZTA 1LDYA 4WCDA 3N58A 5FF9A 4AJIA 2OXIA 3D4OA 5KJFA 2DTEA 3OECA 4UVGA 5IDXA 1ZK3A 4OAQA 3LYLA 3O03A 5KWEA 2JFFA 3ZWBA 1E5LA 1EBUA 5JCXA 4RL6A 1N92A 5B37A 3BYZA 3RCBA 1VPDA 3JQGB 3F46A 4KOAA 2CDCA 3DBRA 4BKOA 3V1UA 2BHLA 4D3FA 1GUZA 3VVCA 2VOJA 2NQ8A 4YRAA 4HV4A 2E48A 2QX7A 1F12A 5L7YA 4IDBA 2PGJA 3G1UA 4EEXA 4E0BA 4RQTA 3VAZA 1WW8A 3PJFA 4NG5A 3LQFA 4OQZA 4DIBA 3Q2KA 3VDRA 1E6UA 1P1KA 2OL4A 3S1LA 3I4FA 3JQAB 4PLCA 3JTMA 3O8QA 3RROA 2WJPA 4BNKA 4XCVA 1XIVA 3KSUA 5AXDA 4BNHA 2BF7A 4H7PA 1R12A 5MGBA 2XXJA 4PG5A 4TSKA 3GVCA 4DRYA 4J0FA 4IJWA 4ZN6A 2BRUA 3UCFA 3EY4A 3GAFA 4ND2A 1GYPA 3ENKA 2W2LA 4JNKA 1B3RA 2WSBA 1UXJA 1X7HA 3H3JA 3U0BA 4IDFA 1F0YA 1XQ1A 4P8RA 3QE3A 4TKLA 2OGUA 5IXYA 3U4CA 2JAHA 4DIFA 1A4IA 1QYDA 4IXWA 4M8SA 5DBFA 3KYCA 1HE2A 2VYVA 5AOVA 4ALLA 1V0JA 1SZJG 1O95A 4WK6A 5BNFA 4CMBA 4CV2A 1F17A 2NUAA 4DYVA 4KQWA 1RM3A 3HB4X 1YL6A 4R69A 3CTMA 4WLOA 1E7SA 3ZWOA 1MFZA 2VYNA 1ZFNA 4NIMA 4Z6KA 1J6UA 3EMKA 4YVFA 5GZ3A 5IDQA 1ZBQA 2H9IA 4QEDA 1YOVB 1EUDA 1YH3A 2HSDA 5HWSA 4ALIA 3H3FA 1Y5MA 3ZNOA 1LEHA 4CQMA 2B69A 4ZQEA 4CUKA 1WWKA 3QVTA 3I9MA 4XYBA 2VRCD 1NHGA 2DTDA 1YB4A 3H9EO 4JN6B 3VKVA 4DQXA 1K89A 3NAQA 9LDTA 2NV6A 1I3LA 5FI3A 5G4KA 4L74A 3JD1A 2B5WA 2D3TA 3T7EA 1Y9EA 2VHVA 4LCEA 4RDIA 3LF2A 3MOGA 1C1DA 4L9RA 3TQHA 2UYYA 3QQPA 4YT5A 4XRGA 2EGHA 5JMWA 1NPTO 3ZWPA 1JU9A 5KJ1A 1EFLA 4TRJA 5JAQA 2DVMA 2I76A 4R9SA 3C7AA 5IAAA 2X0NA 3SVTA 4M1QA 1XA0A 2O4CA 2NVUA 3DAFA 4E5PA 5BNIA 4B7XA 2GPTA 5ENDA 4WNIA 1YS4A 3WQQA 4I8XA 5IN4A 1CJCA 1NQAO 1XELA 4FQ8A 2PKQP 3DFZA 4IY1A 1E0DA 1ULSA 1ONPA 3NGXA 2IYOA 3H8VA 5AQ1A 2OHXA 5L7TA 4XGIA 2GASA 4XJTA 3D3WB 3TJRA 1T4DA 3RBZA 1U8XX 4CMIA 3M1LA 3ZWCA 4Y9DA 1X1EA 2XOXA 4J7CA 1N5DA 3DOJA 3EUWA 3BMNB 3FHLA 4AL4A 2WD7B 4RVGA 4BUCA 4CLOA 3U3XA 2E82A 2PLAA 4BO4A 4NK5A 3PWKA 4MIYA 1YDWA 3CSDA 1BTOA 1XG5A 1GY8A 1W73A 1HSOA 3KXDA 4QO7A 3P2OA 1BGVA 5DN9A 2J8ZA 3CINA 1BSVA 3PYXA 1WZIA 1KYQA 3O26A 1TXGA 1Y8RA 4RF3A 4JQCA 3I6IA 3V8BA 3I9KA 3B20A 2XPCA 4IINA 4DQUA 4BNYA 3D4NA 4FR5A 3LK7A 4PGFA 2NNLD 4D42A 1VC2A 1GR0A 1HEUA 1B2LA 1E3IA 1ADCA 2CUKA 1BRMA 1FDSA 2EP5A 2FPGA 4WASA 3QRWA 4ZA2A 2G17A 3GFBA 3KOUA 2JCVA 2VWHA 1YL7A 4MKZA 1HKUA 4BO5A 5K0ZA 4CPDA 1MG0A 5BSFA 4OO3A 3HDHA 3OJFA 3UUWA 5JCJD 4YAJA 4ZJUA 3GC6A 5IDYA 4ALMA 2E49A 1VJTA 2A9FA 3TSCA 4PZEA 2GN9A 5JMPA 3G0OA 4R68A 1U5AA 1E1LA 4OSPA 4HP8A 1FF9A 2AEMA 4WCFA 2P5YA 2CFCA 2CVZA 4BO1A 1DJNA 2D2IA 2EF1A 2H63A 2YYYA 2QRLA 4GWKA 1AXEA 5EQFA 4DPKA 4H3VA 2VUUA 4HX5A 5ER9A 5U1PA 4EYEA 3M2TA 1F8GA 4AJPA 2CVOA 5IXSA 4WLNA 2PGDA 1E6WA 4MINA 4YJFA 4CLXA 1JA9A 4QSMA 1C3VA 4AVYA 2D0IA 3UHAA 4XA8A 2HMTA 1QMGA 2HQ1A 1UZMA 4GL4A 4GX0A 1DXYA 2B4TO 3FR7A 4PLYA 3WBBA 3WX0A 3UXYA 1DO8A 3BAZA 2NU8A 1YB5A 4TQGA 1LQUA 2Z1NA 3LU1A 1W0CA 3WGHA 4FOSA 1HDXA 1R66A 2FPPA 3GRPA 4Q9NA 4XIJA 2BELA 1A72A 3F6YA 3PFFA 1PIWA 3VOSA 1NTOA 3DMTA 4IDAA 1P0FA 3PTZA 3JQCA 1WP4A 4Q39A 3S2GA 3VHRA 2IODA 3C85A 3L9XA 2GZ3A 2IZ1A 4PRKA 1FJHA 1KVRA 3GN1A 3QVXA 1PWXA 1UDCA 2DAPA 2BGLA 3UAGA 5K9ZA 1TT7A 4WLVA 3PQFA 4FS3A 1NHWA 4J16A 5I7SA 3Q9UA 3DBLB 1RYDA 2P4HX 5ENVA 3A06A 3AK4A 4JP3A 5DT9A 2WYWA 4UVDA 2QRJA 3V2GA 4EEZA 1HRDA 3NTRA 1V3UA 2ZB4A 4INAA 2RHRA 3S2IA 3GZNA 4RCVA 1G1AA 1H9AA 3JD0A 1L7EA 3RC9A 1TA4A 3WLFA 3JQ9A 1X7DA 3H5AA 1DC3A 3H5NA 5ITWA 3PZBA 3CH6A 5JO0A 2FSSA 3CUKA 5HBRA 5L53A 2BD0A 3RUIA 3U09A 4BNJA 5JDCC 1OOEA 2IZZA 1SEVA 1KEPA 1LRKA 3PI7A 1C1DB 1PU2A 4RZHA 4RZIA 3D64A 1MXHA 1EE2A 2YHIB 4KDFA 4CMJA 4J9UE 4Y6SA 4KDEA 4WLEA 2A92A 4L73A 3FRJA 3IUPA 2NVWA 1T1RA 1QXSA 4BKRA 4B7UA 4JJIA 5A9SB 5FFFA 3GY0A 4TZKA 4BNGA 3IL2A 4B3JA 7ADHA 3VVBA 3WGGA 1U2DA 4OQYA 4AJNA 5CEEA 2EXXA 3RBVA 2G1UA 4FJ1A 3ORFA 1J4AA 4OM8A 1P77A 2GDZA 2BH9A 3HB5X 4BHTA 1NVMB 1DAOA 4O0LA 5EESA 5TSDA 2E4AA 1BDMA 4UVIA 5ITVA 3E03A 3F9IA 3PYMA 5B1YA 4NBUA 4R16A 3ONDA 4FW8A 5CEFA 1YJ8A 3TNLA 4J7XA 3GDGA 3VC7A 1T26A 1RYEA 