2GGSA

Crystal structure of hypothetical dtdp-4-dehydrorhamnose reductase from sulfolobus tokodaii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
MRTLITGASGQLGIELSRLLSERHEVIKVYNSSEIQGGYKLDLTDFPRLEDFIIKKRPDVIINAAAMTDVDKCEIEKEKAYKINAEAVRHIVRAGKVIDSYIVHISTDYVFDGEKGNYKEEDIPNPINYYGLSKLLGETFALQDDSLIIRTSGIFRNKGFPIYVYKTLKEGKTVFAFKGYYSPISARKLASAILELLELRKTGIIHVAGERISRFELALKIKEKFNLPGEVKEVDEVRGWIAKRPYDSSLDSSRARKILSTDFYTLDLDGMVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of hypothetical dTDP-4-dehydrorhamnose reductase from sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Oxidoreductase
molecule keywords 273aa long hypothetical dTDP-4-dehydrorhamnose reductase
total genus 95
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ggsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2ggsA02
1N9GA 3OQ1A 4WLUA 3PZBA 5IZ4A 1I3KA 4F6LA 3JYLA 4CMBA 2NU8A 3W4KA 3EZYA 4CM5A 4E5YA 4BKRA 4DIOA 4RVUA 1UZNA 1I2CA 3DL2A 2ZATA 3OIGA 2AXQA 3IC5A 1NM5A 4R69A 4OM8A 1F17A 1RYEA 4IDGA 4E5PA 3VKVA 1H9BA 4PG8A 4F45A 1SEPA 1GQ2A 2ZCVA 1ZSYA 3PHJA 4OKIA 4ID9A 4YB8A 3GGPA 4D46A 4KQWA 2AQKA 3E82A 3OETA 1MFZA 4LISA 4PRLA 4CR7A 3ONFA 3WWZA 4E2YA 3GZ4A 5BNTA 5AXDA 2DUWA 5IN5A 4JN6B 4BKPA 4BNGA 1XHLA 5DBFA 2Y0DA 1NWHA 4H3VA 1Y8QA 4J3FA 2ET6A 1SB8A 1W4ZA 2YHIA 5I7FA 2FR1A 3G1TA 3R3SA 5BR7A 3LK7A 4RPLA 1EVZA 3QV1A 4M1QA 1ZZEA 2PA3A 4J7UA 4DBZA 3TN7A 3AU9A 3JYNA 3DBVO 2LDXA 9LDTA 1OC4A 1EE2A 5KOIA 1YRLA 3FNHA 3H5RA 3PGJA 3ETGA 1M6HA 1MXFA 4OSOA 3RU9A 5A9RA 2HMTA 2VUUA 3EHEA 3LF1A 2R2GA 5B37A 5ADHA 1M6WA 2VWHA 2W2KB 4J43A 1DIAA 2BI7A 3JQ6A 5JYDA 4W6ZA 2HRZA 2HU2A 3AUTA 3MTGA 3OEWA 4XR9A 4BQPA 2NQ8A 2W98A 2D4AA 1E7RA 3NDRA 1GYRA 1GU7A 3JQBA 5C7OO 3B1FA 3JQCA 3NTQA 3H9GA 1YOVA 2EXXA 1NVMB 1NPTO 2ZJ1A 3FTNA 5JY1A 2AQIA 2VRCD 1I36A 2DFVA 3WYBA 2BF7A 2ZYGA 2NNLD 3QJ5A 2O4UX 3U62A 5A05A 2HO5A 1HDGO 2DPHA 1IOLA 1PGOA 1HRDA 1BRMA 2Y0CA 4QT0A 2RHCA 1KY5A 3L6OO 4QTZA 3KLPX 3ZW9A 3VPGA 1LU9A 3GVHA 3PLRA 5CP8A 4CLRB 5KIAA 2EIHA 1DIGA 4DYDA 4GX1A 1U28A 2O23A 3GUYA 1LEHA 1P45A 3GVIA 5T57A 4ZJUA 5I9MA 4INAA 4DBVO 2Q4BA 3JQDA 4R68A 3ZWCA 3NJ8A 4CR6A 1ZJZA 3A1NA 3NKLA 2QYTA 5AXAA 4FJ1A 1SAYA 3NV9A 3M6IA 5THQA 1DFGA 4DUPA 1GY8A 4FIZA 1Q0HA 4UVHA 1EQ2A 2JCYA 1QMGA 3ZV5A 4CQLB 3UH1A 2NADA 5ITVA 2RH4A 1YJQA 3M1AA 3CPSA 4OXYA 3WGYA 1QXSA 2V7PA 4J0FA 4R3WA 5JCXA 2O48X 2VHVA 4GVXA 3B1JA 1GZ4A 3UCFA 5K6AA 2OZPA 4NJMA 1UXKA 1FDUA 4FFRA 4QECA 3TRIA 1U9JA 1X0VA 4B3JA 2IZZA 4GQAA 4OOFA 3HN2A 2J5RA 4CM6A 3PP8A 2WD8A 2O3TA 1PJTA 2EHDA 4O6VA 1IHXA 4CM3A 4JP2A 1BVRA 4K28A 2D5CA 4M8SA 1WDMA 3NUGA 1Y5MA 1P1IA 2NU7A 4O0LA 4RGBA 3ZNQA 4XB1A 1WPQA 3DZBA 1JAXA 3JQ8B 1R0SA 2VWQA 3DDNA 3WSVA 4D3DA 4J9VA 2PLAA 4GX5A 4OL9A 3QWFA 5L4SA 3ASVA 3HDJA 1Q7GA 1YWGO 4IDFA 4XYGA 3L6DA 3DHEA 2OBNA 1ZMTA 3BA1A 5HA5A 4E2ZA 4BNVA 4PG4A 3N7UA 3C8MA 4YT4A 1J4AA 2VCYA 3ORFA 1LNQA 5CDUA 4UEKA 3AOEA 1L7EA 4U7WA 1MA0A 2ZYDA 3ENNA 1FDVA 4OMUA 1D7OA 3PJDA 1UH5A 2B36A 4FPXA 1ISJA 3TFOA 1PR9A 2PR2A 1Q2XA 2JHGA 3GNQA 1NFRA 4LN1A 1P44A 5HBRA 1RM4A 1U1IA 2GCGA 4E30A 4BOYA 4M89A 3U0BA 4NBVA 2DQ4A 1BXZA 4QUKA 2WYWA 1TB4A 3KSZO 3GQVA 4L76A 4PLPA 3K92A 4J90A 1GV0A 4MKXA 3JV7A 4JBIA 3DMTA 3JQ7A 1HE3A 3DOCA 3E9QA 3VH2A 4MP3A 3CXRA 4I5FA 3H9QA 2BH9A 4PLFA 3MJEA 3DZGA 2RBEA 4NG5A 6LDHA 1NR7A 2J3JA 4WGGA 2NVUA 1ZBQA 4YT2A 3L9WA 3GR6A 4EGFA 2V65A 4WKGA 1W0CA 2HCTA 2HDHA 3OBBA 2TMDA 3ZHYA 1ISGA 2JL1A 3INRA 4IS3A 3OSUA 5JDIA 4IMRA 1VPDA 1G1AA 5DBIA 3KM0A 5IFLA 4FDAA 1PTJA 2GUGA 5FEUA 3S2EA 3MJSA 3CTMA 2G5CA 3ZH2A 4GLLA 3KRTA 1R66A 3KYCA 2RIRA 1D8AA 4O1MA 3S2FA 3H9JA 3H3FA 3PGXA 2IZ1A 4KMSA 1E92A 1NAHA 2EJVA 5JAQA 3OEYA 1JKJA 4YJHB 2Y68A 3AFNA 4IZHA 4PCVA 3BXXA 2WTBA 5ITWA 2WEKA 1DIBA 4TQGA 3QLJA 1N1EA 2GO1A 3WSWA 3AI3A 4NDNE 4YRDA 4FN4A 5DNAA 3LT0A 1P0CA 4DWVA 2NM0A 3DEYX 1QLHA 4B3IA 2X5JO 3WYEA 2Q50A 2A4KA 1YDWA 1QKIA 4FFNA 3AUAA 5TRTA 4ZQBA 1DC5A 1T1SA 2ZIZA 4P4LA 2QIOA 1ZKMA 3V2UA 2VHYA 2X8LA 2C2XA 3PHIA 4MIOA 3GY0A 2VYVA 3BTVA 3BAZA 2CMDA 2OGUA 3C1TA 1S6YA 3H9UA 2FHSA 4BNTA 3NT4A 3QWIA 1H94A 1ADBA 1PJ3A 1R0KA 3NGXA 4RO0A 3WICA 1SOWA 1PL6A 1Y81A 2JKVA 2DFDA 1NHGA 2VHZA 2ZB8A 5I9NA 4DLLA 3FD8A 1B8UA 3F1LA 1XA0A 2W8ZA 5ICMA 4J7CA 3A06A 2VZ0A 3KYDB 1W8DA 5L7WA 1EFLA 3IUSA 3UCXA 2BGLA 2JAHA 2P9EA 1E77A 1KC3A 2GLXA 4FSHA 5JS6A 3E48A 4MKRA 1YO6A 1DIHA 1XU9A 4CJXA 4ZRNA 5DCUA 2G76A 1FMCA 3DO5A 3KB6A 1B26A 4BHTA 4E21A 3AFMA 1AXGA 4F46A 4BS9A 5KKCA 1WVGA 1J5PA 2R00A 3JQAB 1V9LA 2UDPA 3EK2A 2C7VA 4H15A 1EVYA 1TLTA 2AEMA 3IKTA 1NVTA 3KV3O 3RUIA 3ANMA 4YQZA 4E4YA 4G81A 2O3SA 1UP6A 1Z73A 4I5EA 4IS2A 5HM8A 4E3ZA 4M54A 5K9ZA 1V35A 3TJRA 1QG6A 2F1KA 4JP3A 3GA0A 4D7AA 4N5MA 3IP1A 2AQHA 2B0JA 1CF2O 1RKXA 4U6SA 1N92A 4ILKA 4CV3A 5KVVA 4BO4A 3U4DA 2IEBA 1A9ZA 3GMDA 4IQ0A 5C7IO 1HDRA 4DYVA 2BFPA 4HFJA 1B2LA 3JSAA 1CRWG 2A92A 2UVDA 4NPCA 1R12A 4OQZA 1VJ1A 2DUUA 2Q4EA 1IY8A 2IYPA 4R9RA 2C82A 2IXAA 1V3TA 3UHAA 1XG5A 4C7KA 1IHYA 1XLTA 2CDAA 2I3AA 4YAGA 3QVOA 4XR4A 2JCXA 1C0KA 1HETA 4FB5A 1QP8A 4XIJA 3DBHA 3HQ4O 4QFDA 4GWGA 3ZU3A 4BNHA 1X7DA 3KYDA 3ASUA 3NT2A 4BGEA 5L4LA 4M87A 4CM4B 