2GI4A

Solution structure of the low molecular weight protein tyrosine phosphatase from campylobacter jejuni.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
156
structure length
156
Chain Sequence
MKKILFICLGNICRSPMAEFIMKDLVKKANLEKEFFINSAGTSGEHDGEGMHYGTKNKLAQLNIEHKNFTSKKLTQKLCDESDFLITMDNSNFKNVLKNFTNTQNKVLKITDFSPSLNYDEVPDPWYSGNFDETYKILSLACKNLLVFLSKHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure and ligand interactions of the low molecular weight protein tyrosine phosphatase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Hydrolase
molecule keywords possible phosphotyrosine protein phosphatase
total genus 37
structure length 156
sequence length 156
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gi4A00
3H6GA 4HNQA 3OM0A 5IC5A 2PAFA 4RK5A 1E6KA 2P9HA 1P8AA 4D6XA 1QP0A 1ZH4A 2NT3A 3Q15C 5EWMB 3CG4A 4RU1A 3QK7A 3RVSA 2FKAA 2R47A 1H9CA 3CFYA 2FQYA 2L18A 3CLKA 5GQSA 2J48A 4P98A 1JLKA 3JVIA 4DADA 3O1IC 3NHMA 1RZRA 1W25A 1LK0A 3GBVA 5EWJB 1M2FA 4OG2A 3FFWA 4MQFB 4LX8A 2NZUG 4QYMA 1ZITA 1CYEA 3QLVA 2JVIA 2E4ZA 2E4UA 3N8IA 3C3KA 3HVRA 3MIZA 2VUIB 4PE5B 5DKFA 1QPZA 1U04A 3LUFA 1DBWA 4WXEA 2VUHB 5IEBA 3H5WA 4OTZA 3I42A 2CWDA 3HEBA 3RVQA 2FXIA 3NHZA 2QXYA 2GWRA 3SQNA 1IIBA 3OLZA 1J56A 4ETNA 1FFGA 1LJLA 3OLWA 3F7NA 1VRVA 1JDNA 3HS3A 3M9WA 4G0YA 1Z15A 3RQIA 1A0OA 3KLOA 5DCLA 4KMRA 3F6PA 1TJYA 1DP4A 1K68A 1D1QA 3RVMA 3F73A 1BDIA 4E7PA 2PUCA 3LUKA 4N76A 4RK4A 4Y9TA 2TMYA 3UK0A 4IILA 4RSMA 3R0JA 4W5TA 3HCWA 4HNSA 1EWTA 1Z25A 4YWHA 1XWWA 1XHEA 3EQZA 3HSYA 4L4UA 2W42A 2IPLA 3OLXA 2GBPA 4NICA 1QKKA 1ZGGA 2LBPA 4RKRA 4QPJC 3JVDA 3QX9A 2IPNA 2PJUA 3KTOA 4WWHA 1ZVVA 3I09A 5IEJA 4PEVA 5IX8A 4TMYA 3DGFC 1APBA 4IRXA 3HJFA 1U2QA 3HXMA 4Z4EA 3K9CA 4ZMSA 1D2AA 1AB5A 1JL3A 1RXIA 3EGCA 4G97A 3B2NA 2F8SA 3M6MD 1ABEA 2FLWA 2L2QA 4NV3A 4Z4FA 4ETMA 3KYJB 1B00A 1LJUA 2I6FA 4JAVC 1P6UA 4JB0A 2JVJA 4RXMA 5HQJA 3DBIA 3G1WA 1MAVA 2DRIA 2QVCA 3URMA 