2GGSA

Crystal structure of hypothetical dtdp-4-dehydrorhamnose reductase from sulfolobus tokodaii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
MRTLITGASGQLGIELSRLLSERHEVIKVYNSSEIQGGYKLDLTDFPRLEDFIIKKRPDVIINAAAMTDVDKCEIEKEKAYKINAEAVRHIVRAGKVIDSYIVHISTDYVFDGEKGNYKEEDIPNPINYYGLSKLLGETFALQDDSLIIRTSGIFRNKGFPIYVYKTLKEGKTVFAFKGYYSPISARKLASAILELLELRKTGIIHVAGERISRFELALKIKEKFNLPGEVKEVDEVRGWIAKRPYDSSLDSSRARKILSTDFYTLDLDGMVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of hypothetical dTDP-4-dehydrorhamnose reductase from sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Oxidoreductase
molecule keywords 273aa long hypothetical dTDP-4-dehydrorhamnose reductase
total genus 95
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ggsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2ggsA02
4Q39A 4QX6A 4MKXA 1AUPA 4BO5A 1RYDA 2P9GA 3PHJA 1UZNA 3C7AA 1Q2XA 1EVZA 4FIZA 4EYEA 3VTFA 2HO5A 4D3SA 3OETA 5AQ1A 2QIOA 2AQHA 1BW9B 1NR1A 4GKBA 1HDOA 3ZHBA 3AUAA 5LCXA 2NNLD 3GUYA 5TQVA 4E4YA 4ALJA 3D5QA 2JCVA 2FZWA 1LDGA 1EUDA 4CMGA 2JFHA 1C0KA 4BIIA 2P9EA 3IAHA 4E2WA 2VZ9A 5DOZA 5IXYA 3GVXA 3PZBA 5EESA 4AJJA 1WWKA 2VYVA 4II3A 4L4SA 5L7TA 5TGDA 1YO6A 1M66A 3COSA 5CEEA 5EPOA 1MFPA 1PZFA 4CUKA 2HQ1A 2YFHA 1W8DA 3OJFA 2YV2A 3TZHA 1LSJA 1HDYA 3C8MA 1Y8RB 3PJFA 4TZKA 2FOIA 3JYPA 3TOZA 3GN2A 2I6TA 2NSDA 3UHAA 3GGOA 2VNAA 1Y6JA 4EJMA 1FDSA 4N5NA 3ZWAA 3ST7A 4FB5A 1T4BA 1WZIA 4GQAA 4WEOA 4Z0HO 2E37A 3AU8A 4IY1A 4K6CA 4TKMA 1K6JA 3Q11A 3KO8A 1D1TA 2O50A 2HKIA 2VT2A 8LDHA 1MV8A 4BS9A 1VKNA 4WKGA 4B7UA 4B3HA 2GN4A 1ZK3A 4ZD6A 1AGNA 2VCYA 3GLQA 4AJKA 5TJHA 3L6OO 3IIEA 3WYCA 4G5HA 4AJLA 1X7HA 4NFSA 3BTVA 3NTOA 3EW7A 2DBQA 4H15A 5COQA 1J49A 1DIHA 3GFBA 4WASA 2C29D 1HYHA 3GDGA 3AI3A 3VH3A 1K3TA 4Z0PA 1NWHA 2WTBA 3JCZA 4MP3A 4P8RA 3EZYA 4JROA 2W2KB 4MOWA 1E77A 1ZKMA 3T7EA 4R01A 5A03A 1JWBB 1LSUA 2H63A 1F14A 4UUPA 4R1NA 3IJPA 1YKFA 4HNGA 4DXHA 3I4FA 3HFSA 3WWYA 1C1DA 1YB1A 4WLOA 2NTNA 1P1KA 5JBIA 4NBTA 4XRGA 2OFPA 3AFMA 4GWKA 2PGDA 3OIGA 5G4LA 2J5RA 2C5AA 3H4VA 2VT3A 3DHEA 3HN7A 3L07A 3NRCA 5A3JA 1BXGA 4QSMA 2NTJA 3AUTA 3OQ6A 2G17A 5EN4A 1ISFA 1T1RA 3I23A 2IODA 1KVQA 5K0ZA 2ZCUA 1V3TA 4MJLA 4K9DA 4CUJA 5JDCA 1TEHA 3L0DA 2QHXA 2ZB4A 1GV0A 3I9MA 4OIMA 1V0JA 1YQGA 3RIHA 2OUIA 1P44A 4GLOA 2R2GA 1Q0HA 3MWDB 4B7XA 2C07A 5FF9A 5FI5A 3SLGA 2GR9A 2VOEA 2ZCVA 2JKVA 4BNKA 3PQEA 1QRRA 4BKPA 4CMEA 3ROPA 3FD8A 3GNTA 1YDWA 3U4IA 3GRPA 5JYDA 1ZSNA 4GX0A 2FPGA 4QEDA 1M75A 1UDCA 2BGMA 3WOHA 1E5LA 1ZJZA 3O8QB 2I3AA 3L9WA 1E1LA 1UP4A 4UVIA 5KJ6A 4KUEA 4YJFB 3JTMA 2J3JA 4C7KA 3KXDA 1F8FA 2AXQA 2W90A 5AXAA 5I7EA 5DBFA 4L0QA 1ZEJA 1H6AA 2O4CA 1SMKA 1EMDA 3HE3A 3TFOA 1WW8A 4NIMA 2D3TA 3H6KA 1HYGA 5T64A 2Y68A 3WDSA 1X0VA 1SBYA 3IKTA 3F46A 1JN0A 1SB9A 1XELA 2Q99A 3ZNNA 2ZQYA 1FMCA 1HSZA 3G49A 3KZVA 1VJ1A 5MDHA 3ENNA 2D8AA 3FBTA 3GDFA 3QLJA 1F17A 4UVHA 4YT5A 3LLSA 1UXKA 2NQTA 4JN6B 3LDHA 5G4KB 2GRAA 1PWXA 4W7HA 1MLDA 1UDAA 3M6IA 3OJOA 1U28A 4L73A 4DL9A 4DWVA 1KEUA 2HRBA 1P31A 3DFUA 5DOVA 3UAGA 3GVIA 3PGJA 1SC6A 4F6CA 4MVJI 3QWFA 4DQVA 1B0AA 3HDYA 1IHYA 1NX6A 2EJVA 3H7AA 5JXWA 4KOAA 3AOEA 3ZNPA 1WDLA 2PR2A 1NP3A 3JQ7A 4ZQFA 3U3XA 2NWQA 2OO5A 3U5TA 3PFWO 4CM4B 4Z9FA 4PZCA 1ISIA 2I5PO 1ZEMA 4EJ6A 3GEDA 3IUPA 2GYYA 5J23A 1F8GA 4YRDA 4RF5A 4UEJA 4OXKA 4PLYA 3JQAD 4CMKA 1L7EA 4BKUA 2UUOA 5K9ZA 4U0KA 4HFRA 2EKQA 3VVBA 5L51A 1G0NA 4J4HA 1B8UA 3I9LA 2CVZA 4E3ZA 4PRKA 1GUYA 1U5AA 3ON5A 1QV7A 2WD7B 1L1FA 5LDHA 1PQUA 4HKTA 2TMGA 5B4VA 2O4UX 2OL4A 4DLBA 3EVTA 3ETEA 4FOSA 5EJ2A 3WIDA 4AJ1A 4FQ8A 1MFZA 1PR9A 1EQ2A 4F45A 4ZQEA 1M67A 4ALNA 1PGPA 1P45A 1NAHA 3NDRA 1RJWA 3DOOA 1K5HA 2CD9A 1B8PA 3OSUA 1W0CA 4LGVA 5A9RA 3HN2A 5ER9A 3EVNA 4JJIA 3AI1A 5ES3A 4BNXA 5FI3A 4QQRA 5A05A 2QRJA 4K28A 3KOUA 3DOJA 1ADGA 2EKPA 3QWBA 1HE5A 3JQGA 4ZVVA 5TS3A 2BGKA 1BXZA 2C2XA 1C14A 1YQXA 3H9UA 4LCJA 4YXFA 2ZJ1A 2CDCA 2J5KA 1LRJA 3V1TC 3B6ZA 3V1UA 1SEVA 4BGEA 4JJGA 2OP0A 2I3GA 4IS2A 1Y9AA 4OO3A 3RJ9A 2D5CA 5KVSA 1FXSA 4HADA 5CEJA 1A4UA 3DMTC 2O2SA 4J90A 5JFOA 3GPDG 3CE6A 4GX1A 1YL6A 1BHSA 3W6ZA 4CODB 2QX7A 3FNEA 4F46A 5EINA 2P4QA 5A06A 3ONDA 1A9YA 3H2SA 2C5EA 3DBRA 1EK6A 4JP2A 5C3MA 3IL2A 3DL2A 5A02A 4BGUA 1KIFA 2NVWA 3WJ7A 1YBMA 2ZATA 3H5RA 4YQZA 4A27A 1C0IA 3UCEA 2QZZA 1YXMA 2Y66A 3L4SO 4J2HA 3R1IA 4OH1A 3O26A 4AL4A 2V6GA 4QECA 3GZ4A 2B5VA 1WXDA 3KYDA 3DZIA 1YJ8A 2RAFA 4UEKA 4L8VA 1AE1A 4JIGA 3HNPA 4BQRA 5B1YA 5T5QA 4IPTA 1XSEA 2AQKA 3IKVA 1EZ4A 1FDTA 1GPJA 4G81A 5C7LO 3AJRA 1IOLA 3DMYA 3OBBA 4UVEA 4R51A 4D3FA 3RBZA 1LSSA 3WS7A 4RPJA 3E48A 4E13A 2WSBA 2YHIA 4IDEA 4DGSA 1C0LA 3L77A 4GGPA 5JDCC 3AI2A 3C85A 4XR4A 3V5NA 1Q0LA 1U3WA 4QXMA 5GMOA 4TVBA 3IQDB 4OOFA 5B12A 1EVYA 3ICCA 1EK5A 1CJCA 3EK2A 3KETA 5F1PA 1HZZA 3PLNA 2AA3A 4OXYA 1LX6A 4RVDA 4UAGA 2VHWA 4CM3A 3JSAA 1YB5A 4DTIA 1WDKA 4CMEC 5HS4A 1X15A 4NJMB 1DHTA 5TSDA 4L75A 3PHHA 2DQ4A 1MGOA 1N7GA 4AFNA 2FSSA 4ALLA 2YFQA 5GY7A 3D4PA 2YV1A 3DAPA 2GSDA 1TLTA 3MJ4A 3I52A 3PYXA 4CL8A 3RQSA 4O5OA 5GZ6A 4BB5A 3HWRA 5HA5A 3BMOA 4PVDA 4RDIA 4FDAA 1DPGA 2HMUA 5BSHA 1EEHA 2H6EA 4YAIA 3WLEA 3P2OA 4W82A 