1TT5B 3KSZO 4RPLA 3B1KA 3AFNA 1K6IA 2PH3A 4YT2A 2R2GA 4YYZA 2OO5A 2XXBA 1X14A 1X15A 3GA0A 5EN4A 1YJQA 4PCVA 4CUZA 5FYDA 4WEQA 4IGEA 1J0XO 1RJWA 4R51A 4OIMA 5JNLA 1MC4A 4CV1A 4F46A 1B26A 5JDIC 3ITDA 2I66A 1X0XA 4ZQBA 5JBIA 3KVOA 5T67A 2DPGA 4IQ0A 3GHYA 3ANLA 1LLCA 1DLJA 3SX2A 3R0IA 2FR8A 1C0IA 3UICA 4CMKA 1E5QA 2P2SA 1OAAA 8ADHA 4S1VA 3K5PA 1U9JA 3OFSA 3QP9A 4RLHA 2Q4BA 3JQFA 2V65A 3OQ1A 4BIIA 1VSUA 3I5MA 4XB1A 4J1QA 1XSEA 2Y93A 3GVXA 1E1MA 1E7MA 4RORA 1R0SA 4HADA 1C0LA 4NU6A 1MLDA 4PZCA 3GR6A 1O8CA 4DXHA 1XDWA 2Y68A 4FFNA 1IHXA 2E37A 2EP7A 4IUYA 3OMLA 4YBZA 1G0NA 2ZB8A 2AQHA 3DDNA 4B4WA 3I6QA 4A2CA 5IF3A 3D7LA 1LC3A 4R1SA 2G76A 2I67A 4JXKA 2RHCA 4U7WA 5I7FA 1K2WA 2NTVA 3BTUA 2PA3A 5HRUA 3FBTA 1M75A 4MO2A 2LDXA 2O2SA 4DREA 3VTZA 5FWNA 4Q3BA 1ZIDA 1ISHA 3ZV5A 1CYDA 5CDGA 4FFRA 4YJFB 1VI2A 1UP4A 3GOHA 4A26A 4J90A 4R41A 3INRA 2PTGA 4KMSA 3F1LA 3WMXA 4E5YA 1U1IA 1NR1A 2Q49A 2C7VA 3IKTA 2JD2A 1E92A 4CR8A 2YJZA 4QFCA 1UR5A 4DMMA 1T25A 2V6MA 3MJCA 5EINA 4TRMA 4XYLA 4N18A 3WYBA 3ZNPA 4D3DA 3HN2A 4BOYA 1I33A 3DWFA 2A94A 3KTDA 4MKXA 4Q3EA 4AG3A 3BTSA 1VRWA 5U4QA 1HF3A 3IKVA 4QTZA 5CEJA 1E7YA 1ONOA 2HAEA 4UREA 1FK8A 3SLKA 3IOYA 4BNZA 4C7JA 3GG9A 1TVEA 3TL2A 4LRSB 2HRBA 4EJ6A 1GQ2A 4BV8A 1E3EA 1N1EA 2DFDA 5TQVA 5KIAA 3GPIA 2ZIZA 4XRRA 4W9NA 4XQ9A 4R1TA 3S2FA 3ZWXA 5F1KA 3VH2A 5IDWA 2Y1DA 4UEKA 3HG7A 4JK3A 2YZ7A 1Z74A 1ZSNA 3D4PA 3FPLA 4NBTA 3VH4A 1SMKA 3RAJA 1QRRA 1O0SA 2OBNA 2NU7A 3VPSA 3UKOA 3GGPA 4DBVO 1WAMA 1VL6A 3NX4A 4CLRB 4IJVA 2NVBA 1NWHA 1FXSA 3F5SA 3GZ4A 3LT4A 4XX0A 3WICA 1ZEMA 4P38A 3RWBA 3NT2A 1K6XA 4MVJA 2NACA 2VTDA 5DOVA 3RUCA 3H9GA 3LSYA 1E1KA 5LCXA 2O3JA 2OP1A 3GDFA 1DFIA 1LLQA 1BDBA 1DDOA 4MP8A 3WSVA 1DB3A 2DQ4A 1M76A 1G0OA 4OH1A 4MVJH 2GN8A 3WGOA 1UP7A 4NDNE 3PLNA 4MVJD 1HDGO 5JY6A 3PVZA 2EKLA 2O2YA 1Y6JA 3K96A 1PGQA 3A28A 1HYEA 2GR9A 1LSUA 4HNGA 1T2AA 2FMUA 3I9JA 2VHWA 3RUAA 4QT0A 1Y8QA 1NPDA 1HETA 1JWAB 1WLYA 1ZJZA 3G1TA 5DP2A 4CM8A 2CSUA 1ZO8A 4E2WA 4JGBA 2UVDA 3MZ0A 5F3RA 2BFPA 2Y1EA 2X9NA 3M6IA 3Q6IA 4OYRA 5JC8A 4B79A 4AJKA 4DC0A 3NKLA 1PJCA 1S7CA 3BMCB 4PG4A 3I23A 1DFGA 2Q4EA 3JYOA 4EGFA 1TEHA 4BQRA 2J3JA 1GYQA 1DJQA 4CMEA 1V35A 4UAGA 4FN4A 3SXPA 1KC3A 3KV3O 4IGFA 4PIVA 1LSJA 1YBMA 4CMAA 4HY3A 5DBGA 4MVJP 4XGNA 2Q1UA 3TOZA 4C7KA 3WWZA 2QIOA 3FN4A 4HKTA 4FB5A 3K30A 2OP0A 4U6SA 3JQ7B 4D45A 3PPIA 1U4SA 3DHYA 1L1FA 1NFRA 1CWUA 5CDUA 3GF4A 1C1XB 4K9DA 2X5JO 1DIHA 3TOXA 2XAAA 4DWVA 2FR1A 2NSDA 1IL0A 1MP0A 4E30A 1Q0HA 4MVJF 3KBOA 4Z9YA 4II2A 2Q2VA 4E2ZA 3DZHA 4PFJA 5TNXA 4Z0PA 1RM4A 2C20A 4UVEA 1WDKA 3ZHBA 2X5OA 4R3NA 3BMOB 1HXHA 2JJYA 3AOEA 3IC5A 2C2XA 1I32A 4PVDA 1PTJA 1OI7A 1MUUA 5F1PA 1N1GA 4J1NA 4LRTB 3ENNA 3QVOA 1VM6A 8LDHA 2H6EA 2FZEA 4KUGA 2IXAA 4WEOA 3QW2A 1DIAA 4YB8A 4U5QA 4AJEA 1ZK0A 1KOLA 3JYPA 3DOCA 4RLSA 3G17A 4CM5A 1VE9A 4OXNA 3UOGA 4BB6A 1YVEI 2ZJ0A 5THQA 1QYVA 2DBRA 3ZCXA 2PNFA 4HWKA 2RAFA 2VWGA 4AJ4A 1AGNA 3FWZA 1SB8A 4Q3CA 4CLEA 4A10A 1MXFA 1GQQA 1BW9B 3JD3A 3MWDB 3QIVA 4MIEA 2G5CA 5CG2A 5JW6A 3I9LA 3KLPX 2Y66A 4AJHA 3CPSA 4CV0A 4ZHSA 2FRDA 1IYZA 2GERA 2X23A 1W6UA 3KSDO 1KIFA 1LI4A 1H6CA 4BMVA 4N5LA 2BI8A 1XKQA 3FF4A 1JW9B 3KM0A 4WCFC 1XHLA 3QY9A 3R6DA 2R00A 5AXAA 4BB5A 2PZJA 3OJOA 3MOIA 1XCBA 3PEFA 1ENZA 4BGIA 2AXQA 3I9NA 1NYTA 3EHEA 2WEKA 3ZNNA 3JQBA 3GPDG 3LLSA 4XQCA 5HTOA 3QWFA 2FOIA 3OP4A 4GX2A 4LW8A 4OHUA 4F3YA 3WGZA 1FMCA 2BLLA 3LT2A 5DDIP 5GMOA 1I2ZA 1Y7TA 4BO8A 2D59A 3JQ8B 2GNAA 1O6ZA 4I9UA 2D8AA 2YDXA 3W8DA 1DC4A 5A05A 1ONNA 1DHTA 1Q7BA 1FDWA 5EJ2A 1OC4A 4LVCA 4NJMA 5T57A 3ZU4A 2P91A 2FHSA 2W2KB 1GPJA 2TMDA 3RD5A 3ROKA 3L0DA 1GV0A 4WJZA 3DMTC 3L9WA 3BTOA 4UEOA 1ISIA 4J0EA 1E7RA 2B36A 3K6JA 1EZ4A 1P74A 1N2SA 5A9RA 5TC4A 2Y0EA 2DU8A 2EGGA 4XYGA 2NU9A 4A03A 2UDPA 4WLUA 1G6KA 1R4NB 4PVCA 1DFHA 4LMRA 4D7AA 4ILKA 5COQA 1GQYA 1QV7A 3WGTA 3H6KA 3DAPA 3KLMX 4U0JA 3NTOA 4EITA 2W2LD 3PHLA 5L51A 2I5PO 1QR6A 