2GHPA

Crystal structure of the n-terminal 3 rna binding domains of the yeast splicing factor prp24
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
251
structure length
232
Chain Sequence
TTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKKNFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHLTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLTLEGREIMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQKFNNCCAFMVFENKDSAERALQMNRSLLGNREISVSLADKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and interactions of the first three RNA recognition motifs of splicing factor prp24.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U4/U6 snRNA-associated splicing factor PRP24
total genus 53
structure length 232
sequence length 251
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ghpA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ghpA03
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ghpA01
2KXFA 5LSLA 3J7YU 3NS5A 4WKRA 2FY1A 3MOJB 1HA1A 4Y00A 4F26A 2MQPA 1P27B 2ERRA 1Q86T 1KD1T 3EGNA 2L08A 3G96A 3LQVA 1A9NB 4TLQA 1YITS 2RRAA 3BO2A 5CXTA 2MQLA 2RUGA 1SXLA 4WCEQ 1WF1A 2N7CA 2WBRA 3CCUS 2M7SA 3V4MA 3CPWR 1YJNS 2LEAA 2RNEA 1WWHA 1FJ7A 2KH9A 1X5TA 2J0QD 1OWXA 3CCMS 1UAWA 3HI9A 1VQ7S 2X1GA 4FXWA 3P49B 4TU7A 1YJ9S 1D9AA 4IOCQ 1SJRA 2XS2A 2LXUA 1VQMS 2M8HA 5CYJA 3H2VE 5GAGU 3TP2A 2CPIA 4BS2A 2M2BA 2MQOA 3MUTP 1U1KA 2DNQA 1YI2S 1PO6A 4Z2XA 1Q7YT 2JX2A 2QEXS 1U1MA 2KU7A 2CPEA 2CQ4A 3TO8A 4TU9A 2MZJA 3THPA 1RKJA 1M90T 2DGWA 1X4DA 1CVJA 3EGZA 4FXVA 1R8PA 1UW4A 1WHWA 2XS5A 4C4WA 1B7FA 3CC4S 5GMKa 3CUNA 2LEBA 2KM8B 2KXNB 2F9JA 3BO3A 4OZ0A 5IQQA 1KQSR 5DM7Q 2DH9A 2DGXA 4IO9Q 3NMRA 2LECA 1OIAA 2HGLA 2U1AA 2M0GB 2M4MA 2KXHA 2LKZA 2CQ3A 1WTBA 2V94A 3B4DA 5LJ3Y 3UD4P 1U1RA 1VC0A 2LMIA 3G8SA 1VQKS 3I55S 3IRWP 2RQ4A 2CQIA 4LIRA 3UD3P 2AYGA 1WI6A 4F02A 5IM0B 2EK6A 5DDPC 1YTYA 5MLCV 1Q82T 4ERDA 3R1HA 4CQ1A 2DO0A 2DH7A 1U1QA 3U1MA 3VAMA 2CQPA 2KFYA 1WELA 4W90B 2CPDA 2ADCA 2OTJS 2VODA 2KM8C 2N3LA 2CPHA 4CH0S 3MURP 4PR6A 1K73T 2EK1A 1JJ2R 2NZ4A 2DGQA 2E5HA 2JVOA 2MZTA 1NO8A 2RT3A 1O0PA 3MUMP 1H6KX 2MXYA 5GVQA 2E5JA 3G4SS 3CD6S 2HVZA 1N54B 5JVHQ 2CJKA 2Q79A 2DHGA 5JVGQ 1VC5A 4LMZA 4ZKAA 2CPYA 2HGNA 1N52B 2AD9A 2G0CA 1WEZA 2LA4A 3PIPQ 1VC6A 1FO1A 1ZH5A 3S8SA 2CPJA 4CH1A 3SMZA 4Y0FA 1JJHA 3VAHA 1M5PC 3H2UB 2DGTA 4WIIA 1P1TA 2KYXA 4M5DB 3P6YC 3S01A 2VONA 5H1SV 1WF0A 4UY8T 2KI2A 2MKIA 1SJ3P 2MZQA 1HD0A 2QFJA 3VAFA 1VQ4S 1G2EA 2DNZA 3CCLS 2D9PA 1K9MT 3FEXB 2MB0B 2HGMA 1FT8A 2XSFA 2KVIA 4YB1P 3CULA 1QVGR 2M52A 1FXLA 2AYEA 2MKCA 5IFMA 1WHYA 2AYBA 2ZJRQ 1QVFR 3CCVS 2XB2D 2OTLS 2BOPA 3OW2R 1SJFA 2BZ2A 2L9WA 5DM6Q 2ZJQQ 1VQ8S 2FC9A 3BS9A 2OSRA 2SXLA 4PKDB 1U1NA 2CPXA 5DDQC 3RW7A 1WF2A 2M70A 2LYVA 3R1LA 3CC2S 2MPUA 3ZZYA 4LJMA 1X4FA 1X4BA 2ZJPQ 1DRZA 2I38A 5GADU 2X1FA 1FJEB 3MXHP 2RS8A 2N3OA 2MJNA 3CCSS 1X4CA 5D78A 3ULHA 2MKSA 2DNNA 3CXCR 2LCWA 1X5OA 4QPTA 2MJUA 2MKHA 3SDEB 2X1AA 1U1OA 2CPFA 1U1LA 2MQQA 3VAIA 2K8GA 2MMYA 2D9OA 1F9FA 3SDEA 2M8DB 1U6BA 2F3JA 1WG5A 2DGOA 2E44A 2CPZA 4EGLA 5LJ5Y 1H2TZ 3S6EA 2DNPA 3HHNB 1X4EA 5DETA 4WF9Q 4A8XA 1VBXA 2PEHA 2RS2A 1ZZFA 1X5PA 4YUDA 2DISA 3S7RA 2MGZB 4W92B 4P6QA 2KG0A 3DLLQ 2AYMA 2VOOA 3K0JA 2CQGA 2MSTA 1SJQA 1ZZNA 3LPYA 1YHQS 1WG1A 2MQMA 3CTRA 3CCQS 1U6FA 2DITA 2J76E 2KHCA 3SXLA 1VQPS 1WI8A 1FHTA 2KRBA 1WHXA 1UFWA 2XS7A 1DBDA 5LXYA 2DB1A 1H2UX 2L41A 4C7QA 2CQCA 3UE2A 2M88A 4RU2A 4YOEA 1BY9A 3FEYB 3VAGA 2DNGA 2MYFA 2YTCA 1OPIA 4IUFA 2DNLA 2DHXA 1Q81T 1M5OC 1WEXA 4CIOA 2NLWA 2MZ1A 2DGUA 2YKAA 4PRFA 2MGZA 2RVJA 3CC7S 2JVRA 2DO4A 1SJ4P 2MQNA 5D77A 3VF0B 2F9DA 3Q2TC 3TYTA 4J5OA 2DNKA 1KOOA 5DDOC 2DNOA 4WFAQ 3L3CA 1S79A 2CQ1A 3MD3A 2FC8A 2DK2A 1PGZA 2X1BA 3NNAA 3U1LA 2FPHX 2J8AA 3UCGA 1URNA 1YIJS 2RRBA 1VBZA 2DHAA 1R8HA 3I56S 3UWTA 2G4BA 3BEGB 3JB9k 1FNXH 3NNCA 3B4MA 3G71S 2E5IA 5LSOA 1N8RT 5FJ4A 1W2BR 1KC8T 1XN9A 2DNYA 2XNRA 3IWNC 2MZSA 1S72S 1WEYA 2YH1A 1X4AA 2G1DA 3CMES 4QU6A 1M5VC 3BO4A 2DIVA 3DXBA 5HO4A 1NU4A 4IOAQ 1A7GE 3VAKA 1JMTA 1FJCA 3G6ES 3P5TL 3PIOQ 2DIUA 2UP1A 5LXRA 2KT5A 2HYIB 3CCRS 1VQ5S 1D8ZA 3P3DA 1N88A 2LXIA 2MY7A 2K3KA 3UCZP 2DHSA 3R27A 4V19X 2JWNA 2KRRA 2YH0A 2MY8A 1X4GA 1WHVA 2LQ5A 2D3OR 3RW6A 1AUDA 2I2YA 2CQDA 2OIHA 2MHNA 1YWXA 3ZZZA 3CCJS 1H2VZ 3MUVP 1X0FA 3J7ZT 4TU8A 3MI7X 2DNRA 2E5GA 2EVZA 2J0SD 2U2FA 1VQ9S 1VBYA 4WFNQ 1VQNS 1QM9A 2CQ2A 2MKJA 1M5KC 4UQTA 2CQ0A 2JRSA 5CA5A 1U1PA 3MD1A 5GAHU 2QA4S 2YWKA 4F25A 3CMAS 5HL7Q 2ADBA 2DH8A 5GAEU 2OJ3A 2RQCA 2DNHA 3VAJA 4QQBA 3D2WA 1VQLS 1IQTA 2MKKA 3CCES 2DNMA 2XNQA 1M1KT 5IM0A 1JJ4A 4OZ1A 2GO9A 5BJRA 1YJWS 1X4HA 3UCUP 3G8TA 1HD1A 2N82B 3N9UC 2CQBA 2M9KA 2MSSA 2DGSA 1KOHA 3EX7B 2A3JA 1WG4A 3THTA 3MDFA 2B0GA 3G9CA 5EN1A 2CQHA 1OO0B 3NNHA 4ED5A 1UP1A 2KG1A 2O3DA 2PE8A 2OSQA 2GHPA 3VALA 4U67Q 1K8AT 4WFBQ 2RU3A 3NS6A 1DHMA 1X5SA 5DDRC 1VQ6S 2FHOB 1DZ5A 1NJIT 3Q2SC 1L3KA 1RK8A 2HZCA 3CF5Q 1HL6A 1VQOS 4C0OC 3US5A 5ITHA 4QU7A 1U2FA 2LA6A 2VOPA 2MZRA 2KN4A 2DGVA
chains in the Genus database with same CATH superfamily