4NK5A 3QWHA 4M54A 5JSFA 1UZLA 4GSLA 2OGUA 1X0XA 2VHZA 3FNHA 5CG1A 2JD0A 3ITDA 1YS4A 3V2HA 4U5QA 4KUGA 3GUCA 2ZYAA 4CLXA 1R66A 1R4MA 1XLTA 1YOVB 4DRYA 4E31A 2QW8A 1DOHA 8ADHA 4IIVA 3C7CB 5JW6A 2PGLA 5H82A 2B69A 3GC6A 4IDGA 1R4NB 1HYEA 2QRLA 1NR7A 1LLUA 4K6FA 3UUWA 4BV9A 1UXGA 4RF2A 4XDYA 3JD2A 1FDUA 4INAA 4WLNA 1D8AA 5IDXA 1R37A 3GHYA 4XJSA 2FR8A 4TRRA 3B70A 1KVUA 1Z45A 1N1GA 5I8ZA 4YT8A 4I8XA 2XXBA 4CR7A 1ONPA 1PJ3A 4R1TA 2X5KO 5KNLA 2O23A 4R5HA 4TRNA 5F21A 1BXGB 3K5PA 2QZ9A 1UR5A 5COBA 4MVJF 1PGJA 4HUJA 1DC5A 5JS6A 1LLDA 2CMDA 2C7VA 2YY7A 2NTVA 5BSEA 1QYXA 2OHXA 2PZMA 1CYDA 4N5MA 1LXCA 2OOSA 3NAQA 1Z7BA 2QQ5A 1PX0A 1U9JA 3Q2IA 3BMCB 4NJOA 3DR3A 3WNVA 3RFTA 3C1AA 1U4SA 1GYQA 5C5IA 2GDZA 2JL1A 2HUNA 1OFGA 3WTBA 4Z9YA 3WGQA 5BQFA 1FK8A 1HE4A 2D1YA 2DTXA 2VTEA 4JNKA 1I8TA 4PGFA 4E5YA 3VKUA 1O5IA 1H0KA 1IZ0A 1H93A 3A14A 3GGPA 3MWEB 1P74A 2DTDA 1GZ6A 2VRBA 3DZFA 1WP4A 2O7QA 1DHRA 2UYYA 1XCBA 5CAEA 1IY8A 3BA1A 4LK3A 1E7SA 4GVXA 2PA3A 3NTRA 4DC0A 2GN6A 2X7HA 4BL5A 4HNHA 1ZXLA 3VTZA 3RBXA 4NK4A 4FPXA 4RL6A 2Q49A 5T67A 1NHWA 4A5OA 4PLPA 3I3OA 5IXSA 4Q9NA 5G2OA 3UCFA 5ADHA 4IS3A 4XZ3A 4ND4A 1JTVA 2IXBA 3ORFA 4BO1A 1P1IA 1MXHA 4R9SA 1U2GA 4BOYA 3IS3A 1I2CA 2VWGA 1U8FO 4W7IA 4EUEA 1ZNQO 5JY6A 3UGKA 4JJFA 1MXFA 1IYZA 1DFHA 2EV9A 2Y1DA 3BMQB 3ANNA 3ROQA 3ZDFA 5AXDA 2O3QA 2ZB7A 3C1TA 4FCCA 1CDOA 3K96A 2B36A 1LQTA 1UAYA 3PIIA 3QY9A 4BO6A 5LC1A 5I7VA 4CM7A 4OHUA 1PIWA 3FTPA 3IMFA 4CLEA 4Q3AA 3LF2A 2Q50A 1T2FA 1VSVA 1GD1O 4YJHB 3BMQA 1EFLA 4NH4A 4DPKA 3OQ1A 5EERA 2I76A 2PZKA 2EGGA 5IJZA 2BI7A 2ZTMA 2W2LA 2P9CA 1G1AA 4J7UA 4QT0A 5KKCA 4UEOA 2C20A 5DP2A 1I0ZA 1X1EA 3TNLA 1O89A 3DFZA 2JD2A 2O3JA 4WLFA 3HB5X 2BLLA 3FBGA 4IDDA 4Y6RA 1U3UA 4EUHA 5KJ1A 3TSCA 3GFGA 1KETA 3SC4A 1YB4A 4D3DA 3I6QA 2JHGA 3LQFA 5EQFA 1WNTA 4MKZA 5JO0A 3FR8A 1HKUA 1V3UA 6LDHA 5A9SA 1DLJA 5ITVA 1TT5A 3GT0A 1P3DA 4XR9A 5TF4A 4XD2A 1PS0A 2WMDA 1R0LA 3D4NA 3OEYA 1PL7A 4R1UA 3RUCA 3RC9A 1KEVA 4R54A 5F1OA 1LBEA 4HBGA 2PFGA 1K89A 3HJAA 4RZIA 3RBVA 4M49A 1VL6A 1ULUA 3R6DA 4PLFA 4TRMA 1X7DA 3E5RA 2WEKA 3GN1A 4RPKA 5CHEA 2XPCA 4AJEA 5A1TA 7ADHA 1LLQA 2V65A 1FDWA 2EIHA 3WQRA 1M76A 2VYND 1EDZA 3OICA 2ZYGA 3W4KA 3K2EA 3QIVA 4JBHA 1P1JA 2DTEA 1GADO 2RHCA 3ZV5A 3RASA 4Q3CA 5DT9A 3GMSA 3IDSA 2EKLA 4AJ2A 1H94A 3PPIA 4B7CA 1Z75A 3OJLA 4CQMD 2UVDA 3PGXA 4OQYA 3MTJA 1S6YA 1EVJA 1XA0A 4N18A 4PLWA 4CQMB 3DAGA 4EEXA 2AHRA 2IZ0A 3KEOA 4CMBA 2PH3A 1CQJA 1O9BA 1WLYA 3NGLA 4ND1A 1ZFNA 4YVFA 2D2IA 3DXFA 5COAA 1P0FA 1VJ0A 4FFPA 3RUIA 3KB6A 2VUTA 4CJXA 3DBLB 3F9IA 3WTCA 4E2YA 3B20A 3OM9A 5TJ9A 3G17A 4D43A 3NUGA 1QMGA 3L9XA 4WLUA 4YWJA 5HTOA 3GDOA 5IFLA 2VYVD 4PVCA 1C1XB 3MOGA 4BKQA 3H5AA 3SLKA 3UVEA 2BFOA 3E5MA 1LRLA 4OGWA 1JWAB 2Y1OA 3TOXA 4ITUA 3ZW9A 1H9AA 1HE2A 3M2TA 4A26A 3NT4A 5U9CA 5L7YA 1UXHA 1LNQA 3UF0A 4PRLA 2C59A 1XQ6A 1WPQA 4LMPA 2QG4A 3W8FA 3ZWMA 3E6AA 2B4TO 4WPGA 4I08A 2NU6A 3B1FA 1JVSA 4XQCA 9LDBA 2O3SA 3KLMX 1R15A 1E6WA 3BYZA 3FI9A 4ND3A 3FWNA 4GI2A 2BKAA 1JU9A 4CLDA 2PY6A 5ENDA 2EERA 3GMDA 2PKQO 2DC1A 2PK3A 1Y9EA 3KSZO 2NUAA 1E7RA 1W4ZA 3KV3O 4O59O 1R16A 4P4NA 1HLDA 2A35A 4XJTA 5KJEA 3DAFA 1T2CA 2EXXA 5KVQA 1I33A 2OORA 2RCYA 2HMVA 1AN9A 1T24A 3QA9A 4FJ0A 1DXYA 1DBVO 3OMLA 4YAEA 4JXKA 2VWPA 4Z3KA 2Q46A 3RU7A 3WXBA 4Q3DA 1ZMOA 4TVOA 1ARZA 3JD4A 4E2XA 4BO3A 3AY6A 3DZBA 3D7LA 5CP8A 3C7DB 3C1OA 3QVOA 4YJHA 4I5EA 3X2EA 5BNFA 9LDTA 5HS6A 3GAFA 1LU9A 3I9OA 4NFYA 1BW9A 4RVHA 3SJ7A 4A10A 3GA0A 4UULA 1D1SA 4AJNA 1MG5A 1NQ5A 1P1FA 1E3IA 2I66A 2P68A 4URFA 4WCFA 1U4OA 4LCEA 3JQ9A 4YBZA 5DCYA 4CM9A 5CEFA 4KTTE 2X0NA 1G6KA 4J4TA 3WFIA 4DIOA 1I3MA 1LC3A 4CM1A 4WUVA 4AJIA 1E3EA 4OM8A 3VPHA 3WMXA 4CMCA 3U09A 4IDBA 2G82A 4DPLA 1JLLA 3TDKA 3NEPX 3ZI0A 4J9UE 1DFIA 2Y99A 4ALIA 4NHEA 1ZIDA 3NJ4A 3ADPA 4WEQA 1NFRA 1MP0A 4LW8A 3W6UA 5JMPA 3AY3A 1BSVA 5IDYA 1I10A 2EF1A 1NVMB 1ZCJA 4HXYA 2FPPA 2HMSA 2ZYDA 1ZSVA 1KY4A 4YR9A 3S1LA 1DRUA 1JAYA 4A2CA 4Y9DA 1X14A 2QYSA 2GO1A 4N54A 4N5LA 3PQDA 3ZWNA 1KBZA 2UDPA 1RWBA 5K6AA 1A7KA 3LYLA 2X5JO 2BH9A 1PSDA 2WE8A 3A28A 2CZCA 4NQZA 4XQGA 1XHLA 4EGFA 1C3VA 1FDVA 4RPHA 3O9ZA 1ONNA 2OMEA 3C3XA 3ZV6A 1VPDA 3ZW8A 1BWSA 1U1IA 4OSPA 3A1NA 2EP5A 2VYNA 4YJDA 4GMFA 2D0IA 4J1QA 4P4GA 1E92A 3DBHA 5KWEA 5L7WA 2WD7A 5I9MA 1QORA 1W73A 2X9VA 3RUDA 3WYBA 2HK8A 1YH3A 4BO0A 2ZTVA 3D0OA 3ZNQA 1IL0A 1LDBA 3QQPA 1F06A 3QWIA 4BNHA 2DM6A 4RPGA 1M6HA 4WOKA 4A03A 5IZCA 4GAEA 3WNQA 2ILTA 3KLPX 3DZJA 1T2AA 5F5NA 3U4HA 1B2LA 5T57A 4BKOA 1B14A 2YDYA 2J8ZA 3MEQA 1PZEA 3JYLA 2H9IA 1B16A 4PLCA 4DVJA 5F1KA 4XB2A 3I4CA 3GG9A 3I9KA 4RORA 3LC1O 2OP1A 3RC1A 5TNXA 2EEZA 4R9RA 4B4WA 1DO8A 3KM0A 4IMRA 1E5QA 2GZ2A 4IQGA 3QV1A 2G5CA 4CR8A 2RIRA 4OAQA 4P38A 1NBOA 2P5UA 2WD8A 2JCYA 3FR7A 2Y1CA 5JNLA 1H6DA 1ADBA 3H9QA 2DAPA 4XYBA 4D41A 5I7SA 2GGSA 2XAAA 3UOGA 3WX0A 4AJHA 3NTQA 4RVUA 3ZWBA 4RQUA 1B3RA 5L4LA 4FJ2A 2HRZA 4OXNA 2NU7A 2O3RA 5KJCA 3C24A 4DBVO 3TZKA 3EY4A 3N58A 2A4KA 1CEQA 2GD1O 3F4LA 3W4IA 3F4BA 4M87A 4GX2A 3ZGYA 5CDYA 4YACA 1ZK0A 3VHRA 2NU9A 3ZH2A 2NACA 2I67A 2VHXA 2GLXA 1NXQA 2Y93A 2WYVA 2JFGA 2GASA 1HSOA 3DHYA 4EUFA 4IUYA 2ZTLA 2CY0A 3PIDA 