1ZESA 1YMUA 4LDAA 4H3HB 1LBHA 4XASA 4XARA 4TLLB 3O2QB 4G0QA 2QSJA 4G0PA 2CHFA 2LP4Y 3OQNA 1QO0A 1KRWA 3Q41A 4Q6BA 3BILA 5EWMA 1NXTA 1ZH2A 2HJ9A 4N0QA 4KQ9A 3FMVA 3EQ2A 2PUEA 5EWLB 3RVJA 2RJOA 1USGA 2WMYA 3Q7RA 3VNAA 3RH0A 1GUDA 4KPYA 1U8TA 1W9HA 1YVUA 2FMHA 4FB4A 4MS1B 1YK0A 2MYPA 1BAPA 3LUJA 2WWVD 3E3MA 3OO0A 1ISSA 2L19A 3CZCA 3O1HB 4Q6WA 3UKJA 2IYNA 4JOQA 1PEYA 2IPAB 5PNTA 4PYRA 5BRAA 1VPWA 1M5TA 2ID7A 3OQMA 2JCGA 4MS1A 2JBAB 3OM1A 1F51E 3BBLA 3QLUA 1JDPA 4DN6A 2MSWA 4LRQA 1QP7A 3CG0A 2GI4A 2E4YA 4LE0A 3O74A 3Q9SA 1Z26A 2FMKA 1PHRA 2PUAA 1FFWA 4O1HA 1FQWA 4EYOA 5IUNC 1YTUA 3N53A 4ETIA 2RGYA 4F3TA 3D8UA 1YS7A 2WJAA 4YLEA 1CEYA 5JNTA 1DC8A 2H3HA 1YIOA 1WETA 3W9SA 4MS3A 5BQ3A 2CD7A 3H5LA 5FBKA 1DRJA 3OMXA 5DLEA 3T95A 3LKVA 4NCBA 3A0RB 4EYQA 4N47A 2ZWMA 2JK1A 3KHTA 4OBBA 2MYNA 3TX6A 2LIVA 4JA2A 2JRLA 3GL9A 1LBIA 4N41A 3RVKA 3T8YA 2GKGA 3MM4A 4MR8B 1QMPA 1L5YA 4EVSA 2RDMA 3T6KA 3SNKA 2VYCA 4RXTA 2B4AA 3H75A 4ZYLA 2FMFA 3Q7SA 1U0SY 5CHYA 3N6VA 9ABPA 2YHBA 4YP9A 2PL9A 2WB4A 3CNBA 3OO1A 4YGXB 4YCSA 3RVLA 3H1GA 2Q5CA 3S99A 1NY5A 1M2EA 3BRQA 1DCKA 3JTEA 3L6UA 4RK7A 1URPA 1ZY2A 3QLUC 3GA5A 3RVRA 1E2BA 2E4WA 3HUTA 2E4XA 3IPCA 4CBVA 1OXKB 1TMYA 3A3KA 4QICA 2QV0A 3NNSA 4MS4A 3N0RA 5CNMA 1A04A 3CU5A 3LKBA 3QLTA 2V0NA 4KK4A 3SG0A 1VKRA 3IP7A 3LUDA 2OENG 5JNRA 5TPZA 3CKMA 1S8NA 4MR9A 5JS2A 1GLGA 2X7XA 1QQBA 3IP6A 3LOPA 1NXWA 1ZN2A 2AYZA 2GX6A 3NNNA 1Z12A 1PUXA 2MYTA 4F12A 1XHFA 3MYYA 2IDMA 2A9PA 4MLCA 5FWXB 4OATA 3IP5A 3GT7A 1DZ3A 2MSKA 3I5AA 3RVPA 4RXUA 2PLNA 4MRMB 1RXEA 2HSGA 3P9YA 1T34A 4RS3A 4WUTA 4ZMRA 1JYFA 1DBQA 4YV7A 5E3JA 5IULC 1EFAA 4RKQA 3SAJA 2HQBA 2R48A 2FQWA 3H6HA 1M5UA 3G85A 3EODA 3KLNA 5JNUA 3DGEC 1SRRA 1DBPA 3QEMA 3M9XA 1NXOA 3TB6A 2LUOA 3MA0A 1P2FA 2FQXA 4Z9AA 4PICA 1RZRD 2ID9A 3OLVA 1E6MA 5EWLA 4S05A 4MYRA 4G0XA 5HKOA 4IMIB 4YR7A 4EGSA 1DJMA 4HNRA 1ZDMA 4MRMA 4RV5A 5JNSA 5T7BA 2FN8A 4MQEB 4Z4CA 3CZ5A 4MGEA 3GWGA 4YO7A 2LPMA 