5CZVA 4C8OA 5C7PA 3M2RA 1B0TA 4NWBA 2ZH5A 1FDDA 1CLFA 3J7YU 3SFGA 2FY1A 3BYPA 3M2VB 3PX6A 2J9DA 2R8KA 1P27B 4RNMA 2ERRA 2PSZA 4CDIA 4IDKB 3ZTSA 2L08A 3G96A 3I0RA 3LQVA 1VIOA 2C3UA 3PW0A 5ETNA 1A9NB 5T41A 1Q7LB 1T03A 4RW7A 3KJVB 4M5DA 1HIYA 1OYDA 5IV4A 2VHGA 4QW9A 4J9LA 1X8DA 1JLGB 3NP5A 4FVMA 1TL7B 5DZ6A 3UO0A 1S49A 5L1KA 3CGIA 3OFHA 3PW4A 4WCEQ 1R7IA 1WF1A 4C3LA 3PW7A 1UVLA 3NY0A 2V2KA 3CCUS 3OJUA 4KQZA 3V81A 3DYAA 4CT8A 2RSQA 3DRSB 1FJ7A 2KH9A 3QT7A 3VZHA 4MKBA 1KVKA 3I0SA 2QYCA 3WBZA 4USMA 3ILLA 4KH0B 4OYBA 5CYMB 2BACA 1VQ7S 4TU7A 1D9AA 8RUCA 3F0NA 4IOCQ 1IKXA 3ISND 2H51B 2D69A 2LXUA 3HDSA 2M8HA 2RRNA 3ONQA 4R0EA 4Y6IA 4LT6A 4Y3CA 3TZYA 3ZZ0A 5ETVA 4DDFA 5KFWA 5MAOA 4O4GB 4DMZA 4F67A 1SJ1A 1SIZA 4CP5A 2W8KA 4WZQA 3HSJA 3PYDA 5AXKA 4UZBA 5I42A 1S4EA 4XPCA 4N8NA 1FDNA 3RBXA 1F3VA 1FTCA 4J9PA 1U1KA 1YI2S 1TKXB 1XERA 2KT3A 1ZTTA 4OQJA 2Y1IA 1XR6A 2YY3A 2I1RA 2FY8A 3MEEA 2RMLA 3QSIA 4WK1A 4OJ3A 3KLFA 4F0HA 3KLHA 3O2IA 1LWFB 2JEJA 2KU7A 4ZP9A 3TO8A 4WJBA 4X4SA 1N32F 3GMGA 1M1HA 4USIA 1N48A 1J5EJ 1FFSB 1FJGF 1R43A 4AL5A 4F3MA 2YX1A 5HMZA 1IKXB 3PR4A 1X4DA 1CVJA 1KDNA 1XTZA 3EGZA 3KK2A 4H4MA 5G4DA 2GIQA 3ILOA 5F8HA 1IJFB 1SBRA 2YWGA 4FKXA 2OELA 3N6LA 3EPGA 3CUNA 2LEBA 1J5EF 2KM8B 2KXNB 2F9JA 5KOXA 2MTLA 2XHCA 4J9UE 4CO1A 1WC6A 3CJRA 2NUUG 3D54A 3ITHB 4OLPA 4E2FB 2FIUA 4NLXA 1HQEA 4IQMA 5EWFA 2W7PA 3PFEA 3H42A 3MEDA 5JJBA 1Q8IA 1KLMB 1S59A 2U1AA 3CCTA 4X64F 3QJPA 3MF5A 2AMCB 2DD8S 2OPQA 4P7VA 2UXDF 2KXHA 1Z4UA 1DQAA 4JV0A 2ZDOA 4ENOA 1WTBA 2OH2A 4KY3A 1RT6B 4URSA 3B4DA 3DKDA 3H5UA 3UD4P 4DFKA 1T05B 2QJ3A 1KNZA 3BN4A 3W64A 2A2DA 1VQKS 2LU2A 1JLBA 3G87A 1HHSA 3IRWP 4J90A 2ZKUA 3HVAA 2XLJA 4CLYA 1FNOA 2HWTA 1N5VA 2ZVIA 5GADI 4LUBA 4M94A 1UJ4A 1RSCA 3GB0A 4K2XA 3L7OA 2EFQA 5CYJA 2OPSB 5IM0B 5DDPC 4DR2F 4P2SA 1HWJA 3UI3A 5F9LA 4CQ1A 4OLOA 1MN9A 3DMJB 1C0TA 2B9WA 1U1QA 3U02A 1RACB 2GX8A 4RWXA 2DYAA 4NZ7A 3DU5A 1MROB 2HVDA 5HBMA 4RUHA 4EK2A 2VFTA 1SUQB 1GMVA 4NCAA 1YX2A 2H1YA 5E3CA 1Q16B 4DU8A 4W90B 2C2KB 1F2HA 4AFFA 2KM8C 1ITPA 2N3LA 4CH0S 4DN9A 3C46A 5KG3A 3KJNB 4ZCIA 2C3PA 2W2PP 1JX4A 1BQNB 1RGVA 3R5JB 1K73T 2EK1A 3GU0A 2NZ4A 4PQAA 2JVOA 2HW3A 3I4HX 4D3HA 3T1HJ 1O0PA 1NDPA 1H6KX 1E6YB 3D3BJ 4MH8A 4TVAB 3GJQB 3OFFA 3RU0A 2HVZA 1N54B 5M2UA 3CD6S 1QSSA 2FLPA 3DMJA 2Q79A 2DHGA 2QO3A 2I5JB 3R5BA 3MFHA 4DLEA 2HK3A 1U0SA 3CD0A 4KV8A 5J2MB 4QWEA 1YJRA 2ILYA 4G1QB 5F3ZA 2VQEJ 3UN3A 1R89A 3TAPA 3I9V9 1S6UA 2RKIB 3M8ZA 1YZ7A 5F8MA 5F41A 4NE9C 4ILMA 1TVRA 4NYOA 2NQPA 5L9NA 1UPPA 3BN7A 1VRTA 4ZP6A 3OL7A 3LGNA 2CPJA 3WHIA 3HD1A 2RDDA 2OGUA 2Y1RI 3ET6A 1R8BA 3W9JA 3H25A 3ISZA 4WIIA 4UOHA 1P1TA 4M5DB 4NRTA 5HQMA 3P6YC 1X9WA 4UW2A 1H7WA 2VONA 3G82A 1XNQJ 1WF0A 3L4BC 1RXOB 1V3SA 3JS9A 5AJ3F 3OV7A 2HMIA 4M95A 2P9EA 4UUXA 1S9FA 5RUBA 4WP3A 1N5YB 3BH7B 4RX6A 5I3UA 3M2VA 2VPWB 4J7CA 3RAXA 4J37A 3VAFA 1UVMA 4F2RA 4OZ2A 4ZA1A 1TVRB 2IYIA 1JXEA 2UV8A 4NRUA 1S9GA 1R27B 3D4JA 2DNZA 4KGKA 1FXRA 4C8YA 3Q8UA 5C42A 3WQPA 2IRYA 3CCLS 1MMLA 3VZIA 2XSFA 1UEUA 1QSYA 5K8NA 4YB1P 2EBGA 2R7TA 3UVJB 4OI1A 3R7NB 3SV4A 3C16B 1NJWA 4HACB 3FDSA 2UVVA 1Y00A 5A0YB 5DQGA 4OZJA 3CCVS 1LWEB 3FZ2A 1B64A 5LMNJ 1T9UA 3AT1B 1X31C 4DPTA 1FX2A 2VH7A 3MEEB 5F8GA 3D6FB 5HVHA 1B70B 1OSDA 4P2FA 4R0JA 3G6VA 5LMUF 2FC9A 2OSRA 1P9YA 2AX1A 4PKDB 2XCAA 3V6DB 5HP1B 2N4DA 1U1NA 3HHLC 3MAHA 3MECB 3RBEA 3QRPA 4DX7A 1RTHB 2IPOB 4FBTA 2I6WA 4A8QA 1G3OA 1RAHB 2BA9A 1S99A 2P5VA 1YRTA 1HWIA 5HJXA 2W9AA 2QG9B 1U0HB 1X4FA 2LQ8A 4LRDA 5D4OA 5K14B 1REVA 1XWLA 3GIIA 2OD4A 1L5UA 1F6TA 2EFNA 2BE7D 3GWCA 5IT9U 3MM8A 3IC1A 3CJTA 3C6UB 3TJ9A 4I6AA 2HVHA 2JLEA 1VLYA 2HBYB 2QMWA 3MXHP 3R6GB 4OHWA 1FRHA 2MJNA 5I3QA 1X4CA 4K4XA 1TFYA 2O1PA 2ZZNA 3IM9A 2V8VA 1RLCL 1SI9A 3TW0A 3CXCR 4EBEA 1J5OB 3FC9A 2D3O1 1MLAA 2AQ4A 1AFJA 3C8YA 2GMHA 3EWGA 4PUOA 1IQZA 4QR0A 1BLUA 2H5EA 2ZNZA 2Z30B 3ENVA 3TA0A 3C14A 3V6JA 3MM6B 2MMYA 2HWIA 3MMAB 2ATCB 3OR1A 3VQSA 1F9FA 3EGVA 4LVOP 4U8YA 3NGSA 1KQFB 3SDEA 4ES2A 2E44A 4OMFG 1H2TZ 2EPIA 3SSSA 1DLOB 1M1GA 1ACMB 2JLFA 4KR0B 1L3SA 3HHNB 2PO4A 1X4EA 2IM0A 1XBWA 5E0OA 3PRBA 5A8WB 4LQ9A 4ECYA 1XR7A 1XMOJ 4LF1A 3OTCA 3ZTOA 1IVZA 4KGVB 3MMCB 1ZA2B 1X5PA 4H4OB 4P71A 2MGZB 3DLGB 2ZC3A 3RAMA 4TY8A 4Q5VA 3FUYA 1HR0J 3DLLQ 3IGVA 5KFUA 2J7WA 2YNIB 5IQ6A 2XI3A 3QBCA 1TR0A 3K8VA 1L3VA 3JQMA 3FRZA 3K0JA 3OSNA 1FD2A 4JBCA 4DV5J 1NSKL 1UZDA 2HKEA 1PG5B 3BKFA 2EFVA 4QWDA 1S76D 3LPYA 5ETQA 1N33F 4RW9B 1O8BA 4N77A 2YKNA 5E5NA 4DV7F 4JI7F 2MLXA 1WOOA 2C2NA 1U26A 3BZQA 4XPEA 1C1BA 3PX4A 4DL6A 1RP5A 2ZDPA 3SQOP 4QWBA 1OY8A 3EZ5A 3AD7C 2HHSA 1FHTA 3HVTB 4YMEA 1N5TA 2XS7A 1DBDA 2EWHA 1QAYA 2R7OA 2VFSA 2PIIA 5K8OA 2PI5A 3HMJG 4IO1A 4A8SA 4LFBJ 4DFJA 1K1SA 5B7WA 1RT5B 2UUCJ 2M88A 1JLFB 4RU2A 3VAGA 1RTHA 3AD8C 2DNGA 1VK8A 2MYFA 5SUHA 4Q43A 5KFGA 4AL6A 2YTCA 1OPIA 1TK5A 2HHUA 2HRYA 1DTTB 1LEOA 1PC4A 2YKOA 1M5OC 2XQCA 3ICLA 2WONA 4MMOA 2J7KA 5K20B 4CIOA 1V3ZA 1VLOA 1MROA 2E7WA 1W26A 5E7OB 1PC5A 4DV1J 3DLEB 5HATA 5LT5A 2DGUA 3FRYA 3DRXA 2DY9A 4PRFA 1SC3B 1GXLA 2WOMA 1T8EA 3NLCA 1NAQA 3JTPA 1JK9B 4MIAA 1YZ6A 4K4WA 2H54B 3TQEA 2NPFA 4ZVEA 2Z57B 3O1LA 4QIVA 1RT7B 3R7SB 3DGPB 3SSRA 4Q8EA 3C3LA 2PMHA 4JI8F 1KHWA 2F9DA 3PYEA 2ZH3A 2DNKA 3DCAA 5KFVA 4K4UA 