3I9KA 4WASA 3D3WB 5MGBA 1PWXA 3BIOA 2NV6A 4L4RA 3FHLA 4KWHA 4Z9XA 5A04A 4IDAA 5A5EA 1WDLA 2EGHA 2P5YA 3ZU2A 1Y1PA 4E31A 1XYGA 3AJRA 5LDHA 3IL2A 5U1PA 2E37A 4BV9A 1R6DA 2B5VA 3I9OA 3BMCA 3Q9NA 3VPHA 2QZZA 2C07A 2VT2A 3GMSA 1DJNA 4JX8A 4OO3A 4UUNA 5IDXA 4RJTA 1KVSA 4IJWA 3FBGA 3HHPA 3W8FA 4DQVA 3P19A 2UAGA 3VZQA 2GPTA 4GSKA 4RCVA 1ENZA 1O6ZA 3ETDA 1MUUA 1RM5A 3OMLA 3UOGA 1IL0A 4BVAA 3P2OA 4GWKA 1EBUA 4NFSA 1HWYA 1KIFA 5F5LA 4IIVA 3EZLA 4JBGA 3PQEA 1ADFA 4J4TA 4URFA 2JD1A 4W9NC 3LF2A 2HK9A 2ZTMA 5GZ6A 1PS9A 2YUTA 2EW2A 1ZMOA 1PX0A 3MWEB 4CMKA 5BQFA 2H9IA 1VSVA 4IXWA 2HKIA 1A4UA 2ZTUA 3RU7A 4E12A 4FC6A 1EUCA 3WG9A 1TT7A 5G0TA 4CMEC 2OOSA 2X5KO 2YQ4A 4IQ8A 4IDDA 4S3MA 3TF5A 1DHRA 1I8TA 1UXJA 3GOHA 3M2PA 1HDYA 3D4NA 1JVSA 3MJVA 1K6IA 5LC1A 5TSDA 4KDEA 1IUKA 3KZVA 3Q0EA 1KC1A 4PVCA 3EMKA 2IXBA 4GH5A 3GK3A 1ORRA 1U4SA 2D1YA 3ON5A 4CMCA 3BHJA 4Y6RA 2VRCA 3L9XA 1PEDA 3VDQA 5A4DA 2ZB7A 3PYLA 1AHHA 2IE0A 4BGVA 1ARZA 1Z6ZA 3QSGA 4CLXA 2C0CA 3OECA 5TF4A 5TNXA 4NK5A 3NTOA 2P68A 4Y6SA 5L9AA 1PGQA 3JQ7B 4YA6A 1O95A 1BGVA 4WK6A 2VOEA 4W7IA 5LCXA 2ZB3A 2LDBA 3KTDA 5ILGA 3C7DB 4YCAA 4J16A 5EQDA 4BNUA 2JHFA 1F8FA 5CDYA 2CVQA 1JKFA 1JKIA 1LRKA 1SMKA 3M1LA 1ADGA 1SC6A 4P22A 4XGKA 2YFQA 5HRUA 3KSUA 3RUDA 2C2YA 3BZUA 3W1VA 2VN8A 4Y9DA 3TOXA 3UAGA 5CAEA 1HDXA 1WP4A 2B83A 4NQZA 4U5QA 3D3WA 2QG4A 2WYVA 3K5PA 2PH5A 1UAGA 1FDSA 1KEUA 2CZCA 4UVIA 5F5NA 1EBFA 1ZNQO 4EJ0A 1VKNA 1QR6A 4FGWA 4CM8B 2CUKA 2BI8A 3CZMA 3E6AA 4NIMA 4XCVA 4B3HA 4BO9A 4XQCA 2J3HA 2YFHA 1YJ8A 4LVUA 3X2FA 1PJ2A 1PZHA 3EAGA 1PZGA 4JK3A 5DZSA 4ZD6A 3SC4A 3ZHZA 2B69A 1DRVA 2FPGA 3GN2A 5IXYA 1I30A 1C0IA 1W6UA 4BNJA 4YVFA 4TRJA 1YB5A 4ND1A 4YRAA 1IZ0A 3GAFA 5ENVA 4NK4A 3ZNOA 5J23A 1PGNA 3WX0A 1MC4A 1YH3A 4QSMA 3IOYA 1J49A 2EF1A 3OIDA 3KOUA 3JQ9C 4R9SA 5EESA 1RM0A 1W73A 3RKUA 4DLAA 4YTEA 2GN6A 4RLSA 2HMVA 3JYPA 3H65A 5DN9A 1JVBA 3DBHB 2FZWA 3V8BA 1ZO8A 3U4CA 1KYQA 4FW8A 1K2WA 1CYDA 1HDOA 3NRCA 3PFFA 1X0XA 4GI2A 1KVRA 1OC2A 5JPIA 5I7EA 5JCJD 4CMHA 4KTVE 4ALKA 1MG5A 5G0VA 5JMWA 1Q1NA 5COQA 4IINA 1CJCA 2OO5A 2Q46A 2Y1DA 1LDEA 1CERA 8LDHA 2PZKA 3AWDA 1UXGA 2Q99A 5G0UA 3GRPA 3KBOA 3I6IA 2J3IA 3AM3A 3ZDFA 5G2OA 4IXTA 4D44A 2Z5LA 1LDGA 4J49A 2CNBA 2X0IA 3VZSA 1X7GA 1Z7EA 1OI7A 1MGOA 4CODB 5A9SA 4J2OA 2YYYA 2BFAA 1B8VA 1GZ6A 4RVHA 2GSDA 1PZEA 1J6UA 1V8BA 4O63O 5ER6A 2C5AA 4YT5A 3GC6A 4WE3A 2NQTA 2C20A 1ZXBA 5F3RA 5IN4A 1OZAA 1SOVA 1Z82A 1LC3A 3E18A 3SC6A 5IG2A 5JSFA 1OMOA 3VPSA 3WBBA 5CEFA 4XWYA 4BNIA 3TFQA 4MO2A 2DTXA 3X2EA 3NJ4A 3QVXA 1ZCJA 1FJHA 2O7QA 3MTJA 2DTDA 3DOOA 2XF8A 2CDCA 3ZWXA 2OUIA 2IYOA 2OHXA 3MEQA 1VL8A 2WJPA 4UVEA 3DFUA 4XQGA 5IDYA 4FQ8A 4XYEA 3ABIA 3L0DA 5COBA 3INGA 2EP5A 1JQBA 3IDSA 2FPPA 1LLDA 1GQQA 1X7HA 2I6TA 2VZ8A 1K3TA 4AJ1A 3JYOA 1HYGA 3C24A 1DO8A 1H2BA 1JWAB 3DBRA 3HDQA 3WGZA 5EJ2A 4DA9A 4RPHA 3QA9A 1EK6A 1C1DA 4HKTA 4IJUA 4FFMA 1Z75A 1Q7BA 2E49A 4EYEA 4XD2A 3I6QA 3JQGB 1JDJA 3GH3A 2V6FA 2GN4A 2EP7A 2NVBA 3CMMA 1IZ9A 4IY1A 1B3RA 3P5SA 4MINA 1E1NA 4DMMA 3FTPA 3S1LA 2G17A 3NDIA 3JQAD 1ISFA 3AUSA 3VHRA 4J7XA 1B16A 4J4HA 4LK3A 5C3MA 5F21A 1E3EA 3TDKA 2JJYA 4XIYA 4O59O 4J6FA 1E5LA 1I3NA 2ZTVA 3E9MA 3GG2A 4CM9D 5AXBA 3CE6A 1E1MA 4AL4A 1VE9A 2BHLA 2Z95A 3D7LA 1P77A 1U8XX 4M49A 2PKQO 3WGIA 3I4FA 5ER9A 2C54A 2I99A 3VTZA 1UR5A 3PI7A 3HFSA 1XQ1A 1HSZA 1A7AA 1BW9B 5KJEA 3FN4A 4RVFA 3E5MA 1YBVA 3B20A 1SZJG 4GVLA 2O50A 4FFPA 3F5QA 3BMNA 4MVJE 2O7SA 5ES3A 1PJBA 3RFXA 4ZN6A 1LSUA 4OGWA 3QWHA 5JDIC 2PWZA 2Q1WA 1B8PA 2NVUB 3TWOA 3GPIA 2DKNA 2I67A 3U09A 3CEAA 3LC2O 1GYPA 1D1SA 3ZWPA 1YL7A 4ZA2A 2W4QA 4Q39A 3DZKA 4A0SA 3I3OA 4K6FA 5KVQA 4ZVVA 4P4GA 2NU6A 1Y5RA 1ZXLA 4FFLA 3VZRA 3ZWWA 2GASA 1WMBA 2HJSA 4NFYA 1ZVMA 2QRLA 3DMTC 3NX4A 3H8VA 4NU5A 4WJZA 3ANNA 3SXPA 2FZEA 4AVYA 4BL5A 4JIGA 2Q2WA 1BXKA 2EV9A 5COAA 2GF2A 5CG2A 2F00A 3ZGYA 2Y93A 3GGOA 4MIYA 1KOLA 1NWCA 4GX2A 3KYCB 1B15A 3BTOA 4L9RA 1PJCA 1ZFNA 2EWMA 4PRKA 2SCUA 5KJCA 3PIIA 2OORA 3N58A 3KUXA 4UUMA 3KHUA 1AXEA 5HS4A 1VRWA 3OQ6A 3ST7A 1HTBA 2I76A 1YB1A 4ESOA 2VZ9A 4OAQA 2Z1MA 7ADHA 1VKOA 4ZQHA 3AY3A 5FWNA 4OH1A 3DBRB 1P1KA 2X5OA 5TX7A 1E1KA 4L8VA 5A02A 4HFNA 1DEHA 3BTUA 3D4OA 1E5QA 5FFFA 1KS9A 1YXMA 4GAEA 1NTOA 1GADO 2Q1UA 3PHHA 4WLNA 2D3TA 2E4AA 3V5NA 4N7RA 4MVJA 1GCUA 1WAMA 3L4BA 4LMRA 4B4VA 3O4RA 1GDHA 2X22A 4KTTE 8ADHA 4W82A 2D5AA 5CFZA 1T4BA 3FWZA 3K31A 5IDQA 4PG7A 3O8QB 4GGOA 3FRJA 4MVJM 1A4IA 3FNFA 1JWBB 4DC1A 1BXGB 2VQ3A 3T4EA 4EUFA 3OJEA 4CQLA 2Y66A 1MP0A 4GGPA 1M75A 5KVSA 1WMAA 4ROSA 3CH6A 3WIEA 5KJFA 4OXKA 4PZEA 1EE9A 2I66A 4FBGA 4DLBA 1BVUA 4DRYA 4HNHA 4H16A 3L4SO 5JAMA 2A9FA 4ND2A 4A10A 1IYZA 3EY4A 4O5OA 3K2BA 3WNVA 3DAGA 3O38A 5C7LO 1LLQA 1U7TA 4J2HA 1HSOA 1NBOA 3MJCA 4BNNA 4CM1A 2PNFA 4DC0A 2GYYA 1N2SA 1R4NB 3L07A 4NBUA 4LVCA 3D0OA 3AY6A 1BW9A 1P1RA 1E7MA 2AMFA 4E33A 3U5TA 1FDTA 4WNCA 3PJFA 4BB5A 3BMOA 3OH8A 4Z0TA 2X9VA 1DOHA 2Y1CA 1NR1A 1TT5B 4KWIA 4B4OA 1WXDA 3PIDA 4KUHA 4R4JA 2B4TO 4Z0PA 1OBFO 2UV8A 3RQSA 4JCOA 3R6DA 4R41A 4CPDA 1CEQA 1ZEMA 2Q49A 4GLOA 5JNLA 3GNSA 1EEHA 4D3SA 1Y9AA 3DMYA 5A03A 3AI2A 2WWRA 4PZDA 1SBYA 2HMWA 3ZWYA 4R16A 3I1JA 3V1YA 3RJ5A 