3PGJA 1ZSYA 5BT9A 3GK3A 5EPOA 3G3EA 3WBFA 1ZXBA 4G2NA 1AHIA 1KVQA 1LUAA 4ZRNA 3PYLA 3KYBA 5G0VA 2Q50A 3DBHB 1ENOA 4RVDA 4XQGA 2VT2A 2ZKLA 4D3SA 4DA9A 1N9GA 1H6AA 1UUFA 2VYVD 3D3EA 5EIOA 2ZCUA 4GSLA 5G0UA 1DLIA 1LNQA 1D1TA 1T2CA 2OMEA 3H65A 4I1IA 4N5NA 3JQ9C 3PDJA 3W4IA 3KEOA 3NEPX 3EDMA 3K73O 5IZCA 5BQFA 3FD8A 4ND4A 4A0SA 4IQ8A 4MDHA 3QWBA 4IBOA 2VWQA 2VYND 3V2HA 5TF4A 2VUTA 3W1VA 2NQTA 2X22A 3OIGA 1R15A 1TB4A 4KTVE 5JXWA 1NVTA 4HXYA 1Z7BA 2C59A 3ADOA 4CM9A 1M66A 4CQMD 4TVOA 3UN1A 1O94A 3BA1A 1Z82A 3DBVO 3ULKA 3DR3A 4QECA 2CZCA 1GFSA 3ZN2A 5EMHA 5CFZA 2OZPA 1U3UA 1EUZA 2QZZA 4YEDA 3RFXA 1X13A 4GH5A 4FC6A 4RVHA 5A06A 1GUYA 1F14A 4K6CA 1D4FA 4CV3A 5TS3A 4LK3A 1E3WA 2O3SA 3AUAA 1HDZA 4FPXA 2I3GA 4CM9D 4DYDA 3OSUA 1UZLA 1NAHA 4YJGB 3WIEA 2I99A 4M55A 5F5NA 5EERA 2NU6A 4JBHA 3LT1A 5L40A 3C1OA 3I83A 4Q3NA 4W7HA 4CMCA 4S3MA 2AMFA 1LLUA 1Y5RA 2WYUA 2O3UA 4X54A 1BXKA 1EUCA 5CDTA 1EVYA 3WYCA 1H93A 2VWPA 4I9HA 2Q46A 4RO0A 2VZ9A 6ADHA 3MJSA 4CJXA 3I9OA 2HK7A 4G5HA 4YPOA 1AHHA 1Z73A 3QWAA 1JAYA 5JO9A 2BFAA 1FDUA 4XYEA 3TZCA 1P1RA 4G81A 4UUPA 1YDEA 4CM6A 4CQLA 3A4VA 3BIOA 4MP6A 3GNTA 4QUKA 4D43A 1V9LA 1R37A 4IJKA 4PLPA 5TGDA 3RKUA 2VQ3A 2NTJA 3KYDB 5GZ1A 3LVFO 2VTEA 3RVDA 3ICCA 2Y1FA 2GZ1A 1YQXA 4P22A 3U62A 4U6QA 3H2SA 3WGQA 3RIHA 2V6BA 4F45A 3RC1A 3TF5A 1UDAA 1R4MA 4QO8A 5JAIA 2W8ZA 3BMQB 3IDSA 2IXBA 2EG9A 3JQFC 4MVJM 2PD6A 1ZH8A 4CM4A 3AM4A 4J9VA 2DT5A 3TRIA 3WOHA 4FJ2A 1SEPA 3AUTA 5T6BA 4EUHA 3PP8A 1BXGA 3DZBA 2PV7A 3ZV6A 1VL0A 4BO3A 4TMFA 1PQUA 1PX0A 3JV7A 2CMDA 4OJNA 4F6LA 4HUJA 2LDBA 5JS6A 4YAKA 4B3HA 4I5FA 2J6IA 3E9MA 4Y8VA 4BO2A 2HMVA 4E4YA 1LX6A 1LDEA 3G49A 3U9LA 3DBRB 3OJ0A 2FP4A 1QLHA 3PLRA 3ZV4A 1P45A 5A5EA 3F3SA 1HE5A 3AM3A 5KVSA 1NQ5A 1PGNA 3PZRA 4EI2A 1ADBA 3H9QA 3DZFA 1K0UA 4BVAA 1HLDA 2X8LA 3O8QB 4B8WA 1A4UA 4L0QA 5A02A 3C7CB 1A7AA 4BNNA 3O4RA 4HFJA 3TZHA 1Z45A 3DHEA 3UFXA 1P44A 1YQDA 3HSKA 2JAPA 1BWSA 1LDGA 1JKFA 1XEAA 4KP7A 4UUNA 3HNPA 2VN8A 2OOSA 1HDCA 1WDLA 4J7UA 2X58A 3H9JA 4U0KA 1WZEA 3H4VA 3HZZA 1QKIA 1DC5A 3NGLA 1ZZEA 3KYCB 5JPIA 4MP3A 4BNUA 5C7OO 3AU9A 4E33A 3PIIA 4W9NC 2J5RA 4IS3A 4JCOA 4B3IA 5I7EA 1XYGA 1KEWA 2NWQA 1R0KA 3QVSA 3GRKA 4BGUA 5A03A 4FD3A 1I01A 2X7HA 5AVOA 3ZU5A 4FBGA 1W4ZA 4XWYA 3OICA 3E5MA 4LN1A 1BHSA 4YJHA 2IYPA 2D5AA 3NRCA 4J4TA 1IHYA 1GUFA 5F5LA 5ER6A 3LLVA 1A9YA 1ADGA 2Y67A 3IQDB 4QXMA 4BNVA 1Q0QA 1WDMA 3FNEA 2HK8A 1SB9A 4JJFA 3AI1A 2J3KA 2DBZA 3PQEA 1OBFO 1PL6A 3VPFA 4CQMB 1E77A 3PHGA 2EJWA 1PZGA 1CETA 1F06A 1WMAA 5U9CA 1YE3A 3AUSA 1DAPA 1QYCA 1Q7CA 4O6VA 4RVFA 5G2OA 2X86A 2QYSA 4O59O 4BGEA 5I9MA 4IDEA 1MB4A 1I2CA 4L76A 2GN6A 3SEFA 2YFQA 4U8GA 5G4KB 1M6WA 3HDQA 4D0RA 4W82A 1LQTA 1DRVA 1HTBA 4KZPA 3W8EA 5C7IO 5A04A 1PJQA 2V7PA 4XD2A 3Q3CA 4WNCA 4IZHA 2JCYA 4DUPA 2JFGA 2GZ2A 5TRTA 3ZU2A 4RV9A 1ZCJA 4XKJA 3ZWAA 4EZBA 3BZUA 3S2EA 4GBJA 1DC6A 4RPJA 2NVUB 4GGPA 1OMOA 2GO1A 4IQGA 2I6TA 2VZ8A 1PGOA 3ZU3A 3PIDA 1HDRA 2YV3A 3FNFA 3JCZA 4GWGA 2ZK7A 1ENYA 2UUOA 3VDQA 4CMEC 1WXDA 4NZ9A 2VRBA 5T8KA 4KUHA 4JBGA 5ILGA 1HDOA 3D5TA 5CAEA 3V5NA 1CIVA 4CMIB 1LLDA 1TI7A 3PK0A 2ZATA 4B4VA 1H5QA 1QYXA 2O3TA 5G0SA 2D1YA 4NU5A 1ZK2A 3PFWO 2CD9A 4GVLA 4CLOB 4RF5A 1MC5A 4J43A 1JWBB 2IZ0A 3P19A 4B7CA 4N7RA 2ZB3A 1D1SA 2JCXA 4TKMA 2B4RO 1KEUA 2UAGA 2O7SA 4NBRA 3INGA 4DVJA 5T64A 3C1AA 3IAHA 1DBVO 4J4BA 4NNJA 3DTYA 1JTVA 1Y8RB 3RUFA 2HCTA 4NHEA 5JY1A 1JDJA 4HNHA 4NBWA 3ZW9A 2ZQZA 1JN0A 4YA6A 2WE8A 1ZSVA 3VZRA 1DIRA 2DBQA 3WFIA 3LC1O 1LRJA 4B4OA 1LJ8A 3RC7A 3A1NA 3FWNA 1ULUA 3AOEC 1PGPA 4ND5A 2O50A 1ISJA 1JLLA 1GZ6A 4IXTA 2W90A 2A35A 4CMHA 1RKXA 4CMGA 1AUPA 1I3MA 4A7PA 3AJRA 5L4NA 3NYWA 1T2DA 5GZ6A 1VKNA 1Y9AA 4YCAA 4YQYA 3AFMA 3IS3A 1D3AA 3B70A 3WFJA 1VJ1A 2DUWA 3ZWMA 1H0KA 1KVTA 1XU9A 3ETDA 5TIIA 1WNTA 4FFOA 4NFSA 2YUTA 3ZI0A 4IDDA 1NQTA 3I52A 4GI2A 4Z3KA 1U5CA 1U2GA 3BHJA 3F5QA 4LVUA 5LDGA 4WCFB 1QV6A 5DP1A 2IE0A 4W99A 2NADA 4GSKA 5T5QA 3UGKA 3VPHA 3E82A 4Z0HO 1SCUA 5KJ6A 4KUEA 2WWRA 3CIFA 4DLBA 3ZWVA 1DHRA 2BMAA 3SBOA 3WTCA 3HE3A 4GVXA 1QG6A 3K31A 3TPCA 2X9GA 5IZ4A 1SPXA 2R00C 4ZVVA 2O4UX 3ABIA 3WMWA 1ZNQO 1ZMOA