2XMVA 2UU9J 3M8SA 2FTRA 1HQUB 2CRLA 4OHVA 3TX0A 3VWSA 4AXJA 4FPRA 2FC8A 2C2EA 5FIIA 4B9NA 1NH7A 3BREA 4MK9A 3EM1A 4XDCA 1VI7A 4M5LA 2NXCA 2X1BA 2IJNA 2POKA 2YQ0A 3RRKA 3KHLA 2L9NA 3A8KA 3QO9B 1FRJA 5FD1A 2YQ1A 3C66A 3U1LA 2QA4G 4DWIA 2FPHX 1SIWB 2HVEA 4X66F 2HBQB 5F9NA 1TK0A 5ADZA 3H4DA 1VMBA 2E1RA 3C14B 2VL1A 1URNA 1DTQA 3CJSA 4HH1A 3I56S 4NLDA 1YQHA 4DF8A 1PBUA 4GKKF 3BEGB 2PEBA 2NSCA 2XY6A 3LP1B 3HT0A 4IQXA 4DR1F 2GZOA 1W2BR 3OD2A 4FNIA 4FYDA 1N32J 3BGUA 2OD6A 2DNYA 2ASLA 2XNRA 2BM0A 4KFBB 2ZFHA 2KFZA 2MZSA 3KLIB 2VUGA 2DPIA 3PW5A 2BMBA 3D0HE 3KWMA 5A0YA 2VJUA 2BW2A 1J27A 3R5AA 2FJDB 2QLJB 2AWZA 1I94F 1KONA 2B4PA 3EVWA 3P96A 4NYPA 2QA1A 2CNKB 3D67A 3TQ1A 1QAIA 4TXSA 1IXKA 1CJTA 2ALYB 2FVQA 2XMMA 2DHHA 1PKUA 1CULA 1NU4A 4ITSA 1JKHA 2DEJA 4S0MA 4IOAQ 3IG1B 3VAKA 3ELHA 2HQCA 4NPOA 1D3WA 1L3TA 2V68A 2W7OA 1FJCA 3NOCA 2BE9B 4ZOSA 4QOTA 4WE1A 1G6BA 5E3QA 4DQPA 1UEVA 2LP4A 3DXSX 2RDIA 1S6QB 3W1YC 1GTEA 4OHYA 1PYTA 2OKQA 1RCXB 3MMBB 3MM9B 4YR0A 2MY7A 2R8JA 3K5PA 3ETMA 3OHBA 2KZZA 1RE1B 1S57A 2R2RA 1DAXA 2OO4A 3IN5A 1QLNA 2Z0GA 3U7JA 3VTIA 2KRRA 4WXOA 4RNOA 2JLGA 4QW8A 3RW6A 3MR5A 1CS4A 1AUDA 3H5SA 5B0CA 2DKOB 1Y10A 5J1EB 3MFIA 2J7UA 4OX6A 3BJYA 2EKYA 3VCDA 4A46A 1IM4A 1T3OA 3FBEA 3HJFA 4K5SA 3KUHA 2YKMB 3ZZZA 1S1UB 2HRUA 3OT9A 2ZHOA 2W2MP 5H9EJ 1KFDA 5A76A 1U25A 2Q66A 1XMQF 3M2RB 4P74A 2EVZA 2G13A 3WX4A 4DPUA 5A6PA 2XO7A 2ATLA 3FFIB 2J9CA 2FYXA 1HARA 4WFNQ 2C3MA 1QM9A 4WFZA 1I51B 2CZ4A 2MKJA 3GIKA 1VQNS 1U8SA 1M5KC 1U8WA 1XEZA 2JRSA 1U1PA 2ZH1A 4UOCA 1MU2B 2AZ1A 4LR7A 1ZPWX 2C1EB 2NZCA 3F56A 5L46A 2XTJP 1RHQB 3JAMU 3KK1B 3KFWX 4F4AA 4DV7J 4JI7J 4MTPA 1TMMA 3KLVA 2BR0A 4DSIA 3D2WA 1I6JA 4ZVOB 2BJ8A 4LBHA 2BVZA 5LSRA 1MMDA 2FVPA 4KE5A 4YY3J 1HNWJ 3BB5A 2XNQA 2Q43A 1T02A 3BH6B 2VDIA 3KMQA 4OZ1A 1RT6A 1V5VA 1VQSA 1XMBA 3IRXB 1B7YB 3Q83A 3LP1A 4BWMA 2CQBA 2M9KA 2CJYB 2MSSA 3F73A 4BHQA 3Q89A 1NDCA 1TUVA 4ER8A 3NOGA 3EX7B 2VU5A 4QIEA 3DRSA 4DSJA 1WG4A 1RCOB 1N0VC 2CDQA 3MMAA 4I69A 5KFRA 4C6AA 3QT6A 2IM1A 4B3RF 2ZVSA 2B4UA 4IRCA 1UWAA 5ETOA 3T6BA 3W2VB 3HVRA 3Q23A 2RRAA 1KVIA 1LWXA 1HW9A 1WNEA 2G0JA 4M5HA 3IBFB 1UFLA 3E01B 2V50A 2EBEA 2ZBIA 3CJ4A 2JC0A 3TVKA 3RAQA 4Q0BB 2Q3PA 3VHQA 2HZAA 4Y28C 2KT2A 3A4TA 2M5YA 3MPUB 5KFFA 2H48B 4ZMMA 4I2PB 1CJKA 2CG8A 3DM2A 2P9CA 4URGA 4ZITA 4X65F 3DLGA 3KHHA 4U67Q 5D0EA 3LP2A 3NGDA 2OFHX 3TARA 2FJVA 2GAHC 1DHMA 3EVMA 1VQ6S 1DZ5A 2JOQA 3KJFB 1TAUA 1PJ7A 3I0RB 2ZWPA 3KUGA 2Z58B 2IM3A 1L3KA 1S6QA 1Q1KA 2J0WA 4DEZA 1HNZJ 1DLOA 1S1TB 3M8QA 2CAJA 5ITHA 1RT4A 4DL3A 2B9XA 1HKAA 3E51A 3QAUA 3QJLA 3AJ2A 2VOPA 4USKA 4KGZB 5DG9A 4CLTA 1HBUA 1RHMB 2ZHBA 1RABB 4ED1A 3PEHA 3KDOA 2WAQD 4F26A 1KR4A 4F04B 2Q6BA 4ZLLA 5KG5A 4N41A 1WSVA 1J2VA 1KD1T 2K06A 2D3ZA 3KXDA 1QUVA 3G2XA 4DR1J 4GC7A 2K1RB 4J9VA 1C1BB 5KFAA 1M0SA 5I42B 2VC0A 2VJVA 2HZVA 3C2PA 2BJ9A 4JI3J 1RT3A 3SV3A 1XNRF 3I0SB 4IR9A 2N7CA 2W2NP 6AT1B 2ZM6F 2FLNA 1YJNS 4F0KA 5D3GB 4O3QA 3GONA 3CDUA 3THVA 3OXFA 1YITS 4PPZA 3MCOA 1DQ8A 4QR2A 1OWXA 1N6QB 3R5DA 5KFBA 1UAWA 4YHHF 2V6AA 2VFRA 4B9LA 1AZSA 3QLHB 4FXWA 2ZWOA 2X3DA 3P49B 4K7QA 4OX9J 1NB2A 1RWNB 1VIXA 4PWUA 4EYHB 1L3UA 1SJRA 5ETSA 1DURA 1S0OA 4M5MA 2V0NA 4WZMA 2XULA 1AROP 4DQQA 5J2QB 2QYGA 2BANB 3TP2A 1FWPA 2CPIA 1KN6A 1O51A 5KFHA 2LQ9A 1XNRJ 5T14A 1G1XA 2RHSB 3IR6B 2MQOA 2YX4A 3MUTP 4X4RA 5F8LA 3HM9A 4X84A 2BDPA 1IKYA 3MM9A 1LWCA 3D5MA 3FSIA 2VB6A 4V1Ak 3AQPA 1U1MA 2QEXS 1S1UA 4Y2MA 4QCLA 2GGPB 2VIHA 2CPEA 4TU9A 2FQQB 2WSFC 2AT1B 2BE2A 3GILA 2BJEA 3K57A 2AKWB 4I2QB 2MZJA 1GTHA 1SCJB 4LRFA 4DV5F 2CWXA 1RKJA 4PG5A 3GG1A 3OL6A 4UQGA 3CD5A 4OJHA 3KLEA 4DV2J 2UXBF 1XK8A 1QTNB 1UW4A 4DI6A 2CA9A 2JC1A 5GMKa 3TR5A 3W5XA 5KFNA 4KPCA 3K59A 5J2MA 2XMKA 2XSJA 3D1HA 4IG0B 5AE1A 3T1HF 4OZ0A 3MAQA 3GV5B 3GFXA 2A2CA 3IGNA 3KOAA 2CIMA 5HQ8A 2ZC4A 1S0VA 4R5PA 1KEKA 2E1CA 1HBUB 2O5DA 4YB6A 1NK5A 1OY9A 5AE2A 4QBUA 1QSLA 3NXZA 1UPMB 1YBTA 2CQ3A 1FKPB 4XAKA 5G0RA 4MAKA 3RYLA 2V94A 5CCMA 5LJ3Y 1U1RA 4ECVA 1VC0A 2ASYA 2EG1A 4C0BA 2HAFA 2YWFA 2AJ1A 2CYYA 3G8SA 4B3TJ 1IBLF 3FNNA 1OQ3A 2RQ4A 1RQ0A 4X2BA 5IC6B 3OQ2A 1MW7A 3SI8A 3P5BP 4WWSA 1S0MA 4TN2A 2KJWA 1HBMA 2XZTB 3I32A 1FRIA 4F02A 1SKUB 2GNKA 2V69A 4LF6F 4B3TF 2XMJA 4ERDA 1Q82T 2HWHA 3V6KA 4RW8B 2DO0A 3OSPA 4IFVB 4LFCF 2I0XA 3GR1A 3I9ZA 2FJEB 4KGMA 1R0BG 3L09A 2HRTA 3MEGA 3W62A 2FJXA 2B9EA 2BQ3A 2DRAA 3BPSP 2B51A 3PX0A 2QL5B 4DCPB 4C3MA 4BBYA 4Z7YA 2Y8YA 5E3AA 3FBFA 2RQKA 3K7RA 2QMXA 2WZ1A 4FP9A 4PEOA 1W7WA 5ETKA 3ZZTA 2AGPA 3PM9A 1M5SA 3MM7A 2CPDA 2H4WB 5A8WA 3MR3A 4A8FA 1Q5VA 2VBZA 2VG5B 2HFZA 2LQJA 3DRYA 3IMQJ 3PTWA 3MURP 4DR3J 4WYWA 4PR6A 5IT4A 2MZTA 2V9WA 4UF4A 3BKUA 3M2UA 4N47A 2MXYA 2ASJA 2XEXA 2BJ1A 2I8EA 3G4SS 2XG8A 1WORA 4MYUA 5IOLA 2C2OB 3KLGA 2CJKA 4IFVA 1VC5A 4LMZA 5J2NB 3G82B 3IS9B 2DY1A 3LW5C 4MT1A 3ZTPA 4HT7A 4ZKAA 4JI4F 1URRA 1RWPB 2R2UA 4ZIVA 1TP7A 1VDHA 3LP2B 2DR8A 2FJWA 5U47A 3DM2B 3BGRA 4FYVB 1REVB 4C48A 1WD6A 5KFIA 1KTVA 3TZZA 3I5BA 5HQLA 3TA1A 2GAGC 3TJAA 2C22A 1VYAA 4P7TA 3FVYA 1ROFA 4I67A 2HHWA 4ICLB 4ZDNA 5D0RA 4CO3A 4G65A 5CYQA 4C8MA 1JJHA 2LDYA 2NXJA 3MCNA 3VAHA 2R7XA 2KHDA 1M5PC 3DDIA 1PAUB 3CJKB 2HNYB 