4TN5A 4RZSA 4F11A 1ZAYA 2PUDA 1K66A 2RJNA 2L17A 2FVYA 4XAQA 5FWXA 4EVRA 5ED4A 3GBPA 1FSPA 1KRXA 3QX8A 3H5IA 1JX6A 3UUGA 1BA2A 6ABPA 4ZPJA 3SY8A 3FFXA 4G0ZA 5CNJA 4KNYA 1TLFA 3KS9A 4W5NA 1D1PA 1GCGA 1TM2A 3MQ4A 4TLMB 2QR3A 4MR7A 1P6QA 3A10A 2FN9A 2JB9A 3KKEA 1C0EA 4UHJA 1Z16A 3LUHA 3DZDA 5TE9A 5BR1A 3HZHA 4UHKA 1EWKA 5TQ0A 3IPAA 3F6CA 1L5ZA 2PUBA 2FEWB 3EAFA 5KQPA 3H5TA 1R8JA 4W5RA 1ZGZA 3L49A 2PL1A 5BRJA 4Q7EA 4XFKA 2NZVG 5B3JA 4EYKA 1NXSA 3QELB 4ZJPA 5FWYB 5FWYA 5DTEA 1JFSA 1F4VA 4D6YA 2HQRA 3GYBA 3LUGA 3NNDA 1JF8A 1DCMA 1I3CA 1NTRA 4LE2A 4RY0A 4EUKA 2WY2D 2R4QA 4IF4A 5C5CA 3DLHA 3KG2A 3N0WA 4S04A 3QEKA 4H60A 3ILYA 5ABPA 1SXIA 1USIA 2A9OA 2ZAYA 3K4HA 1U2PA 2NUBA 2FSPA 3LUAA 2PUFA 1C4WA 4MR7B 1JH9A 2R25B 4Z4IA 3GV0A 3QLVC 4XLTA 1DCFA 1Z18A 4DQDA 4LZLA 3HDVA 1NXXA 4KRFA 3KCNA 1PEAA 3QELA 1VLZA 1BDHA 3EDCA 4NQRA 3LFTA 2JVKA 4KZKA 5D2CA 1EHCA 1USKA 2NT4A 4KVFA 2A9RA 4Z4GA 3KSMA 1QO0D 1Z17A 2WJWA 4EVQA 2HPHA 5TQ0B 2MSLA 3E61A 3ILHA 1A2OA 4G0MA 1GCAA 2WRZA 2YHAA 4G86A 2PUGA 1SXGA 5JNVA 2OQRA 4QYWA 1PNRA 5I4CA 3EJWA 3LTEA 1Z13A 3RVNA 4FE4A 4KK3A 3O75A 1PNTA 2QW1A 1KGSA 3D02A 2QU7A 2CHEA 4MAAA 1EWVA 1D4ZA 3QEMB 1TVMA 3O1JC 4O5AA 3N0XA 4FE7A 2FTKE 1Y1LA 5IUKC 5IUJC 1YK1A 2KYRA 4L85A 4M88A 1QP4A 1FFSA 3H5VA 1QQAA 3IP9A 2O20A 1RPJA 3NBMA 3CRNA 4YS6A 1YS6A 1ISRA 1E6LA 3MMNA 1MB3A 1ZHHA 3C6QA 4WZZA 3HO1A 5KQLA 4KFCA 4OLAA 1NXVA 3TO5A 5JS1A 5JNWA 5CNIA 3OMWA 4ML3A 1JYEA 2B1JA 4O1IA 4MQEA 2JBAA 4OLBA 5DGCA 3H1FA 5TPWB 2IPMA 1RNLA 1EAYA 3O21A 3KYIB 1KMIY 4GNRA 1JWLA 5HSGA 1SXHA 5CNKA 3Q7TA 4E7OA 4P1ZA 3C97A 5KWSA 4KV7A 3GRCA 3HM9A 2E4VA 4RK0A 1QNLA 3T38A 1ABFA 1JHZA 3JPYA 4HYEA 3I45A 3HV2A 3HUUA 3N75A 2IKSA 4Z0NA 1YMVA 1DG9A 3C3MA 2FMIA 3JPWA 3FFTA 4MLDA 2A9QA 5T3YA 3VNBA 1D5WA 1BDJA 4IGAA 2QZJA 1MVOA 3LUCA 1JFVA 4LDZA 2PE5A 2FLKA 2F8TA 1MIHA 5FBHA 3C3WA 4MR9B 3JY6A 2FEPA 4D74A 3OQOA 4N0PA 1Z2EA 3BREA 4H3KB 5TQ2A 5KI6A 4PZ0A 2PKXA 4Z4HA 1DC7A 4Z99A 