chains in the Genus database with same CATH superfamily
3OJEA 1N2CE 1DADA 2HDNB 4H4CA 3JQBC 3V7UA 4JZKA 3MWLA 5JASA 4MYRA 2C7GA 2VDLB 1O4WA 4IIEA 2QBYA 3ZWNA 3SKYA 4D79A 3IXLA 1UM9A 2HA3A 3PV0A 4BRZA 5IFKA 3TGLA 3LWDA 1DIOB 4COOA 1KY5A 1E1NA 3K0HA 5JSHA 1GKKA 2X5XA 2F17A 2BPOA 5BV8A 4Y9SA 3CUWA 2FOXA 1TGYA 4WUVA 3VTFA 2QRQA 4KQGA 3WZLA 3QEOA 1RJEA 1S8FA 3TFQA 1KQNA 3NJ4A 3E3MA 5GOTA 1CXZA 2G71A 1QFMA 4H0FA 3E1KA 1E2MA 1GUAA 2PS0A 3SJCA 5CFLA 2ZR9A 3ASYA 1JG6A 2BKVA 1Y1RA 1THMA 3U4IA 1ZX1A 2OWEA 3F4BA 5KQPA 3PC8A 4QQRA 1JIKA 3GVPA 3IDZA 1YMVA 2GF2A 5BV1A 4U7PB 3HBLA 3IXMA 4B7AA 1US8A 1X6VA 2EQBA 2QY6A 3RG2A 3WNBA 5HKKA 1VLLA 3A6GA 1NA5A 4TWRA 2PUGA 3NBYC 1YIDA 5ALQA 3U6BA 2H4XA 5CFRA 4HYQA 4DLWA 3EUEA 3GZNB 4DA4A 4Q1AA 3GJYA 3GGSA 1CJTC 3G68A 3OM0A 1P8JA 1IOLA 3ZH2A 3RHSA 1ACMA 3G6WA 1KL7A 2PU7A 1CRWG 3GAZA 5TJ9A 5G3ZA 1J2RA 4OFXA 3L6BA 3O3CA 4J3NA 4CT4B 2YQ5A 3TL3A 1KIMA 3QJ5A 3C24A 4AZWA 2QU7A 1RHRA 3LOPA 4ASUA 4MVJE 5TB5A 1VXRA 3M81A 4CF6A 1BAPA 2BE9A 2KI5A 3RAGA 4TROA 1LF0A 3UJPA 5BUZA 4P0TA 1BFUA 4YYEA 4H15A 1T29A 3THSA 2YQZA 3GMSA 3AZPA 3QFCA 1NMZA 2ZRIA 4C0AC 5F4BA 4L3OA 4D99A 1FFSA 4B4DA 5GJVC 4NR0A 4OOEA 4V0LA 2OGWA 5IZCC 1PJBA 1RCUA 3G02A 2BBTA 4Z7JA 3BXPA 4QFDA 4QARA 1II9A 3IHTA 4K26A 4RH1A 5ALTA 1QH1A 3PKZA 4M8IA 1P4JA 4N3AA 2QW8A 1T4BA 2WHEA 4NJOA 4L4SA 4ROTA 4V3CA 4QM7A 1EJ0A 1YIAA 2RGAA 4MV9A 1CUGA 1Y89A 2A1UB 3V34A 1E20A 3PJRA 1XFDA 1YB7A 2A9QA 1TAHA 3UTDA 1QDLB 4QWMA 4ZYZA 4BVEA 1M1YB 4FWTA 2XB2A 1U2EA 4Y1EA 1PX2A 1Q6YA 4DA6A 1AN0A 3SZ3A 4R7TA 5J4YA 1YC5A 2AG8A 2WYOA 3V8EA 1OTHA 5HVNA 1ZI6A 3IR6A 5AXCA 2PBFA 3HEMA 1PD0A 4OHXA 3PRJA 4HMPA 1X19A 2O06A 2C1ZA 2OXFA 2J1LA 1RRCA 2UXBB 4TQ9A 2VJYA 4KXUA 3ETCA 5AHOA 3LDFA 4TV8B 4U2CA 1TMKA 3QSGA 2Q6OA 3OFVA 4EA9A 1O6FA 1O1YA 2VP9A 4H60A 2C0CA 2ZYAA 1K7YA 1T43A 1TJPB 5K45A 2DFKB 4MH0R 3NAGA 2PBRA 3B85A 3YASA 3C2QA 4GMKA 4RAQA 1WUIS 1RC0A 1E0JA 4C08A 2PD3A 2JGLA 1P39A 1ZMBA 1WBDA 4MRRA 3TB6A 1JJAA 2E6UX 2JJ2A 4JX8A 1GEEA 3FDZA 4AMYA 1Z0KA 2B8NA 1W0JA 1Y34E 2FLKA 1CJKC 3EDYA 4LISA 2FJ0A 2VHJA 5HEKA 1Y4DE 4KMMA 4AWXA 3FG9A 4H6VA 2MYPA 4ID9A 5L3QA 3N8HA 3SS7X 4M1SA 2DCUA 4Z0NA 2CMFA 1XBTA 2JNWA 3THOA 1YONA 3VVMA 2PWAA 4Y6PA 5FEUA 5CVUA 1N6KA 5DLDA 2Q2WA 3TSAA 2FW9A 4NP6A 3DQQA 4Q19A 3F74A 3HU2A 3I30X 3ON5A 2YYZA 1PS8A 4IMPA 3ESDA 4WK2B 4CL8A 3D3JA 1O54A 3LLMA 1DX6A 5DBEX 3WIBA 1YBAA 3MYRA 4L9SA 2O0KA 3C3BA 4KXVA 3EGOA 2PSFA 1SWVA 4DCNA 1ZUNA 5T6MA 4YUYA 3P5BA 3PEVA 2NXWA 2PZEA 5FTJA 5JVDA 3N2IA 4ZVPA 3T5MA 3EIWA 1NAIA 5EP2A 5A3JA 4DLNA 4TRRA 5JAOA 2OV2A 3GJZA 3P52A 3FIJA 4YRLA 1XZLA 1HYHA 1CS4C 4NMHA 1KETA 3I39X 3TPZA 1CV2A 2VJMB 1QIMA 2BGKA 2WD7A 1UM8A 4EEKA 2QTBA 1K6MA 1KDOA 2C4WA 1G55A 4BVKA 1NW5A 4Z3DA 4YDQA 3AVXA 3JS5A 4DQVA 2FOLA 1UMBA 2IW3A 3RFUA 1ZIYA 3EYAA 2IYWA 4X94A 2FU5C 2WAMA 3TXYA 4C43A 3B1ZA 1CZKA 3F6PA 2DFVA 4R5HA 4HDQB 2WUGA 3NDBB 1C0KA 2PYZA 3HMKA 1XD2B 2LW7A 2XUGA 3E5RA 3IE0A 3CLVA 2FGJA 3PU6A 5FOUA 4LE0A 3SE7A 2YV4A 2N75A 1J49A 1R50A 2G77B 4YR9A 4UHCA 3A1WA 3UMGA 3FNQA 1EFHA 4G5YA 1J2UA 3COWA 4WY8A 4EJSB 1FY2A 4XFKA 3EY9A 5IYZF 4V2IA 5MDHA 1Y6FA 1AE1A 1SFRA 2F59A 3H1BA 3F1KA 1O96B 4IIJF 4R31A 1SNYA 5ES3A 2IV3A 1AB5A 1JIQA 2ZBQA 3FYSA 4KFSA 5DGCA 4ER3A 2ZTLA 5K2MA 2Z6QA 3H0KA 1RYYA 1SOVA 1UAYA 4HEQA 1BMDA 1C9DB 4TPKA 1H66A 1RBYA 3ZV3A 5JPDA 1BG6A 1SCQA 2FPMA 2HBQA 4J6FA 2EW8A 3CH7A 2O1SA 2QNRA 2Z3ZA 5D3KA 1EINA 2C5LA 5LBUA 1I4TD 2IGTA 3ENQA 2W70A 5KAMA 1XVLA 4MS1B 5JWOA 4BMPB 2GD1O 5FL7A 1HUQA 3TZ6A 4J07A 4KQHA 2PUFA 1TPYA 1B0ZA 1KI3A 1U7OA 2J48A 3ZE6A 4RTQA 4GDFA 4GI5A 4GRIA 2X3FA 3QE4A 4G1VA 4QL3A 5BSUA 1FYVA 3BQMB 3STVA 4RVUA 3PT9A 3VR2A 1SC1A 2HU2A 3NHWA 