1GD1O 1U4OA 3QRWA 4MOWA 1DPGA 3WOHA 4I9HA 1I2BA 1I3MA 1QLJA 2AHRA 4YAIA 4AJOA 1E3WB 1TT5A 2PFGA 3RBXA 3IJPA 4CMGA 3MOGA 4I5DA 2G1UA 4IIUA 2P4HX 3RC7A 2O2YA 3CZRA 3RSHA 2GR9A 3WQQA 2HSDA 5TC4A 3AU8A 3LLSA 4LGVA 4NH4A 2CD9A 1PSDA 2QQ5A 1PS8A 3MOIA 1T25A 4AJPA 2FN7A 1YE3A 3ZU5A 1A71A 3C1AA 4PLWA 4RF3A 4E5MA 1GQYA 3QVSA 3DZFA 3TZ6A 5EL0A 2I3GA 4QXMA 4LMPA 2Q45A 4TRNA 1EDOA 4WUVA 3VKUA 3E1KA 4MVJP 2PZJA 5L95A 1E6WA 5IXSA 2X0RA 3TL3A 4DREA 3F3SA 2HRBA 3WGOA 3GFBA 4BNYA 1LC0A 1T2FA 4BKUA 4Z3KA 2B37A 3D5QA 1B14A 1VLLA 4BO5A 3JTMA 2AA3A 2DBVO 1O94A 4DQUA 1IULA 1ZH8A 5BNIA 4YAEA 4YAKA 4ZRMA 2DLDA 4QEDA 4EJMA 2OL4A 1WW8A 3JQFA 5KNLA 4EW6A 5B4TA 5AQ1A 1JA9A 2NUAA 1R4MB 2YHUA 4WCFC 4E2WA 3UGKA 4BKOA 1P0FA 4IJVA 4BNFA 3BHIA 5L53A 1BTOA 1GV1A 4CUKA 4DQXA 1Z74A 1LRJA 2NVWA 2PD6A 4TSKA 3D4PA 3AOGA 1LSSA 1KEWA 3FCOA 3Q11A 3P7MA 2AEJA 1PU2A 1YL5A 4CM9A 1NQOA 3M2TA 4Z0HO 4E13A 1I32A 3G0OA 3G79A 1R4MA 3PYMA 4FOOA 4AJIA 5EQFA 3LT2A 3WLEA 2Q3EA 1Y6JA 1EDZA 3E9NA 3R1IA 1NQAO 4FFOA 4II3A 2JD0A 1LDNA 5JLAA 3DTYA 3GEGA 5L51A 5DP1A 3WS7A 5T8KA 3I83A 5JDCA 1XQ6A 2CFCA 1ISIA 1G6KA 5TGDA 3TQHA 4NBRA 1I01A 1SNYA 3QHAA 1H2HA 3VOSA 4F3YA 1LXCA 3ITDA 3JQGA 1MC5A 3KLMX 4WECA 4D79A 4Y98A 3VH3A 4YT8A 3TZHA 4R1TA 1EK5A 4RF2A 3BMOB 3S8MA 1LUAA 4YJHA 3DAPA 4P8RA 5DOZA 1ZEJA 2R00C 4RZIA 4J1SA 4CL3A 1AUPA 3BMNB 1PQWA 2V6BA 4QO7A 4CLHA 2WM3A 3U49A 1UJMA 3ZWVA 3BMQB 5JAIA 3ZV4A 3I9MA 3DZJA 2BELA 3HN7A 4I8XA 5AOVA 4DPMA 1QYWA 4MP8A 2XAAA 5EPOA 2W2LA 1E3IA 1BWSA 2YY7A 5IJZA 3QIVA 4WLEA 4QQRA 2G0TA 2JFFA 4CMAA 1QRRA 4LRTB 3CMCO 1HYEA 2X7HA 3OM9A 5BSEA 2DPGA 4B8WA 4YPOA 3SEFA 1AN9A 2GZ3A 5EMHA 4QO8A 3QP9A 4OIMA 3RIHA 1FXSA 4JJIA 3PWZA 1QYVA 4CM8A 4ZGWA 1N7HA 1E3SA 4UVGA 2GERA 2JCVA 2UUOA 5IF3A 1DXYA 4OSPA 3LDHA 1HE5A 1QYCA 3U9LA 4WEOA 2PTGA 1SEVA 1DAOA 4KZPA 1BG6A 4B7XA 2QX7A 3VH1A 4RPGA 3F47A 2DVMA 4MIEA 1VJ0A 4BNKA 1C1XA 2VTDA 2OP0A 4Q3DA 5TS3A 5A1TA 3DHNA 4OXNA 3K30A 2FY8A 2VRBA 4E5NA 3IS3A 2UYYA 5BSFA 3SJUA 4YRBA 3AM5A 5AVOA 4C4OA 2BFMA 5A3VA 3FPLA 3GHYA 1YKFA 4ZU3A 3GDFA 4AJLA 1K5HA 1HDZA 4HBGA 3BTSA 1ENPA 1DRWA 3R3JA 4CV0A 3HADA 5B12A 4XQEA 4RZHA 3LSYA 3R0IA 4D43A 2QRKA 4DPLA 2FR8A 5KJ1A 2ZCUA 3ITKA 2POQX 1U3TA 4FGSA 5H81A 5T67A 2XPCA 3TSCA 2D0IA 1TI7A 4J1QA 1YQDA 5HWSA 2FSVA 2W90A 4B79A 3OHSX 4PLVA 1UAYA 3AY7A 2AEFA 2NTJA 4L73A 1MLDA 1ENYA 3B6ZA 3FWNA 1UP7A 3PWKA 1H6BA 3ZHBA 4GX0A 1ZSNA 5L3ZA 3ICCA 3WMXA 4EUHA 1EVJA 3C85A 3H3JA 1C1XB 4LW8A 1RYDA 1X1EA 3VAZA 4CLDA 4Z3DA 5B4UA 3PQDA 3HDYA 2C29D 3BYZA 3ZWAA 4R51A 4BUCA 1WNTA 3G49A 3NAQA 1I3LA 2EG9A 4I08A 3SX2A 4DVJA 4WOKA 1Z45A 2HLPA 1ZUD1 3HFGA 4RPJA 1LLUA 2WSBA 4WLVA 2H63A 4IM7A 4GL4A 3WJAA 4PLCA 1TVEA 2VYNA 3RUCA 1JN0A 3RC2A 2ZYAA 4EEZA 4YQYA 3OJFA 4RPKA 4J9UE 1N5DA 3ETEA 1B7GO 3WIDA 1NVGA 2X6TA 5JE8A 3I23A 2FMUA 3JD3A 4ZQFA 2Y1OA 2ZTLA 4WCDA 1PR3A 2HAEA 4M86A 1TXGA 5TJ9A 2ZK7A 1VM6A 3H5AA 2BD0A 4YJFB 3L77A 4MJLA 3LT4A 2PD3A 1I10A 3SLKA 2H6EA 4R1UA 1GUZA 4BNZA 2D59A 2GN9A 3MJTA 2BKAA 1XELA 3JQ9A 1DC4A 3ONDA 4TZTA 4YWJA 4XEHA 1RM3A 4CLOB 1YVEI 5A06A 5JAZA 3PXXA 3AW9A 1DB3A 2P4QA 3ROQA 3PJEA 1QYDA 3Q2KA 4EITA 3HG7A 5TT1A 4FJ2A 4JJGA 3GF4A 5GMOA 1CIVA 1HDCA 1OFGA 4GMGA 4MDHA 2C5EA 4PIVA 3RUHA 3O26A 2BGKA 4L4XA 3ROKA 4RVDA 5K6AC 3D5TA 1FF9A 3ZV6A 5JBIA 1XSEA 2GZ2A 2DBQA 3GPDG 4TWRA 5KCZA 4D45A 4G65A 4Y8VA 4YJGB 5HTOA 5A9TA 1T2AA 2VTEA 4ALIA 3RBVA 1DC3A 4B4WA 3F1KA 1ZW1A 5CPBA 4A73A 1UDCA 3OFSA 5JXWA 5C5IA 2E6UX 5KWEA 1U2DA 4AG3A 3VPXA 1J0XO 3GDOA 4EI2A 5JC8A 2YHIB 3ENKA 4CMIA 1U5CA 2QYSA 5LDGA 1O9BA 4GPD1 5CDTA 3W4JA 3V2GA 3ZI0A 4OKNA 3IAHA 3DOJA 3ZNPA 3L6EA 2WD7B 4BMVA 4RF5A 2Y1GA 1YBMA 2PY6A 1U7HA 1YBAA 3WB9A 3UICA 2IEDA 4NJOA 1AGNA 1O89A 1HEUA 4R1SA 2CY0A 3IJRA 3NYWA 2ZQYA 4J1NA 4YEDA 1ONOA 2OP1A 3RBZA 4ZHSA 4EUEA 3GNTA 1LRLA 2VHWA 3PHGA 3DXFA 1TEHA 3WQSB 3GDGA 3RC1A 3PJGA 2EEZA 1NYTA 2FSSA 2VWGA 3RI3A 5KVCA 6ADHA 2ZJ0A 5A9SB 5AYVA 5L7YA 4AJ4A 1NPYA 2EERA 1GYQA 5EERA 1N9GB 3JQ8A 1F14A 1Q0LA 3H4VA 2FP4A 2IRWA 5DOVA 4CMEA 4YYZA 3FSRA 4XGNA 4J4BA 1SO8A 4KUGA 1D4FA 3LQFA 3ZV3A 1K89A 1MFPA 1GAEO 1U3WA 1V3VA 3KYBA 4U6QA 1EFKA 5BSHA 5KTKA 3QY9A 3QWBA 4MVJI 3O03A 1T24A 3WR5A 4CMJA 2HMUA 1E7SA 3S2IA 4OYRA 1LDYA 4CQMA 5JYEA 2Y1FA 5DCYA 3ICPA 1UP4A 1NPDA 2PH3A 1C3VA 1HZZA 1P3DA 1EZ4A 1PGJA 1XGKA 3WGQA 3PYXA 4MVJH 4Q3EA 4HWKA 3OIFA 4N18A 1DDOA 1QV6A 1SPXA 2FOIA 4A7PA 2O3JA 2YW9A 4G2NA 1XEAA 2HMSA 1ULSA 1ZK3A 1O0SA 1BDBA 4CL8A 5A3JA 3F9IA 1E0DA 3EYWA 3ZHXA 4MP6A 2ILTA 2QRJA 3RROA 3GT0A 3AK4A 2Q2QA 3EC7A 4NFHA 1H9AA 3A28A 4A03A 1CQJA 3ZWNA 2VWPA 1X14A 1JLLA 4PLTA 5IZCA 1CWUA 2EGGA 2RCYA 3NTRA 4MVJD 4XYMA 4PLYA 3VVCA 4IJKA 2IDZA 4HY3A 3UFXA 1IB6A 4YJGA 2BRUA 2C7GA 3F46A 2O3QA 2ZKLA 3EUWA 2PD4A 3WQRA 1P1FA 1YL6A 3I52A 3WGHA 3LYLA 1T4DA 1YOVB 2XXJA 1V0JA 2YJZA 2VUSA 3GAZA 1I2ZA 4JXKA 4CR8A 4H7PA 3WGTA 2CF6A 4B8ZA 2PGDA 3NEPX 2PZLA 2DC1A 3FR7A 4ZQEA 4NU6A 4YJDA 1VSUA 5F1KA 1YS4A 3K96A 4JQCA 5JFOA 4MPDA 1YDEA 3EW7A 1R37A 2NTNA 4W99A 4RV9A 4AJ2A 2DM6A 2X1HA 3GZNA 4I9NA 4CLRA 4BNLA 3C3XA 1ONPA 4BO7A 3UCEA 3WMWA 1PS0A 2CVZA 3H7AA 1QORA 3CSDA 4PZCA 3OF2A 2YV2A 1F06A 4NNJA 