4YRZA 4MPTA 1AB6A 2XDYA 3FGZA 3O2SB 4MR8A 6CHYA 4G0OA 2IOYA 5HM6A 1GUBA 2AYXA 4WXMA 1JBEA 5KQMA 4W5QA 4LE1A 3TD9A 5KC8A 4JB2A 7ABPA 5KQGA 1BVHA 2FEKA 4F8JA 4F06A 4XXHA 3FDFA 4KQCA 4MS4B 1SD5A 4RY8A 4EY3A 4RY9A 8ABPA 4IMJB 4MS3B 5GOTA 4RK1A 5TQ2B 1OXBB 1HEYA 3RVOA 1UDRA 2H0AA 3IDOA 4RK6A 4W5OA 4N03A 4B09A 3CHYA 3HK2A 3KJXA 3H5OA 5C5EA 5KC9A 3DLBA 2M98A 3CS3A 3H1EA 2M1ZA 1NXPA 4JASB 4RWEA 3HDGA 1CHNA 3TMYA 1DRKA 3JS5A 2FW0A 2P4UA 2QVGA 1NATA 2MYUA 5EWJA 3O2JA 3LMKA 4WT7A 4NCAA 1JFTA 5B3JC 3ROFA 4EYGA 3OLYA 3EULA 5TPZD 4GPAA 4MQFA 4RDCA 5IBQA 5TQJA 4KREA 1Z2DA 3CTPA 2N9UA 5F64A 3ROTA 5TPWA 2BGGA 3MF4A 3A0UA 4JP1A 4Z9BA 2HQOA 2VK2A 1MB0A 3SM9A 3BRSA 2PMCA
chains in the Genus database with same CATH superfamily
1MX9A 4OBEA 3K71B 4HDRA 2BMDA 1FNMA 4MQ5A 5KPDA 2PAFA 2F64A 1UWVA 4IL5A 1H42A 3LP6A 4ENTA 4ZN6A 5LQAA 3MAGA 1MJGM 5JTTA 4P7FA 4WNAA 5F1OA 5K6AA 1WDTA 3ZU2A 4C0LA 1PZNA 4A0FA 1J9EA 2ZFUA 3LGSA 4BJHB 4R6XA 1O6GA 2Z09A 1JAHA 3OCYA 5K0JA 3JAMA 3GP3A 4NU6A 1H65A 2YYZA 2CXNA 1MC5A 3Q7EA 5GQSA 3E5HA 2BJVA 2HMWA 5TXGA 4UTRA 1ZGJA 4P98A 4ZAWA 2WF9A 1AXGA 1T5LA 5J4VA 3MWEB 4L4YA 1DSSG 4CFSA 5KVAA 3GBVA 4G5XA 1VYTA 4MQFB 3TD6A 1IPEA 1N92A 1BU5A 1RZ3A 4H7DA 4WDRA 1EIWA 4JBNA 1TCBA 5ALUA 3N7UA 3QLVA 3DCJA 3UJPA 4XVUA 3EA5A 5B2ZA 1E79D 2DPGA 3RUEA 2C1EA 1V4BA 2E4UA 2ZIAA 5H70A 4QUIA 3CF2A 4P36A 1HKUA 1S7CA 4BNZA 2AIRA 1PW7A 1UXOA 4TMKA 1KYTA 2I29A 1ILWA 4MQUA 1FFHA 2BGRA 2SKDA 2IBMA 3G0DA 3H5WA 4WV3A 2PGOA 3QNMA 1IHXA 3A4MA 2B8EA 2ZXFA 1FTNA 3CLUD 4ZHQA 1V41E 4DLYA 3GQBA 1XWIA 4EX6A 1WCYA 2DFTA 4P3NA 4JXXA 1BROA 3FPHA 1BFUA 1P9RA 5DOZA 3V1LA 2XYGA 2AI3A 4J7AA 1QRSA 4KOAA 4UNQA 5IYZF 3LWNA 4I99A 4BIMA 1Z38A 1E2QA 1EZZA 2XGMA 4LS3A 4NOKA 2OXRA 1R9NA 2H1CA 3V1UA 5JAUA 1A1VA 2VQ6A 5LXTA 1J23A 5BSGA 3FOBA 1M33A 2CFOA 3LUKA 4UU0A 2MCFA 2GLXA 3SR3A 4HS9A 4R0NA 2B4RO 1NN1A 1P7YA 2FX5A 5F1KA 1ZM9A 3CZRA 3W8NA 4BYMA 4M7PA 4D4MA 2WB2A 1JPJA 1GLVA 2XE4A 