3QIAA 4NU8X 1ES9A 2BFFB 4INPA 3MT9A 3AY0A 4OHKA 1FQJA 2YWXA 1V8DA 3T3NA 2BFMA 4KWIA 3LRPA 3H5TA 5HNKA 3N28A 3LPLA 2C29D 3WKEA 4ENRA 1EXNA 4C4ZA 4IIDA 3WRXC 5HRAA 2JGFA 1JQJC 3MEQA 1UDBA 3FPBA 3P96A 5B3JC 1H1LA 1LWNA 1NF3A 2E1PA 2ZTMA 4KQEA 3JASA 3LCUA 1SIBE 3BB3A 2JL1A 4E08A 4LOJA 4Z1OA 4KO2S 4LCJA 4PQFA 4CRWB 3LOQA 1GTG1 1QIJA 3HJFA 2ROQA 1HE3A 1I36A 2AQKA 1J06A 2C4TA 5LZ5A 1XRNA 2ZYHA 1Z4LA 5TF0A 1KA9H 5E6RB 2VJCA 3FUVA 1OE0A 3BGSA 4YX9A 4FS8A 2I78A 3E23A 1SO8A 3DEKA 4ZT2A 5EMNA 1WULS 1YU6A 4GPTA 3ZHOA 1AXGA 4CGZA 2QJOA 3LWZA 4QFMA 4TS9A 3S81A 1IUKA 1LVGA 3LUFA 3WMEA 4CLDA 4CR6A 2I7CA 4RIFA 3SKVA 1DWOA 3LBNA 3RV3A 2JFPA 3JAWA 1CLUA 2VDKB 4LNUA 3PNQA 3JSAA 3OY2A 1AKVA 2N46A 4JJGA 1VKZA 1AO0A 4BCDA 1XL0A 3R7WA 2G7MC 4C01A 3RI3A 1N77A 3IUSA 1KERA 4ZYUA 1YR1A 5B1SA 4CM8B 3CRW1 2W98A 3NUZA 5HS6A 3F47A 5BUQA 1ND5A 2QTNA 5FPHA 2BJWA 1C3XA 3U4MA 2EATA 3V9PA 1B3BA 2EJBA 2OSVA 2Z2JA 3FPAA 2AQ8A 4BKPA 3I2JA 3GLGB 3GUCA 2HF7A 2IVZA 2ODEA 2CB0A 4PHFA 2UVQA 4JSYA 2GCOB 1V26A 1G6Q1 4R1NA 2R68A 2CNKA 4G0YA 2AFRA 4LJ9A 4NDZA 4LWZA 3TN7A 3SQWA 4DCUA 1RLUA 1ZJ5A 3EXHB 3AUKA 1HDYA 2IBSA 5DCYA 4WTOA 5DNAA 1K7EB 4CTJA 2R5FA 5IYZB 2XF8A 1CR6A 1IPHA 4IIJB 3B38A 5I7EA 3ANSA 1EX7A 5L3SA 4DIKA 1R8YA 1P1IA 1PEYA 2Q0HA 4LQCA 3VNRA 4HTFB 3E0XA 3DEZA 3RIEA 1S2IA 4WXHA 4MPPA 2GBLC 4UFNA 2BKAA 5T8KC 4ZICA 1DVRA 5CT4A 4YTEA 1ODKA 1OX4B 1PNTA 3K20A 4LHXA 5DBHX 1JQKA 5K0GA 3SZGA 3HNRA 2OR3A 2DETA 4EP1A 3BWEA 3F5DA 1OH8A 1NI3A 5IC5A 3W6NA 1G64A 3KQNA 2BL4A 2G1AA 4MW1A 2C3YA 3FLMA 2IU0A 2AXNA 1Q1NA 3UT5B 4ANFA 4AY6A 2XCLA 4BX0A 2XMSA 2HRZA 3AT1A 1J7KA 2D00A 3WOVA 4YPVA 1VBKA 3QBEA 4ZWNA 1UH5A 3RABA 3V1TC 4BVGA 1P0CA 2H1CA 4XEUA 1Y0BA 2PMEA 3T61A 5K2OA 3FGOA 3TMYA 1AHNA 3CZQA 1ODIA 3FBWA 2AVNA 3MTDA 2ETVA 3DXZA 2BFBB 1XVVA 2DLDA 1G18A 4HUTA 3CVWA 4OQEA 3SZOA 3T9BA 3PXXA 4QTYA 4OI2A 3MIZA 3FDIA 1C30B 3QFFA 5B4VA 4BWFB 3QY0A 2N1MA 4GPD1 4DR7B 5JSFA 5C8VA 2QYOA 3TW6A 2RK6A 3B1XA 3E8MA 5BN1A 2HRQA 1E2UA 2AOWA 4RK5A 2ENWA 4CDRA 3BQ9A 4E51A 3AF5A 4CQJA 4H2DA 5KNBD 4DMGA 1VBNA 4O4HF 2H7CA 2YV1A 3N59A 3RBXA 3T0FA 2OM6A 1I2BA 5C5IA 2WUEA 2EKQA 3GFPA 2JVIA 4QPDA 1KTIA 3V00A 4QICA 1ZKDA 1GUBA 3I01M 4GPZA 4RENA 4WPGA 3HEBA 3VH1A 3B5IA 5I7OA 2Y3IA 3BXGA 3HQ4O 1EX6A 4FFBA 3TZKA 3UT6A 3CE6A 1P9LA 2ACWA 2O0HA 1EWRA 2OUKA 2FN7A 5AW1A 1HLPA 1KZ6A 2NM0A 3GNQA 4LQLA 3TFOA 3U40A 4A6PA 4UE2A 3A6DA 1N2EA 2GFIA 4FKZA 5DHFA 3ICPA 4ZOLA 2OCKA 3CF4G 3BFXA 2FZWA 3L6DA 3EX7C 3QSYA 2VR1A 2GOYA 1GPKA 2J3DA 3CHYA 1IZYA 1U2GC 3EZLA 3IMKA 1CS0A 2J0UB 3ISJA 1HG0A 4H08A 5CFMA 1JECA 1LI5A 1OIXA 5IAKA 3EAGA 3REQB 3TWOA 4KXMA 4G5OA 4GAEA 3U49A 3PWSA 2XUQA 5K3AA 3K70D 3OZVA 5AVXA 1DINA 2XZLA 1H85A 5C7LO 2RHWA 3AM5A 2A5LA 2GBIA 2C54A 2VNSA 1CKEA 4Y7DA 3C3PA 1YBVA 2HIHA 1KO4A 4RF2A 5K20A 3IP8A 3QNWA 3A6JA 4TN1A 3RASA 1H94A 3WTBA 2J41A 2IRWA 3NPMA 4B35A 3JYHA 3AKCA 1GA6A 2VFAA 3EEYA 3NHFA 1Y1TA 4AKTA 3PHJA 4Q47A 1FDTA 2PRYA 1T2NA 3FNGA 1WOMA 4HFRA 4II3A 3UPTA 3K0SA 1HO3A 3QYAA 2FSVA 3OKFA 3QLJA 1CX9B 1KZHA 3MTAA 1HFWA 2MINA 4IO1A 4ZT4A 1ISGA 1SUSA 3L4JA 2DTXA 1W75A 5GY7A 5JS2A 4LHSA 3TIVA 5AKZA 5AI5A 4UU1A 3RKRA 3IKLA 2QJRA 5CDSA 4GP6A 1NIJA 4WK0B 3P9QA 5LZ2A 2ZYDA 2OORA 4UAUA 3USZA 3W78A 2Q1WA 2GCNA 2P5UA 1DMRA 4GLOA 4DR6B 3I73A 5GVRA 3BRQA 4L5AA 2J7KA 3ZXXA 4C0XA 3ZHXA 2YW9A 3FOZA 1B00A 5CH8A 1C9NA 4ND8B 2J32A 4J03A 1Z8HA 4OJQA 4KRYA 3ROZA 2JEOA 2ZJ7A 4CUJA 1CY4A 2VP0A 2FJUA 2JGAA 4JJ7A 2RONA 5AMXA 4ITVA 4N0EA 4TMTA 2W6IA 1NYQA 3GEEA 4C76A 1VJRA 3BH0A 1S2LA 2BWJA 4N03A 2FH5B 4NQZA 4E5MA 2JAWA 1GG2A 2XMZA 4JYBA 3SR4A 5I4IA 4JI2B 4DPLA 2H51A 1JYEA 1QHIA 4WNYA 2YIVX 2H2IA 2GN4A 1YWGO 2PANA 3KKZA 2ZB2A 4L2IA 1XRLA 4N49A 4COKA 1O89A 4GC5A 4HFMA 1SXJC 1XZPA 1OFVA 4E6PA 4GLLA 4GL2A 4O4HB 4LHZA 3GJSA 1NYLA 3ZBUA 3TDMA 4MJLA 3C7DB 3WJAA 1HOXA 2GYYA 3FPGA 3FYCA 4IG4A 1SOAA 5G0WA 4C2AA 3C3DA 5HP4A 4OSEA 2IS4A 3I28A 