1RJWA 1XWFA 4IDCA 4FC7A 1PJ4A 3ANLA 3TOZA 3GHHA 4DIBA 3E5RA 4XZ3A 1O5IA 2VYVD 4Z6KA 5I8WA 4LCEA 3VPFA 2JAPA 1HE2A 3LU1A 5I8ZA 2HK8A 2HK7A 1BXGA 3HNPA 4K1LA 1LI4A 3Q2IA 4HX5A 2EKPA 1FDWA 1H6AA 1D3AA 4WCFA 3INTA 1MX3A 2X9GA 4GMFA 3JQFC 5JO9A 4A5OA 5C37A 3RKRA 1E6UA 3DZIA 1DHTA 3UVEA 4FJ0A 2AG8A 5DCWA 2AW5A 2OXIA 1KVUA 1H6CA 3N74A 4PLHA 4Y67A 1UXHA 4XJTA 4D3FA 5TT0A 2YDYA 3RJ9A 2R6JA 4JROA 3Q9UA 3LZ6A 5DULA 4UUOA 1LQTA 5TQVA 1KY4A 2NTVA 4G5HA 4N5NA 1M76A 5IZCC 2NU9A 4BGIA 4XDYA 4TRRA 3QWAA 3TZCA 4CUZA 3ZNNA 3HUDA 1NHWA 4B7UA 4UUPA 4MVJG 4LSMA 4IUYA 4I5GA 4RF4A 1PL7A 1BHSA 1VL0A 3JQAA 3U4IA 4U0JA 3ZWBA 2VYND 2P9CA 4RQUA 1Y7TA 1Q7CA 2P2SA 5THKA 3PPIA 2H1SA 2I9PA 5CPFA 3ZN2A 1E3JA 4E32A 1T1RA 4ZQGA 7MDHA 2X23A 3NDJA 1HYHA 4WLFA 5ILOA 1QV7A 1E7WA 2PKQP 1PL8A 3BMCB 3ZW8A 3OQBA 3AUUA 1K6XA 3TZQA 2QW8A 2WE8A 3JCZA 1KERA 4DL9A 5A5FA 5DF1A 5U4QA 3ZCXA 3Q1LA 5L4NA 5KKAA 3FI9A 4BB6A 3BHMA 5JO0A 3CINA 4OJNA 1H0KA 4MVJF 2DBRA 3PVZA 4BNMA 4NJMB 1LA2A 2I65A 4R1NA 1MB4A 3WYCA 1NQ5A 3JD2A 4QX6A 4L0QA 4ALLA 4A2CA 1NAIA 3IP3A 1LDMA 3TNLA 5FI3A 2V6GA 4AFNA 4I1IA 1H6DA 2OBYA 4DIFA 1RPNA 4NHEA 3GLQA 4XQ9A 3GVXA 3T7EA 3PK0A 1UZLA 4N5LA 1YQGA 2DTEA 2FR0A 3UUWA 4BO8A 5GY7A 1H5QA 5K0ZA 3PWSA 5GZ3A 4IPTA 4BMSA 2X0NA 3STHA 4CLOA 3A4VA 1AHIA 5G0WA 2WYUA 1ISMA 3DB2A 5H82A 1ADCA 2O3UA 2IODA 3PQFA 2NLOA 2E82A 4ALNA 4BGUA 1R0LA 2GD1O 1KVQA 1PJSA 1ENOA 1LQUA 1WWKA 2PGLA 3W8DA 5G4KB 1K0UA 5L45A 3KEOA 5CHEA 2AQ8A 2B4RO 1NFFA 1A5ZA 3QVTA 4HFRA 3RWBA 5CDSA 4YJFA 1XIVA 2YV3A 4P4NA 4LRSB 4D42A 2Y0EA 1JU9A 2CDBA 2RH8A 3DBLA 3TZKA 3EVNA 2VOJA 2Y99A 2YZ7A 4UAGA 4Q3BA 3B1KA 3KETA 4GBJA 3I4CA 1LJ8A 2TMGA 1DLIA 2JD2A 3PLNA 1I0ZA 1WZIA 3EVTA 4R01A 4DTIA 3K9QO 4GSLA 2X58A 3MZ0A 3A14A 1VI2A 2BGMA 1YQXA 4TKLA 1PZFA 3NT5A 1M67A 1DRUA 2DAPA 3L4BC 3K6JA 4FCCA 3FNEA 4W4TA 1LLCA 5JC1A 2W2LD 4TKMA 1MG0A 3DBLB 3CUKA 1ISHA 3GVCA 3VTFA 4Q9NA 4BKQA 4NI5A 1X15A 3H9EO 1ZK0A 4PGFA 5JY6A 1R15A 3UF0A 2Y1EA 3PRJA 1A27A 2QHXA 3F5SA 4TROA 4XYLA 1DC6A 2XOXA 1HXHA 2ZB4A 1IPEA 4RDHA 4YBZA 5TJHA 2OFPA 2GN8A 2Q1SA 1WLYA 4CUJA 3DTTA 4FS3A 3KSDO 4XRGA 3OJLA 2O2SA 1A72A 3W8EA 2NACA 1UUFA 3DC2A 3RUFA 4S1VA 4L75A 4W7HA 5I9LA 1T26A 3GEDA 3UKOA 1CDOA 2ZQZA 1VC2A 1DJQA 1I33A 4IBOA 4TVOA 5JW6A 4B4UA 1ZSVA 4K26A 1T2EA 3JD0A 4ALMA 1E6EA 2NWQA 1B3BA 5CEJA 3RFVA 4D0SA 2D2IA 5TIIA 1I5RA 4DGSA 3RUAA 5ENDA 5T5QA 5T6BA 1FK8A 1C0LA 2B5WA 3QVWA 5L40A 1NXQA 1NNUA 1F12A 4U0KA 2H5LA 3DAFA 5CEEA 1P1JA 2GZ1A 4AJHA 3WLFA 5ICSA 4WOJA 2Y67A 2AE2A 4KDFA 4AJJA 2VHXA 4PN3A 1U5AA 2NSDA 4B7CA 1XU7A 2B35A 1DFHA 1Y9EA 2DT5A 2EJWA 4WEQA 1HL3A 3WBFA 5DP2A 3WJ7A 5F1OA 3WDSA 2QZ9A 3IIEA 4AICA 3PEFA 1DFIA 1N1GA 3PDUA 2CF5A 3MWDB 2BMAA 1Y8QB 4XDZA 3VDRA 1RWBA 1PJQA 4X54A 1OOEA 3WFJA 2B4QA 4KUEA 3GGGA 4NBTA 4CV2A 3PFWO 3RASA 4J1TA 4C7JA 1S7CA 3UXYA 3OJ0A 5T64A 1DSSG 4JJFA 4RLHA 4ND3A 4R5MA 4BO6A 4BNWA 4IQGA 1R16A 1E7YA 1D1TA 4K9DA 3CIFA 5IAAA 4DPKA 4J0EA 2P91A 1KBZA 1GPJA 1F0YA 3HJAA 3JD1A 1QYXA 1BMDA 1G0NA 4CLEA 4LCJA 2YV1A 4TVBA 4BO1A 1ID1A 1NFQA 2A94A 5CG1A 4CV1A 1G0OA 4AJEA 3I9NA 3ZWMA 5FF9A 4AJKA 3D1LA 4UEJA 2FRDA 2J3KA 1BSVA 1U3VA 3E8XA 4EBFA 1M2WA 2VNAA 3G17A 2X0JA 4BQRA 1ZK4A 3EDMA 4EZBA 5H83A 3U3XA 3FR8A 1KEVA 5F1PA 4XRRA 1H93A 3K2EA 3FBTA 4OOEA 1YONA 4NR0A 1GZ3A 3VH4A 2Q1TA 1UDBA 4JLWA 3F6YA 4EJ6A 1KVTA 3DZHA 3WNQA 1HKUA 1IE3A 1HF3A 1C0PA 4HP8A 3IUPA 5U9CA 3E03A 5GZ1A 1PQUA 1HZJA 2EKQA 2I5PO 3HWRA 4YXFA 2WDZA 3P2YA 1LSJA 1ONNA 1WDKA 5CDGA 4RQTA 2YDXA 3I9LA 4QFCA 4Z9YA 2GGSA 3JD4A 4OHUA 4R5HA 4BIIA 1O8CA 3VZPA 1GEGA 3SLGA 4E5KA 4JNKA 5BNFA 3ULKA 4HXYA 1A7KA 3GZNB 4XGIA 1Q0QA 5EN4A 3GEMA 4L4SA 3WWYA 2AE1A 3T4XA 4BO0A 3LC1O 3F4BA 5AXCA 4RL6A 5DT9A 4FD3A 2HUNA 1X1TA 5BT9A 2P9GA 3GUCA 4NZ9A 1EUDA 4KQXA 4A27A 9LDBA 1GUYA 3OP4A 4IMPA 5JDCC 1PGPA 4BO3A 3LLVA 4WNIA 4K6CA 2X9NA 3TPCA 4E2XA 1C14A 1HT0A 2J5QA 1KEPA 4CM7A 3V1UA 4P38A 4CQMD 1LX6A 2EKLA 2O4CA 3RVDA 1LDBA 2CVOA 3QW2A 3WFIA 1XR3A 3IMFA 1EVIA 1ZJYA 3I5MA 4ONEA 3HZZA 3MJ4A 5FYDA 4E0BA 3CKYA 1PIWA 4XJSA 3HB5X 1U2GA 5G0SA 5DBGA 4U8GA 2Y05A 2GNAA 1B0AA 3Q6IA 3GN1A 3PHLA 4HFMA 2RHRA 3QE3A 4RDIA 4J91A 4A26A 3W4IA 5BSGA 1L7DA 3WTCA 3AOEC 3MCVA 1TA4A 3RAJA 1CQIA 3OJOA 3UW3A 4D0RA 4UEOA 3H2SA 1U8FO 3OA2A 4ND5A 3S55A 3VC7A 4F6CA 2PK3A 1T2DA 4D41A 2E48A 3WGGA 1LBEA 3DQPA 2WD7A 4ITUA 4DMLA 4IGEA 1P9LA 3H5NA 3F4LA 3T7CA 4UREA 3ZWOA 1F8GA 4RVSA 1Y8RA 4EEXA 1SB9A 2EW8A 1E3LA 4PFJA 4XYBA 3GVPA 1XKQA 4HADA 2J5KA 1EUZA 4IGFA 4JGBA 4II2A 3DR3A 4HNGA 3AM4A 2DBZA 1M66A 4HV4A 1E3WA 3ROMA 2J6IA 1XCBA 4KP7A 3B70A 3RCBA 2X86A 3SVTA 2YQ5A 3V2HA 2G82A 1L1FA 1JTVA 2JFGA 3IQDB 2JFHA 3KEQA 4XA8A 4Y6PA 1R4NA 2HQ1A 4BNXA 5MDHA 2PGJA 1SCUA 4UVDA 1P31A 3C7AA 1GL3A 1DIRA 1LSOA 2BLLA 2O3RA 4BO2A 2WMDA 1T2CA 5B1YA 5JMPA 3AI1A 4IZIA 3COSA 3G3EA 1KETA 3D3EA 4WCFB 2RAFA 1YGYA 4WLOA 1OAAA 1VL6A 5G4LA 5EINA 2VNSA 4IDEA 4PLZA 2P5UA 3C1OA 4MKZA 5TLSA 1PQPA 2GRAA 1UZMA 3IKVA 3RUEA 1EQUA 2C59A 2Q2VA 5I7VA 5EIOA 4WPGA 4RORA 2CSUA 5HS6A 1HLDA 4HUJA 4RVGA 1LTHR 3HSKA 2UUPA 3PZRA 1PWZA 3RD5A 5DDIP 3LVFO 4YAJA 3H6KA 3K73O 1HLPA 1VJTA 3JQBC 4NBWA 3ADOA 4PG6A 3ZZNA 