1EB0A 1FRKA 1T9TA 3BGOP 2NUHA 1RT5A 2PGCA 2XMUA 4NLQA 3M9OB 4KHMA 4CT9A 1Q0NA 1HBOA 5H1SV 5EUHA 2NPIA 3UFCX 4NASA 4ECSA 3F44A 2QV6A 4U9RA 1LWEA 1NB7A 4TY8B 1D1UA 4JI2J 3NGUA 3R8YA 3B8HA 3RRGA 2V2ZA 4ELTA 4DSEA 2BABA 1XR5A 2GFFA 2AW0A 5HSPA 1HPZB 5H9FJ 4ECUA 1UA1A 4LFCJ 4OIXA 4DL7A 2HFSA 1RJJA 3D7SB 4K5RA 4X62J 3OTOJ 2DPJA 5HANA 2D9PA 3T1AA 1N34J 1K9MT 4HACA 2DR9A 1FT8A 2VF3A 1EX8A 1YGYA 5IT9Y 5DZ7A 1F5AA 2KVIA 3HFKA 4DV3F 3CIMA 3V81B 2YNHA 4WP8A 1QVGR 2M52A 1D0EA 2RUSA 4G6VB 2GVDB 2ZJRQ 2J5AA 3HZGA 1IKWB 2XB2D 1QE1A 4LSNA 2BOPA 4IG3B 5EX3A 2AZ3A 1SJFA 3T1YF 4ALZA 2BZ2A 3BBFA 2WRMA 3MM5B 4V19J 3HF5A 3R5CA 4JYAJ 1JLEA 3Q22A 2SXLA 4ED8A 5J1PA 5DDQC 4ECQA 3RB3A 1QAXA 3BSCA 1LFWA 1H73A 4OYAA 1MN7A 3RW7A 1MWYA 1JLCA 3ADAC 2B5JA 3MM8B 1FVSA 1U09A 3N5FA 3PACA 2W25A 3ZZYA 1GX6A 5J1NA 1RWWB 5DRKA 2WVEA 3DOLA 1CEZA 3GIMA 4P73A 4A8WA 1FI4A 5ETTA 1DRZA 3HZEA 5LMNF 1AB8A 1RHUB 4ZVUB 2R4FA 3TVYA 3H8YA 4R8UB 3N5BA 6FD1A 5IT0A 4O0NA 3KYLA 2BRLA 2X1FA 3AA8A 2RS8A 1ZA1B 2O01C 3ULHA 4C11A 1Y9OA 2XLIA 1CQMA 2DNNA 4ZPDA 3QGIA 2LCWA 2H4YB 2NCKL 2IBOA 1RUSA 2X1AA 2B56A 2D74B 3DRRB 2AF6A 3P8BB 4C98A 2H5JB 1G7CB 2CPFA 4USVA 4RNFA 2MQQA 2MKYA 1DFDA 4ZHRA 2GJIA 2GJ2A 3Q0AA 1RWMB 3UVJA 2QMUB 1XC9A 4MIBA 2D9OA 5E3RA 2XSJB 4IG0A 3QMQA 1U6BA 4K4ZA 2FVSA 4ELUA 2DGOA 5HMWA 1FE0A 2O67A 1U6ZA 4ECXA 2UUTA 3IR5B 1EP4B 2FLOA 2MLZA 2XMAA 4ZLPA 5B0FA 4A8XA 2FZKB 4C11B 1HBOB 1N33J 4HT5A 5KT4A 5HAOA 2VICA 3KNAA 2P2CB 3A13A 1JLQA 3GIRA 3AB4B 4DG1A 3GV8B 4YUDA 2DISA 4XTTA 4Y34A 4YN3B 5G0RB 1Y3JA 2KG0A 1KTQA 5GMDA 1N36F 2BM1A 2AYMA 2ZH6A 4LFBF 5K8MA 4NMLA 5KT5A 3HHLB 2MSTA 3OFGA 4HL9A 3R9LA 3K5NA 5LM7E 1D9FA 2Y8WA 2GIFA 4K50A 1SJQA 1BMQB 4UT4A 1S4FA 5DO2A 3CDEA 2VQFJ 2AJFE 1ZM4A 2HBZB 2OPQB 2DEIA 1S1XA 3BQ0A 3DLHA 5A2QY 4M5KA 2DITA 2VKZG 2DCLA 3OR2A 3NRBA 3Q8PB 1WI8A 1IBCB 2FVCA 2W9CA 2YKMA 1EARA 5LXYA 3RG6A 4A8KA 4FYYB 1H2UX 3V6HA 2AV5A 5J2PB 1F9EB 1RTZA 5FDLA 3HJVA 3TRGA 5ETPA 2WONB 4KHRA 1P6TA 3WX8A 4K0KF 1NZ8A 3OTBA 1RTJB 3QIPA 4NLOA 4FF1A 3GJTB 4I56A 7AT1B 4F4XA 4LRBA 4P10A 5EDWA 4KHPF 3D6TB 1EETA 3AOBA 4DCOB 3ZZPA 1HQUA 1YRUA 4LBIA 4R25A 2CG4A 4KGXB 3SEOA 5IC4B 2ALZA 3GLJA 1D9DA 1H3DA 2ZOFA 4KBIA 5HN0A 4KPYA 5L1LA 5F8JA 1PBAA 3ILJA 2QLXA 2V34A 4C8ZA 1YJTA 1SC4B 4DN0A 3DLKB 2HIQA 2OMLA 3V4IB 4ZP8A 2K2PA 4CTAA 1Y5LB 1SJ4P 4M5JA 2XWYA 5KFLA 1FFGB 2HK2A 1RHJB 1RAOA 2QT7A 3JSRA 3VF0B 1E6YA 4J9RA 4LF8J 1XIQA 3DRRA 4J5OA 4PAAA 1KOOA 4CLZA 2R7SA 1YG0A 4DV6J 4IH6A 1S1TA 2IFXA 4WFAQ 5DGAA 3ZO7A 3L3CA 1FNMA 4ANEA 4LF5F 4PWDB 2K7KA 1CQNA 3MD3A 4HH0A 1PGZA 1FKOA 4QWCA 3NGRA 4PCQA 2CJAA 4FF4A 2ZZMA 1RI7A 4ELVA 4DXLA 4G1PA 3ZZRA 3H4BA 3MHYA 4MFBB 4P72A 4J9SA 1U49A 3NNAA 3GR0A 2I9SA 2AEMA 3LWMA 4JUZA 4ZHRB 3PKYA 3V5RA 2PA8D 2RRBA 2WB4A 4I1TA 2DHAA 4CLPA 1JLBB 4Z37A 2OPRA 2R42A 4LF8F 2HHPA 2JHEA 5LOQA 1CG2A 1HNWF 2W4PA 3VQTA 2F63A 3OFEA 3VV2B 3JB9k 5HVFA 1U45A 3B4MA 3RGIA 2V2QA 4I2PA 2ZEJA 1BQMA 4OV6A 3O5TB 1KQKA 3CWJA 3AOAA 5A8KA 3M2UB 2ZM6J 2COLA 3H90A 1XN9A 1KC8T 4PXDA 4A8YA 4ZPBA 3DFEA 3X3UA 4AT1B 4HTIA 1X9SA 3SFUA 5J2NA 1UTAA 3LH2S 1UA0A 4MKVA 2EG2A 1WEYA 3ENAA 2BOAA 1UL3A 1JLEB 1CBKA 2ZUAA 1X4AA 5K5MA 2NYIA 1FEHA 4ZLNA 3A12A 1B4SA 2VKRA 4L74A 3Q8SB 3A3NB 1M5VC 4MKYA 4QU6A 1JLCB 3GFHA 2QLBB 3DXBA 3P4UB 1YRXA 5KFDA 2QC3A 1TKDA 1OQ6A 2OLWA 3JQJA 3EZUA 3KLFB 5KFZA 4H54A 3KLHB 3K5MA 1R0AA 2BXJA 1JMTA 4WKYA 1TFWA 3G6ES 2ROGA 1K47A 3P5TL 4K2JA 3MPWA 4IG3A 2UU9F 3ZTQA 1HNVB 3HSDA 5DJBA 4TQRA 3W3SA 3MECA 3TUJC 4PZVA 3EYZA 5DQIA 4RR5A 2LXIA 3FSYA 2ZE2B 5F8NA 2YKPA 3M1VA 1MMNA 1OSCA 3PJWA 1GFWB 3D68A 4L3NA 3PO4A 1UVJA 2QE5A 2DHSA 3M6WA 3BYRA 4O23A 4RPFA 5CH7B 2FZGB 5F3TA 2XBPA 1HQ2A 2APOA 2CNOB 3KG0A 2HAIA 1WHVA 1U0HA 2OAUA 2YPZA 1HI8A 3TZWA 3S1TA 4DZDA 3M4XA 4C2MA 2CQDA 1WC5A 1DY3A 4DPXA 4TYAA 1NK0A 1FTRA 4ZPCA 2OIHA 2HNYA 4B02A 4ED0A 1ZTWA 2KZMA 1WOPA 2MHNA 2HNZA 4I4BA 3SQGA 2HFNA 2IVMA 4OHZA 3KK3B 2B9YA 4CLFA 3J80Y 4WIQA 3A8JA 4KTQA 1LXNA 2EEYA 1NSPA 3GIJA 2BE2B 2DNRA 1GMWA 1H0HB 1YSJA 2E5GA 4C3KA 5K8PA 4JI2F 1GMUA 2U2FA 4U7UD 3IM8A 1HNIA 1WC3A 1LW0A 2FHKA 2CQ2A 2E7VA 2YKQA 3GPAA 3DDNA 5JXSA 2HIYA 2G2OA 4DHVA 2B4VA 2QSWA 2VV5A 3OPKA 3M8QB 4YR3A 1T03B 4LIWA 5CABA 2R8HA 3PKMA 2VQEF 5A2QU 3MD1A 3GG0A 4C97A 1SL2A 2Z2LA 4BCAA 4DV0J 1S97A 2HSEB 4OYZA 1XMQJ 4ED3A 5HL7Q 1NMEB 2B4OA 2C28A 3POTA 2LDIA 2YVSA 2DH8A 3QRRA 3GP9A 4RNNA 4F4YA 4QQBA 1YK9A 3DHWC 3A3OB 1IWAA 5L39A 1VQLS 2HQDA 1HBNA 2BV3A 2GA7A 1AZSB 3IFEA 2XY7A 4RW8A 3AXKA 1RAIB 4DL5A 1U7LA 2DNMA 4YB7A 2JEIA 1EKRA 5BJRA 2GO9A 1YJWS 4C8LA 4M5IA 3IAS9 4U8VA 5FDLB 3G8TA 3R3TA 2VQFF 4K4YA 4F3OA 3LA0A 4K8RA 1GX5A 5K14A 3N9UC 1RT3B 3PG9A 3OLBA 2A6OA 4DSKA 1YBUA 4BWJA 2C2MB 4LSLA 4NI2A 2AGOA 2A3JA 2R2SA 3R7BB 3MDFA 1Y5NB 2K3IA 2E1AA 3GFZA 2G2YA 2YNGA 3GCWP 3QLHA 4IH7A 2DR5A 2CQHA 2R7VA 4F4ZA 4WPAA 1OO0B 3NNHA 2VA2A 2YNFB 2KG1A 1AT1B 4EUVA 4DLGA 2O3DA 3N6NA 4DSFA 2IC3B 1HNZF 4OYOA 3BSOA 3PFOA 1VQYA 4DL0C 4PYAA 4KB7A 2V4JB 1REGX 1UJ6A 2KVQE 4EFAC 3VGVA 4UZCA 2IY5B 1K8AT 4LF4J 3WC2A 5IV3A 2XI2A 3QGPA 4WFBQ 3NS6A 3MPDA 1NDLA 4PG4A 2RU3A 2L3MA 1X5SA 5C24A 5DDRC 2FHOB 1Q79A 3J7A1 3GFYA 2BKOA 3I82A 