3FPCA 1TT7A 2FSVA 1NYTA 3M2PA 5KKAA 4JLWA 1B8VA 1NWCA 2WDZA 3UXYA 4L4RA 1YL7A 5HBRA 2GUGA 1QG6A 3VH1A 2FR1A 4YJFA 1HLPA 3P7MA 5KCZA 2PZLA 2Y0CA 1O6ZA 3LT1A 4Z6KA 2GN8A 4EJ0A 1SOVA 3QVSA 3UKOA 2BRUA 1VLLA 1YBVA 1ZMTA 3RI3A 3QVWA 1OZAA 1NVGA 1Y8RA 2IEDA 3GVCA 1HDZA 4FJ1A 2Y67A 3ZWVA 2BELA 4R4JA 3SC6A 2TMDA 2PD4A 4E32A 1ISGA 3FRJA 3LC7O 4DYDA 1W6UA 1E7MA 2BHLA 1U7TA 4E33A 3HDHA 4R3NA 2AW5A 4QO8A 3IC5A 5JAZA 1LSOA 1GUZA 1UUFA 3FWZA 3KSUA 4U8GA 3E9NA 3ZU5A 1GU7A 1A71A 2X4GA 3ZU2A 3MJVA 4U7WA 3WGOA 1E3LA 1UJMA 3UN1A 1SAYA 2CDAA 4NDNE 5JCJD 2O48X 1YBAA 2P91A 1DIGA 3PDUA 3IOYA 1LDNA 4RPLA 4OQZA 2Y1EA 4MDHA 5JAMA 1DSSG 3KVOA 3FNGA 4R68A 1GFSA 2X6TA 5AYVA 1DC3A 3JQ7B 4BVAA 3PHGA 3GNQA 4YYZA 1J0XO 2X58A 4WGGA 2Q2VA 4UUMA 1XYGA 4CM4A 4DLLA 3DBHB 3A4VA 4PLVA 3CMCO 2PD3A 2G1UA 2GZ3A 1PZHA 2JAHA 1EE2A 1IZ9A 3OJEA 4BNFA 4E5NA 1XU9A 4KP7A 4P4LA 4EEZA 3H9JA 4MVJE 4DMLA 2DBVO 2XOXA 4FR5A 4FFMA 5JO9A 3LC2O 1VL8A 3NKLA 3VKVA 4IMPA 4BO7A 1VSUA 5BSGA 3WJAA 3NDIA 4CLOA 4CQMA 3S2FA 1AHIA 3JQFC 2XXJA 5DP1A 4YRBA 3JD0A 1Z6ZA 3H2ZA 4JQCA 3U62A 2GERA 3AOGA 4TSKA 4QO7A 5DZSA 1U2DA 4KQXA 2NQ8A 1OOEA 3GRKA 4RDHA 4WJZA 2OXIA 4BO8A 3WR5A 1KEWA 2FP4A 4CMIB 3UH1A 3LK7A 1VI2A 3WIEA 4IZIA 4HX5A 4PG8A 4ZRMA 1N8KA 2B37A 3CINA 3U49A 1HF3A 1NPYA 1ZH8A 5CFZA 1JQBA 1TI7A 5JAQA 2Q3EA 1T2DA 4WCDA 3FTNA 1ENZA 1E1NA 1OBFO 4ESOA 3G3EA 1U3TA 3CIFA 3SBOA 3DC2A 4Y67A 4BGVA 1ENOA 4CLRA 3ZN2A 4A7PA 3ROKA 2EW2A 1K6IA 1YQDA 4RF3A 3WMWA 4MINA 4S3MA 1DIRA 4FD3A 5L95A 3NDJA 4C4OA 5IDQA 4CM8B 4UVDA 4L74A 3WGHA 2RBEA 4XQEA 2AEJA 2IZ1A 4G2NA 3AU9A 3G1TA 4Z0TA 3VZRA 1UXJA 2NADA 4Y6PA 2E48A 5B37A 4BNMA 1FF9A 3VPSA 3Q2KA 3DWFA 3GZNB 4IJWA 5JLAA 3TWOA 5B4TA 4AG3A 3OJ0A 3AFNA 3N7UA 4MPDA 1P77A 3PYMA 1ZK1A 3KHUA 4DIBA 2X8LA 1NPDA 4YCAA 4CM8A 1WZEA 1TXGA 2HMWA 3GEMA 3W8DA 2PNFA 1GDHA 5KTKA 1WMBA 4XIYA 5AVOA 5C7IO 1U7HA 4BNTA 1JAXA 5A5EA 3DHNA 2CDBA 4J4BA 1RKXA 4ALMA 4CV2A 4DC1A 3JQAA 5IDWA 3A06A 1HDXA 2H5LA 4BQPA 2OBYA 1J5PA 2YYYA 3VH4A 2BI8A 3Q1LA 5THKA 1ZW1A 5JE8A 3E82A 1WMAA 4CLHA 2PLAA 1Y81A 1ID1A 5U4QA 3F47A 1A27A 5FEUA 3MZ0A 1ADFA 1ZK2A 2OZPA 5TLSA 2AE1A 4DBZA 4YAGA 4HP8A 4NBWA 5JY1A 1OI7A 2CVOA 4IBOA 4BGIA 1BG6A 1DLIA 1I30A 2E6UX 4WLEA 4U0JA 1HWYA 4XIJA 4BV8A 1YRLA 4BO9A 1Z82A 3D64A 5T8KC 3ICPA 2DFDA 2YJZA 5KVCA 2RH4A 4RGBA 4D46A 3DBVO 2PD6A 3ZWPA 5F3RA 5ILGA 3EZLA 4LMRA 1PJCA 3RKUA 3QVXA 1I3KA 4Y8VA 3NJ8A 1A72A 2J3IA 4LRTB 3ANMA 4RVFA 1JKJA 5G4KA 2X0IA 1P1RA 4NPCA 1ENYA 4J43A 4YT2A 2ZIZA 2VZ8A 4D7AA 1XU7A 3WICA 1I3NA 1H2BA 3DZKA 3PRJA 2QRKA 4NBRA 2C0CA 4PIVA 1I2ZA 1A4IA 1QLHA 4ZQBA 3DOCA 1VM6A 3ZWXA 1NPTO 1DAPA 3SX2A 4FFLA 4AICA 4OKIA 3VOSA 3ZWWA 4EITA 2E49A 2NLOA 3ONFA 3TQHA 3GH3A 5C37A 3JQ9C 3ROMA 3ZV3A 3JQBC 2CNBA 4WOJA 5DBGA 4ID9A 4MIYA 1HTBA 4PG5A 5G0WA 1PGOA 3ZV4A 4CLOB 2X23A 3O03A 1Y1PA 5L40A 2CSUA 3QHAA 1OMOA 1KYQA 1DAOA 1LTHR 4W9NC 3F5SA 4Z3DA 4DQXA 5BR7A 2J5QA 4L4XA 2PV7A 1R4MB 4IDAA 4XGIA 3JQGB 3L4BC 2X5OA 4MVJA 5JMWA 2Z1NA 4ILKA 1X1TA 4PLZA 4CMIA 3FCOA 2I9PA 1QYVA 3H9EO 4K1LA 4UUNA 3IJRA 1JDJA 2Y0EA 5TX7A 4FOOA 5A4DA 1BXKA 2ZKLA 2F00A 3ABIA 1GCOA 4AVYA 1R6DA 2J3KA 2DUWA 2A9FA 3SEFA 4ZHSA 1K0UA 2AE2A 1ZUD1 1X7GA 3GAZA 1IE3A 3WBBA 4XKJA 3S2EA 3VAZA 3AUUA 3EAGA 3WG9A 1TA4A 4CLRB 4IXWA 2O2YA 1GL3A 2P2SA 4NZ9A 3RUHA 3VZSA 5JC8A 2X9NA 4RVSA 1PJ4A 2Z5LA 1UP6A 3DBLA 3NGXA 1GR0A 2HDHA 1QR6A 2O3TA 4PZEA 3E9QA 2HAEA 1NQAO 3E9MA 4H3VA 4I1IA 1GCUA 3PTZA 3T7CA 4MVJG 2X86A 1KOLA 3ADOA 5EMHA 3TL2A 3U9LA 1E3WA 2YQ5A 3QP9A 4RF4A 3RROA 1J6UA 1CERA 4DMMA 2FN7A 1V3VA 2Q1SA 4F3YA 2VTDA 3F1KA 1ML3A 3WGYA 2VNSA 4E5MA 4DQUA 1MX3A 1P0CA 3WGGA 3OP4A 2W2LD 5TC4A 2IRWA 3P19A 4FC6A 1XGKA 4WK6A 3DBRB 4EBFA 3RC7A 5KOIA 2FRDA 4R1SA 4RCVA 1LUAA 3JQAB 2P5YA 5IZ4A 3VPGA 3D3WA 3JQ8B 1Y5MA 1YONA 3ZCXA 3P5SA 3G79A 4JCOA 7MDHA 4WNIA 1ZJYA 1I36A 3X2FA 5BNTA 4BNNA 3VC7A 1VRWA 3TZQA 4MVJM 1KVRA 1DIBA 3BHIA 1MUUA 3WWZA 3LLVA 1DB3A 1B7GO 3PWKA 2UUPA 4M89A 4UREA 4Y98A 4BNIA 4O6VA 1JW9B 2CUKA 1I3LA 3JD1A 3WGIA 4IINA 3NT2A 3Q0EA 5H81A 4H16A 3EHEA 1PZGA 5BSFA 5ENVA 1HDGO 1IB6A 3B1KA 3O8QA 3HADA 3D3EA 4I9NA 3CMMA 3BMNA 3PJGA 4OYRA 3INGA 4GH5A 4IJVA 4FGSA 1T26A 2WWRA 3TRIA 2FZEA 5EIOA 4FFOA 3Q3CA 4C7JA 1AHHA 3CUKA 4R69A 4BNZA 3MTGA 2YHIB 1GYPA 2IDZA 3O4RA 4JX8A 1NFQA 4ZQGA 3OH8A 3I5MA 1TVEA 3G0OA 4XWYA 3AY7A 4OL9A 2YZ7A 2Z1MA 2FY8A 1NM5A 1XEAA 1N1EA 3ZWOA 1F0YA 3WFJA 4CQLB 1YDEA 2DVMA 2YHUA 1KC3A 3BMNB 1C0PA 1Q7CA 3T4EA 3H9GA 2HLPA 1N2SA 1V8BA 2PTGA 5HWSA 4E6PA 5KIAA 2Q2QA 1NASA 3PQFA 1NFFA 3K8ZA 3DONA 1Q1NA 4IIUA 3AWDA 4E30A 4FN4A 4E5KA 4J2OA 3DMTA 4GKVA 4XGKA 3ZU3A 2EP7A 3JQEA 3OFSA 1LDEA 1XQ1A 5KJFA 3TF5A 2W4QA 3KRTA 3QE3A 1E7WA 5AXBA 4O63O 1RM3A 3TN7A 1G0OA 4BNGA 1LDMA 4HFNA 3F1LA 2PGJA 4S1VA 3JYNA 1YWGO 4JBGA 2PWZA 1KEPA 5CPBA 2R00C 4O0LA 4M86A 1KS9A 1EDOA 2AQIA 4J0EA 3Q9UA 2A94A 1P33A 4TKLA 3OA0A 3RJ5A 1RM4A 3EC7A 2HU2A 2Q4BA 4LVCA 5A04A 2Y0DA 6ADHA 3DDNA 5TRTA 1ZSYA 4Q3NA 1C1DB 2IYOA 3GOHA 3LSYA 2X22A 4TWRA 5DBIA 3U0BA 5IF3A 2PKQP 1DC4A 1OAAA 3HHPA 1BGVA 4XYGA 3MJTA 2LDXA 2F1KA 4ND2A 1PS9A 3D4OA 3F3SA 1PJTA 2IEBA 3JQFA 4XDZA 4IZHA 1UDBA 2NV6A 2WM3A 