3I9JA 3PTZA 1AE1A 2HJRA 3UN1A 2PV7A 3HB4X 3OA0A 4UULA 1NQTA 4I9UA 4NMHA 4CMIB 3O9ZA 4XB2A 3ADPA 3U4HA 1GPDG 2X4GA 2DU8A 4GKVA 3KO8A 1E7QA 4ALJA 4Q3AA 5B4VA 2VUTA 2OMEA 3HDHA 1UXIA 1GTMA 3H2ZA 4FOSA 4TMFA 3OICA 3PDJA 4W9NA 5I7SA 4ZICA 4FR5A 2J8ZA 3KVOA 1X13A 4R3NA 1V3UA 2VT3A 1K6JA 1IPFA 1DAPA 3BMQA 4R54A 1WZEA 1ZK2A 2PZMA 3G1UA 5KJ6A 4XKJA 4TRMA 3V1TC 4IDBA 4OQYA 1CETA 4KOAA 1GCOA 1HE4A 3HE3A 3LC7O 1V6AA 1GFSA 4CM4A 3EGOA 1P1HA 1N8KA 1U3UA 4PG5A 4Q3NA 4PVDA 3LT1A 3TL2A 1Y8RB 2WE7A 3K8ZA 3W6UA 3WXBA 3ZU4A 1NX6A 4PLGA 3ROPA 2BFOA 3JQEA 3DHYA 2FWMX 3Q3CA 1N7GA 1ULUA 1GUFA 5L7TA 4GKBA 3DWFA 4JBHA 3D64A 3FNGA 2W2KA 1P33A 5G4KA 1DLJA 1UDAA 4YDRA 1NASA 5FI5A 4EDFA 3O8QA 3SBOA 3VVBA 3FF4A 4XX0A 4CQMB 1MXHA 3DONA 3NGLA 1EMDA 3WTBA 1A9YA 1ML3A 1MV8A 4N54A 4ND4A 3KXDA 4Z9FA 1YB4A 4L74A 4YACA 2Z1NA 4AJNA 4TZKA 1JAYA 1ZIDA 1E1LA 4Q3CA 4BMNA 3S2GA 3ONEA 3GFGA 3QQPA 1I24A 4DXHA 4YR9A 3DFZA 1PJLA 1GR0A 1NP3A 2D8AA 5T8KC 2XXBA 1P74A 3FPCA 3JYQA 1QSGA 4E6PA 3C7CB 1JW9B 2V6MA 3A9WA 3RC9A 5JCJA 2AG5A 2PKRA 3W6ZA 4LSWA 1ZK1A 3GRKA 3RFTA 2A35A 4BV8A 5IDWA 4M55A 3SJ7A 2FPIA 1C1DB 2IZ0A 1Z7BA 1DBVO 1XDWA 2GDZA 3GG9A 1BDMA 1GEEA
chains in the Genus database with same CATH superfamily
1N9GA 3OQ1A 2RGDA 5J5AA 3TLGA 2W5UA 1QP4A 2QTVA 3MTEA 2VYFA 1Y6QA 5EZ5A 3JYLA 1XBTA 3W4KA 1TNDA 3K6SA 4CM5A 3K1TA 5CCEA 3ED5A 1GTRA 1N4AA 3OESA 1I2CA 3OIGA 3IMCA 5H68A 1G8FA 1YCGA 3X44A 4OM8A 1K6MA 2D5IA 2FDXA 1T6NA 2VJLA 3MUNA 4I0WB 3AF6A 4IDGA 1VE3A 2BL4A 1YA4A 2Z8YA 4I66A 4F45A 4HLCA 5GM2A 3PHJA 4D46A 3GGPA 3AVOA 2F3QA 3MJHA 5E3IA 4B3TB 3E82A 3PICA 4E2YA 1ZJJA 3WWZA 5EJ7A 1A9QA 1GPYA 2QYOA 2DUWA 3SJCA 1H1DA 2XOKA 1XHLA 5DBFA 1WHTA 5LA6A 4EATA 4BATA 3B2NA 4A9AA 3R7NA 4ZCQA 3FIUA 1SB8A 1KPHA 1W5EA 4Z1OA 1GG2A 1JQJC 1W4ZA 3VSCA 4FM9A 5F7OA 2FPSA 1YZHA 3ETNA 1NSFA 1YQEA 3S2UA 3R3SA 1QF6A 4TLCA 3DOUA 2UYOA 4MUFA 1EVZA 4ZYUA 3ZX4A 5L6LB 2PIDA 1Y6FA 2QX8A 2JZNA 3GJ4A 3VV2A 1EUCB 2ERCA 1W36B 4ZK2A 2WY2D 5AOAA 1NP7A 1EE2A 4MV3A 1X9GA 1FVOA 5KOIA 1X7WB 4G5SA 2ZIFA 2GPBA 3DE4X 1AKMA 3ZY3A 4DYHA 2J59A 1MXFA 1OGIA 1UPBA 2PM8A 2PZ8A 5ADHA 1YACA 2QP3A 1BA3A 4MYHA 3W06A 1VPWA 2CC2A 2ZDGA 2BI7A 1ZZGA 1E2IA 2QM8A 1R8YA 1S4MA 2GB4A 3AUTA 3FA2A 1JWLA 2UU9B 4EFKA 3SNKA 5EQTA 1BWRA 1E7RA 3PWTA 3NDRA 1WZCA 2XDQB 4X44A 1WSWA 3O7MA 3WA7A 4D9FA 1XPUA 3GPLA 1CS0A 1TZJA 1G5TA 1SVKA 3KX2A 3X3HA 4B48A 3Q12A 3RTDA 3SWWA 5D86A 1J1UA 2F9MA 1UWCA 1YOVA 4YP0A 1NVMB 3ITEA 5CB4F 1IJBA 2ZI6A 4IYJA 3WYBA 4HMOA 4G56A 2V4ZA 2IHTA 3U62A 1E61A 2NSJA 2O4UX 5H5JA 1HDGO 4NV0A 5K05A 2DPHA 1IOLA 1PGOA 4EX7A 1A1VA 3N6XA 3S4YA 4QHTA 1W5SA 4LYHA 4YCJA 5BUZA 5LL6P 2FEMA 2YRXA 1LU9A 3M4ZA 2PXXA 4CLRB 2GTHA 1ZD5A 3E53A 3E3OA 4X90A 3AZPA 2PRKA 3FDIA 2AKEA 4UATA 3TZEA 3BWMA 3G85A 2P11A 1KI1A 2XIQA 4M1TA 4X8HA 4ND8B 4R31A 5GVSA 3WAKA 1QGUA 1Y34E 1YT5A 3ZWCA 4CR6A 4JEHA 4K86A 1XTJA 2PX3A 3E9DA 1XALA 1WRBA 4KZKA 4NCHA 3GXBA 4EBBA 1GJRA 2QYTA 3BDIA 3G0CA 2HR1A 4FJ1A 1G1MA 3UFBA 3M6IA 4DDMA 3L93A 4MVXA 4WZAA 1GLGA 4DUPA 1MR3F 1CNMA 2OFWA 5I7WA 2AR9A 4I99A 5BV1A 1QMGA 4E14A 2YR0A 1YMUA 3DO8A 1HOXA 1UBEA 4I4LA 4KNVA 1E9VA 3WNQA 1W93A 1IIRA 2VP0A 2YWBA 3DLIA 4RK4A 5K2OA 3CPSA 3WGYA 5C8ZA 3ROZA 1UPAA 1XK6A 2GVNA 2ZZKA 4HAZA 4XEUA 1O87A 1QXSA 4J0FA 2SHKA 4NMMA 4R3WA 5JCXA 5EP2A 3A3OA 2R6CA 3IVMA 4PXAA 1SUEA 1LZLA 1C29B 3RAGA 1GZ4A 3QXSA 5K6AA 4PW0A 4OHRA 4Q4AA 5F2NA 1ZG3A 2QTBA 3HMKA 2WAMA 3NLLA 4QECA 3AR6A 4Q1EA 1L5LA 1DV1A 1K7CA 3QI7A 4ZGBA 2ZIGA 3A4LA 4TLLB 2NAPA 4EUNA 3LV8A 4LV5B 1HKHA 5EFZA 4HRXA 1OE0A 1MRSA 3DCYA 4O6VA 5AW2A 3OSZA 1P2VA 1XKXA 1DQNA 2ZB2A 1BKYA 5FTJA 4JELA 1VI5A 2BDTA 5LXTA 2VI5A 3I76A 2FP4B 1E2JA 4RGBA 2B98A 3NBUA 3PNYA 2JEOA 3ZNQA 3DZBA 3EXG2 1XRLA 3EOAI 3CUEF 3E9EA 3JQ8B 3RF7A 1JFRA 2QS9A 4N03A 3EW9A 4BCCA 5CFPA 3QFRA 5YASA 4D3DA 3HO6A 2NG1A 3ODGA 2GF9A 3CNOA 4ZVOA 4ENPA 4D25A 2QG9A 1IUOA 4PO3X 5M7EA 1HQKA 1EBBA 1S2DA 3ABOB 3K2IA 4G8BA 1DTEA 4U2FA 1YZLA 3ASVA 3WL7A 3D3KA 4EI8A 1EFVB 1P9OA 1Q7GA 1UIRA 2HSZA 2V6JA 2QLBA 5A6VA 1N2CA 3L6DA 2COKA 4IYRA 3U7QB 3DXZA 1A4XA 2HIGA 4G5XA 3LVQE 4HRAA 5HA5A 1C80A 4L4YA 5BMVA 3BSFA 3WNBA 3HU1A 5HZMA 2VDNB 4YT4A 1JBEA 3W34A 3ORFA 2ONKA 1C9NA 5CDUA 3HL0A 3ZDXB 2A0YA 2B4YA 3RYCB 4FMCF 2VTBA 3AF3A 1L7EA 1MA0A 2ZYDA 4S2UA 3WIVA 1D7OA 2HU5A 4AQYB 1UH5A 4NOLA 3IAM1 2Y3IA 3NAMA 3TFOA 1LPOA 1T6ZA 2PZGA 1COWD 2J87A 3U60B 2JHGA 4JI4B 4LN1A 1P44A 1TMKA 3OQHA 3UUGA 2GCGA 2WM2A 3T9DA 4GP7A 1KXZA 3IAM6 4BOYA 1PZXA 1U7XA 5D3QA 1BU8A 4NBVA 5CT8A 1TB4A 3IRUA 4IHAA 4MLPA 3VSBA 1MQAA 3EDRA 1C4WA 1AT1A 3F7TA 1KOGA 1F51E 1Q3HA 2VJOA 4PLPA 1RP7A 2C0QA 3JASA 4MKXA 4JBIA 4MQEB 4JQZA 4LDRA 1YVPA 2ISQA 3I6ZA 3KKLA 4AN4A 1M34A 3HI4A 4PCUA 1PUIA 3O8OA 5E6UA 2CBXA 2IWHA 1R8SA 2PX2A 4PU0A 1JEDA 2BH9A 3MJEA 1E2QA 6LDHA 1R1DA 1NR7A 5M2QA 5AVQA 3SI7A 3EVZA 1W88A 3LT5A 3DBIA 1NIJA 1G16A 4QBHA 3TW8B 2ECKA 3ZKWB 2VAVA 2Q8PA 4LJ9A 4GR5A 1E6MA 1KYXA 4IDXA 2HDHA 4BMZA 3MW8A 1D2HA 3A11A 4Y9SA 2JL1A 3INRA 4IS3A 2JIZD 2P79A 3DL4A 1WBBA 5AQEA 1N3LA 3CR8A 5FEUA 3UHFA 4P1ZA 3CTMA 1JHAA 4LQLA 3B3QA 1Z06A 3G9UA 1GCAA 1R66A 1NVVQ 2BBOA 2YRWA 3IHTA 4FOLA 