5EQDA 3VHLB 4HLUC 1YVUA 4UQLA 3HTXA 3NUGA 3VU9A 1JQLB 4EGCB 2ZB7A 3WGKA 3ONVA 2AW5A 3UATA 1KVSA 1NVXQ 4DQLA 3WDMA 1P61B 3TKLA 5JI2E 2H07A 2VP2A 4YALA 2YINC 1RNLA 1P1JA 5LNK6 2X13A 1XZHA 1KBOA 2NTNA 5TMEA 3NB0A 2AMYA 3IEPA 2CLFB 1VQ1A 3FR8A 2W6OA 3LM8A 4P5DA 4R84A 1T5IA 2DHRA 1T6YA 4NAHA 2QRVA 4M7WA 1QIGA 2XR1A 3L6CA 1E3WB 1A5TA 3OQVA 4I50F 4MAMA 1XZBA 4Q6BA 5HFAA 2UVPB 1QOQB 1UEXC 1QQ7A 4IIYA 5AJWA 3ASVA 1QH0A 4L8GA 3LIIA 5D1HA 1JHPA 3BHIA 3KQWA 3S2YA 3TSYA 1T8PA 2XE4A 4PSCA 4P3PA 3UV7A 1SKAA 1NXQA 4KH1A 1DQYA 2XT6A 1GRRA 2NV2B 4L7QA 1JV2B 1T5BA 2GILA 3FTCA 3Q85A 4UEWA 3PL5A 4UKDA 1H9BA 1I5EA 3SNHA 4ED9A 1PUXA 4PWYA 4O4LA 4OQDA 1ISFA 2OEPA 5F51A 4AROA 3EDOA 3OESA 5CG1A 2Q3EA 3GRFA 5C7YA 1WBBA 4KR7A 1J2EA 2IXDA 5H9WA 5JZ9A 4MHSA 2Q1SA 5G02A 4I5GA 1V6AA 4KLAA 2Y05A 2CW5A 3K9LA 1OF1A 3TZLA 4C03A 1TMYA 1DRWA 5EJGA 1L6RA 2QYTA 4M1MA 2YJ5A 1X80A 1GJRA 4PAWA 3KR1A 3BE8A 1MW8X 1JG2A 1NMXA 1W8DA 4XQEA 4LOKA 3BMCA 3V1YA 1N34B 2PRSA 3R2JA 1DIGA 4Z7OB 2PZMA 3ICOA 4G67A 4LMPA 3BSSA 1VI5A 4QXOA 1BVRA 2H29A 1VCHA 5IHPA 4O8CA 4S1PA 3K8QA 2O8CA 3KTFA 2QL6A 1SRQA 5LIPA 3OG9A 3H8WA 4IF6A 3EGEA 5HIIA 1VG9B 1JB1A 1GRQA 3DMRA 2FQXA 3DM9B 1I2DA 4HPWA 2QVGA 4M54A 1JLKA 5H4HA 4AIRA 1KK0A 4NQRA 4U3JB 5AK3A 1IQ0A 2P9EA 3DTTA 3OZAA 3K09C 2JKVA 3B1JA 4F91B 4A0FA 4UEQA 3KTOA 3N6VA 4KVZA 4RS4A 1U1CA 2CC2A 1ONBA 3GFGA 3HVKA 3E9QA 2VCYA 3JD4A 4L3VA 1Q2UA 2MYUA 3CS3A 3FDFA 5HDBB 4CM3A 1NMQA 2WP8J 3NAMA 4JD5A 4AKGA 1DKQA 2CY0A 4JT8A 5DOZA 4HAIA 2B83A 4BVHA 5IJ0B 1XRPA 3M5WA 4W5NA 3Q8XB 2HDHA 2ON6A 4WWHA 5AO9A 5LB2A 4D46A 1PZXA 2MT9A 4HNVA 5L45A 2WHPB 3MUEA 1XZCA 4BAZA 3F6SA 3BG5A 3P0EA 3DMDA 2AA3A 4HHEA 3SFVA 2TYSB 5TLSA 1GAQA 5J58A 3T41A 2G5TA 3F8TA 2GSDA 3ITNA 4Q3LA 2FP4B 2OUIA 2GUGA 3BC1A 3IUQA 3K1ZA 4I9GA 3CTPA 3PDHA 4RL4A 3BMOA 4L4XA 3RUPA 1EFVA 4BCBA 1ENPA 3TAHA 3A27A 3IAS6 3O8OB 4TVBA 4D0SA 1U9YA 2VSQA 2D5LA 2I3AA 4KVAA 2EFHB 2H2WA 3C70A 2HU7A 3CRQA 3NBUA 1ZW6A 2EV9A 4PRLA 3RU9A 5F9HA 2P6UA 3ZGVA 4HVCA 2JBHA 4FHFA 2W5UA 5HZMA 2PX6A 3TIGA 2ZIFA 5BSHA 3DPUA 5CIQA 4KHZA 4B76A 3TOVA 2PAFA 3SQOA 3KRTA 1SUDA 4JJEA 4NH0A 4M9UA 1WCV1 3UYKA 5EKUA 1C0PA 4FEGA 1WKCA 2QRMA 5ALLA 3TLKA 2AN5A 4X0EA 1EQUA 3HN7A 4ZT5A 1LZKA 5I9LA 4YP0A 2IHYA 4OHWA 3NQ41 1T2FA 5BMVA 5FV4A 4MWEA 5B3LA 4WACA 5JZBA 3AFHA 3D54D 5LOVB 5EAIA 3IQIX 2GTPA 3MRTA 1Q12A 2ZBGA 4LZLA 4BQPA 2WNSA 5DN6A 4IJUA 1PLJA 1FP2A 2BZ1A 1ADYA 1DX9A 2QVLA 3IQEA 3KWJA 2A1TR 4EF4A 1ZBDA 4JUFA 3D8BA 4ZQHA 4B3SB 3VR5D 3LX8A 4ND7A 1ZZGA 3W7BA 1IPFA 1QFJA 2RH8A 3NDIA 1JR3D 5C37A 5BSTA 5EZQA 1PR6A 4X1KB 3R5HA 4EAAA 2JJ1D 2W71A 2R65A 1D6JA 4GZ5A 3KSBC 3ND7A 1OZAA 1TZKA 3I0ZA 3QV2A 2P69A 3I3SR 4BVJA 1R6TA 4GBMA 1K63A 2HLPA 4AY4A 1AZWA 2XKJE 3QPBA 1UXHA 3WL4A 3D2LA 3QU4A 3W04A 1Y9ZA 2OBYA 3ZX4A 4DB2A 4UNIA 1T0PA 1KU0A 1EP2B 1M2VA 3ETGA 3HCRA 1XLTC 1SKMA 2H5LA 1M73E 2AG0A 1NVAA 4IEIA 4QREA 4DV3B 1EEHA 3KQOA 3NP7A 3OOHA 1QGUA 2CNNA 4MKFA 3COSA 3OKAA 2XQIA 4R54A 5DSZA 2WSIA 4W5JA 2NPOA 3HADA 3HZRA 4LKOA 3TM5A 2ZRLA 3CKMA 3N8DA 3URMA 3V4ZA 6GPBA 1FMLA 1MGPA 3ABOB 5CMLA 1C3EA 5IKEA 2Q4OA 1ZD4A 4YMIA 3OEWA 3IT2A 2CFIA 2VTKA 1PG5A 2Y4OA 4LGMA 4LJYA 3RFTA 4BO9A 4YT8A 3HUFA 5BW4A 3PQ8A 4I4TF 4MWZA 1PT8A 1X1SA 4EO9A 5CB8A 1EFRD 2WF8A 4AX4A 5C1PA 2OVFA 5DRTA 3ZDRA 5FKJA 1JKIA 1KBZA 2YWGA 5KTPA 4BQQA 4KL8S 2P6MA 1BS2A 3MCVA 5FHRA 1MO5A 4B45A 2L19A 2Z5GA 2B30A 3HWSA 1E2JA 4LJKA 3QUBA 2CLSA 2D7CA 3HI6A 5ERXA 2I55A 4EW1A 6NULA 1ID1A 1R4NA 2AIRA 1X1TA 3WSWA 4RPHA 2PMDA 3AEZA 4QBGB 1NJ1A 3LWBA 5AJVB 5HA5A 1G20E 1QO0A 4KI7A 5KO2A 3QMVA 3I34X 3EGWA 2F55A 3ZTWA 3QU9A 4V0SA 2VJDA 2GBPA 4PQYA 2V9CA 4U1RA 2ESRA 4BZZA 1SHLA 2FSHA 4JYPA 5KYWB 1JXOA 3U7QB 3NT5A 4JXXA 2QMEA 4NV1A 5KTRA 1KQPA 4BNMA 2I6UA 3ZHRA 3NCTA 3ESQA 2A4KA 4IM7A 3DDCA 1CHNA 4PLVA 1VJGA 1X9IA 5EVJA 5TVGA 1L2TA 4EFLA 3LJKA 5EJ6A 1BDIA 2R5NA 4Q6WA 3EFBA 1Z5VA 4EG1A 3JRXA 2ET6A 4TSFA 