1IHXA 4M55A 1NTOA 1R4NA 4UVGA 3PZRA 1AXEA 4G65A 3NYWA 3IP3A 2D59A 1QYWA 4MVJD 4CV0A 1CF2O 4DYVA 1SO8A 5L53A 1JKIA 1BTOA 4W6ZA 3LF1A 4DLAA 2WYWA 1UZMA 3WSWA 4LSWA 4W99A 1D7OA 4GLLA 1IUKA 5EL0A 1B15A 2SCUA 1Q7GA 3R0IA 4CR6A 1OC4A 1B26A 4IM7A 4IQ0A 1VJTA 1BVUA 4GX5A 4HV4A 1O8CA 2VRCD 1E7YA 5I9NA 1HEUA 1SNYA 4RO0A 4ALKA 2B0JA 3WBFA 1DDOA 4OOEA 2DPGA 3BMCA 3BAZA 3D3WB 3JQ8A 3GZNA 4GMGA 5GZ3A 1I01A 4JP3A 3PK0A 1PTJA 1E6EA 1F12A 2R00A 3OQBA 1R0KA 4OJNA 3ULKA 4U6QA 1N92A 4MVJH 4PLTA 3RCBA 4M1QA 4Q3EA 4BNUA 5JAIA 5DNAA 1GQ2A 4J1TA 1QV6A 2BF7A 3K2BA 1PGQA 4PG6A 4PLGA 3RUEA 3ZHYA 1PQPA 3GHHA 4I5GA 1N7HA 4FC7A 2VN8A 5IN5A 2WE7A 2PH5A 1SEPA 3KEQA 3OIDA 4J1NA 4J7XA 3D1LA 4I5FA 4PG7A 2E82A 2Q45A 1ISMA 3F5QA 3DB2A 3RFVA 1QXSA 4LN1A 1PL8A 4BMVA 1DRVA 4NU6A 4BHTA 2FMUA 1HT0A 4YT4A 5DDIP 4CL3A 5L45A 4M8SA 2UV8A 1GY8A 4BKRA 4B79A 2VUSA 3JQCA 3GY0A 4E5PA 3P2YA 1D3AA 3I9JA 1GPDG 1V9LA 2PZJA 1HL3A 4YEDA 3RUAA 5CG2A 4WECA 5BNIA 3EUWA 3RC2A 3PWZA 5IG2A 1LEHA 3H8VA 1QKIA 5EQDA 3HUDA 5IAAA 1CRWG 3FF4A 1ENPA 2VHVA 1O94A 3KYCB 4MIEA 3ASVA 4AJPA 1Q7BA 4P22A 3SJUA 4RVGA 3ZWYA 2Q1TA 4L9RA 4MVJP 2DKNA 1U8XX 1BDMA 4E21A 2HJSA 1H6CA 3HDJA 2G0TA 1O95A 3LVFO 4BNVA 1ZO8A 4JBIA 2AEMA 1EBFA 1RYEA 3LZ6A 4QTZA 5BT9A 1LRKA 4LSMA 1DEHA 4GBJA 3RVDA 5A5FA 2HMTA 4LRSB 5L4NA 4NBVA 4RLSA 3ONEA 3PP8A 3RUFA 2ZB3A 2R6JA 2YDXA 3KYCA 5JYEA 3OHSX 1Y8QA 3VPFA 5CDGA 3T4XA 4I5DA 3PI7A 3KUXA 4NJMA 4E12A 1Z7EA 4NI5A 2X9GA 2B83A 5T8KA 4ONEA 1D4FA 3JQDA 4IDCA 3WQSB 3TJRA 1IULA 3PLRA 1EUCA 3HG7A 4KZPA 3UW3A 4DREA 4KQWA 4RV9A 3LT4A 1NHGA 1WAMA 3JQ6A 3STHA 2O3UA 1R0SA 3EGOA 4IJKA 2W98A 5A9SB 1P9LA 5T6BA 4KWHA 1SZJG 4BO4A 4YRAA 3EMKA 4D0SA 3JQBA 3V8BA 1RM0A 2B4QA 2GNAA 3CH6A 2DBZA 1HDCA 3B1JA 4PCVA 5G0VA 2GCGA 5G0SA 4D44A 2PKRA 4B3JA 4ND5A 4RZHA 4BUCA 4Y6SA 1EFKA 1EVIA 4OKNA 4ROSA 3LU1A 1J4AA 1DC6A 2V7PA 2BD0A 3WSVA 3ZHZA 2W2KA 3L4BA 4KMSA 3IP1A 4DPMA 4J7CA 1YOVA 2EW8A 2C82A 3R3SA 4HWKA 2J6IA 3E18A 4HY3A 3PEFA 2X0RA 1GZ4A 1IPFA 2BMAA 3GK3A 1U3VA 2G76A 5DCWA 4CM5A 1ADCA 2BFMA 3K31A 4LISA 1QYCA 1EBUA 1WVGA 2FPIA 3CKYA 3PVZA 1H6BA 1CWUA 1NAIA 5AOVA 3F6YA 4XYLA 5JCXA 3FPLA 4L76A 2DBRA 3LT0A 1XG5A 2Y1GA 1OC2A 4XA8A 1NQOA 2YW9A 5C7OO 3VDQA 4B4OA 2VHYA 4B4UA 3QRWA 4YQYA 1QLJA 1XKQA 4YA6A 2VWHA 3E03A 2B5WA 4NG5A 3FSRA 4BB6A 2V6MA 3BTOA 3S2IA 4W4TA 5TIIA 1GTMA 2AQ8A 1M6WA 3U4DA 2LDBA 3VPXA 4PZDA 1EUZA 1GEEA 3KYDB 1C1XA 1E1MA 2C7GA 3L6DA 3MOIA 3ZHXA 4PN3A 4HFJA 3SVTA 1GV1A 2X0JA 1BRMA 4Z9XA 5I7FA 3DTTA 5TT1A 3HQ4O 4KWIA 1PJQA 1B3BA 1BMDA 4EI2A 2EG9A 4CM9D 3QSGA 3V2GA 4YB8A 3I1JA 3GEGA 4DA9A 5DCUA 5DF1A 5HRUA 3PXXA 2P4HX 1KY5A 4AJOA 4IGEA 5F5LA 4ZU3A 5ICMA 1PJSA 4XQ9A 2V6BA 3Q9NA 1LI4A 4FFRA 1UAGA 3MJSA 2EWMA 2GPTA 3GVHA 3AUSA 1LC0A 1K2WA 4KTVE 4KDEA 4D0RA 2HJRA 4XCVA 4NFHA 4CMHA 1BDBA 2NM0A 3WYEA 1N9GA 1DFGA 4BMSA 3NX4A 4FSHA 4XX0A 3NV9A 3RFXA 4Q3BA 1GUFA 2Q1UA 4IGFA 2I65A 1K6XA 2CFCA 4B3IA 1PU2A 1HDRA 5I9LA 2A92A 3DTYA 3OEWA 2W8ZA 4CQLA 4YTEA 1VC2A 1R12A 1CIVA 2HSDA 4BO2A 5A9TA 5THQA 2FR0A 1M2WA 1V6AA 3UFXA 1N9GB 4EZBA 3V2UA 4II2A 3VH2A 4MIOA 3JYOA 1T1SA 4I9UA 1RPNA 1HXHA 4WNCA 3RAJA 1KERA 1KVSA 1S7CA 1I32A 3BXXA 3D5TA 5GZ1A 4J0FA 1XDWA 4J3FA 3E8XA 3KTDA 2VWQA 1L7DA 2VQ3A 4FBGA 4TQGA 5LDGA 3EDMA 3ENKA 4GGOA 4N7RA 1PR3A 1DRWA 1MC4A 5CDSA 2POQX 4GSKA 1Z74A 2JAPA 3INRA 3W4JA 4YPOA 4ZQHA 1E3SA 1GQYA 2Q4EA 3HB4X 4W9NA 4WLVA 3HFGA 3TZCA 5I8WA 5MGBA 4DUPA 1MG0A 2ZB8A 5IN4A 1GEGA 1P1HA 2Y05A 3WGTA 3TL3A 2GF2A 2JJYA 1JA9A 1H2HA 1UXIA 3AM5A 3AM4A 3TZ6A 2CVQA 3VVCA 4IXTA 1ISHA 2J3HA 3GR6A 3ANLA 5TT0A 1YVEI 3ZU4A 1SPXA 4U6SA 2YV3A 3CZRA 1T2EA 3WQQA 5ILOA 4K26A 5H83A 5KVVA 1IPEA 5AXCA 3DZGA 1DIAA 4QFCA 2NVBA 3N74A 4R41A 3WB9A 3GG2A 4YJGA 4R3WA 1WDMA 3OIFA 1PWZA 2EGHA 2DUUA 1ULSA 3HDQA 5HM8A 4X54A 3I9NA 2BGLA 4CMJA 4TRJA 4YAKA 3AM3A 1T25A 4MP6A 1TB4A 1H9BA 3QJ5A 3RWBA 3K92A 4RJTA 3RSHA 3S2GA 1YL5A 1E7QA 2D4AA 2EHDA 3HSKA 1LDYA 4EDFA 4J1SA 4YJGB 2DFVA 2NU8A 3CTMA 2ET6A 4KUHA 1VL0A 1X13A 2Q1WA 3KSDO 1AXGA 1ORRA 3BTSA 1PEDA 1PS8A 1GZ3A 4TROA 5L3ZA 3GPIA 4B8WA 4F6LA 1PJBA 2FHSA 4GL4A 4OMUA 4O1MA 4MO2A 2RHRA 1GAEO 3CXRA 3H65A 3QWAA 3KYBA 3ZWCA 1BVRA 1E0DA 2BFPA 3WGZA 2FWMX 3GNSA 3JD3A 2AG8A 1U5CA 2VOJA 4RQTA 1I24A 3CEAA 1NQTA 3BHMA 3BZUA 1SB8A 3GVPA 3PHIA 3S55A 1SOWA 4JK3A 2C54A 1XR3A 2ZK7A 1HZJA 2B4RO 3FHLA 3WLFA 3IUSA 1LJ8A 2V6FA 2DT5A 5JC1A 1ONOA 3OA2A 4D42A 1LLCA 2ZTUA 2NVUA 3JYQA 1MB4A 4JGBA 3VDRA 4AJ4A 3Q6IA 4DIFA 3DQPA 2I99A 4FS3A 4J16A 4A73A 1XWFA 4ZN6A 4GPD1 3KBOA 2JD1A 3TPCA 5JCJA 3I6IA 3DEYX 1RM5A 4B8ZA 5FWNA 1PJLA 3OF2A 3PJEA 1I2BA 5DN9A 3K6JA 2NVUB 3AOEC 3ITKA 4FGWA 4WCFB 4BNWA 1EE9A 1QYDA 4J91A 2RH8A 4BMNA 4TMFA 5JDIA 4NNJA 4MP8A 1XIVA 1EQUA 3BIOA 1UP7A 3VZQA 5ICSA 3NT5A 1PJ2A 5CDTA 4NR0A 3ETGA 5DULA 2GZ1A 4XGNA 1KC1A 1E6UA 1H5QA 1I5RA 4OSOA 2VZ0A 1KVTA 3ETDA 1VKOA 3O38A 4XYEA 4LVUA 2Z95A 2ZQZA 3PDJA 4J6FA 4YDRA 2AEFA 3FNFA 5G0UA 4GVLA 1A7AA 3VZPA 2BFAA 3AK4A 1HETA 2UAGA 2IE0A 1GYRA 3M1AA 2AG5A 1Y8QB 4ZA2A 4B4VA 3H3FA 4H7PA 1TT5B 1NNUA 4XB1A 3V1YA 5L9AA 4D45A 2VUUA 4CPDA 4EW6A 3JV7A 1A5ZA 3G1UA 5FFFA 2DLDA 2HCTA 2YQ4A 3BMOB 4IJUA 3PFFA 