5KWEA 2QT1A 3MT0A 4LNHA 3K0CC 1OZGA 4DCUA 1Z63A 1L4GA 2VNKA 5CA0A 1PL8A 4DR6B 3QX9A 4CQNA 4C1NA 3HR8A 3ZWCA 2ATIA 3WC4A 2WKQA 3ZC3A 1PNQA 2Q7DA 3GGCA 3U13A 5A3RA 1M3SA 1QH8B 1Z4OA 4OMCA 4TWZA 1GR1A 3VI4B 5G4KB 5ILOA 1H2RS 3OG9A 1VA5A 2DUMA 2N47A 4M9SA 3FUXA 5I9BA 2FQ1A 5EIEA 3FUUA 5JI2E 2O2ZA 4FS8A 1TKAA 2D5IA 4Y1FA 1YA8A 4G9GA 4DT1B 3F97A 2IXFA 4NVRA 2CZGA 4URHA 5EJFA 4MI3A 5GPBA 5HFAA 1HEIA 2PMDA 2JLSA 3T3EA 2UVPB 1P0QA 4RADA 4YJDA 1YIAA 4O2LA 2NLOA 4MV0A 3PT5A 4XWGA 1GTG1 2QRJA 1SZCA 1MH9A 3ZJTA 3EG5A 3CLSC 3W5UA 5JBNA 1CUUA 3S81A 2AEMA 2GBLC 1BQ3A 3R77A 4KQ9A 4ZCSA 3SGLA 3CUYA 1NVEA 3DV2A 3LKZA 4HLUC 4J3NA 1QH1B 3D7KA 4PSUA 1IUKA 4RNCA 4ETWA 3DYBA 1MFZA 5CT6A 3Q0EA 1W5FA 1XJQA 2X0NA 3RJ9A 1ZD1A 4QNNA 2NTEA 1O5IA 4BQRA 3Q3CA 3V4OA 3VO2A 2PX6A 3EVTA 3K3PA 3DTYA 1TW2A 3WJ1A 4B9AA 4LSMA 5IVKA 1L7OA 2P9EA 4W6QA 2Q4EA 4YGYA 2CLSA 1WTCA 2J0VA 1B1AA 2P41A 3SHTA 3DV0B 3PVCA 3KTDA 4Q1EA 1MX3A 5AI6A 5CPBA 3H1AA 3BIWA 3BBLA 5D5QA 5C37A 4ND6A 3UUEA 2XMRA 4FXOA 2WZDA 1EX6A 4IGEA 4KDEA 5CMLA 2XZOA 3FMOB 2C84A 2WE8A 3KZOA 4OHFA 1HV8A 1EFUA 3TN7A 2XB2A 2EJVA 1M73E 3V8RA 5CB4A 3LCMA 1KQGA 4RTNA 4AMYA 1Z4IA 1NJ5A 4B87A 4NRDA 5L3SB 2I33A 5I5EA 4B3FX 1CEYA 2ZUFA 4LOHA 4C06A 2G36A 1B0AA 1RZVA 3ZJUA 1GGFA 1NWHA 4RF3A 5E6UA 4EZBA 5JXWA 4QUGA 2R8EA 5FBKA 4MUFA 3PUWA 4CL8A 5EHZA 3U49A 3AV0B 3LI2A 4D0RA 2O3RA 2YS6A 2XMCA 3FVVA 1BXRA 5E4YA 5JW6A 5J2UA 5IVHA 5SY4A 3TXXA 2E49A 1DPGA 5C8YA 3RTGA 3V1TC 5TS2A 3VOAA 2EL9A 1ORHA 1CULC 3WK5A 1SXQA 3MS4A 1SEPA 1VGVA 4I36A 1KZ7B 2AD5A 1LEHA 1AGYA 2CUKA 3MTQA 5JO9A 4ZOQI 5LOVF 5KVSA 2XUPA 2RHDA 3A37A 3AVOA 3DDOA 1NLYA 3SFVA 4BRUA 3OX1A 2P69A 2X2PA 4CL0A 2CNKA 9ABPA 1XPOA 4GC9A 3EIXA 3K0FA 4II2A 3OO1A 2YDXA 2Y1LA 4C0WA 5ALXA 1U1FA 2Q5CA 1P31A 1VI2A 1L5WA 3LVFO 3IX7A 4BV8A 2QSUA 4FGLA 4A8HA 5LKRA 3M70A 1P7CA 4IZ6A 2J7KA 2PGLA 3ZE6A 1JVNA 2E6UX 1JKXA 1XOIA 2QV0A 2B6NA 2C42A 2QUZA 2BE9A 2VF7A 3A3PA 3AIMA 3ODGA 5GIOE 