4DFDA 5BOSA 5CT9A 3UMFA 3Q72A 1WPRA 4CE6A 2A9OA 3PUIA 1TA9A 1QLJA 3K32A 3QLEA 4JJ8A 3W9UA 2NZWA 1OWMA 1O9HA 1U3VA 2F2TA 3T94A 3W4KA 4UE6A 3WIDA 3GMTA 1R1DA 4RJJA 3NBZC 2ZS8A 1G3IA 5HTKA 5JNUA 1QZXA 1YBHA 3L93A 3H5RA 1EUQA 3V55A 4ID3A 4Q1BA 4E2FA 1XTPA 1CEQA 1LDNA 2Q1XA 2WNHA 1ZPDA 3JQRA 1V5EA 4JI3B 4C6HA 4CF7A 3T9CA 5SZJA 2GETA 1D8AA 5JXGA 1HE4A 3WYGA 1FDIA 2MMCA 3N7UA 4YUAA 2HWKA 1OXBB 4O0MA 4BGVA 3TUJC 3F3KA 3L7BA 3UG7A 1NULA 2VA9A 1O0CA 1KOGA 3NM5A 1YO6A 4MV5A 3R1IA 2Q1TA 1R5BA 1DKMA 5D3MB 1Z26A 2YHBA 3H7AA 3O1JC 4I4LA 1RWXA 3OJLA 3GEGA 1FNSA 1NFQA 1JXQA 4NFHA 3UWSA 1HSZA 3T4XA 4K1LA 1I4OA 3RSSA 3VO2A 3ZHZA 1I1QB 5I8PA 4F3KA 2AN3A 1JI0A 4HQ6A 4CDMA 1COWD 1EFPA 2RGWA 2QGNA 4QUHA 3PNPA 4DZRA 3SJ7A 1PQ4A 1N6IA 4JIGA 1DEHA 1ZOOA 1WETA 1PEDA 1USIA 3GELA 3ISVA 4ZO9A 1VB5A 4PYJA 1Y8AA 2N1BA 3DV2A 1PNRA 2P41A 4EPWA 2J0QA 2VAXA 4S1TA 4Q1FA 3PJEA 3JQEA 2QI9C 4Q1CA 1GTVA 1EEXB 1I4DD 2SKEA 1EPUA 3E58A 3A1FA 3K1JA 5KYXA 4JNGA 3CSUA 3L8EA 2H9YA 2EX1A 2IX9A 1IY8A 4BE9A 2O59A 3TOCA 2AOUB 1M7GA 2XWBF 3IIMA 2QS9A 3ORQA 1GT91 4Q1DA 2CVQA 4DA7A 2DUUA 3KG2A 4EY3A 1FFBA 1QSGA 2EFEB 4K0RA 4WGGA 4A73A 5ADHA 1QG2A 1RLOA 2HI0A 1KZ7B 1RJ9A 1RRGA 4U02A 4J91A 4XSVA 3SIWA 4A1FA 3ZVMA 3HABA 4AJ1A 1V11A 1NZFA 1IHPA 3MJFA 1B73A 1DBWA 4HLNA 4XIIA 1Z75A 4LRWA 4RTLA 3H4IA 4I14A 3L0CA 4O1MA 3KJHA 4CXMA 4ND3A 2AXPA 3B82A 1P2DA 5CYGA 5DZSA 1EESA 1OYOA 3E6AA 2Y27A 3R5XA 1ISPA 4HQ0A 4IKOA 4TSRA 2ZYTX 1NURA 4IEFB 2IHZA 1FU4A 3ZD7A 4WCDA 2QBYB 4Q4HA 5DGIA 3F5FA 5JATA 5KJFA 1UM9B 4QU8A 3OECA 4IOLA 4UVGA 5IDVA 3ZE9A 3AR8A 4CKYA 2ZI3A 8GPBA 5IDXA 2YS7A 3DEAA 4UDOA 5CR9A 1AIPA 1BD4A 3E9ZA 1T0UA 2QAIA 1E5LA 2R8EA 3P9NA 1AS3A 2RG1A 2G28A 1VXOA 1ULAA 2SKCA 2IUUA 1IQRA 1FMFA 3PA6A 1WDWB 3F46A 3OF5A 4BU0A 4N6NA 3V1UA 3QGMA 1WSBA 4X45A 4UZSA 2WHYA 2FF5A 2HF9A 2NQ8A 1LV8A 1RDFA 3WV4A 5LLTA 4YRAA 3F5MA 4YQEA 3ZXUB 3UB2A 1US8B 1T36A 2E48A 5IP5A 5C8ZA 4BMOB 1F4VA 3KYIB 2R7AA 5AK0A 3KQLA 4UNRA 1WW8A 3PJFA 4NG5A 3TINA 2IH2A 5JVDF 4V0QA 3VDRA 2HHAA 3HVIA 3UMRA 4PLCA 4BLOA 4B0OA 4NABA 5KQLA 2BONA 5A7HA 3BB4A 1WMEA 1GLGA 3GH1A 3L1VA 4KO4S 3RQIA 4ZT3A 3DFIA 1NBHA 4XCVA 1JKXA 3KSUA 3EPKA 1CUUA 3WGJA 3FA2A 2JHAA 1BMTA 3AONB 4BNHA 4D82A 4EHDA 1RWWA 1G3QA 1T4CA 2XXJA 2C4HA 1PNVA 1CUCA 1RC1A 1J9EA 1BX1A 1SUPA 1A97A 3IHKA 4IJWA 3ET5A 1Y6RA 3GAFA 4JNCA 5H16A 4RSGA 1JXAA 1N3BA 1YZVA 3VV2A 4EELA 2W2LA 4FUQA 1J07A 4JLDA 5EJ7A 1B3RA 1Q7TA 1UXJA 3H3JA 4JXJA 5EOVA 3U0BA 2IH5A 2I1WA 2CD7A 3DFFA 4WXPA 3QPWA 5HZHA 2QTGA 3ELDA 4DIFA 4FBLA 2FDXA 1E9SA 1PJZA 1QYDA 1HE2A 3BHNA 4JOCA 2VYVA 5AOVA 1R00A 3H4TA 1QH1B 1V0JA 4EHLA 3OPNA 4I3GA 4RHTA 4I5IA 5HOEA 5ECGC 4IHQA 4L9AA 1EWVA 2NUAA 5EJMA 3JY6A 2IP2A 3BXOA 2M32A 2YZGA 4F56A 2IK8A 4Z4GA 3EH1A 1N6NA 1EVQA 1C7QA 1CR1A 5TS2A 2OAP1 4YCSA 3HB4X 4TXLA 5K5EA 3HDTA 5BURA 1M0TA 3T1OA 1GKIA 2IUSA 1ZFNA 4JLAA 4NIMA 3L8ZA 3EASA 1J6UA 4Z6KA 2ZYVX 2KJQA 1O95D 4KXLA 4QEDA 3UA4A 4FDUA 1V25A 4UNSA 2R8BA 4KR3A 2Q6TA 3R4CA 5AM4A 4ALIA 4C3VA 1K88A 4YP1A 4CG2A 1P9NA 4WINA 3KWMA 1XOIA 2QPAA 2V58A 1LEHA 4ZK6A 5KOJA 2QTVA 4CUKA 4MUYA 2AEEA 3ZE7A 4XYBA 2RK3A 2VRCD 1NHGA 4B2IA 5M34A 3Q12A 2A5DA 3D8UA 1DAGA 4RK1A 5HJ7A 3VKVA 4DQXA 3NAQA 1I3LA 3LXUX 5G4KA 4NG4A 3U44A 2B5WA 4I6JA 4E5UA 1BNCA 3U13A 5T4HA 5NLLA 4MUGA 5H3CA 1KU6A 1YJBA 2GXSA 2N3ZA 2P2YA 3MOGA 4IHJA 1C1DA 4L9RA 1AX9A 4YT5A 3BGOS 1I80A 1NBMD 4IRXA 4IIGA 2CNOA 3MERA 5CW1A 3BK1A 1CQZA 4ZT7A 5L3QB 2DT8A 1HPLA 3DL7A 4OP1A 2C3PA 1C4WA 1N5RA 3DZCA 4JQYA 1F6DA 4L16A 1EFLA 4TRJA 4AC9A 2JLUA 5AKLA 2I76A 1M2OB 4M3NA 3R3XA 1QHEA 5E0KB 2QN2A 3E5HA 1VL1A 3NFRA 3PXAA 5EJFA 1N2XA 2WKQA 1L5LA 3TO5A 3VTAA 2PFKA 2XCUA 4CKCA 1E63A 3ROEA 1XA0A 5B57C 2NVUA 5CDFE 2P8JA 2QAGA 4B6RA 4QXAA 4BXOA 1KSFX 3LPDA 4AUEA 2J0SA 4UU0A 3OQPA 4B2YA 2KHZA 1OROA 3FYUC 1SVKA 1YS4A 4UHFA 4QHTA 1A5SB 3B1VA 4WY2A 1JDUA 721PA 5IN4A 1CJCA 1F2VA 1ZUNB 4W7SA 3ER8A 