4CV3A 1ZZEA 4IDFA 4E0BA 3ZZNA 1NVTA 2WYUA 2X1HA 4GWGA 4CMAA 1PL6A 2XF8A 3RU9A 1LQUA 5ER6A 3SXPA 4R16A 1V35A 3ASUA 4ZICA 1PQWA 2HK7A 2YUTA 1HE3A 5L4SA 1A9ZA 1DJNA 1Z73A 3AW9A 4J9VA 2EJWA 4PFJA 5U1PA 3W1VA 1E1KA 3OECA 4J49A 2O7SA 3I83A 1QP8A 2WJPA 1JVBA 4NMHA 3R3JA 1O0SA 4UUOA 2AMFA 3E1KA 4WCFC 4FFNA 1YGYA 3A9WA 3H5NA 3U4CA 1YE3A 2CF5A 1HRDA 2C2YA 5G0TA 4CV1A 3MJCA 3DZHA 3CSDA 5JPIA 4MKRA 4NU5A 4A0SA 5JDIC 3RD5A 4HFMA 4TZTA 4RLHA 3ZNOA 4CUZA 1ZVMA 3GF4A 3K9QO 2QYTA 3UCXA 1PGNA 5CPFA 4PLHA 4XEHA 4ZRNA 3M1LA 3L6EA 4XRRA 2ZJ0A 3MJEA 3K73O 1ZBQA 2B35A 2HK9A 2GN9A 1SCUA 3DO5A 1E3JA 4CM6A 2JHFA 2CF6A 1N5DA 3PYLA 1GQQA 1QSGA 1ZXBA 5CDUA 2OBNA 3GQVA 5K6AC 1FJHA 3RKRA 4BNLA 3BHJA 3CZMA 3QW2A 1LA2A 1Y7TA 2Y1FA 3W8EA 3PHLA 3CPSA 4ZGWA 4NBUA 4QFDA 4FW8A 3UICA 4BNJA 1JKFA 4I9HA 4XYMA 3H3JA 3MCVA 4KDFA 3S8MA 2DPHA 3PJDA 3EYWA 2E4AA 2IXAA 3INTA 5ITWA 3QVTA 5FYDA 1CETA 2IYPA 2Q2WA 3PWSA 2D5AA 2IZZA 1E3WB 4PG4A 3K30A 4BNYA 1VE9A 5IZCC 1DJQA 3TFQA 4E2ZA 1MC5A 4IQ8A 4R5MA 2VRCA 1MA0A 2JCXA 5A3VA 3FN4A 1YJQA 3GGGA 2H1SA 3HZZA 4ZJUA 2DU8A 3BTUA 1ISJA 3LT2A 1Q0QA 1CQIA 2JFFA 4QUKA 5B4UA 1ZK4A 4YAJA 4D79A 1T4DA 1UH5A 1Y5RA 4WE3A
chains in the Genus database with same CATH superfamily
1BMTA 4MKXA 2C3UA 2QQGA 3E7FA 1YC5A 3PHJA 3VR5D 5LP6F 1TC2A 1JH8A 4LBVA 2OWEA 4P53A 3ZIAD 1EVZA 5CM2Z 4F56A 4LBYA 3SSMA 3SZRA 1A2OA 5HF8A 4D9HA 2FSPA 2FFQA 2IYQA 2AQHA 5A6SB 1I9GA 1UEIA 2VDLB 4RMHA 1GNPA 4XI9A 3N2GB 4Q7QA 5HQ3B 3RH0A 4EGQA 3MJRA 3GUYA 3F3MA 5TQVA 3Q5DA 3GLSA 1VGRA 2FZWA 1W96A 2MMCA 1EUDA 5FQNA 4C7XA 3PEWA 4OGKA 1L5FA 4M1OA 3PF9A 3P52A 1N0WA 5BPHA 2JATA 1T2NA 3IVAA 2RHHA 4QQ8A 4I1PA 1U65A 3TD2A 1E2PA 2WMNB 3T9BA 4FWTA 2MMGA 1EB8A 1NW8A 3RHZA 3SXUB 3A3KA 2XNHA 3PQ2A 4AJJA 2VYVA 2AN5A 1JECA 1U7XA 4II3A 3V8VA 4X66B 4TWAA 4HNVA 2NXCA 4KMMA 3SIRA 5EPOA 1OB5A 3L0IB 1YZHA 4B76A 2ILVA 3PDCA 1W8DA 1WR8A 3TZHA 4DM7A 2VRNA 3K0BA 1E0SA 1T2UA 4LA4A 1Y8RB 1KI6A 3C48A 2QUHA 3JYPA 1A7JA 3T3MB 1ZGZA 1KRXA 1EI9A 4KFTA 3UHAA 3GGOA 4EJMA 1Y6JA 4FMBB 1Z12A 1BEZA 2FQXA 3BK7A 3HJUA 3ST7A 1NKVA 3VJKA 3ZWAA 5LBTA 4FB5A 1O0BA 3ZE1B 4M46A 1USKA 2E37A 3M6UA 5JECA 3QUQA 3IVRA 2CK3A 2QF7A 1KU6A 4I0WB 3ZE6A 5EWMA 2H0QA 3MT0A 4UXHA 2O50A 5CM9C 2HKIA 2VT2A 3D9QX 5K8CA 3DCJA 3CLUC 5KX5A 3TM4A 4NPHA 4WKGA 1FYVA 1XJWA 3W78A 7MHTA 3PV0A 2DX7A 4ASUA 1NXWA 1Z0KA 4ZD6A 1OSNA 1AGNA 1SKYB 4YRTA 3D6FA 4RPCA 4AJKA 3AV0B 3ES9A 1M8JA 3WYCA 3KT0A 3KZNA 2RGNA 4LWPA 3BTVA 4NFSA 3ZEIA 4F7WA 1UFVA 1ND5A 3ZL9A 2DBQA 4GR5A 2A3NA 2GF0A 1CU1A 1DIHA 2V7UA 3C7KA 3GFBA 1J0AA 3IGFA 4O4JB 2I3BA 4QDUA 3AI3A 4OA5A 4IIEA 3EXHA 4MK4A 1G8SA 3B36A 3G7UA 4RANA 2BFWA 4JROA 3STWA 4BLWA 4DR1B 3M6WA 4MOWA 4N82A 3UB2A 1ZKMA 3UWKA 3T7EA 2VBCA 1AGXA 3U4MA 2IWHA 2H0RA 2WU8A 2VDPB 1MRSA 3IJPA 4R1NA 1EM8A 1QYRA 2J31A 3EEQA 4UDXX 3HFSA 4LKRA 3DFIA 4WLOA 5HCIA 3UHPA 1QO0A 2YMMA 4J0CA 3E3OA 2R7LA 1RC1A 5JBIA 3L4KA 2OFPA 2PGDA 3OIGA 3UJ9A 2J5RA 2CFTA 2QVBA 3RS5A 2PKCA 1M3SA 1FSFA 5CX4A 1SCDA 1FTSA 1L7XA 1SIWA 4GOLD 4FKZA 4NYJQ 4OB8A 4U7HA 3UV6A 4X64B 1U3CA 5BV7A 4LF4B 4YASA 1B42A 2NTJA 3Q3HA 4Z4GA 4P5PA 3IH5A 3DEIA 2FPIB 2IODA 1KVQA 1O7JA 1JJ7A 1Y48E 2AYXA 3NVDA 1PK7A 2ZCUA 2B7BA 2VBIA 4XJVA 3LUCA 5BW6B 4CU5A 4R7ZA 4I4LA 4I7EA 2QHXA 1DU4A 4N7JA 3I9MA 4M76B 1FFHA 4B71A 2QLTA 1R6AA 4U2BA 3GRAA 4JJ4A 3PE6A 1CSEE 2ZAIA 3MWDB 4GLOA 2VAXA 2C07A 3IBTA 5E3HA 2GM5A 4AKSA 1PJZA 3NIGB 3W2GA 2XB9A 3NTVA 2W5UA 2O8VA 3FWHA 1FTYA 1ZUNA 3L7JA 4M21A 4HN2A 3ZWDA 1XPRA 5ARCA 1SOUA 3KR9A 4F84A 4J0QA 2A7XA 3VKWA 4M7PA 3I9V1 1DE0A 1JZSA 1NM5C 2Q7XA 4L5JA 1VCOA 2ZWOA 5JYDA 3R75A 2FPGA 1THGA 3RRJA 1UDCA 13PKA 3WOHA 1E5LA 1RW4A 4QXQA 2H54A 2I3AA 3QPVA 4UVIA 3LUHA 5AJZA 4AQYB 3JTMA 2I1LA 2IVZA 1B0UA 3ESBA 1I14A 1L5NA 1R8JA 1QK5A 2HLNA 1RCFA 4X95A 3UWPA 3D4BA 5FOTA 2ORWA 2GPYA 5JIBA 5JISA 2C0QA 1M6EX 3DKKA 4KMRA 4M1MA 4R8SA 1C81A 3TFOA 5IXJA 5JROA 1N2BA 4EHIA 2AVDA 1STOA 4NIMA 1O77A 2RGDA 3ICOA 2D3TA 3N3AC 2Q5HA 1KDRA 3L0SA 3H8JA 3PPXA 3UG6A 5ADUS 1X0VA 3DE7X 4TYNA 2UVPA 1ACJA 1OYOA 2O6HA 3RV3A 1D2RA 1X2EA 1QGZA 4F1JA 3AL2A 1XELA 1KO5A 2IU4A 1WZUA 2Q99A 4R0MA 1HSZA 2IWRA 1GA6A 1VJ1A 1L4EA 3WGVA 4QM6A 1F17A 3DKIA 2F3QA 3LM8A 4UVHA 2FKNA 4YT5A 2PS0A 3FFXA 5G4KB 3LDHA 5G40A 1NU6A 2J9YB 1UDAA 2D74A 3E3NA 3OJOA 1U28A 5FTKA 4DL9A 3T3EA 3PQ5A 1UJBA 2GCEA 4BWVA 4DWVA 1BX1A 1P31A 1PRYA 5DOVA 5I7OA 3EVZA 4PC2A 4DA4A 1PEAA 2AZDA 2JGLA 1TZCA 1FY2A 2Q2OA 4HB4A 4RXUA 4X63A 1SC6A 3TIVA 1K7FB 3LCJA 4UU7A 3FRIA 1DEOA 3OZVA 2J0UA 1FLAA 4L8FA 1DAFA 3HDYA 4X71A 5TEVA 1IHYA 3QEJA 4KOAA 4X9XA 5BSTA 1GNLA 3AOEA 4MRRA 4ZTUB 4H7IA 4S0ZA 1HFKA 1U8AA 1EP9A 3L92A 4EW3A 3KQNA 4MAAA 3U3XA 3H2GA 1V7PC 4NESA 2F8TA 4QOFA 1TKAA 1DCTA 3PFWO 4FYYA 2WIJA 4PZCA 1J97A 2FSGA 1RZRD 1RRKA 4X00A 1JLKA 1ISIA 4EJ6A 2WT8A 1R2QA 5KEIA 1NT2A 3HVJA 1BCRB 4QUAA 3C3CA 4UEJA 4NTZA 3VO1A 1AZSC 4EPRA 2W0SA 1P6XA 4YRZA 3NWPA 5AUQA 3HWX1 4YP6A 3D8NA 3HCAA 3HVIA 2CLMB 4N8EA 3CB4A 4J4HA 5ELXA 3IT0A 3GYGA 3I9LA 4CGZA 3FLAA 2ZIAA 4BU0A 4TZ0A 1Q77A 2HV9A 5D3MA 4TS4A 3WRXA 4RV4A 3OJCA 2HT6A 5FO0A 4U2GA 1YQEA 3HBMA 3KHSA 4HKTA 3RTEA 1N6RA 1KI3A 2HBRA 4P92A 