3WZ0A 3VGTA 4CRJA 3PNIA 5AXLA 1RK8A 2HZCA 3CF5Q 1RDRA 2ZOMA 3M8PA 4C0OC 5KAKA 3JSMB 3DNCA 2MLYA 5I3UB 1JLAA 1U2FA 2LA6A 2QL9B 2FJAB 3M30A 4OI6A 3AD9C 2V2VA 2ZNYA 2GMLA 5IXUA 2KXFA 4CYUB 4OYIA 2UUAF 4WKRA 3QWUA 4F36A 1ULRA 4Y2CA 2KDOA 5J2PA 2CKWA 2PT0A 3DN9A 1HQEB 2AIRB 4L72B 2RD5C 3EGNA 3C15A 2R3VA 1DARA 1H98A 4OX9F 3CMQA 4EZ6A 5EGYA 4MK7A 1Y5IB 3GSIA 2OPSA 2W4CA 4TLQA 3PXGa 4RBTA 5D0HA 3BO2A 5KG2A 1JIHA 2MQLA 2RUGA 4TKTA 5E3PA 5CXTA 1SXLA 4G3IA 4FF2A 3OXGA 1BWEA 2D41A 1ZETA 2EKNA 2WBRA 4RL1A 5KG7A 4WBFA 3FQLA 3V4MA 1O5JA 1LWCB 5AXMA 4FF3A 2LEAA 1W2IA 4CLUA 1WWHA 2CDRB 5K9FA 1T11A 2NXUA 4GVBB 3CCMS 3E8OA 1RT1A 5M2PA 2EI5A 4ZVFA 4KJIA 2X1GA 1UKUA 1IJEB 1VOMA 2BANA 3NGTA 4NLVA 3TX8A 3ZNUA 4ZCMA 1YJ9S 4RO0A 3ZZUA 1UFKA 2XS2A 2XYGB 1HI1A 3DRPA 4PWWA 3CCZA 4I7FB 4PG7A 2HNDA 4CWBA 4X66J 1HFEL 2B7CB 3H2VE 4ZJOA 5GAGU 4N76A 2EC0A 3NKYA 4TY9A 4RUCA 3FK4A 4USJC 1RYSA 2D7SA 2UVRA 4L3KA 2F8MA 4BS2A 2M2BA 4UY8T 2ZBCA 2LFVA 1PO6A 3IP0A 3VVTA 5BYQA 3VGUA 2F5GA 4Z2XA 3H0PA 4LFAJ 1FCAA 2QN6B 4DOZA 1Q7YT 3UDLA 4YHHJ 4WF9Q 2C2ZB 1TL4A 1R6VA 1OJ4A 3OVBA 4JOUA 1OS5A 4CLWA 4EYIB 2UUBF 1C2PA 3TAMA 3J7YI 4OZ5A 4PXBA 2CJBA 3EGWB 3THPA 1VISA 2DGWA 2NXEA 2R9LA 1SB6A 4FXVA 3DLJA 2FLLA 2GV1A 2Z56B 2YWHA 4DU7A 1R8PA 1WHWA 1Z2LA 3BV8A 2XS5A 1F3FA 3R6LB 1JLGA 4B9SA 3AHPA 1RU2A 2RAQA 3C19A 3N28A 5L1JA 4ED7A 5DG7A 3PJXA 2JEGA 4ZS6A 2IDLA 4D3GA 3M1VB 4Q7AA 5A8KB 1APSA 5IWAJ 1R31A 1KQSR 3R2CJ 3UDVA 4I64A 4IDKA 4QYZJ 2Y1JA 2DR7A 3NMRA 3NS7B 4EBCA 1XJWB 4HYKA 1S6PA 4QIFA 1UW9A 1RHKB 1OIAA 3NG8A 4UUWA 2ACYA 4WFXA 2V8PA 4Q45A 2HGLA 2F1FA 1BC6A 2M0GB 2M4MA 3MEGB 2XY5A 2CZ9A 4K59A 1TKZB 4ZCKA 4AE5A 3J7Z5 2LKZA 1AXQA 3M8WA 3TNVA 3H5XA 4ZVQB 1WSRA 1TUGB 3M6XA 2LMIA 1QDUB 3HHLA 3I55S 1T9VA 2A18A 4K4TA 1FA0A 2DJWA 2P6SA 1IN0A 1TELA 1NRKA 2B7BB 3DHXA 3HVWA 3U27A 4GKJJ 3UD3P 2HVIA 3HT3A 4DL4A 2BW7A 1WI6A 2KFNA 4RW7B 4CLKA 2EK6A 2FJBB 4X65J 4LSNB 4QYRA 3R1HA 1NM2A 3ZZOA 2ROEA 2Y3YA 3MCMA 3U1MA 2CQPA 3NBPA 4B9UA 2NXNA 5DLFA 2XZWA 5ETRA 2QFIA 3BBBA 2KFYA 5KFEA 5AE3A 3TOQA 1TL5A 1KHVA 2GVZA 2RF2B 1WELA 2VFVA 3H2LA 1Y0HA 3W2WA 4U6PA 4X62F 3K5LA 1LWFA 2ADCA 2ZZTA 2F4VJ 2VODA 3CE8A 2CPHA 4RW6A 3PHTA 5C24B 1HWKA 3FSXA 4DFMA 1UVNA 4USTA 2YX7A 2DGQA 1EETB 4DPYA 4KH1B 2YNFA 3IAM9 1NO8A 4DPWA 4DQIA 4DR5J 1OMSA 4F7VA 3KJQB 4NCGB 3EICA 4K4VA 1MG7A 5JVHQ 4O0IA 1P8GA 1PSDA 2XZDB 5JVGQ 2YBVA 3KG4A 4HHHA 2E66A 3DGVA 5J1EA 4J9KA 3DC2A 2HGNA 3DLKA 3MWBA 3J7AN 1CS4B 1KQGB 3RB6A 4JV2A 2G0CA 4M1KA 5KG0A 1TL7A 1WEZA 2LA4A 4IOBA 2XHWA 4NOHA 3PIPQ 2JJ4D 4ZK7M 5D15A 1VC6A 1FO1A 3BQ2A 2AJ2A 1X60A 4BC9A 2ABYA 3UDCA 1V3RA 2EFGA 2GQQA 4CH1A 1IKVB 2E5LF 1IBLJ 2HQFA 4Y0FA 3AQOA 4B08A 1FK9A 2RE1A 2CNLB 4O44B 2EXUA 1S5ZA 3LAMA 4ZPTR 4IR1A 3MR7A 5HI7A 4ECZA 2KYXA 1BE4A 1VJQA 2OHDA 2ZITA 3S01A 1ZYQA 3OVAA 2DXFA 4HVZA 3CC4S 1S7IA 1NK7A 2Z2MA 2KI2A 2YPYA 1QE1B 2BBEA 2MKIA 1SJ3P 3MZIA 5C42B 2HHHF 1FVQA 2GHVC 4QR1A 1RWXB 2MZQA 2C2RA 1G2EA 3GSDA 1FEEA 5LMUJ 1KS2A 3C6TB 3POTB 5DLGA 3FMBA 2VG7B 2EC2A 1FX4A 4UOGA 3T1YJ 2RDJA 4U96A 1FK9B 2MB0B 3CCWA 3D0GE 2HGMA 5SZTA 1C1CB 1HLWA 2AJ4A 2CVEA 4PUOB 2VD3A 4EI2A 5HK4A 1D09B 2V9KA 3E3XA 4OFZA 4YR2A 3TAQA 4JI6J 3K2YA 3L7PA 2B43A 1JWWA 2AYEA 2BUNA 1RT2B 2HS3A 2MKCA 5IFMA 1XMOF 1IBMF 1VGYA 2PN6A 1CULB 1Q5YA 4NEYA 1HMVA 2IC3A 4DPOA 2OTLS 3ENQA 1Q78A 3OW2R 2HHHJ 1YLXA 2K1RA 4KYZA 3LUYA 1TL3B 1N34F 5KFYA 3M7VA 3TA2A 1ZS6A 2Y0SD 2N7YA 3GCXP 5KT6A 3Q8QB 2L9WA 2ZJQQ 4KKOA 1H38A 1VQ8S 4LF9J 1RAJA 3BS9A 3GZ7A 4OYXA 4ZVSB 4GKKJ 2J6SA 2E1MC 1SQFA 3ETOA 4JI5F 1WF2A 2GVZB 2W2OP 5CYQB 1TKTB 4O3SA 4CNZA 4KO0A 2HNDB 4QIWD 2MDAA 4Y2IA 3HKZD 1B0PA 3CC2S 3JYTB 3OL9A 2P8IA 4X4PA 1GQEA 1Q4RA 3MEKA 5B0GA 4URQU 3ZFVA 3PRVA 4KT0C 3LF0A 1X4BA 2LQBA 2X3GA 4XK8C 2ZJPQ 1U2CA 4X4QA 4LF7F 2I38A 3T9ZA 4CLLA 2Y0BB 5GADU 1I94J 1T05A 4HHUA 1FJEB 3K58A 2N3OA 2OPPA 5D6GA 1VJWA 2GIRA 2RIJA 1V9OA 3LWLA 3CCSS 3IA0A 3HCXA 5D78A 3SYZA 3HHDA 4CM2A 4DUYJ 4DV4J 1SV5A 2MKSA 2R7QA 3KLEB 4B3MJ 5CCLA 4F2SA 1V6HA 1RHRB 1Q8KA 1X5OA 2J9EA 1S7HA 2HBRB 4NLSA 5KTQA 1T3NA 4DSLA 4QPTA 4JI3F 2MJUA 3CEDA 4NZ0A 3SDEB 4DV2F 1U1OA 3R2DJ 1KRPA 1W25A 1U1LA 1I3OB 4LBPA 3MPYA 4FYWB 5KFSA 1F0XA 2XYHB 1AW0A 1NNDA 5KFJA 1VQ4S 4CO4A 2M8DB 3QO9A 2OUGA 4OHXA 3N6MA 2CPZA 2LEPA 3IO1A 1RBLA 2D3UA 2Q6CA 4M5NA 4NLYA 3S6EA 4A4JA 2DNPA 1WJ9A 3N0VA 3WIVA 5HVGA 4LR9A 4DR6F 4AXIA 5KG4A 1H7XA 2CJXB 2JDJA 2CWKA 5CQGA 1ZZFA 7FD1A 2KYZA 5A8RB 4RJVA 4ZJQA 4E8UA 2BJ7A 3RRHA 4ZVTB 1XQIA 4I6YA 1BGXT 2OPRB 9ATCB 1PYSB 4EWTA 5HMYA 5KFQA 3KHRA 3UW1A 4O44A 3NMAA 2P9GA 4NLWA 1R8CA 2IVYA 4DQSA 1TAQA 3G6XA 4UY85 4GKJF 1FFWB 3BPDA 2IJFA 2VBWA 3I96A 1ZZNA 4DUZJ 1S12A 1N4LA 3OVSA 4QJVA 3EXYA 1YHQS 3FBCA 1WG1A 1Y4ZB 2RKIA 4J91A 4PXEA 3WIUA 2ZBRA 1WKKA 2MQMA 3K17A 5DQHA 3CCQS 1U6FA 4IYQA 4HI1A 2VDHA 3O6QA 4O4RA 1VQPS 4DV1F 3RB0A 2KRBA 2GHWA 2BX6A 1QAJA 3CDBA 3JQKA 5ETMA 4BC7A 2DB1A 2QX0A 8ATCB 3CIZA 3PDNA 1T95A 1IR2A 5KFTA 2E29A 4EO6A 4HKQA 3LP0B 4USHA 3UE2A 3DYAB 3D6HB 4IKAA 4UOFA 1VRUA 2ZBPA 1BY9A 3FEYB 4ATNA 1TKTA 3A3PB 3KKFA 2OEKA 3CJ3A 2PMWA 2QIFA 2QLWA 4NXMF 4GO7X 3MR2A 1HNVA 2DNLA 3D1OA 3QYYA 3GV7B 1SUQA 4NL5A 4DR3F 