1AN0A 2CJPA 1R27A 3OEHA 3ONFA 3T7RA 2FWPA 2W2XA 1I3MA 2YJ5A 1DS6A 4C2BA 2AMFA 3LD9A 1GFIA 4FFBA 3MQFA 3B1ZA 1CQIA 2ZYAA 3B3AA 3QTTA 2PL5A 1X19A 4I66A 2I3DA 4QJ5A 3SS8A 5JS2A 4OIFA 3I6YA 1JEQB 2XUDA 3PT9A 5K3SA 2A5YB 2PQ2A 3SQDA 1UZAA 1X7XA 1KZHA 2QG6A 5ICGA 1PJ8A 4YCMA 3AUTA 4P54A 4TRMA 3P9CA 3SBOA 4C3UA 2ZT7A 3EF0A 3DZFA 1QS0A 1H0RA 3IP5A 2G0NA 4UVHA 1GSOA 2QA5A 2RBEA 3A9TA 2XT0A 2WKPA 3ACDA 3LLCA 4R01A 1GZUA 1JYFA 1LS1A 2YWDA 5CR9A 2LVBA 1KO7A 4KPGA 2WYUA 2H1WA 1J2JA 5TMBA 1R4ZA 2B4TO 5MGBA 1DIOB 1JHDA 4OU5A 4PWZA 2A92A 3CX3A 3KLNA 5LZ8A 1CY2A 1DBPA 3QX7A 4BY9E 4GI5A 4MV1A 2BL4A 3IAM1 2REBA 1E7QA 2V54A 5DIFA 4QXOA 3NVDA 1MJ5A 2YS7A 2VZ8A 2V6JA 1T3HA 3L3BA 5JS8A 4YUAA 2Y9MB 1W93A 5K0GA 1CRZA 1G8AA 1MDFA 1Q7GA 1U8CB 4COKA 3ZE2B 4YR7A 4PYQA 5G41A 3U09A 5DBFA 3U16A 3K2IA 2XZDA 4G09A 1RC8A 1D2EA 3CZ5A 3PL5A 1FYFA 3PHBE 5SY6A 5CXUA 5F3WB 2IFTA 4DEXA 4E5KA 3IEMA 1LH0A 1EB8A 2RJNA 4XAQA 1ZI9A 1ECBA 2BJWA 1WHTB 3IBGA 4BNJA 1EGQA 1XZAA 5B12A 3PBKA 3OBIA 1Y7IA 1BA2A 3FFXA 3I2JA 2DPXA 4BMOB 1TVKB 2EF1A 1BQ4A 2D1YA 5IN5A 3G6KA 2XF2A 1W4ZA 1YBHA 2VJOA 3I1YA 4WBSA 4KR0A 4PZUA 3WWYA 4XVRA 4UHCA 3KPWA 3U4QB 1I7DA 2R8ZA 4V0SA 2VF8A 2PKQO 4EKYA 1Y3DE 3GQVA 4BBAA 3EFEA 2SCUB 1JHMA 3LUPA 3CR7A 2ZP1A 3UGQA 1MRZA 2VTBA 4A6XA 2PX3A 1SD2A 3DMDA 5ARBA 1OILA 2B1IA 3ZGXA 4KSCA 4Z3OA 3H42B 3IUBA 2HJRA 5DSXA 2I65A 2ZRIA 2VTEA 4OH7A 3G17A 5ITSA 1UM9B 3A2KA 4ITRC 3E9QA 4A16A 1NXSA 4LY0A 4RACA 1ACLA 3EZGA 3G2OA 1VPEA 3LDHA 3T1TA 1MT3A 1P18A 1VB5A 3K5PA 5AR1A 3DW1X 1YZNA 2A8YA 2PZKA 1K9SA 3OOYA 3LPDA 1OZFA 1VIYA 4H6VA 4LMBA 4PCLA 3CO0S 3CLRD 4L3WA 2ASEA 3GZNB 3NPAA 3F49S 3JQQA 4Q19A 4YJGB 1N6LA 2JAXA 2RGXA 3DM9B 4FS3A 5AVRA 5E6UB 1JFTA 2QG9A 1U2PA 1X3SA 3LUAA 4JJKA 1JH9A 3UGKA 5LR6A 3JARA 1H1TA 3HDYA 1SVWA 4Z4IA 2X0IA 3GV0A 2JCYA 4J49A 1C81A 1FXUA 3U7IA 4LZLA 1X70A 1F4PA 1AZWA 4YI3A 3B3GA 3AL2A 3SZUA 5AVYA 3W4KA 3TDMA 2IBSA 4GECA 4AN1A 1E18A 2C54A 1VZ2A 4MYHA 4A8PA 