2DPYA 4DSNA 4UARA 1QGYA 4DLBA 3EVDA 1QCCA 2RGCA 4AJ1A 4L78A 1AV6A 2FWIA 4IEIA 5TDHA 1RWOA 4BX3A 3IDFA 5AM0A 3ISVA 1VL5A 3O93A 2JH3A 4NWIA 4HWSA 5JYBA 1M67A 4B3BA 5KYWA 2BBTA 4QBKA 1P45A 4KITB 1V2HE 4GIBA 5EKTA 5A9RA 4QRHA 1KDYA 1B8PA 3V4VB 1GTSA 3D6NB 3DM9B 4MQLA 3EVNA 1C50A 2G40A 1BOOA 1K4KA 3OCXA 4HDRA 5ALFA 4U7PB 5IBPA 2Y4NA 4BNXA 2ZRNA 5JSHA 2VA9A 4S1PA 5FI3A 1J2JA 1GVNB 2QRJA 3CZ4A 4XSVA 1WMSA 3KOUA 4FB4A 4N41A 1V7CA 4WOBA 3D8BA 4ARBA 4ZVVA 5B2FA 1BXZA 1P7CA 4N1AA 5LP6A 4H4CA 2W37A 3JARB 3ZU2A 4BJ1A 2GXUA 2ZJ1A 3WLPA 4DLVA 3WA7A 2XJ4A 2DFLA 1OV6A 1JEAA 1X8JA 5ELLA 4JJGA 1J42A 4W5JA 5PGMA 2ZJBA 5BN4B 4IS2A 3EZGA 2VYCA 2P3SA 1VKHA 2WAOA 3AEXA 2YRXA 3MWDA 3RJ9A 1GNQA 3DMTC 4J90A 2O2SA 2R6FA 3DR5A 3O75A 5LSAA 3CE6A 4GX1A 1YL6A 1BHSA 2QR3A 2YYSA 4BATA 4EW1A 5EINA 1PTKA 3MMNA 3S4YA 1ZGJA 3HY3A 3FPFA 3I4LA 3H2SA 2ZUVA 3O2QB 3ONDA 3VFDA 2Q29A 2C5EA 2BW0A 5KYKA 1N33B 3ENVA 5CLJA 2C3MA 3A2KA 3DL2A 4JOBA 4G6ZA 4RENA 4NYIQ 2NVWA 4TUYB 3LPNA 1W5SA 1YBMA 3K0FA 4URVR 1EEXB 1SXJB 3KE9A 1VGQA 1E2JA 1M2OA 5AKZA 4IGIA 1ZITA 1J1UA 3JAKB 3M4XA 4D92A 2NUTB 3EWNA 1H05A 4H1UA 2VBGA 2QTNA 3ANTA 2ORYA 4J2HA 3BK1A 1KP3A 1MH9A 4OH1A 5JNRA 3NBKA 1E64A 5BMOA 3GZ4A 5I47A 2Q5JA 4K6MA 3B53X 4UW9A 5BW5A 3DEZA 4EATA 2FGKA 2I8AA 1DP4A 1YMUA 3TTXA 3THXB 2BC9A 4IV8A 2VAPA 5AKHA 5I7UA 2ZJ2A 5CYOA 3N5CA 3W6NA 2VP3A 2AK3A 5FKJA 2HA0A 4JLUA 4JI0B 4KGDA 4NS4A 5A06A 1NW4A 4G81A 4EHLA 3HB9A 1KH3A 3AJRA 3I2KA 4HQ6A 4Y6GB 3WL6A 2LVBA 5E8RA 2ANBA 3L8MA 3RBZA 3B85A 4XWKA 5G53C 1VB3A 3EARA 3OCUA 1V5WA 2WSBA 1TM5E 2YHIA 4IDEA 3L77A 2QYOA 4RNDB 3TQOA 3VHLB 4DGSA 5HRAA 1XC7A 2YXDA 3AI2A 5H4HA 4XR4A 5JDCC 1X94A 2I87A 2KE5A 3OUTA 3V5NA 2KW5A 1JHRA 2GK4A 4QXMA 4R1OA 3T7AA 4EP1A 3TUJC 3OTGA 3IQDB 5AI5A 3TLBA 2D5LA 4DG8A 3T1OA 1EVYA 3WK9A 3ICCA 4W9MC 3NEAA 2PUJA 2OZEA 1E4EA 1ULTA 2P8SA 3GLTA 4UDOA 3ORYA 1LX6A 3FCUB 1T0IA 1WB4A 3N07A 4MWZA 1P4GA 4Q01A 4L0CA 3U3DA 2QTFA 5JS1A 3Q9SA 1INLA 2YWFA 4XX0B 3HA2A 5EJ9A 2F3SA 4B82A 1MIHA 5CMLA 4EB0A 1YD7A 1R0XA 4NJMB 2H85A 5ECYA 1IN4A 4L75A 2DQ4A 2B4AA 3CH4B 1MGOA 4IZOA 3F74A 5D7BA 3NHFA 4MGEA 3ENWA 2FVYA 1WCIB 1EUCB 2YFQA 2P62A 3BL8A 1JYEA 3OWOA 3QVLA 4QPPA 5GY7A 1CLUA 4C87A 1Q1AA 3G9XA 3PYXA 5DSXA 1R5JA 8OHMA 2X8JB 3RQSA 4IUBS 1Q11A 3AJ9A 3KWMA 1PNTA 3GGSA 3HWRA 5HA5A 4RDIA 3A3PA 2ATCA 4FDAA 2R5FA 2QK4A 3ABRB 4H6WA 4IJ6A 4MYCA 4UNPA 4G4GA 4Q9DA 7AT1A 5CUQA 3QWHA 4M54A 5BUSA 2X0FA 4BQQA 3A1VA 1KP2A 4GSLA 3DO6A 3O1LA 1SKYE 3FMOB 1AM4D 2XE7A 3A11A 3RYFB 1Z7YA 3C8DA 4U5QA 3KXLA 2FWBA 4RVNA 1PNQA 4MW9A 5JMOA 1R66A 1M2JA 2VPXA 1YOVB 1XJ5A 3FVVA 4E31A 3CLVA 1QFXA 3NC1C 1RAGA 1W1UA 1JDBB 4UAUA 1DOHA 4L02A 4FEYA 3A9TA 2G9RA 2C5FA 2H00A 3R5FA 4X61A 3CLUD 4B3MB 1Q1GA 1H1LA 1QIDA 2B6NA 5H82A 1C4WA 5FLXA 3K1AA 1ATIA 1DQYA 1NR7A 2DJ5A 2QRLA 2WV7A 4BV9A 5JLJA 2OG1A 3O9VA 3S2ZA 3CT6A 5AI8A 3JD2A 1XB2A 2N0SA 2QUBA 4EKGA 1OILA 2MYTA 1C3EA 3GLHB 2NUBA 4XJSA 1LLFA 2H2FA 1NIJA 4PAGA 3B70A 4B85A 1N1GA 2WYIA 1KR2A 4MB2A 4KAJA 5KYXB 3HC7A 4ECEA 2WVAA 4B75A 1PJ3A 4HDMB 1FNNA 5ALMA 3SF8A 1HT1E 2PRKA 2X5KO 5DISB 1QTRA 4TRNA 3N0XA 2PYDA 3K5PA 3LYHA 5KYUB 1U8YA 1Y1LA 4HUJA 3TLMA 1EWVA 5G1OA 2A1UB 2GF9A 4FOLA 4EPYA 5BSEA 1IY2A 3B9RA 1DVRA 3UMFA 4AZTA 3W3ZB 2WWWA 3FETA 2ZPTX 3OTIA 4UBKA 1K9VF 1L5YA 3LBHA 3L6UA 2OOSA 2C2WA 2BKLA 1U7PA 4N5MA 1BQ3A 2H2HA 1WA5A 1OWNA 4JLAA 4OHYA 3BMCB 2QP9X 3A6JA 3DR3A 3FNQA 3LOUA 3RFTA 4PYLA 3HNOA 1USGA 2IYRA 1CNEA 1U94A 1KEEB 4S1NA 1QH8B 1DZIA 3P2JA 4LCBA 4MA0A 3MMZA 5BN3B 3G2KA 1BN7A 3C8UA 4YP9A 3ROXA 1FK8A 4DLTA 3BD8A 3NIFB 3V3KA 1F3OA 3MOSA 4GEKA 4QG3A 2Q1YA 3FW1A 4RKYA 2EFYA 4YROA 2ZRLA 3VPDA 2PG3A 3B3FA 4FBMA 1IZ0A 4KNVA 4XH9B 1THZA 1HQKA 2HJ9A 2B8TA 4RH3A 1PQ4A 3FIJA 1WF6A 1YZVA 2O7QA 4Q1CA 1T2VA 5IYZA 1DT5A 1H4TA 3CN7A 4LK3A 2BVNA 2B4KA 2G7ZA 3EBPA 2PA3A 1JALA 2XUDA 4NOLA 5AR1A 2GN6A 1YS7A 2WFLA 4DC0A 3SY8A 4MDFA 2A3RA 4QDOA 3SBDA 2F9FA 3RBXA 1HT2E 3GJ4A 4NK4A 4FPXA 3WGKA 2ZW9A 1LFDB 2I2DA 3ANSA 2BGUA 3EB9A 3AFOA 4RHFA 3VR0A 3QFFA 5B3JC 4LOAA 1I4OA 4HNRA 4NMLA 2WZBA 4X1KA 5G2OA 3UCFA 2IQ5A 1MDFA 4LJYA 9MHTA 1NN5A 4ND4A 1K5PA 2CYBA 2XEDA 2R6HA 3TS1A 3GJTA 3KOXA 2XGGA 3I05A 1U2GA 1UC8A 5ISMA 5KINB 2V7TA 4QU8A 1QF7A 3K0CA 1E4EB 1I2CA 1U8FO 3P9YA 1NULA 3LNTA 1BHQ1 2PWPA 4QNRA 3B7GA 3Q2OA 4YJ2B 1WXFA 3ZX5A 1J0EA 2DY0A 4EY7A 3NVMB 3BMQB 1GTL1 4Y6LA 2Z4TA 3ANNA 3KFXA 1EDDA 3SBEA 2ZP1A 3SC2B 3MBKA 1TJ4A 1XZFA 2W22A 1U2ZA 1FE8A 3C1TA 3X1XA 1LVHA 1W4LA 5B57C 1YVUA 1LQTA 2RB5A 1A88A 4KQ1A 4LJ6A 2WOJA 5LC1A 5I7VA 1X86B 4EFNA 3IMFA 3Q7EA 3BZWA 3B6KA 3ZK7A 3LF2A 2JANA 2W4MA 1T2FA 3LT5A 3Q0TA 4MLPA 4N8DA 4QHYA 3UB4A 3CVYA 1UMBB 3PITA 5JT1A 4X1OA 4U63A 2HGSA 3VYWA 4ENSA 3V2IA 5B7PA 5BMVF 4KK4A 2VJMA 5IJZA 5AOBA 1T3ZA 1SD2A 3DXYA 4X3PA 2ZTMA 1L5QA 1WD7A 4NDAA 4QT0A 5FNVB 3ZY2A 1TD1A 5KKCA 2MDTA 1O5OA 1OR8A 2WHPA 4JNGA 4EG1A 1X1EA 3ETNA 1KFCB 2BLLA 2WT9A 1JNYA 3O47A 2IKQA 1GP2A 1KETA 3SC4A 2BOVA 2QP4A 2C4HA 4N4AA 3IA2A 4NYJR 1RR6A 4MKZA 4LYAA 4W1PA 3QBJA 3GT0A 3LZDA 5TF4A 2JFBA 4GC9A 1HDEA 1C4KA 3VV2A 2QZSA 4IX1A 2WG0A 1WF3A 4FD2A 1RIIA 4PBTA 1YS1X 4MWOA 3R74A 4AD8A 3RC9A 1PO7A 