3CJ2A 4DX5A 2IYGA 4PG6A 4I2QA 3TEGA 4DX6A 3IS9A 3JSBA 1JJCB 2V4QA 4DQRA 3V4IA 1NZAA 1S0NA 4FS2A 2GJFA 2V8HA 3HPOA 3MAAB 1IBKJ 3KK1A 1WC4A 2GS8A 1GH8A 3IWLA 2W9BB 1RKIA 1V5IB 3MM7B 3Q8YA 1S6OA 2CFXA 5A6WA 3L7UA 2MGZA 4NXNJ 4M5GA 3CC7S 1SPBP 2Q1LA 5B09A 2JEFA 1VR6A 2JVRA 2UXBJ 2MQNA 3CJ5A 2PC6A 3KLGB 4X4UA 1LW2A 1TV6B 3GE9A 4ZPAA 1F2GA 3HX9A 1RAAB 1EIYB 4OYMA 1EAYC 2QGFB 3HULA 3TYTA 3IXQA 4YEAA 4ZVRB 3GYXB 5B0DA 1OYEA 2FUG9 4NZ6A 3BKTA 1S1XB 2DK2A 1D8YA 2UXCF 1HNIB 2FZCB 1RBAA 2R7RA 2BKNA 4WU2A 4ZLJA 2W9CB 3MTKA 2LVWA 1YJVA 2YWWA 1A0OB 3ZTRA 1FKPA 3DI6B 3MMBA 4HTJA 4FNHA 2RH3A 2WVCA 3JTNA 3T5JA 1VBZA 3LANA 1R8HA 2E7XA 1RZMA 2KB2A 3QJJA 2XMWA 3OHAA 1HBMB 2G2ZA 1LOUA 2V4JA 2E5IA 1NJZA 2QTWA 4DR4J 4OX7A 3TEHB 1RAEB 4FVCA 3BDPA 1KVJA 4ANDA 2UXDJ 1AFIA 4LRAA 3FCHA 1K44A 4DG1B 2OEMA 3BR9A 4HLBA 4ZP7A 5IZHA 3QRQA 1SH0A 1NSAA 4NA2A 1SC6A 1TU0B 1U24A 5F0WA 4NLUA 3VR1A 4QWAA 4J9OA 1LV5A 3UR3C 3NL0A 2LXFA 2QZ8A 2CJQA 2G0IA 5EWEA 3KLIA 2DTJA 2G1DA 2GMJA 3CB4A 4GVLA 4LSLB 5KG6A 5HROB 3J80U 3BO4A 3IR7B 4F3QA 3BBCA 4NLRA 3JXOA 2YNGB 1A7GE 4OZLA 3ZXWA 4AL7A 1NK8A 1HW8A 1NK4A 1P1LA 4JI1J 2A1BA 2DCUB 3IBWA 4PWDA 4JI8J 1WKLA 7FDRA 2BQRA 2ILZA 4XIUA 1SC1B 3HFZB 2UP1A 4LRCA 4AQYJ 1A6LA 2HYIB 4JI0J 1WUUA 2RU9A 5E33A 4ECTA 3CCRS 3UQSA 4DF4A 1VQ5S 1D8ZA 3P3DA 3CJQA 1EHWA 3CD7A 2F8EX 4DS4A 1VBKA 3DLBA 1EQ0A 2J8SA 2X51A 3BF4A 3W63A 3CO0P 4NI2B 2K3KA 5T7LB 3R27A 4HEA9 4Q44A 3K5OA 3UCZP 2BEFA 2RB7A 1NEEA 2FHJD 3FQKA 2JWNA 1RTJA 2VBYA 3ET6B 3QIPB 2J9DE 1X4GA 2LQ5A 3ITHA 2D3OR 1IKVA 1FE4A 1WC1A 2ROPA 4GO5X 3R5GA 3CJ8A 4Y65A 4FDFA 4KIAA 4KV8B 4LSZB 5KFXA 4N56A 3PHEA 5JUMA 3QZ7A 1YBAA 4R8UA 5KFCA 4HDGA 1NHUA 2HQ3A 1KFSA 3FGVA 3NEKA 4WFYA 2WSEC 4F0MA 2W9BA 3CCJS 3LAKA 3KTQA 2PFFB 1H2VZ 1X0FA 1EZZB 5AT1B 2CVIA 2KTQA 4TU8A 3NWRA 4ZN1A 3MI7X 1IWGA 1S6PB 3W5ZA 3M8RA 1YDLA 2B6AB 4IFYA 2JSXA 2J0SD 1FDBA 5KG1A 1VQ9S 1RTDA 2AJQA 1VBYA 3CW2C 3HLUA 4LFAF 1QTMA 2GQCA 4RNHA 4UQTA 3QPIA 5CA5A 1FESA 4YDDB 4RZRA 2V8GA 2XWXA 4EMDA 5GAHU 2QA4S 1LK7A 4LF6J 4DJBA 1OY6A 3PYFA 4F25A 1N36J 4Y2KA 5KFOA 3CO9A 4GC6A 2ADBA 3I4PA 3B78A 4MIWA 1VRUB 3SZ2A 2AU0A 4L76A 2AHOB 2FGCA 3MR6A 4OJGA 2GW8A 3CT9A 1S10A 1GT8A 2CNNB 4EU0A 2PA3A 2J6UA 3NAIA 2MKKA 4RUBA 3K89A 3CCES 1RWKB 1RA6A 3MCSA 3BM7A 4GVBA 4C8NA 5IM0A 1CJUA 4N8OA 3J81U 2W4DA 3DRPB 1X4HA 3LP0A 4QYZK 2JZ5A 1NJXA 1NUEA 1S48A 2QL7B 2N82B 1HD1A 4ES1A 1JNZB 2O66A 3H20A 5AXNA 1TMJA 3AODA 2VC1A 3QATA 2IMOA 3F41A 1ELOA 2GC8A 3HHLD 3AB2B 3AH6A 3B82A 4P2XA 4B9MA 3PV8A 4NX9A 4RWWA 4CLSA 5FLXU 2FHJA 4M63A 2WHOA 3PVXA 3KDNA 4N7TA 5EN1A 2PDAA 3EZOA 2XGQA 4XO0A 4OI3A 4QZVB 1X7VA 4EZ9A 1UETA 2PE8A 2QLFB 2F8HA 2WVFA 4WTYA 3AJ1A 1H72C 2WTFA 2IDEA 2F65A 4J9QA 1U47A 1OPZA 4DR2J 1JXVA 4OZ3A 1S9EB 3VGSA 1LNQA 3B6BA 3EXCX 3ISNC 3VALA 1HNXJ 1KLMA 2IIHA 3C6UA 3V2UC 3JSMA 1S1VB 3T6JA 4BDPA 1NJIT 1CJKB 4OJ1A 1FDAA 3C15B 4ETXA 4OYWA 4ZVPB 1UMJA 2VASA 2VA3A 1HL6A 2WBMA 1VQOS 1RT7A 3R97A 1HNXF 1PJ5A 3DOKB 3O3LA 4DUTA 1SKWA 1MWQA 4C8KA 2BKPA 3O8WA 3K8WA 2G1HA 2KN4A 2MZRA 2VG5A 2PI4A 2DGVA 1C0UB 3UDEA 5LSLA 3IRXA 3M32B 3QT5A 2L48A 4P2MA 1YKWA 3I87A 3QGHA 1VK3A 3NS5A 4DS5A 1LQ9A 2XYPB 2DR6A 1HA1A 3SCLE 1QJHA 4Y00A 1WDDA 3MOJB 2C42A 5C25B 1LXJA 2MQPA 3HO1A 4DFPA 4YDXA 3LOUA 2RHQB 3HP6A 1Q86T 3C16A 3SBMA 5F8IA 2UZAA 3T5LA 3D3CJ 1RB0A 4Q2MA 4ZCLA 2M3DA 1DQ9A 3OTOF 4FZVA 5CZXA 4DUYF 4DV4F 4DR4F 1ZBTA 4JI6F 4DUZF 4UTGA 3LPEA 4TYBA 4X4NA 1DTQB 1TZ0A 1RTDB 4B9VA 2V5HG 3QFWA 4KAIA 4Y2AA 1RT2A 3W8PA 4DV3J 3V6DA 4NLPA 5HP1A 2M7SA 3BR8A 3GJRB 3KJVA 4ICLA 5E41A 3CPWR 1BUXA 3KUEA 2RNEA 1T9YA 4B3SJ 1X5TA 2OI2A 4EEYA 2J0QD 1Q95G 3H5YA 4I0WA 5HLFB 3NAHA 3HI9A 3UD5A 1NPPA 4JV5F 1Q8BA 1S1WA 2JNJA 3OBIA 2MQ8A 1R3NA 4F4WA 3DOLB 4ECWA 3RB4A 4JI5J 5T7LA 1NHKL 1VQMS 3OR2B 4MYTA 4K0KJ 4NA3A 1NKEA 3LTOA 1JXLA 4HI2A 2V8DA 3FFIA 2H65B 2E9ZA 2ZBQA 1E6VA 4YFUA 3HK2A 4O3OA 3UPFA 2DNQA 3UR0A 1VRTB 2H5IB 2JX2A 3GJSB 1SH3A 2YWEA 5IWAF 3KHGA 5B0EA 1N5SA 3IG1A 2H3EB 4YY3F 2DXDA 4DBQA 2B3TB 1Y3KA 2CQ4A 3W7BA 5HJYA 1HR0F 1Z1ZA 1DJ0A 1RWUA 3DLEA 4FBUA 3MOZA 2YNHB 1EJ7L 4LVNP 5KFPA 1HHTP 4X4VA 2B8QA 3OR1B 3DOMB 1M90T 1UEKA 3PR5B 4LREA 4PG8A 2HLUA 1EP4A 4C4WA 1B7FA 1FWKA 3J81j 3NCPA 4E0DA 3GQCA 3T3FA 3MPVA 4F8RA 3T5HA 1PJ6A 6FDRA 1VHIA 2HEKA 3BO3A 1N0UA 1FXDA 2G9OA 2P6TA 4ANCA 3H40A 4JP8A 5I4MA 2ACMA 5D3GA 1RA7A 5IQQA 2Z2YB 5DM7Q 2DH9A 2HLTA 2DGXA 2WVDA 1M5HA 2ZHAA 4IO9Q 1B0VA 1K0TA 2LECA 2Y1LB 2FVRA 1UCNA 2DXEA 3QNWB 3JTOA 2AEJA 1TL1A 2IAJA 3CDWA 1ZM3A 1NJYA 4GMKA 3OUYB 4ID5A 3M32A 1FWLA 2I5JA 3TANA 3VVUA 3NBPB 1FKOB 2RILA 3IWXA 4RW9A 2DBBA 2HNZB 4L6V3 1Q53A 2CJ9A 3TJ8A 3DU6A 3HVTA 4H4KC 1IBMJ 2XGPA 1GK8A 2HG4A 1KBRA 4YQWA 2QA2A 3SSQA 3M8YA 1MWZA 2YNIA 5L38A 2CQIA 4LIRA 4W98A 3HFVA 2XC9A 3NCRA 2ZH4A 1X0PA 2YXLA 1Z2ZA 2AYGA 4U95A 1TL3A 3QGGA 5CHCB 4HR2A 1YTYA 5MLCV 4DR5F 2W2QP 2W1BA 2ZE2A 4A48A 3HXMA 4Q8FA 2DH7A 2MEWA 2VG7A 4QIGA 3KMSA 3RJMB 3VAMA 4KSEB 3JSYA 2IA6A 2UUBJ 3BGLA 4X4OA 2C2DA 4OZNA 2EW9A 5ETLA 4TQSA 3AXMA 1CSJA 3HD2A 3HSGA 5KOWA 4DX8H 2WOMB 2UVWA 1R8AA 3OLAA 2AEFA 2GGPA 2GVDA 2OTJS 2RJZA 5EWGA 4DR7F 2BRKA 3P45B 4LQ3A 2WW4A 4A8OA 4AUKA 5GAEI 