2RB4A 2PUWA 1Z47A 1DEAA 3N8NA 3RARA 1OXSC 1Y1KE 4DLNA 3E8MA 3EGDB 3IQGX 1N2HA 3I58A 3L43A 3VU1A 2PMKA 5GJBA 1MVNA 3IXLA 1PWZA 2J3LA 1D04A 3FFAA 3PQ8A 3WLNA 3CV3A 3WK6A 3MPUA 1SUSA 3RUCA 3E48A 3VR5H 2FSVA 1KGSA 1KU6A 4RGBA 1OYYA 3L8DA 1E2NA 3SZLA 4B1FA 4XWYA 2DBVO 3CLHA 3WGZA 1E2PA 1H93A 1PFYA 2JNWA 4UTXA 3G59A 3HCEA 4FGJA 1QH1A 1YHNA 3HZOA 2ZULA 4L50A 4M88A 1QP4A 1GGMA 2F00A 1M6HA 1UP4A 3C1TA 4AIRA 4C7BA 5MHTA 3FYSA 3I4CA 4IIDA 4WN3A 3BZUA 4AUMA 3SF8B 1JDSA 4BVAA 4EHAA 3I8OA 3PDCA 4MA0A 1XDBA 2ZBPA 3O26A 1BWRA 2PKEA 5EHIA 5KYXB 5BSWA 5CNIA 1Z6GA 4I8XA 4CTNA 1AS0A 3L8YA 5A06A 1N0UA 3ZH9B 3SIRA 5CFMA 3G2QA 4BNGA 3CZ9A 1CRWG 3FI9A 3H1FA 3NDIA 4HAOA 5TQVA 3T5GA 1U4NA 4C43A 5JD3A 1B76A 2FFHA 2RFLA 2WOOA 1ZU5A 2AZMA 2JJ2A 4GNRA 4NYIQ 4QRIA 1KERA 3U31A 4D9GA 1SXHA 2J67A 3PZBA 1OJLA 3IOEA 1MA3A 2VA9A 5FTWA 5BQOA 3ZGVA 4CCYA 5L6MB 1KDRA 3FYUC 4DLUA 4QA9A 4JK3A 5KWSA 3AEKA 3MYRA 1BW9B 3H3XA 3QKRA 1CNFA 3QE3A 1XRLA 3HUDA 2W6QA 4MW6A 3C14C 2FPGB 3MCZA 2C7OA 3LQFA 4DQXA 1B0PA 2PRJA 3VR2D 4GF5A 2GYUA 3V48A 1P8JA 3T1QA 3FVRA 4YAUA 1WUJS 2YJ4A 4JI5B 3RWMB 1KK2A 3WLLA 1ETUA 1UDWA 1E3QA 1DG3A 1KEWA 2F8TA 3WGVA 4O2BA 5FPSA 2ZROA 2BC9A 4I5EA 4KE9A 4CMEA 4JT2A 1RI2A 1Z2EA 5TQ2A 4MQLA 4PWYA 1U7HA 2XHEA 3U3RA 4EQZA 1UPTA 4BO3A 1US8A 2BFBA 3KT8A 2ZPAA 4MR8A 2AF4C 1VA4A 3NUQA 2XB9A 3BUSA 2WTMA 1B8PA 2HUNA 2AYXA 3O83A 1Z68A 5HKBA 1E7YA 1UP7A 5ECDA 5AYVA 4XA8A 3P0RA 4KQIA 1JKMA 2A14A 3LBFA 3KPUA 3VZCA 2QN6A 4ENWA 4QXMA 3V1YA 2PS3A 3JYOA 4ZHQB 1IVNA 1NVVQ 4MVWA 3FHJA 4DUZB 4DIFA 4JYPA 3E7PA 3KQYA 4X7RA 1SUBA 1YB1A 2I6QA 4N03A 2YV1A 4D9EA 1TF7A 5TIIA 4IX1A 3OCVA 1AHNA 3AB3A 4IFEA 5F51A 4L15A 4JASB 2D7DA 1CHNA 4LWOA 1QSGA 3GJ8A 3OAAD 4RX1A 5BNFA 2NUAB 1LVUA 2ZI4A 3MB5A 2A6PA 1HG1A 4RHYA 3F5DA 2R9VA 2VAWA 1LSUA 1Q7TA 3PGXA 1I10A 4U6NA 1DBVO 3C3PA 4EHNA 4NBUA 2ET6A 4UPEA 5DHRA 1F4LA 2FJUA 2QMYA 1IUNA 2WYHA 3HHPA 2YNMD 1PI3A 3PC6A 4KFUA 3U1BA 2CV0A 4CG3A 3LT1A 