1NRIA 3B60A 1KEVA 3O7MA 1U1FA 1LBEA 1VJGA 1WQ3A 3EA0A 3H83A 3S1AB 1UPUA 1VP9A 1K89A 1PF7E 5A2GA 1H69A 1U02A 1ULUA 1G21A 2BT4A 2PGIA 4RV5A 3CW8X 2Y71A 3DAOA 2WEKA 2JLAA 1TYAE 3GN1A 3H2IA 3U4QA 5BQOA 3ZVNA 3I9V6 3KR0A 1LLQA 3NXKA 4TYPA 3REGA 1FDWA 2EIHA 3HMKA 2OO7A 2H08A 1M76A 4UUQA 5EQJB 3DCYA 3OICA 1CUHA 4YQEA 1B8OA 4BQSA 4Y9UA 3W4KA 4AECA 3OUZA 4MUKA 3QIVA 4WUTA 4JBHA 1I7DA 1OWMA 2UZ1B 1WVMA 4ZVUA 4TVSA 3ZDDA 1VLHA 1JQ3A 3RASA 4Q3CA 2D5IA 4HAYA 4L0MA 3WP1B 3A6ZA 1ILEA 1UPBA 3G88A 1FMJA 1R4ZA 4IDPA 3ZUGA 1H94A 2WLSA 2EW1A 1U7WA 2IPMA 3PGXA 4OQYA 2ZVPX 2GAOA 3AF2A 2JZOA 4N0MA 4WZAE 4CQMB 1VE3A 4HEA6 1ES9A 2TMKA 3WYGA 2IZ0A 2QPTA 721PA 4Y2GA 2ZIXB 1WZCA 4TYQA 1WLYA 1EIZA 1MN6A 1O9BA 4TLAA 1ZFNA 4YVFA 3RWMB 2XMCA 1VJ0A 2Z5VA 4XAQA 4FFPA 4TMXA 5AKXA 5FPKA 4S2UA 5AO9A 4E2YA 2DR2A 2G8LA 1RPTA 2IIPA 2RHMA 4GPEA 2R84A 5TGZA 5FBLB 3TCNA 3W7VA 1U9CA 4COOA 2J3LA 4Z51A 4AS1A 3OZAA 4JLOA 1FL9A 5LP6C 2IXEA 1TX4B 4HS4A 1U80A 2CMFA 5AKKA 1ID8A 2NAPA 3UV7A 2IGTA 2VYVD 2MU1A 2B34A 4MV4A 4I3GA 1C1XB 1L7QA 3MSXA 1COZA 2I4TA 2BFDA 1KH1A 1G9SA 2PLWA 2QV7A 2RBGA 2CUZA 2V3WA 3MOGA 4FFVA 4K86A 4WKNA 3SKVA 3SLKA 3UHOA 5EHZA 4OBWA 4JI6B 3PXCX 1WQ4A 3OE5A 5FJJA 2G7MC 4ITUA 3IOBA 3ZW9A 4F5WA 1V8ZA 3JWHA 4A26A 1QOPB 5HILA 2JCSA 2WDPA 4C0SA 4RFSB 5C1DA 1US8B 1WXWA 2H92A 1FU4A 3IIJA 3MS7A 3QBTA 1JG4A 3OU6A 4MYDA 4PRLA 4QLBA 1QZZA 2QG4A 2ZM5A 3DLBA 4ZEXA 3B7WA 3ASYA 3FCAA 4TN5A 2VDRB 1G5QA 2MINB 4AUMA 4D96A 4I08A 4RVCA 4XQCA 3ZIAA 1CP2A 3PR1A 4IH4A 3WLAA 2YFKA 1UOEA 3KLMX 1E6WA 3PTLA 4MS1B 4BCCA 2NZVG 3FWNA 1HQYE 4OD0A 4KPEC 1GUAA 3KDPA 2YWEA 3Q8XB 2JLVA 3OHPA 2IUUA 2FJPA 1DBSA 1E7RA 4FSXA 3U48A 4PINA 5GM1A 3TR6A 4F9FA 1R16A 2A35A 3B9QA 4XJTA 1J56A 3DAFA 1T2CA 2V5UA 2M6KA 1AU9A 1I33A 1NY6A 3FNRA 3HU3A 3QOXA 4H6PA 4JSRA 4RZUA 5ALNA 2BN4A 4MWSA 4MQFA 3ZHOA 4LZAA 2ID4A 1NBMD 4JB8A 1TA9A 4YAEA 4JXKA 3U3ZA 3GGJA 5IAOA 2XX3A 5A4FS 3O82A 2N47A 4Q3DA 5JARA 4TVOA 4E2XA 3QG1A 1UOPA 4ZXPA 4H7KA 1LY1A 3I72A 3C1OA 3GFOA 1PEKE 3LW7A 5BNFA 2OQVA 1O3YA 3GAFA 3I58A 4M99A 4Q6BA 5KMGA 2YHBA 4NFYA 1BW9A 4C0AC 1QK3A 2AR9A 2C4VA 3GA0A 3QKSA 2ZGVA 2Q2NA 3H1EA 4KMOA 1KI7A 1PJ8A 3QVJA 3EPPA 3ODGA 4QULA 1ETUA 4KPFC 3U7JA 4UBLA 3X3HA 4Q21A 1P1FA 1NQ5A 2P68A 5HFJA 4ZYLA 3JR3A 1U4OA 4WBSA 4ZI7F 3JQ9A 1VFPA 2ZULA 2G72A 2ZRHA 3R6WA 1G6KA 1XK7A 4MWGA 4J4TA 4QUEA 4FFSA 2WIFA 4GPAA 4Z5XA 3PXDA 2YJ5A 1QM5A 4BZXA 2B1IA 1E3EA 3GQBA 5KAMA 3VPHA 4AY6A 1QWSA 3P0FA 4G24A 4PCUA 3WYFA 5JHHB 1X74A 3NEPX 3ZI0A 4J9UE 4Z4FA 3LPCA 1X80A 4R8VA 3E9CA 2JDIA 4OMDA 3A37A 2RHBA 2YHAA 3R24A 1NFRA 2QKYA 1L7BA 4HWRA 4LW8A 3VC3A 5JMPA 3AY3A 1UJ5A 3G2MA 3W6UA 3F73A 3RIEA 2QZPA 4GICA 3CUTA 2EF1A 3G2PA 1JIKA 1IY1A 1ZCBA 1WU8A 4L85A 3QMMA 1TM4E 1V48A 2RAVA 1LFAA 1KY4A 4ZCRA 2ZE6A 2G67A 1JDBC 5GP1A 3EFOA 1NATA 3KZKA 1W85B 1JAYA 4DMGA 4YCBA 1X14A 5JPDA 2B30A 4N54A 3ZLUA 1N5MA 3ZWNA 1XJ0A 1KBZA 2UDPA 3LYLA 4LZLA 4P3YA 3NG1A 5JCPA 3W6OA 1WEHA 1L5LA 3VI4B 1G9TA 5EIHA 4NQZA 3DT8A 3P9XA 4EGFA 1C3VA 4PNEA 3VPAA 5BXQC 1GNSA 4K0RA 2OMEA 3C3XA 1M34E 1V6SA 2HYDA 3SICE 4JMPA 5LZ2A 3PX7A 1JDZA 4JBYA 1BWSA 1GTVA 1VE1A 4G1EB 3RPEA 4UTPA 3HA7A 4Y2SA 4M1TA 1R5NA 7REQA 4ZYVA 3DBHA 5JZOA 5L7WA 2WD7A 4JJ8A 1QORA 2JC3A 3PUYA 1W73A 4G0MA 4IOKA 5IT4A 3WQHA 3W05A 3S68A 4BO0A 1P0IA 3IUNA 2G4VA 3ZNQA 1MABA 1U7UA 3QWIA 4RJJA 3BCRA 4RPGA 1M6HA 3GJXC 3OKAA 4WESB 3CVUA 3KLPX 3HU2A 1GHTA 4PU0A 2F3TA 3DZJA 2RG7A 5T57A 4U3JA 2XYQA 1QBGA 3C70A 2Z2JA 1QIKA 1D9XA 3KKZA 2CXQA 4ENRA 3A6FA 3KWJA 4PLCA 1N4AA 1T9AA 4DVJA 1K8XB 2QJFA 1JQEA 2HQRA 4C0XA 4R71A 1E9FA 1MX5A 5FCDA 5KREA 3RF6A 3QXGA 4D80A 3L1HA 2P27A 5TNXA 1I5OA 2FZVA 3C7TA 4N3BA 4R9RA 3UAWA 4LV8B 2PWYA 3IAFA 5CH5A 4DWOA 5FHQA 2L0XA 4UKDA 1HX7A 1XEFA 5JQGB 3SHQA 4UFNA 4OAQA 1KQNA 4TPKA 2P5UA 4MWTA 2IPLA 4IQFA 2BE7A 2LXNA 5JNLA 1H6DA 1ADBA 1R0ZA 1RKUA 1OBCA 2Z04A 3Q3EA 1XL1A 5TMDA 3WX0A 4AJHA 2QT1A 2CLLB 1RC8A 2P75A 5F12A 2IV2X 1HFEL 4FZVA 3BF8A 3TZKA 3JAKA 3CPJB 2VNKA 2GD1O 3F4LA 3QEMA 2ZZMA 1QPGA 1R3UA 3J80A 3W4IA 1G8AA 2A4MA 4DADA 1IMOA 5C8XA 2DHQA 4Q7MB 1KARA 4YACA 3CVVA 1Y4UA 2VSOA 4NONA 3ZH2A 1J8VA 4LXUA 1DMRA 1GSOA 4PYNA 4EAAA 2EZ4A 2VHXA 5DSTA 3QX7A 1RMYA 1F1JA 2Y93A 4QBHA 3H1GA 1DAEA 1UINA 3QUAA 3U39A 1LJUA 2JFGA 2FE4A 4PW0A 3C14C 5K3CA 5KSYA 1DXQA 1W5TA 1XWIA 2E1RA 2VJKA 5FTNA 1DTSA 1HSOA 3T12A 1FMLA 2ZTLA 2R5WA 4N8SA 3G8AA 3DULA 521PA 2BGRA 3TJMA 4UOQA 4BJHB 3FOFC 2QR5A 4GMKA 2AKAB 1Y3CE 3BFVA 2ODQA 1NYTA 2ZI7A 2YIVX 1R5BA 5AI4A 5KKAA 3U17A 1TQDA 2IEAA 2WHXA 4YWHA 2EQAA 2NU9B 3RSGA 1LGYA 4DLZA 3R5HA 2IUEA 4L4RA 3T3OA 4EGJA 1OAOC 1QG6A 3EPHA 2FR1A 1J0CA 2BPOA 2OZLB 4NCAA 1HLPA 5KMGB 2CJWB 3D6HA 3I6BA 3K6SB 2LNDA 3MWGA 1Z2CA 4NYMR 4BV2A 3CLKA 4Z6KA 2GN8A 3TTSA 4DAOA 3FPAA 3VPBA 1OWLA 3UKOA 4LDRA 1BD4A 2BRUA 4F96A 5K20A 1UOOA 1Z08A 4X6LA 5DTIA 4G1UC 1FLNA 1Z5VA 2ODPA 2OLKA 2AN3A 4YJ2F 3OHMA 5AK6A 3DW3X 3PCXA 4QEKA 1F0NA 3AO0B 2BONA 3EDQA 5DT2A 4KXNA 1TQ4A 3MJHA 4MKGA 1CFZA 3PEYA 1BCSA 2QMZA 4KGVA 2P41A 4OXQA 4AKIA 4ZYTA 2I80A 1KZ1A 3C6QA 3LFHA 4JUCA 3K53A 4MYRA 5I7HA 4BJ5A 5DBEX 4R6WA 3HDHA 2ZYRA 2C9BA 1VXOA 3FYUB 4N0EA 4K9OA 