1S1VA 3HKWA 3TUIC 1JJ2R 4HHJA 2E5HA 1S77D 5M2RA 4FXDA 1LKZA 2HFOA 3KK3A 2RT3A 4LR8A 1CJVA 4ZVHA 4ETZA 3MUMP 2HS0A 5GVQA 2E5JA 2X7IA 4PYDA 2E9RX 3PY8A 1SV5B 4ZJLA 2J0XA 3M6VA 1T0TV 1JB0C 4ZN3A 4NLGA 5IS2A 2ZH7A 2GO8A 2CPYA 1N52B 2CADA 1UVIA 3EDQB 1IUJA 1RBOB 3W2VA 3SQGB 2AD9A 1BWVA 1ZAWA 2HPUA 5BR8F 4P75A 2VZ9A 4G1QA 1RTIA 3DGPA 4I68A 4J9MA 3IBCB 1ZH5A 4Q0BA 3I31A 1F1BB 3S8SA 1KWMA 3GYGA 4B3OB 3SMZA 2FHMA 1KP6A 4Z7CA 1RISA 5BXIA 1BHNA 3FJ2A 3RR8A 4H4MB 2VPZB 3H2UB 5THWA 3MAAA 4WTOB 2DGTA 1SH2A 2C3OA 5EX0A 1NLKL 3RBDA 2MHEA 3CVKA 2HFVA 4CCHA 2WW8A 1HPZA 3A8EA 1Q8LA 4MKAA 4OV1A 1C0UA 3Q8VA 1HMVB 1TUWA 2YKNB 4HDHA 8AT1B 2RF2A 3QIDA 3W2WB 1RWOB 1HD0A 4E98A 2QFJA 1X9MA 4CO5A 1I5OB 3LO3A 1UJ5A 4ZIWA 1RTIB 1TKXA 2HQGA 2BYCA 2E5LJ 1ZOTA 1HYSB 3OL8A 2V67A 1IR1A 1NHVA 1C0TB 2HHXA 1EKSA 2NS1B 1LFPA 3FEXB 3SCIE 1ZPVA 3MTJA 1BQXA 5A8RA 3TWZA 1PIEA 3SCJE 3PW2A 4U7UK 3CULA 1FXLA 3QAEA 3B54A 1Y11A 1WHYA 4OI2A 3EE3A 4M8LA 2AYBA 1QVFR 1CPZA 1GMWD 1RT1B 2BJ3A 5C5JA 2IJRA 2F4FA 5E2QA 1C4AA 3W66A 2FDNA 2GQ2A 5L9XA 1MNEA 2Z4PA 4FKYA 1S9EA 3KNGA 5DM6Q 3EUNA 4IH5A 4EGLA 2CPXA 4JI1F 3I5AA 2M70A 4OYPA 4MFBA 2UUAJ 2N4CA 2LYVA 3E01A 3R1LA 3NWGA 1FRXA 4ID8A 4JV5J 1PILA 3ENWA 1NBEB 2MPUA 3AAWB 4LJMA 3BQ1A 4JYAF 2XMTA 1TTHB 3MGJA 3W9IA 1F5CA 3G6YA 4B17A 3M30B 1CJVB 5BYRA 3GTYX 5B0AA 2R8GA 1NPKA 3EPIA 2R2TA 1GNKA 2DT9A 2IHR1 2HHVA 2D1CA 1UZHA 4O3PA 2QSFA 4CO2A 2WK4A 4DR6J 4CZCA 2A6MA 5D4PA 1NXIA 3Q8RB 4NYZA 3EVOA 3QT8A 4LF4F 4CO0A 3UNGC 1NPRA 2HURA 2FD2A 2MKHA 2Z2ZA 3BSNA 1VRQC 1SL0A 3N01A 5GAHI 4X4TA 3D1QA 3CJ0A 5KFMA 1VS3A 3VAIA 1NK9A 1J5OA 3TUPA 1F60B 2K8GA 3M9NB 3W61A 2CXEA 1IR0A 1RLDA 1UVKA 4P9SA 4LF2A 2V4RA 3PJ9A 2F3JA 1WG5A 3EDRB 1RADB 4MJKA 2NR0A 2VFUA 5LJ5Y 2XM3A 2R8IA 1VBXA 5DETA 4IFYB 1MU2A 2PMZD 4CH7A 1WDTA 1F9HA 2PEHA 1YJUA 4KKOB 2CZVC 3DI6A 5L8RC 2XCPA 3TZXA 2RS2A 3OUYA 1WKJA 5CD4H 2NYHA 4KFBA 1NK6A 2W8LA 4XDDA 4FPIA 3BSAA 3S7RA 3U1NA 1N5YA 2IBKA 2NREA 4PQUB 4W92B 4P6QA 4YS2A 2IA0A 3LGHA 4ILRA 2HHTA 1GXUA 4OX8A 1S9GB 5F0UA 4CTAB 2AX0A 3T19A 5BYSA 3H59A 2VOOA 2CQGA 4R5PB 3OXLA 3OTDA 1MSWD 2E1PA 2A0FB 1FD8A 3W5YA 1KKHA 1SQGA 3PYGA 1LK5A 4NXMJ 2HHQA 1R0CB 2VPXB 3CTRA 1ZM9A 3FZBA 2Z8QA 2KHCA 2RQMA 2J76E 4WK3A 2UUWA 5LL6d 3SXLA 2B5JB 3PZPA 2AGQA 4OI0A 2VG6B 1WHXA 1UFWA 5B08A 1HWUA 1IBKF 4B9TA 3RBZA 2ZH2A 4L75A 1QY7A 4PQUA 4F50A 4OL8A 3T5KA 3J81Y 2L41A 4FS1A 5GMEA 1NH8A 1O6XA 2HS4A 2CQCA 4O3NA 4C7QA 4ED2A 5KT3A 1RYRA 4ZPWR 1SKSA 1WC0A 4JV1A 1T9WA 2DRBA 3M05A 3PCOB 4YOEA 1E6VB 1LW0B 2L9DA 2VPYB 1AYEA 1PYOB 5DG8A 4NCGA 4IUFA 1XNQF 2DHXA 3NGKA 5J2QA 1Q81T 1WEXA 3FKBA 4USUA 2NLWA 4ES3A 2MZ1A 1CJUB 2GCFA 3RR7A 3N4WA 1DTTA 3TVZA 2YKAA 2ZH9A 2JL9A 1LW2B 1TV6A 4A47A 1N6QA 2RVJA 1JQGA 1NDKA 3CDAA 2ZKTA 2UVUA 1CC7A 2YQ3A 3SIPB 1QD1A 2DO4A 3FBBA 3L95X 3M8PB 3MMJA 3W65A 1SL1A 3I5CA 2IVFB 4DCJB 5D77A 2WSCC 4TLRA 4YP3A 5D8HB 3O44A 5I3PA 3Q2TC 2DRDA 1G4CA 5DDOC 2DNOA 2AP6A 4TNOA 5KT7A 1HYSA 1JLQB 3QZ8A 4OI4A 1BD6A 1T94A 3FMWA 1S79A 2HFUA 4U7CA 4EBDA 2CQ1A 1R0AB 4USWA 4PABA 2BQUA 3RZAA 5GAGI 3W8GA 5HMXA 3X1LB 4ID5B 2B6AA 2R7WA 1SKRA 1RT4B 4KRWA 3ZC4A 3LGMA 4WYLA 2BJDA 4NLTA 3WC0A 3HHKA 5D0GA 2E9TA 4X64J 2J8AA 1WTFA 3UCGA 3CJKA 1TQLA 3KG1A 3QFHA 1YIJS 2OP5A 2XLKA 3BDEA 1VFJA 4RBUA 2IRXA 3QSYB 4DL2A 3UWTA 2G4BA 2JFKA 1FNXH 1YVFA 3NNCA 1H74A 4ED4A 3G71S 4LF7J 1HBNB 1SQEA 1TKZA 5LSOA 4N5SA 2ZOGA 2F7VA 1N8RT 3G86A 4C9DA 5FJ4A 1GAOA 3D9BA 3D28A 1FKAF 4WU3A 3IWNC 4B3MF 1U02A 1S72S 5C2GA 1U4BA 3MEDB 4ZPVR 4JI0F 2KKHA 3AY0A 4BLGA 4J9NA 2YH1A 1U48A 2W01A 2WB1D 3FCWA 3M6UA 3UN2A 4K4SA 4WP9A 4Q2LA 1IKYB 3WDOA 4B3RJ 1JLAB 2IMWP 1F5BA 3CMES 4LF9F 1T7PA 2DIVA 5AJ3J 2OFGX 1IKWA 1R6YA 1K1QA 2NSBA 2JH3A 5HO4A 4KC5A 4W4MA 2QRRA 1I1GA 5B0BA 5FLXY 3AA9A 4FN5A 4O3RA 1T9XA 3AOCA 3CSKA 1CJTB 2KO1A 3MM5A 2DIUA 4RLEA 2ZD1B 3PIOQ 2ASDA 3TAMB 1SVDA 3GYNA 4ZVGA 3TI0A 5LXRA 2KT5A 2FGOA 3N79A 3NCQA 3MM6A 3PO5A 1PAEX 1WOSA 1B99A 2DVIA 5D4NA 2HQIA 3PEJA 1KSPA 4LF5J 3DDKA 1AUSL 1N88A 2W24A 4ECRA 1TK8A 2Y9HA 1VCTA 4KO0B 4V19X 4ILLA 1UWBA 4PPDA 1EQMA 1FJGJ 4B3SF 2YH0A 3UNYA 2MY8A 4O4GA 3W60A 3KK2B 4B3OA 1FF2A 1VHFA 3RTVA 3HSZA 5D4LA 2I2YA 4FYXB 1HHQA 1Y7PA 4RU9A 1NKCA 2KJVA 1HI0P 1N56A 1C1CA 4AQYF 1HWLA 2OEJA 1GXTA 4MK8A 3L9ZA 1JNRB 3BGRB 3D66A 5CAAA 1YWXA 3OJSA 3QQCD 4NA1A 2KL8A 3MUVP 2VBXA 4I7FA 5L1IA 1RWVB 1CC8A 3J7ZT 3BGFA 5EHHA 3HHEA 2WCXA 5CD4A 2XO6A 3W9HA 4DV0F 1AA1B 2EFOA 1YJ7A 4CNYA 2UUCF 3E2EA 1N5QA 1NSQA 3PRDA 3RUBL 4WXWA 3C6TA 3FCVA 4JB8B 3MMCA 4H4OA 3FEZA 1K0VA 4AD6A 2CQ0A 3D6MB 3Q86A 1IM6A 2C3YA 3CNQP 4RBVA 4CI0B 1KLNA 4JI4J 2AJ0A 2FB0A 2LLZA 2YWKA 5CYMA 3SCKE 1ZM2A 3CMAS 4KHPJ 3G8QA 3ZNJ1 5DS7A 3TUZC 9RUBA 5GAEU 2V63A 3D0IE 4F4KA 3DOMA 3AFGA 4GRSA 2OJ3A 2RQCA 2DNHA 3VAJA 3T9NA 5BR8J 4IRDA 3ILIA 3LALA 4DZ6A 1PCAA 1BQMB 1JKHB 3H7HB 2PFDA 3Q24A 5H9FK 1IQTA 4C0HA 2ZH8A 2OPPB 1P9QC 2UV8G 5HLFA 2HMIB 2W7AA 1M1KT 4I6WA 1JJ4A 1NCLA 2VG6A 2F4VF 4WE1B 3UN5A 3UCUP 1ZAVA 3OTEA 4AYBD 4CYUA 3H98A 4RW4A 4ED6A 5KFKA 1FRLA 2JFDA 2DGSA 4DR7J 1KOHA 3JAMY 2EFPA 2IM2A 1U2RA 4H4KA 5C2CA 3JYTA 2OMOA 2R7UA 1JLFA 2UXCJ 3T41A 1BQNA 3THTA 4RUAA 2B0GA 2WVBA 4NEZA 4NCBA 3G9CA 4DV6F 1S1WB 5JMNA 4IRKA 1GEHA 4EO8A 1ZAXA 4ED5A 4PXCA 1UP1A 2K7JA 3EMTA 4QPXA 3QWPA 2ZUGA 5KT2A 3A8IA 1C4CA 3A1YG 5HROA 4G1IA 5HBMB 5H9EK 1B3TA 2OSQA 2PD1A 3EJMA 4P52A 1QUPA 2GHPA 2A10A 1NKBA 4RW4B 1RU1A 4RKUC 4NMXA 4NXNF 1BXNA 3AJDA 1UWBB 1RAGB 2B8PA 4YB5A 1RAFB 5C25A 1ICEB 2ZD1A 2CUYA 3DOKA 2F40A 1WACA 2LU1A 2J6TA 3I6PA 3Q2SC 5DGBA 3US5A 4A8MP 1FERA 1TL1B 2IAJB 2IRUA 4QU7A 2H9ZA 4L73A 3M9MB 4RW6B 1FRMA 4CM0A