3DLHA 5JVDB 3UGQA 3DFZA 4IY1A 4AUKA 1E0DA 1LPPA 2Z0MA 4GRDA 3KP1A 1ONPA 3NGXA 1FUUA 2IYOA 5L7TA 1OKKD 2OHXA 3OO1A 2II6A 4O1HA 4E5SA 3M1LA 3S3TA 4Y9DA 4G0MA 5GPBA 2E1RA 4BN5A 2ZJZA 3K1TA 1HYQA 1Z5OA 2FEWB 1AK1A 3MT0A 2WD7B 3A11A 4H6WA 4UAVA 4P34A 4AL4A 4NK5A 1HTWA 1Q77A 4L6AA 3Q3VA 3F73A 4WFJA 1BTOA 1XG5A 2HRDA 2J45A 2JZCA 3LT5A 1SG6A 2ZUUA 3P2OA 1BGVA 3IMEA 4L22A 4US2R 1SXGA 3R7DA 3VKWA 5A2QA 1YKSA 2V54A 3UHPA 4HZUA 1RXCA 1TXGA 1Y8RA 2CEAA 4G5GA 1BWRA 4DQ0A 3NO4A 3V8BA 3UMMA 2B2CA 3DYVA 4DAEA 3ABZA 2ZIXA 4D3YA 3R6WA 3SHFA 1F5SA 3LK7A 5P8WA 3ZCUA 1VC2A 2O8BB 4G6ZA 3EWAA 3MW8A 4M7RA 1E64A 2CUKA 4N0DA 1FDSA 3JWHA 3K0CC 2Y92A 3SHTA 3GD5A 5E1MA 5KSOA 2I71A 3LK6A 1Y5LA 4DSOA 2C78A 1TZBA 4G0PA 2G17A 5ALIA 3GFBA 4HS9A 5JJBA 3WA7A 3QJYA 2JCVA 1RQ2A 1W25A 2VWHA 2PMBA 5I6DA 1ISSA 2OC4A 3P0JA 4D9FA 4CPDA 4EVIA 3G85A 3ZCTA 4ZYYA 221PA 5BSFA 4MW9A 1PT5A 5J4VA 2JEZA 3OM1A 4RTKA 4BASA 1QHFA 4ZK2A 2MCFA 3IKMB 3S29A 3GC6A 4FI3C 5IDYA 5P21A 4FT2A 1YAJA 5IJXA 3ZKWA 2C4UA 2P0YA 4TKUA 4J0QA 1DRJA 2NXEA 1U28C 2GN9A 1U04A 3OE5A 5DX0A 1ST3A 3HP1A 4KSYA 4LWPA 4R68A 4N0PA 1YQQA 5LPNA 3HZHA 4OSPA 4EGJA 3IQZA 1UFQA 2JIZD 1FF9A 2WM8A 3BS4A 2PJDA 4DYHA 2OYRA 2JI6A 2PJZA 1YR8A 2CFCA 4FGLA 2JGMA 2XADA 3GFTA 4GLJA 2AN4A 4ARSA 1WEKA 2VZLA 1H0HA 3DLAA 3P8ZA 2EF1A 1TTQB 5ERGB 4NZNA 5LUBA 4FZVA 1AXEA 5DKFA 5EJEA 3NBFA 2VUUA 3S28A 4NOLA 2AD1A 5AM1A 1ZLXA 4DNPA 2A86A 4EYEA 3NKFA 5JW6A 1P72A 1XKLA 2CVOA 3BKWA 5T41A 3IUJA 1PSWA 4WLNA 4R7GA 4EW2A 5IXSA 1HURA 1E6WA 3T12A 3JASB 4HEHA 1JA9A 4WKCA 2HLDA 5EXEA 3VR6H 2YKGA 3UHAA 4E5VA 4FZ5A 4W1RA 1UBMS 2HMTA 4JBXA 2Q5IA 3JR3A 1UZMA 4GL4A 2DY0A 1DXYA 4F60A 3RH0A 1R0CA 1KGDA 3UXYA 1DO8A 1QQ6A 5C1OA 4F21A 2NU8A 1CF9A 1YB5A 5EJ8A 3URKA 4HRAA 1F6WA 3A32A 2IHKA 3WGHA 1HYBA 4NTZA 4FOSA 4CI9A 4YRCA 4OHZA 3T7AA 1MIHA 2M6SA 2PZGA 3IRUA 2AZTA 4H17A 3N6XA 2BELA 3GYBA 4LV8B 4MV1A 3VOSA 5GJBA 1VZ2A 3CLTC 5HILA 1H65A 3HV2A 5KPJA 2WVHA 2F3PA 1WP4A 3F90A 3JAWB 4LNUB 4BFWA 2VHCA 5A3RA 5FULA 1F60A 2D1QA 3FWKA 4RE5A 3R7WB 2QNBA 3CNHA 2TRSB 3GN1A 3O2QB 3QVXA 3BE4A 2JCSA 2BGLA 3SS8A 3CF2A 2BM0A 1N3LA 3G8YA 1UJ5A 1L5KA 4Y18A 4DARA 5I7SA 1I7SB 2AYXA 5AW0A 3CH4B 3Q9UA 1V5WA 1NKTA 4HGYA 4D4MA 1L1RA 1U1DA 1WD5A 5D6NA 3SX4A 4F4IA 4JP3A 3AK4A 5IT9A 4MQ4A 2EHJA 5DT9A 2VQEB 2WYWA 2C57A 3V2GA 1HRDA 3CURA 4TVKA 4PO1A 3J81A 2YXLA 2HTFA 2XTMA 1IU9A 1HGXA 3FPSA 3UHJA 1L7NA 1F2UA 3WZ2A 1Q0TA 4RQBA 1G1AA 1H9AA 2HR1A 1L7EA 3RC9A 4EX7A 1B41A 1D7AA 1DEAA 1EHIA 2SNIE 1XZMA 2BEKA 1RJDA 1X7DA 4UCQA 3V1MA 3H5AA 1DC3A 4LXUA 3X1DA 2O5EA 3PZBA 5L3SB 3M83A 2O2JA 5JO0A 5LYYA 4YY3B 3KWFA 1WV1A 2NPFA 3WLIA 5IT4A 1NG9A 3U09A 1GG5A 1UBLS 1FDOA 2J31A 4PAQA 1E0KA 4I1RA 2IHUA 5JDCC 4DNXA 2G80A 3F3MA 4GG1A 3FOCA 4J6EA 3QVGA 4NPAA 1N5JA 5FV7A 4P6VF 1LRKA 3LUDA 2IYEA 3ZJ5A 4P3KA 2Y0PA 3L05A 5AKHA 4RZIA 4UBJA 3ZXSA 3D64A 5JH7A 1GTL1 3HXMA 4KDFA 5EZ6B 3TSOA 5DHQA 3I05A 4BLPA 1C0EA 2XQJA 4ZCSA 1XP8A 2IY9A 3FRJA 4M9CA 3E1GA 4X9XA 3IUPA 1MJFA 1AQUA 4BPRA 2NSHA 4C89A 4CCSA 2ODAA 4D4IA 2XECA 4BKRA 1XNJA 2FPSA 2CXNA 4ECAA 4TZKA 1C3LA 1DQRA 2Z30A 1GPMA 1VMKA 3DOHA 3OLXA 1VGRA 4ZKEA 1U2DA 4OQYA 3VVBA 1FS5A 7ADHA 5KJCA 1W36D 3GCDA 2KS6A 3I2HA 4CT0A 1I6LA 3ORFA 1SC4A 2QPLA 3H5WA 4OM8A 5LKAA 1XMOB 4BHTA 2BH9A 3HB5X 5I7WA 1NVMB 4AN0A 2QMZA 2FW6A 2EYQA 3RRYA 1CIJA 3F9IA 3PYMA 4B83A 4DGQA 3FUXA 4PNPA 1GARA 4R16A 1ZP6A 3AHFA 3ONDA 3CU5A 3I32A 4HS4A 2OHOA 5CEFA 1XRJA 1C8BA 1D2RA 4QDUA 1ODJA 5E9WA 2V7VA 1RI5A 1XQWA 3GDGA 3VC7A 1HE8B 1NVEA 1L4KA 1T26A 4EZIA 3JX9A 4JIMA 3B1KA 3AFNA 1GFWA 3HKCB 2Z9CA 4L1KA 5E4JA 3SYTA 5DNYB 4FB4A 4FFBB 3ESRA 2G06A 2CUZA 4G1CA 3MBOA 3ZD8A 2HZBA 3OOSA 2XMRA 4WEQA 1J0XO 5DJ5A 3H4MA 4X44A 4C0BA 3H5IA 4C3ZA 2F1OA 3KZXA 1Y98A 2V7QA 1Z5PA 3I5AA 4I7EA 5JDIC 2A1TS 1IN8A 5KNDH 1U02A 2RIPA 3ZLTA 4ZQBA 4ZOLB 4NCNA 3D0KA 1SKUA 4TXNA 5T67A 2DPGA 1OXUA 2Q9UA 3FLAA 4XOUA 3GHYA 3FTQA 1H8HD