5KTRA 4O2LA 3AKDA 1G41A 1NIPA 2GS9A 2TECE 3QYJA 4HPJB 3FY4A 5GAJA 3IERA 5J3JA 2GJ8A 3OTWA 2GN0A 5LJLA 2ZSUA 1H23A 4GC9A 1PFUA 2BFWA 2KPOA 3SFZA 4YJHB 4JLSA 1QIMA 4G5YA 3TE7A 2DHEA 3I2KA 3SXUA 3MCAA 2EL9A 3A05A 3EA5A 1E1QD 1DIBA 1IPHA 4TQGA 3W1EA 1VHLA 5AM4A 3RSOA 2YASA 5CLJA 4F8YA 2E4ZA 2O0KA 2YZ2A 2PSEA 3MJFA 4FN4A 4NDNE 1P0CA 4YRDA 5DNAA 5FIUA 2ZULA 1KHTA 3R8XA 3PD1A 3UC5A 4PRYA 1W87A 2AYXA 2I8AA 1QKIA 2RONA 4HEA6 1QQAA 1ZCFA 2FPLA 4FFNA 2FMIA 3AUAA 1Y8CA 1E3QA 1UJ4A 4P4LA 3TEJA 4G1FA 1PFYA 3HY3A 2X8LA 1QUEA 2GILA 1OFUA 4B1FA 1E9RA 2BEVA 2CMFA 2GN1A 4QPCA 1QIFA 1ODLA 1G20B 2VYVA 3ORYA 4GYWA 3UYKA 2CMDA 2ENWA 2ZVJA 4YCCA 3H9UA 4XLTA 2VTBB 3RJTA 3RR2A 2LNDA 3F7NA 4C0QC 1UKBA 5B7QA 3LXRA 3NT4A 1AK2A 2JJMA 3WICA 4RXMA 1A04A 1SOWA 2FPPB 1R3DA 5EVJA 2PSDA 2PZEA 3VYTB 5KQSA 1C3LA 1X92A 3N8HA 3V2IA 4DLLA 5KNBH 3CXUA 4BN4A 2OVBA 3HZRA 4V0ME 4X1IB 4OLAA 2BDEA 3IOEA 2W6ZA 3K0FA 4YASA 2OFFA 2FDCA 2C78A 3KJHA 1EFLA 1QMPA 5ALUA 1JH8A 1N3IA 4QGFA 3EJ6A 1Z5OA 2PAFA 4K9OA 1TVKA 1KC3A 3QOWA 4RW0A 2BGWA 5KI6A 2ZT8A 4N0MA 3T38A 1IM8A 1L4UA 1OFTA 2L42A 1E4EB 1OTXA 1QB7A 2W6JD 1KYZA 4CJXA 3UMRA 3ND5A 4FNOA 1NM5C 1PJZA 2G76A 2B3DA 3HU2A 3KG2A 4LJYA 5BVGA 3O31A 3BDVA 1NZFA 4ZCSA 1YU6A 2XNKA 2HSWA 3GCDA 4F46A 4AKHA 1E2NA 1WVGA 3VU8A 3EXFA 2ZJBA 2XVMA 4H7JA 3Q3IA 1ATZA 4FHGA 4D8XA 2BGRA 4FYKA 2AEMA 5IC6A 3NYIA 5DT2A 2WR8A 3BF8A 3KV3O 2C4TA 1JHQA 3OUTA 1A5AB 1V25A 2H5EA 4K9PA 3SYLA 3ZQ6A 2XD9A 1S3SA 3LXMA 4C7BA 3IDFA 5A4KA 3VHQA 5BSTA 3UJNA 2FOXA 5HM8A 3HGMA 2KLHA 3HR4A 4HYYA 4IS2A 4P35A 5C52B 3VBCA 5JT1A 4KPGA 1GPBA 3X1JA 5G1NA 1GNSA 3BSYA 5DX1A 1OB5A 1LK7A 1XF9A 1R0YA 4D7AA 5FOVA 4L16A 3IEVA 2YJTD 2AQHA 1UKVY 1NVEA 5FBRB 1CF2O 5EJEA 1G59A 4OQFA 3OQPA 1N92A 4U6SA 4ZCMA 4CV3A 2ZVDA 3OZIA 2IH5A 4BO4A 1NVKA 4AWBA 3SR0A 1L8QA 3PNVA 3A1WA 4MWCA 3GMDA 3B9BA 4D3YA 1AU9A 4JYBA 4NP6A 3GJ5A 2BFPA 3NKVA 4QQKA 4X3OA 4HFJA 4NPCA 3SX4A 1Y8ZA 4FONA 4M9XA 3TSWA 4A2PA 5JLJA 2OQRA 1DAKA 4EWLA 5IANA 2PMDA 4JI1B 2DB3A 1TYEB 1Q22A 1VJ1A 2I1QA 2DQSA 2Q4EA 2IYPA 2R8PA 1XF1A 5JHGB 1RYNA 5HDBB 4EG7A 3MQ4A 1IQPA 2IXAA 2G06A 4DBLE 4DUGD 1XG5A 2G6BA 1IHYA 3LJKA 4C0KA 4KO8A 7ABPA 4XSHA 2HJVA 2HQOA 4XR4A 3RB8A 5EEHA 3WE7A 5E9QA 4BN5A 4D4KA 1C0KA 1SD2A 5HPYB 4ENVA 5LQKA 1IUNA 9ATCA 3U61B 1I4WA 2J6CA 4FHZA 4XIJA 4OCZA 1W4RA 3F8WA 4QFDA 3WWPA 1KEKA 3ZU3A 5HOQA 1X7DA 1R9NA 3NT2A 3IBGA 4BGEA 5JRZA 2GRUA 3BIFA 2GJSA 4R2MA 2C2MA 5I6DA 2ZIXB 3PGVA 5JS8A 3D3WB 1PWXA 1QG0A 4L4RA 5I9MA 4A8PA 1VYHA 3ANTA 3AV0B 4KQFA 5D1NA 1TJPB 5A5EA 2G8NA 1WDLA 4BV2A 4RJ2A 3QUBA 4Q9AA 4JZKA 3KDAA 4E6EA 3JZAA 2E37A 2GEJA 2RB5A 3I9OA 1J56A 2NYAA 3VPHA 5I45A 1DT5A 5AVSA 4PSAA 4X94A 5EP1A 3M4NA 1ID8A 1KY2A 3FYHA 1IDOA 5IDXA 1HYQA 3ESQA 4I4NA 4IJWA 2BBWA 4GBMA 5HF8A 2IU4A 4KR7A 3HHPA 2B8JA 2FN4A 2AOWA 2MWMA 2Q3MA 1TRKA 1YC2A 5ERYA 3KZ1E 1QHEA 2JFNA 5DVZA 3KZCA 4MI3A 3LRPA 4GSKA 4QARA 4RCVA 5SYMA 1O6ZA 3ETDA 1KDVA 3S5JA 3VSAA 3ETLA 5J63A 2GMWA 4OIFA 4Y7CA 4K05A 4GWKA 1L1QA 1EBUA 1MX1A 2GK4A 2I4NA 1HWYA 3TR5A 2H52A 2YBEA 3F2IA 2W2NA 1BS1A 4AUNA 4W9RA 1J09A 2JLRA 2YXPX 3ZHOA 4JBGA 4RD4A 4YRIA 1GPH1 4J4TA 2VDLB 4MGYR 2I55A 2NO0A 2Z2YA 3KT8A 4IFTA 2HK9A 3GRCA 4PC2A 1IBLB 5E2IA 3CLUC 5GZ6A 1PS9A 3UJPA 3WRWA 2MYNA 3QLUC 5LOVA 1DX6A 4MULA 1ZMOA 1B1AA 3NFRA 2QMYA 4PGGA 1P6QA 4UHBA 1PX0A 4CMKA 2ZJ3A 4RJIA 2REOA 2HKIA 3G9QA 1OLSA 1U0NA 1XZFA 3WG9A 2OOSA 2QY9A 2X5KO 5CFMA 4X84A 4G0YA 1G7TA 2JAQA 2AMYA 3MCUA 4G1UC 1KSHA 3WXMA 3E7PA 3GOHA 3PFIA 4D4HA 3M2PA 3D4NA 3LX6A 3MJVA 3OTQA 4PSDA 1SVMA 3GUUA 3B6EA 2BFFB 3CNBA 2IOFK 3T4PA 4ZV7A 2MYPA 3TVTA 5BRAA 3EMKA 4HWGA 4IICA 4INJA 4A92A 2D1YA 1L5SA 4CMCA 1VE7A 2QNIA 4URUR 3BHJA 1Z63A 4J2TA 4QT4A 1HPLA 5KC8A 2WIJA 2C9CA 3T7AA 2XE4A 3RANA 3RSLA 3DCNA 1PEDA 5A4DA 2ZB7A 3PYLA 1AHHA 1QTNA 2IE0A 4YRTA 4BGVA 1T4CB 4GRIA 1U9ZA 3A8TA 3WQBA 2J3DA 1PGQA 4H60A 4IIHA 3WVNA 1ZD1A 3AVPA 2V9ZA 1K4MA 5AI6A 3LQYA 2ZB3A 2QY6A 1JYEA 1Z8NA 2REQA 4KR6A 3HJTA 1PJ8A 4LZAA 2XYVA 3E8SA 3D3JA 1NJGA 5ALEA 1RACA 3VI4B 5CDYA 3X2SA 2PMWB 4AU1A 2K7ZA 1JKIA 1LRKA 1SMKA 1W2GA 1X8XA 2YWRA 3M1LA 1ADGA 1CUZA 4PINA 1X39A 3I2HA 5SZJA 4P22A 3UG6A 4YMHA 2FP3A 1JKMA 3JVUA 3KSUA 4D5EA 2X0FA 4TLBA 4K03A 5FLXA 4DLKA 1P81A 2C2YA 1IZ7A 1T9KA 2AIRA 1CU1A 4V0KA 3S8EA 3GLKA 4RTJA 3DM5A 2KE5A 2FSUA 1KEZA 3VC2A 4NQZA 1F6WA 1K4YA 1X86B 1ZUNA 2JIPA 1SWWA 8ATCA 4PO8A 4OHXA 4R2XA 5IJ0A 4FK8A 1QVVA 3UKJA 3JQPA 5JD5A 1U1GA 1FDSA 3A9VA 4IIBA 3ELWA 3RU2A 2IU3A 4BCBA 3ZXSA 4BZZA 4NE9A 4EAQA 4UXHA 1VKNA 1ZM3A 3SYKA 4CM8B 4X1OA 3OUUA 2QENA 1UC5B 1VOTA 3CZMA 3DPIA 3GJ3A 4I8IA 4XCVA 1H5UA 5KWIA 4KN9S 2P41A 2YFHA 4LVUA 2DR2A 3OIYA 4G1MB 4DLSA 1EAYA 1T8YA 1LY1A 3OU7A 2BJVA 4G1VA 3KS9A 2B69A 2FPGA 4RELA 2HH9A 2IU0A 2X8AA 5AHXA 1N5JA 4KE6A 5P21A 3ZNOA 4NK4A 3DLTA 5J23A 3WX0A 1IY0A 4GXTA 4O33A 1WO8A 2JGMA 4FBLA 4F6RA 1J49A 4R9SA 3OIDA 2C0PA 2WWFA 5LLSA 3RKUA 2LCFA 3D31A 4KPUB 4GYKA 4R2IA 2IIVA 2GN6A 4JVOA 4YTEA 3RVPA 1INLA 3L92A 3SS9X 2ZZNA 1KMCA 1J21A 1DJPA 2B30A 2BE7A 2HMYB 1V4BA 4P7KA 3F96A 4TUYB 2FZWA 3FHJA 1DWPA 1N9KA 2ZSFA 5CGZA 1ZO8A 5AT1A 3SN6A 5DXAA 2VNIA 3VA7A 1QKJA 4GZ5A 