chains in the Genus database with same CATH topology
5CZVA 3M2RA 1B0TA 4NWBA 2ZH5A 1FDDA 1CLFA 3J7YU 3SFGA 2FY1A 3M2VB 3PX6A 2J9DA 2R8KA 1P27B 4RNMA 2ERRA 2PSZA 4IDKB 2L08A 3G96A 3I0RA 3LQVA 1VIOA 2C3UA 3PW0A 1A9NB 5T41A 1Q7LB 1T03A 4RW7A 3KJVB 4M5DA 1U49A 4J9LA 2RRAA 1YITS 4QW9A 1X8DA 1JLGB 3NP5A 4FVMA 5L1KA 3PW4A 1S49A 3CGIA 3OFHA 4WCEQ 1R7IA 1WF1A 4C3LA 3PW7A 1UVLA 2V2KA 3CCUS 3OJUA 4KQZA 3V81A 3DYAA 4CT8A 2RSQA 3DRSB 1FJ7A 2KH9A 3VZHA 4MKBA 3I0SA 2QYCA 3WBZA 5CYMB 1VQ7S 2BACA 4TU7A 1D9AA 4IOCQ 1IKXA 3ISND 2LXUA 3HDSA 2M8HA 2RRNA 3ONQA 4R0EA 4Y6IA 4LT6A 4Y3CA 4PWDB 3ZZ0A 5KFWA 4DDFA 5MAOA 4O4GB 4F67A 1SJ1A 1SIZA 2W8KA 4WZQA 5AXKA 5I42A 4XPCA 4J9PA 4N8NA 1FDNA 1FTCA 1U1KA 1YI2S 1TKXB 1XERA 2KT3A 1ZTTA 4OQJA 2Y1IA 1XR6A 2YY3A 2I1RA 3MEEA 4WK1A 2RMLA 4OJ3A 3KLFA 3KLHA 3O2IA 1LWFB 2JEJA 2KU7A 4ZP9A 3TO8A 4WJBA 4X4SA 1N32F 3GMGA 4USIA 1N48A 1FJGF 1R43A 4AL5A 4F3MA 2YX1A 5HMZA 1IKXB 3PR4A 1X4DA 1CVJA 1XTZA 3EGZA 3KK2A 4H4MA 5G4DA 2GIQA 5F8HA 1IJFB 1SBRA 2YWGA 3CUNA 1J5EF 3N6LA 3EPGA 2LEBA 3CC4S 2KM8B 2KXNB 2F9JA 4CO1A 3D54A 4OLPA 2NUUG 5KOXA 3ITHB 2FIUA 4NLXA 1HQEA 4IQMA 5EWFA 2W7PA 3PFEA 3MEDA 5JJBA 1Q8IA 1KLMB 2U1AA 3CCTA 4X64F 3QJPA 3MF5A 2DD8S 2OPQA 4P7VA 2UXDF 2KXHA 1Z4UA 1DQAA 4JV0A 2ZDOA 2OH2A 1WTBA 1RT6B 4URSA 3B4DA 3H5UA 3UD4P 1T05B 4DFKA 1KNZA 3BN4A 1VQKS 2A2DA 2LU2A 1JLBA 3IRWP 1HHSA 2ZKUA 3HVAA 2XLJA 1FNOA 2HWTA 1N5VA 5GADI 4LUBA 4M94A 1UJ4A 4K2XA 3GB0A 3L7OA 2EFQA 2OPSB 5IM0B 5DDPC 4DR2F 4P2SA 1HWJA 3UI3A 5F9LA 4CQ1A 4OLOA 3DMJB 1C0TA 2B9WA 1U1QA 3U02A 2GX8A 4RWXA 4NZ7A 3DU5A 1MROB 5HBMA 4RUHA 2VFTA 1SUQB 4NCAA 5E3CA 1Q16B 4W90B 4AFFA 2KM8C 2N3LA 4CH0S 4DN9A 3C46A 5KG3A 4ZCIA 2C3PA 1JX4A 1BQNB 1RGVA 1K73T 2EK1A 2NZ4A 4PQAA 2JVOA 2HW3A 3I4HX 4D3HA 1O0PA 1H6KX 1E6YB 4MH8A 3RU0A 5M2UA 3OFFA 3CD6S 2HVZA 1N54B 1QSSA 2FLPA 3DMJA 2Q79A 2DHGA 2QO3A 2I5JB 3R5BA 3MFHA 4DLEA 3CD0A 4KV8A 5J2MB 4QWEA 1YJRA 2ILYA 4G1QB 5F3ZA 1R89A 3TAPA 3I9V9 1S6UA 2RKIB 5F8MA 5F41A 4ILMA 1TVRA 4NYOA 2NQPA 5L9NA 3OL7A 3BN7A 1VRTA 4ZP6A 3LGNA 2CPJA 2Y1RI 1R8BA 3H25A 3ISZA 4WIIA 1P1TA 4M5DB 4NRTA 3P6YC 1X9WA 4UW2A 1H7WA 2VONA 1WF0A 1V3SA 5AJ3F 3OV7A 2HMIA 4M95A 2P9EA 4UUXA 1S9FA 1N5YB 4RX6A 3RAXA 5I3UA 3M2VA 2VPWB 4J37A 3VAFA 1UVMA 4F2RA 4ZA1A 1TVRB 2IYIA 1JXEA 2UV8A 4NRUA 1S9GA 1R27B 4KGKA 2DNZA 1FXRA 4C8YA 5C42A 2IRYA 3CCLS 1MMLA 3VZIA 2XSFA 1UEUA 1QSYA 5K8NA 4YB1P 2EBGA 2R7TA 4OI1A 3SV4A 1NJWA 3FDSA 2UVVA 1Y00A 5A0YB 5DQGA 4OZJA 3CCVS 1LWEB 3FZ2A 1B64A 2VH7A 5F8GA 3MEEB 1OSDA 3G6VA 4R0JA 5LMUF 2FC9A 2OSRA 2XCAA 2AX1A 4PKDB 3V6DB 5HP1B 1U1NA 2N4DA 3HHLC 3MAHA 3MECB 3RBEA 1RTHB 4FBTA 4A8QA 1G3OA 2BA9A 1S99A 2P5VA 1YRTA 1HWIA 2W9AA 1X4FA 5K14B 5D4OA 1REVA 1XWLA 3GIIA 2OD4A 1L5UA 2EFNA 3GWCA 3MM8A 3IC1A 3C6UB 2HVHA 4I6AA 2JLEA 1VLYA 2QMWA 3MXHP 4OHWA 1FRHA 2MJNA 5I3QA 1X4CA 4K4XA 1TFYA 2O1PA 2ZZNA 2V8VA 1SI9A 3TW0A 3CXCR 4EBEA 1J5OB 1AFJA 3C8YA 2GMHA 4PUOA 1IQZA 4QR0A 1BLUA 2H5EA 2ZNZA 3ENVA 3TA0A 3V6JA 3MM6B 2MMYA 2HWIA 3MMAB 3VQSA 3OR1A 1F9FA 3SDEA 4LVOP 1KQFB 4ES2A 2E44A 4OMFG 1H2TZ 2EPIA 3SSSA 1DLOB 2JLFA 4KR0B 1L3SA 3HHNB 2PO4A 1X4EA 2IM0A 1XBWA 5E0OA 3PRBA 5A8WB 4LQ9A 1XR7A 3OTCA 3MMCB 4H4OB 1X5PA 2MGZB 3DLGB 2ZC3A 3RAMA 4TY8A 4Q5VA 3DLLQ 3IGVA 5KFUA 2YNIB 2J7WA 5IQ6A 2XI3A 1L3VA 1TR0A 3K8VA 3FRZA 3K0JA 3OSNA 1FD2A 4JBCA 2EFVA 4QWDA 1S76D 1N33F 3LPYA 4RW9B 1O8BA 4N77A 2YKNA 5E5NA 4DV7F 4JI7F 4XPEA 1U26A 3BZQA 1C1BA 3PX4A 4DL6A 1RP5A 2ZDPA 4QWBA 3EZ5A 2HHSA 1FHTA 3HVTB 4YMEA 1N5TA 2XS7A 1DBDA 2EWHA 1QAYA 2R7OA 2VFSA 2PIIA 5K8OA 2PI5A 3HMJG 4IO1A 4A8SA 4DFJA 1K1SA 5B7WA 1RT5B 2M88A 1JLFB 4RU2A 3VAGA 1RTHA 2DNGA 1VK8A 2MYFA 5SUHA 4Q43A 5KFGA 4AL6A 2YTCA 1OPIA 1TK5A 2HHUA 2HRYA 1DTTB 1PC4A 2YKOA 1M5OC 3ICLA 2WONA 4MMOA 2J7KA 4CIOA 1V3ZA 1MROA 2E7WA 5E7OB 1PC5A 3DLEB 5LT5A 2DGUA 3FRYA 3DRXA 4PRFA 2WOMA 1GXLA 1T8EA 3NLCA 1NAQA 3JTPA 1JK9B 4MIAA 4K4WA 2NPFA 4ZVEA 3O1LA 4QIVA 1RT7B 3SSRA 4Q8EA 3C3LA 2PMHA 4JI8F 1KHWA 2F9DA 2ZH3A 2DNKA 3DCAA 5KFVA 4K4UA 2XMVA 3M8SA 2FTRA 1HQUB 2CRLA 4OHVA 3VWSA 4AXJA 4B9NA 4FPRA 2FC8A 2C2EA 5FIIA 1NH7A 3BREA 4MK9A 4XDCA 1VI7A 2X1BA 2IJNA 2POKA 3RRKA 3KHLA 2L9NA 3QO9B 5FD1A 1FRJA 2QA4G 4DWIA 3C66A 3U1LA 2FPHX 1SIWB 4X66F 5F9NA 1TK0A 5ADZA 3H4DA 1VMBA 2E1RA 2VL1A 1URNA 1DTQA 4HH1A 3I56S 4NLDA 1YQHA 4DF8A 4GKKF 3BEGB 2NSCA 2XY6A 3LP1B 4IQXA 4DR1F 1W2BR 4FNIA 4FYDA 3BGUA 2OD6A 2DNYA 2ASLA 2XNRA 2BM0A 4KFBB 2ZFHA 2KFZA 2MZSA 3KLIB 2VUGA 2DPIA 3PW5A 3D0HE 3KWMA 5A0YA 2BW2A 3R5AA 2FJDB 2AWZA 1I94F 1KONA 2B4PA 3P96A 4NYPA 2QA1A 3TQ1A 1QAIA 4TXSA 1IXKA 2FVQA 2XMMA 1NU4A 4ITSA 1JKHA 4IOAQ 3IG1B 3VAKA 1L3TA 4NPOA 1D3WA 2W7OA 1FJCA 4ZOSA 4QOTA 4WE1A 1G6BA 5E3QA 4DQPA