3IC5A 4LC9A 5JAZA 4JB3A 1Y7IA 1PR2A 4MIKA 3RNOA 2CUTA 1F2TB 2WP8J 4L3OA 3AF4A 5KKNB 2G08A 4C5AA 4MW4A 5KTNA 4MLDA 5LQKA 2VP6A 1F7VA 5K7SA 2GD6A 4C7BA 2DH5A 3IERA 3MJVA 4J0KA 3OIUA 2QTGA 2WU1A 4OJQA 1L5VA 3PFNA 4PC6A 1E3LA 4ODIA 3S1SA 3LDAA 4KPYA 2CCKA 1JIVA 2ODBA 3BERA 3DSRA 4N6NA 3STYA 1SHKA 1ZL0A 3PGKA 2CDAA 4NDNE 4B80A 5JCJD 3HRIA 4CEIA 1NVXQ 3COYA 1D2NA 1OLSB 2QG9A 3PDUA 4ZVLA 1CNFA 4URWR 4RPLA 4RY8A 1RBQA 2YJ6A 4OQZA 2BEVB 1MVLA 3VC2A 1E2QA 5J63A 2Q27A 5JAMA 3JPWA 3ZYZA 3S99A 3C3DA 3KVOA 4O4LF 3QY0A 4YMTA 3UKJA 1YUMA 1XX6A 2V55B 3RB8A 2VCEA 1UFOA 3GNQA 2WFAA 1DOZA 2X58A 3K9GA 3L4JA 2FPWA 2MYNA 5I9BA 3UT5A 2ZJOA 1HNZB 4PLVA 3A4VA 1OWPA 4NCIA 2ZYHA 3JRNA 1FB5A 2GZ3A 1EE2A 3OJEA 3LK6A 4FS8A 5E9WA 4ZO8A 4M9SA 3WHKA 1ULBA 4MHTA 3SP1A 4EEZA 4P4LA 4MVJE 4GD3Q 2BHRA 5KTRA 4KQMA 4E5UA 3IBCA 3G9TA 1H22A 3OESA 1B0PA 3HWWA 4GZ3A 1E2MA 1WDTA 4Q3LA 2H57A 4IMPA 4BO7A 5BSGA 1AKRA 2BRUC 5JVDA 1V71A 2B21A 1G291 3NDIA 5DK6A 5KCMA 4CLOA 3S2FA 1REQA 4UHKA 2XWBF 1C9EA 5ESDA 3HS3A 3RYTC 1ORWA 3U62A 5JHGB 1X1QA 2BJHA 3NASA 3P9QA 4TSKA 3MLAA 4IO0A 4QO7A 2Q8QA 2GARA 1U98A 1WIWA 5ALYA 3OQJA 4H3HB 2AL7A 4CT5A 1QHEA 4P86A 4PSKA 4EPXA 2I3ZA 3MRSA 2FP4A 5F7ZA 4ETNA 2A1UA 1V1MA 2X76A 3WIEA 1VI2A 1TJ3A 4IZIA 2OVBA 3QI2A 2ZBEA 3T5AA 2XQIA 2BGTA 2OR3A 2W2QA 2B37A 3U49A 5ALRA 1QRDA 1T9HA 1YZYA 3H13A 3MUEA 3QUSA 4F06A 4V0KA 3PUVA 3H2JA 4XWWA 2PXHA 3KJFA 4MWCA 1JMYA 3FTNA 3PL5A 4ESOA 4NABA 2JLSA 3TK1A 5I8PA 2GXSA 2PH7A 3CIFA 3SBOA 2W6MA 4YGYA 1Y6RA 1JHAA 2PGOA 2ZI4A 2QXUA 3UUFA 4ARVA 3ZN2A 2BMVA 4A7PA 1P5FA 4BGVA 4DCNA 4CLRA 4F3KA 2R25B 2YZMA 2XMSA 1K6IA 3BBPA 4KRYA 4IKOA 4UBIA 2WHQA 3JZIA 5KU7A 4JLDA 3D8RA 4S3MA 2PT7A 3IR7A 3DMRA 3BM5A 3Q7SA 2GBCA 4X90A 2DEUA 1DIRA 3M4NA 3MIIA 3QTLA 4QSHA 4DDUA 5L95A 1ZMRA 3BBLA 3UK6A 5IDQA 5BN5B 1FFWA 4UVDA 2DB3A 4L74A 2XBMA 1DAKA 4G2NA 4U5XA 4AK9A 3G1TA 1U63A 1HG0A 5JSKA 4Y6PA 4PONA 4ERNA 3TSYA 5B37A 4PGAA 3V7NA 1VBFA 3VPSA 3U7HB 1WUKS 1D4ZA 2D7CA 3DWFA 3MT8A 4KVAA 1PZMA 2H1RA 4C0HA 3KQSA 4AG3A 5IC5A 1EA5A 2Z30A 3IR6A 3UAVA 1N25A 3N7UA 5JD5A 4U4AA 1A4XA 3H9BA 1OLOA 4LJ5A 4RKWA 2NUTA 3AEZA 4BX9A 4W7SA 1C3JA 4AMGA 2CJWA 4FYVA 2BFBB 1CZOA 3OD1A 1ECJA 4L16A 1Z6AA 5DX8A 1GDHA 5HCUA 5HQ3A 1UBCA 3KSRA 3JQRA 2IHTA 4LXHA 1U7HA 3VGPA 5C7IO 3B12A 1OV4A 3OFVA 3DHNA 4G01B 1A8IA 1DKUA 4MQMA 4ALMA 4H7FA 3N39C 1OY1A 1Y9ZA 3A06A 2H5LA 5BQPA 3TLEA 4BQPA 3THXA 1TK2A 3E81A 2OHHA 1PV2A 2ZETA 1RFLA 3J7TA 2QSYA 4NKRA 2QI9F 1BCSB 2PLAA 3ACBA 2R8PA 3VR2A 3W9BA 5J1TB 1YS9A 5FEUA 4BU1A 2AMJA 3LA6A 2OZPA 3EXEB 3KQWA 2A9JA 3NHWA 4ZTBA 3RGWS 3ZBTA 2VXBA 5HMLA 3R7WA 1N2XA 1E9RA 2IUYA 1WRBA 4V39A 4X7PA 4B40A 3PGLA 4DBZA 4YAGA 1WZ2A 2VS1A 4ZI3A 2P3OA 5IKEA 1VA4A 1I30A 4WLEA 4XIJA 1YMVA 1Y80A 4U0JA 1WUHS 4LMBA 1YRLA 3OUUA 1Z82A 2IH2A 3GFQA 3ZY3A 2M98A 3RJMA 2DFDA 2YJZA 4J29A 4QA9A 1X7ZB 1ONSA 4JJKA 2PD6A 4R2HA 4MRPA 1S5PA 4KREA 3EZLA 4LMRA 1RTKA 5I01A 3LA8A 4ITRC 1PJCA 3KSAC 1YFLA 3CONA 3QVXA 4K6GA 1A50B 3TDNA 1ISPA 1IG0A 3OIWA 5LQSA 2J3IA 2O0HA 1MTZA 1P7ZA 1AIPA 3FX2A 3DMDA 3QE0A 3R5KA 4LJLA 1SXJD 4RVFA 2OAGA 1I0IA 4RWEA 3SPXA 1P1RA 2K7ZA 3SYTA 2PUBA 4DCJA 5DSZA 4KRFA 2FYTA 4OYYA 3OZBA 2POCA 1J8YF 4D7AA 2R3SA 2VDJA 4MI9A 5AHXA 5D1HA 3DE5X 1YRAA 4PIVA 1A4IA 1T9KA 5KTPA 3BILA 5DTJA 1JPVA 3IVGA 4MUJA 2XE4A 3H8SA 3KZOA 4EITA 4EO7A 2E49A 3TQHA 2H5EA 4RY9A 4D82A 1TM7E 1XZCA 2DHRA 4KQIA 2QIPA 1GFIA 3IEUA 4B6SA 1S2MA 5IF9A 4MB0A 2AS0A 1KI6B 3O4HA 5DBGA 2W6PA 4ID9A 4XTCS 1X92A 1M2VB 4RD2A 4GDFA 1PGOA 2OO3A 2C8VA 2HHLA 2YV4A 1ZHHA 4GOKA 2VP9A 4PFKA 3SI7A 4AZSA 4M6WA 5ALLA 2WP0A 2XMRA 5MFZA 2JAOA 1LTHR 3E9EA 3KLBA 4KPUA 3F5SA 3QUBA 4DQXA 1RBYA 2J5QA 2PV7A 3ELUA 3OQIA 4E3WA 2PBFA 4XGIA 4EGAA 2IS4A 1TQHA 1BD3A 1VI6A 3L4BC 4IDQA 1WUYA 1X1TA 1XVIA 1T1GA 4XUCA 3BG5A 2O06A 3T7DA 4CDGA 4D6XA 2PHZA 2O8DA 1OIVA 1JDJA 2GHRA 4FMCF 2Y0EA 1NJSA 2ZS8A 4FOOA 5EAIA 4PRYA 4BQEA 1UOQA 1IC6A 4AVYA 3WZ2A 1XNRB 2A9FA 4MV3A 1ZAYA 1N2ZA 2FZKA 1DQRA 3SEFA 3TMYA 4LYJA 3GX1A 4IJQA 3WNCA 2J6HA 5HZHA 3EZ7A 2AE2A 3GAZA 2QRUA 1YZFA 3S2EA 3VAZA 4LVNA 3SOZA 1FTGA 4MXDA 2Q9CA 3EPRA 4KEAA 5K4AA 1K1EA 4MCAA 4CLRB 4UUBA 2O2YA 3B3QA 1GL3A 1T8PA 4QPJC 1IH8A 3F5FA 4DLNA 4NZ9A 3DVLA 4D3YA 3OZSA 2IHKA 4LHSA 2P6RA 4P2GA 4GRIA 5A7HA 4GBMA 4K9QA 1GR0A 1B2RA 4GYKA 1QR6A 2YFYA 1TNDA 3E9QA 3G0DA 3NOVA 4ENPA 4YUWA 4Z1OA 4BQOA 4HD8A 5B3LA 3OTOB 1Y4DE 3T7CA 3ZV7A 1KOLA 4RIGA 4CKCB 1ORHA 1RRVA 4MUBA 2G9NA 3AKDA 2A5DA 1OXKB 1R0CA 3OOYA 3U9LA 1E8NA 1E3WA 2JKZA 1AQYA 4B84A 3KKQA 1E62A 3SC3A 5KO2A 1Z0SA 4G89A 3OIYA 1CERA 5LQUA 3QPDA 1NW6A 2AG6A 2FN7A 3HVKA 5E2IA 4UU8A 1MO4A 2J87A 4OMCA 5E0OA 3KB8A 3WHIA 1ML3A 3R3VA 5DM70 2IXGA 3NNDA 4OI4A 5DGIA 1R0BA 1FP4A 3VYTB 4GXTA 3IEIA 1A9TA 4R2XA 4DQUA 4EHKA 3ELWA 3R77A 4R1LA 3BH0A 4O8ZA 1G4AE 1KMNA 2IRWA 2PX2A 2GBPA 1KKLA 1Z15A 3Q7RA 3W8RA 4FC6A 1JHQA 1KK3A 3TIFA 2CEKA 3KU4A 3HU1A 3ICWA 4QZVA 5F7JA 5EEHA 3AUYA 2R7MA 4REQA 3NZEA 3LH5A 2G1KA 3JQ8B 4Y2VA 1Y5MA 2Q5LA 4G85A 3ZCXA 4WZ6A 1QPZA 3IX7A 1SXPA 2IIVA 4RKQA 2I2FA 1ZGGA 4BNNA 3VC7A 3IV7A 3VOTA 5IWAB 1ZIPA 1DQPA 3FZQA 3TZQA 3CQ9A 1RQ2A 1Z34A 4IDHA 4PEVA 3K7EA