4D96A 2JS7A 1W35A 5BN4A 2PEYA 4DFDA 4B2LA 2O6LA 1Z5PA 3QFFA 5CBKA 1W75A 2ZE6A 1MCZA 3PHBE 4DJEC 2D1QA 4YAUA 2P2ZA 1MD9A 1XJ0A 1WPXA 2H08A 2NXJA 3A1VA 3EB9A 3IQXA 4MPRA 6AT1A 1OC2A 1KO4A 3EIHA 3ZU6A 3IPCA 2A58A 1VMEA 3DLPX 4KTVE 2CLDX 1ST2A 2A0XA 5A0FA 4YJ2F 3GU3A 1LTQA 3R8FA 5COQA 4F96A 4FE4A 5LYYA 2PUEA 3T7SA 1UWVA 2GPJA 1A9PA 2JFOA 4DS3A 3OF5A 1LDEA 1TAHA 5ALTA 3II6X 3TKLA 4YI5A 3TECE 1CERA 4Q21A 4X60A 1JEYB 2PZKA 5C5EA 3T1VA 3B89A 4NU0A 2X7JA 1FLVA 3OC6A 5G0UA 3VR3D 3GRPA 3I6IA 1KDOA 5ERGB 4QVIA 4ARCA 2J3IA 1SRQA 3VXKA 2B8EA 4EFNA 5G2OA 4YMUA 5EJ8A 1LDGA 3OLXA 4R7ZA 4OHYA 1NUUA 2X0IA 1TO1E 1YI1A 3VZSA 2BGGA 1OI7A 4N0PA 3HJGA 1MGOA 3CF4A 3IOMA 4PGMA 2RK4A 5CX1A 3SG0A 5ECGC 1BC5A 4TYWA 3O75A 1KSJA 1XLUA 4CTJA 2Q5LA 5IKPA 2C5AA 3OU6A 2PL1A 4KKVA 4M7WA 1KJZA 4ECEA 3L0OA 5F3RA 4Z7QB 5IN4A 1KZGB 5LJIA 1GVNB 2CVHA 3E18A 3WLAA 1LC3A 3E3LA 4GO1A 4RSGA 4A82A 2XA2A 1JMKC 1C3XA 4R8MA 1LS1A 3KOXA 3TFQA 2PUGA 5KQRA 3B6IA 4CTKA 1XJWA 2W6IA 3NJ4A 3FPHA 1XXHA 4GP6A 4RIEA 3NBMA 3QVXA 4HGZA 3MTJA 3AM1A 3PR1A 4MUGA 3FOEC 3DOOA 5CIYA 4RACA 2XF8A 3DCJA 3WZ2A 2RGCA 3N1UA 4OQNA 4XGQA 3HXTA 3EFBA 4HQOA 4FT2A 3WLJA 2WJPA 4JEIA 4XQGA 4XYEA 1UJNA 1I5OA 5COBA 3TMYA 1OH7A 4L50A 1WIWA 3INGA 1XDGA 1YZGA 5J1SB 4ICIA 1GN8A 1EINA 3UMJA 3K0SA 3MD0A 4ND8A 1BFKA 1U81A 4G5GA 4J3NA 1RWXA 3SHFA 1SBCA 4L2IA 3CNLA 2OA0A 1WU8A 1QHIA 3LX4A 2XOEA 1RYBA 1UKCA 2VZEA 3B8HA 4LYFA 2XNSA 1KIAA 1DO8A 1JWAB 2P78A 3FYUA 1HYBA 3S0JA 4XM0A 5EJ2A 5A2GA 3K1ZA 4MW7A 5FV4A 2QK4A 2PT6A 2QM7A 3T7DA 3PE4A 3H1FA 4HDQB 1YZVA 2M6RA 2UYGA 2YYZA 3GCXA 3Q7EA 2DHCA 3H84A 3B7WA 1Q7BA 2E49A 2UZ4A 4XD2A 1T2NA 3RNLA 3JQGB 1JDJA 2NU6B 3S99A 2QA5A 2V6FA 2GN4A 2EP7A 1S8FA 2NVBA 3CMMA 2EZUA 2G07A 1B3RA 4WY2A 3ESYA 3JQAD 3SQNA 5ALJA 3A1CA 3BFVA 4P81A 2EDAA 3A9SA 4J7XA 1B16A 1JLSA 1SCNE 4C6TA 3EZ6A 4EW2A 1HOTA 4WADA 2Q4RA 1SCUB 4C7XA 4ENSA 2PWYA 4QBFA 1TPYA 4HXEB 5J1TB 4XIYA 2F1RA 4B35A 1VI6A 5ICGA 1BMTA 2XR1A 2PVSA 2QM0A 3HBMA 3QPUA 4I4IA 3QGMA 3EH2A 4ZT2A 5FULA 3WLLA 4DJDC 3HTXA 3SEAA 2P9QA 1RXSA 5FUWA 4AL4A 1AJEA 2HXGA 2BHLA 2Z95A 4LXXA 4QELA 2FRXA 3TSAA 1P77A 4PX9A 3WGIA 4B3MB 4EQ6A 1OVMA 1JMVA 1C7ZA 2IOFA 3U5ZB 3MINB 5AM1A 2C54A 3KPVA 1K7YA 1UR5A 3HBNA 3PI7A 1XQ1A 4GPIB 1HSZA 2R7NA 2XGJA 4K0KB 2A4MA 3AETB 3DE5X 1SZJG 2O50A 1E59A 1QHXA 3GUHA 3F5QA 3P0IA 4PS1A 2QVYX 1M2OA 2YJGA 3RFXA 4ZN6A 3U44A 1LSUA 4OGWA 3QWHA 4OXIA 1F1JA 1Z8DA 2QXYA 5JRJA 4M1WA 3QYFA 3TWOA 3HACA 3GPIA 3GLIA 2VRWA 4GZLA 4UXIA 1MJGA 2VP3A 3CEAA 3UMVA 1T3TA 3CRMA 3UAWA 4ZGGA 1E6CA 3PQ6A 3KUKA 1T4MA 2V0CA 2JRCA 1FJXA 4ZA2A 3BX1A 5DIFA 4A0SA 3I3OA 4EQ6B 2P2DA 4OHBA 3ML1A 1ZW6A 1KYTA 4AF6A 4AUKA 1AUQA 1M5TA 1QH8B 1Y5RA 1ZXLA 3MBKA 4YCSA 3ZWWA 2GASA 4XJSA 4URXR 4NU5A 2QRLA 3H8VA 5JJLA 5JNSA 1BIFA 3DMPA 2FZEA 4TLMB 1W2WB 3T7JA 1Z88A 4KRYA 4F5WA 5EKSA 3TD2A 4W63A 821PA 5AVKA 1FEZA 3O2JA 4EYKA 1IHUA 1L8XA 4O4IB 1ZINA 4Z86A 5EMNA 2QT1A 1DBRA 2YS7A 3BQ9A 3E9CA 3GGOA 4EL5A 5B5SA 1KOLA 1NW4A 1VJCA 1XRRA 1N2IA 1ZFNA 2EWMA 3ACCA 3FOAA 4FE7A 2PSFA 1QC5A 2QUBA 2OORA 2RJNA 2HSEA 5AUPB 2IV2X 1GZVA 1TRHA 3SKYA 4BBZA 2CJYA 5MHTA 3B3FA 4JAVC 3ST7A 4DG8A 5B7NA 4UUBA 1F0NA 2I76A 1MTZA 3NGMA 1MOZA 3T06B 4ESOA 1E32A 2VZ9A 2NVOA 3L8EA 3PSHA 4KVZA 4L3VA 4OAQA 3WL6A 4C29A 4D74A 1VKOA 2QTFA 4V1CA 2FE4A 4OH1A 1THZA 2JIZA 1V8FA 2DQYA 3IT3A 1P1KA 1Q7RA 2RI1A 1E1KA 4KH0A 3ZWKA 1XZJA 3VR5A 2OT3B 3A6HA 2YC2C 3EPPA 5FJIA 3D4OA 1QNFA 1O97D 1E5QA 1WKVA 4N7JA 2FLWA 4UD2A 1KS9A 4BQEA 4V0RA 4UBKA 3KOWA 2ZFUA 4HCJA 1NTOA 2D3TA 2HJWA 4YONB 3WWCA 5DSZA 1ZM7A 3RRZA 3UK7A 4MVJA 2MINB 4AULA 4CF6A 1GPMA 3L4BA 2F3RA 4D82A 1NDUA 1Q7EA 1SQ5A 2IHKA 2QQFA 3CX8A 4BBAA 1YVDA 1BEZA 1OZHA 2WU4A 2ZBRA 8ADHA 3QXHA 1XZNA 1N0HA 1TFRA 1FMLA 2CLIB 1PJRA 4XWKA 4FEYA 5IDQA 4YJ3A 3IAS6 2XLBA 1Z4OA 4GGOA 5A1JA 3KR2A 2PRIA 3M3HA 3HKCA 3VNAA 4K2AA 1E1CB 2P27A 3N2NA 3T4EA 4QG7A 2ROQA 3OJEA 5I7OA 3QKSB 1M75A 1V2HE 5ELLA 3CH6A 5KJFA 1IG3A 4OXKA 4PZEA 2Z9DA 2GFHA 4I1RA 3QLEA 4ZVKA 4HNHA 4H16A 3GGJA 3L4SO 2WJ4A 4HNRA 4ND2A 1ODKA 5FWXA 2CYCA 2V7EA 3K2BA 3WNVA 3DAGA 4HN9A 2W9XA 4DW8A 5CT5A 5HFJA 1JHXA 4KV7A 1N2SA 1RQ2A 1PNRA 3SVLA 1XVIA 4V0MA 5G3YA 3D0OA 1VHTA 3VPBA 4M1YA 1NRJB 2AMFA 1RE0A 2PU5A 1FDTA 3U5TA 2JGIA 4JB3A 2O1XA 5EHGA 2JEYA 3LFHA 2VF2A 3KR9A 1J2RA 1JYSA 3K35A 4ZOLB 3RM3A 1N5IA 3FTFA 3BF7A 2VPIA 3HLTA 1Y82A 4WZBB 4BXOB 1NR1A 3IIMA 4HB2A 4KWIA 3VMFA 4OQLA 4BLUA 3WGKA 1VKHA 2B4TO 4AZVA 2I3ZA 2UV8A 3IXLA 1TU4A 1HEIA 1QQ6A 2Q1YA 4JCOA 1XRNA 5KS2A 4QPZA 2IPAB 5LB4A 1YNSA 1CEQA 2FZLA 1MT0A 4KYUA 3IBTA 1D7AA 1M72A 3BXZA 5HM6A 1ISSA 3MWDA 4MR9A 5EIBD 3DMYA 2YH2A 4C9BA 4EEKA 2H7VA 2A86A 2XWPA 5A03A 2POCA 1FYEA 1VE5A 2MSEB 1L5HB 1NN3A 1SBYA 2WWHA 3EE6A 3QYPA 3RJ5A 1GD1O 2EF0A 4UEWA 1G4HA 4LX8A 1I2BA 1I3MA 4LE1A 1L0BA 1QLJA 4TL6A 5ALXA 1S8OA 4Q1VA 1JHZA 2WSMA 4DXAA 4AJOA 1P17A 2ZS9A 3OLWA 4RHUA 4RWZA 4CMGA 2AZXA 1L4BA 3SC3A 1KKLA 1AV6A 3UJHA 5ULLA 3C39A 2JFWA 1R8XA 3P9YA 4BFYA 3WQQA 2HSDA 4Y6GB 3AU8A 2IHBA 3BFPA 1OAKA 2H65A 3HV0A 1L5WA 1ZQ1A 2CD9A 2E4VA 2JGDB 2NTEA 3HKCB 4LHVA 1WQ1R 3MOIA 3NBAA 2XWBF 1T25A 4WFIA 5CUQA 3REGA 3OZEA 4AJPA 4RPGA 1VMKA 2Z8XA 1GKIA 4L2IB 4ZVLA 3SHVA 4F5EA 3C1AA 4MRNA 4PLWA 4QFMA 3TR6A 4E5MA 3Q5DA 3BWVA 4B83A 1E9BA 4WBNB 1V8DA 5KHAA 4BGUA 1OZFA 5IASA 1HFEL 2CT8A 4MQ5A 1TD9A 4BFSA 4HDSA 4QXMA 4LMPA 5HHTA 1ULHA 2P2GA 1EDOA 4WUVA 3VKUA 4D6PA 4LV6A 1OLXA 4MVJP 4Q66C 1RC8A 5KEIA 1ZCBA 2ZGVA 3UC9A 4WI1A 3F3SA 3SMQA 3WGOA 1G9TA 3VZBA 1GUDA 5EUBA 4BNYA 1LC0A 1T2FA 3IVGA 4FX2A 2WB2A 4R1OA 3D5QA 1JT2A 3ESXA 4YQEA 3T7TA 2JGKA 2RAVA 1VLLA 2EWWA 3D02A 3PE3A 3BILA 3E0QA 1OVGA 2DBVO 2QNBA 2Q5OA 1J2UA 4DQUA 3EISA 2K6GA 4AI6A 2ALJA 4EJMA 3SR4A 3OZWA 4GMDA 4AG5A 1WW8A 2V74B 3GJTA 3DPUA 5KNLA 3EIOA 1JQ3A 3HVJA 4EW6A 3TLAA 2YHUA 2JVKA 1BOOA 2B2XA 5AQ1A 1PZNA 4BNFA 4IJVA 1DAGA 2CFRA 3BHIA 4JI5B 5B3LA 1RI3A 3VJMA 1BTOA 4O2AF 4S1NA 1RTKA 4G8CA 1LRJA 3LIPA 3D4PA 4GT1A 2QL7A 1QJ4A 1FFDA 3QNWA 1KEWA 1C8KA 3FCOA 4P4SB 3AERB 2AEJA 3B6JA 2R44A 4K6OA 3JQRA 1TX4B 4X95A 1YIDA 4JCCA 1NQOA 3SNHA 3GWGA 3IEIA 4XSVA 4MR7A 2P65A 5DH9A 1I32A 3G79A 4R0VA 3JATA 3TZLA 4EA7A 4F1WA 2R5FA 1LK5A 4MV6A 4QQFA 2ZPAA 3O92A 2P0EA 1K8YB 2R62A 3LT2A 2G08A 2ZWMA 3WLEA 3KLBA 1PVVA 5TQ2B 1ETHA 4II3A 4M88A 2JD0A 1JJBA 7GPBA 5I4IA 1TM1E 5JLAA 3CB2A 1F4LA 3K71B 2OC9A 1TQ2A 3GEGA 1OFVA 1L4NA 2HRDA 5DP1A 3WS7A 2YXNA 3N2KB 4A15A 1XQ6A 2CFCA 4CEIB 4G0WA 1ISIA 2XOKD 1UKEA 2DGDA 2W0SA 1SU6A 5IEBA 5JROA 2CUTA 3BDAA 5TGDA 3T61A 3DT8A 3W7BA 2XCSB 3V4SA 1SNYA 4WN9B 1H2HA 4F3YA 2ZUCA 1RU3A 4OQ4A 4IX1A 1MC5A 5CGQB 5C2JB 2BUBA 3RGGA 3TZHA 3U6BA 3D6UA 3VR4D 4RF2A 2J3QA 1LUAA 2JH8A 2Y0PA 3LOUA 4F71A 2LD4A 4LZLA 3V1MA 3QH4A 3G2HA 3PT9A 1ZEJA 4LPSA 3UV6A 3PNPA 3VV3A 2BEJA 4C7OA 1PQWA 2V6BA 2AZMA 5ALOA 2WM3A 3U49A 3BMQB 3AVVA 4MUYA 3FGPA 3I9MA 3DZJA 3HN7A 3OD1A 5AOVA 4MP8A 4ZJYA 2G9RA 3ZY6A 5JANA 1R5NA 1IQUA 1HFKA 3QFCA 4HDNB 2YZGA 4LWPA 3LPMA 4LVOA 4GOKA 4F2WA 2WT9A 5KYTA 1Z2OX 2CWDA 4LI3X 2D13A 4WLEA 4X20B 2WHYA 2R47A 4F5DA 2JFFA 3JAWB 1E1RD 2I2WA 1NUSA 1Q57A 1X7XA 1XMXA 2X7HA 4LRTB 4ZI3A 3NDBB 2WWYA 2DPGA 2Q6OA 5IVDA 2C5GA 3COWA 5HNKA 2VP4A 2RKOA 1H2ZA 1YS7A 2P9FA 1UMBA 3YASA 4OX9B 1ZU4A 3N70A 3CX4A 2ZQ5A 5BN1A 2ZU6A 1KQ3A 1WXGA 2C9OA 3OFNA 1NMYA 1OI3A 3K70B 4EKDA 3L6BA 1JXQA 3WGNA 2YWDA 4UVGA 3N53A 3BFKA 4B3GA 2X40A 4IXMA 4OSPA 4P6VF 1HE5A 3I9V6 1W0KD 4UAJA 4LF9B 4MW2A 4WEOA 2ZRNA 4E03A 1NQWA 3PE6A 1RC1A 1BEEA 3TNYA 2ZP1A 1M1YB 4TX1A 3ZS9A 2IXGA 2P9TA 4Q7LA 4JNGA 2BKLA 3I30X 3I0ZA 4MIEA 4HDSB 2RJ3A 1KDZA 2VAXA 2EATA 1WCV1 2OP0A 1NLZA 3QG1A 1KZ1A 5TS3A 1YZFA 2WINI 1TC1A 3IR5A 3PUXA 4QXPA 4RXUA 5K8VA 1JJVA 3W3AA 1IAVA 1FS4A 2VRBA 2ID8A 4IQFA 2HN9A 5JAHA 3UMMA 3O3MB 4Z3OA 3MXTA 1FL9A 1OQAA 2UYYA 4TN1A 1NI5A 1V5IA 1Y1KE 2RARA 3AM5A 3A9RA 5EIEA 1G5QA 1LBHA 3GHYA 1T5HX 4MV4A 3GDFA 4AJLA 3QEAZ 1HDZA 4HBGA 1OZ0A 3DW1X 3HM2A 1ENPA 4AS3A 2O19A 4CV0A 3R3JA 5LYJB 3H8JA 2W6QA 3LSYA 2FK7A 1G18A 5A3QA 1KK1A 1T0UA 1JR3E 4KR9A 2GM4A 3GD5A 4IKEA 2PV0A 3A1FA 2POQX 4ZOCA 5H81A 3LUHA 4Y9UA 2ZRBA 1JSXA 1NOJA 3TSCA 4NFLA 5JJ5A 1ZDMA 3EX7C 4EYQA 2V7WA 4DF3A 1XE3A 3IV7A 1O0CA 2ZBQA 2ODPA 4WTOA 4UBLA 2NMVA 3OHSX 4PHCA 5CRIA 3K6SB 5A71A 2AEFA 2Q3LA 4AB1A 5KMGA 3VU9A 3IUBA 3L3BA 4A8JC 1MLDA 1ENYA 2ZSJA 3FWNA 3QVKA 4GR4A 5I3ZA 1H6BA 1ZSNA 2FMXA 4EUHA 4P9NA 3C85A 1V1RA 3QY0A 1U2ZA 2XCTB 3DP9A 4HTFB 4JR1A 2QSZA 4CLDA 2IHYA 1E89A 3DZDA 4MRPA 5BORA 1UBSB 2C29D 3MTBA 3ZWAA 3PT5A 3ILHA 5F78A 1WNTA 3FDFA 2P8SA 2EG9A 4I08A 3TRDA 3SYNA 4ZU6X 4OU5A 3E22B 1H65A 1XJCA 2HLPA 2XB2A 2JA1A 1ZUD1 2QRNA 3BEDA 3HFGA 3M0EA 3ZE8A 4GOMD 5CD9A 1RZ3A 2JLCA 4BMOB 1QRTA 5K3EA 4PHFA 5JALA 3CIOA 3KJFA 4WLVA 2VPWA 3G0BA 4PLCA 3MK31 2VNHA 4JT8A 3RUCA 3SZUA 3VZDA 1JN0A 2HBRA 3KSMA 4FILA 4HGQA 4MX8A 1CUYA 5D5PA 1U31A 9MHTA 5DYIA 4U1RA 1NV8A 1DC7A 1GFZA 1N5DA 1XD2B 5FPYA 2ZAIA 1NVGA 4CF5A 1N2HA 4XCXA 3U3RA 2C92A 4RHTA 3SZRA 3LCVB 4H6XA 2OBFA 5K3CA 3NTUA 2Y1OA 4X7RA 2C4KA 1PR3A 3BK2A 3CF4G 3L41A 1TXGA 2PTHA 2X3YA 4KWCA 1WM1A 4M86A 1SR8A 3IAUA 2ZK7A 3SZOA 2YOHA 4W1QA 4QUGA 3GROA 3V48A 1NXTA 4PF1A 2AKAB 3L77A 2YVLA 4H6PA 1E62A 3HJBA 4RKQA 3LT4A 4EOGA 5CDFA 1E2EA 1F2TA 3HVHA 5ELXA 2PQ6A 2BKEA 3KQKA 2I6GA 5KTOA 4C4YA 4FFDA 1ICIA 5LQDA 1U7OA 3RADC 5BUCA 5FWYA 1ZM4A 5EXDA 3VUEA 5K8TA 4HF7A 3UHPA 3P9RA 2HA7A 3FVVA 2ZDQA 1YU9A 5HE9A 2WM9B 1S2OA 5CCDA 5FDFA 4B6FA 3JS5A 3VNQA 1TM2A 2P4QA 2I6FA 5AWFC 1XEXB 3UK0A 1QZZA 1JDZA 3L6CA 4U00A 5HCIA 2PCLA 1QYDA 4TMZA 2XB4A 1CR0A 4M0KA 4U2DA 4DJFC 4FJ2A 4EITA 5GMOA 1VSTA 1CIVA 1HDCA 1RPTA 3DT6A 4GMGA 1Q0SA 3WMEA 2OR3A 5BWBA 4Q19A 1VECA 5HGJA 2ZSEA 2OORC 1WTCA 3ELYA 4PX3A 4RVDA 1BRTA 3ROKA 4M1KA 3S29A 3ZV6A 1CY7A 4IIJA 1CJTC 2PJDA 2O7RA 4XM1A 4UTPA 4TWRA 4G65A 4Y8VA 4YJGB 4M0UA 3T0IA 5A9TA 1K88A 2C2KA 4ALIA 1X7WA 3BE5A 4QVKA 2CHUA 4D6YA 2CJXA 5JUWA 3Q41A 3UPTA 1G2IA 3F1KA 3KVVA 3F6RA 1ZW1A 3OIUA 1I7LA 5CPBA 4A73A 2HQBA 2M98A 1UDCA 4EPXA 2E6UX 5MFPA 1RMTA 3R9XA 2GAOA 4B71A 3VPXA 4P4SA 1JIKA 3GDOA 4MV1A 4PPNA 2Q0HA 3FF1A 1EXVA 2R1ZA 4L5BA 4UDYX 1O9BA 3C5WP 4GPD1 4XJVA 4PQEA 4F56A 5CDTA 3W4JA 2P6OA 5LP1A 1B23P 3V2GA 3ZI0A 1PUXA 2Z56A 1PVOA 1VPEA 1IN5A 2EL7A 1T9HA 3FAZA 3I39X 5HQJA 1J22A 4A2WA 2Q1XA 2WD7B 3VKWA 3ZE2B 2ATIA 2NSLA 4JODA 4BFCA 1U7HA 1WF6A 5DB4A 5ICEA 4PAQA