3AB7A 1C0PA 2P40A 4DJAA 1DLIA 1NMXA 1T1IA 4FYMA 1N0HA 2ALJA 3ROTA 2QLJA 4YCNA 1PZHA 4OH1A 4D9IA 1M83A 3M1IA 5CFQA 1NY6A 1Y5IA 3RW9A 5DNVA 4X1IA 2B8WA 4B7UA 2NU8A 3SQXA 3V7UA 1E61A 1FPMA 4J07A 1E8NA 4Z1OA 1W48A 3JQRA 1D6MA 1JA9A 4PG7A 4KUEA 3W7BA 1R0CA 4EUHA 2PXAA 1TZJA 1SIWA 2ZR7A 3ZCVA 1QM5A 1THZA 4RHEA 5E6RA 3EIUA 2GF2A 2BGKA 3K0CA 2GF9A 3RNLA 4EMSA 1FYVA 3CLKA 4GNKA 3FKQA 1HFWA 5DYIA 1ZGHA 3KK0A 4RELA 4AJHA 3F67A 4L74A 2GERA 2HRZA 1BE0A 2AEEA 2WKWA 5IH7A 2DKFA 1MNAA 4QDXA 3HB1A 4N5HX 3BKXA 2ZBDA 4DUPA 1WZCA 4Q3KA 4PS0A 3H7IA 3MEQA 4YMHA 2QJTA 2UUBB 5E1BA 1X14A 2XRYA 3H5AA 3P71T 1F2TB 5BQXA 1TJ4A 1JJBA 1OBHA 2B61A 2RE8A 2JLQA 4UD6A 4TMZA 5AHOA 3FPGA 5HTOA 5C4GB 2NSDA 4YX9A 1N34B 5T8KA 1NL3A 2OSBA 1MW9X 2GDJA 4PNHA 5AT1A 3T12A 3WLQA 4NF2A 1JU4A 5BR4A 2N0SA 2I54A 5DLQC 5LJLA 4LGVA 1SGWA 4Y30A 2UUCB 1HURA 3NU1A 5JZ9A 1QIJA 4R98A 4IO0A 2D8MA 3ZK7A 2ZYRA 5EE5B 5GM2A 4BNFA 2Y1EA 1GP2A 1Y3FE 3MGCA 3PFKA 3S1AB 4HRVA 1IPHA 4QEZA 5CW1A 2O8EB 3NLLA 4R2MA 3DKVA 2GA8A 1BHQ1 4FOPA 1RWNA 2IZ1A 4KMRA 4RFLA 3BF7A 1HA3A 2QQEA 2ZEJA 3BWBA 3W3AD 2PYZA 3KNZA 2C0PA 5BNZA 1IOWA 3IEIA 3Q0TA 4S1PA 4G5RA 1SQ6A 5BVGB 3N8DA 2GEDA 5M7EA 3FHLA 3R0JA 3PJDA 1T6XA 1OX5A 1YDMA 4YASA 4F3CA 2NMVA 3X0DA 2X77A 1L1QA 2A59A 2XMQA 1OLOA 2DFVA 2YMMA 2ZT6A 4N6GA 4L4UA 5KVCA 1AM4D 5KYWA 1W8IA 1ZGGA 2CDBA 1JN0A 4IJ6A 3VR6D 2OYSA 3LA6A 1HE8B 1KPGA 1RWKA 1XAIA 4FK8A 1T4CA 5AKEA 4POAA 4QQKA 3NGXA 4IRXA 3MJEA 4PRZA 1I01A 5EIWA 3KPJA 3NB0A 3DEAA 4I50B 4OJKA 3NHFA 4UBLA 3VZQA 3EEOA 5C80A 1B3RA 4LBYA 2X1HA 2AFIA 2GD2A 3CA8A 3KDPA 3M6MD 2PVPA 4M46A 4ZVUA 2ORVA 1SOVA 5KSPA 1LJUA 2XAUA 2VN8A 1P6UA 3R4VA 4JB0A 1YBVA 1KKLA 2I3GA 3AJEA 3DBIA 4UZEA 1V5WA 2DRIA 4XJVA 4LDAA 4BKMA 2OCDA 2W2KB 1S3FA 4GPEA 3ZV6A 3FNHA 4XASA 2DB3A 2D1RA 3K1YA 1N2CA 3A1EA 3K1TA 3DKRA 1U63A 1NDHA 2CYAA 2ENWA 3NHJA 2OV4A 4L5AA 4URFA 1QO0A 4B4VA 4EHBA 2C77A 1CVIA 5BN4A 2ZJ5A 4Y1EA 5EWMA 3RUPA 4BX2A 3NWPA 3MMPA 2ATEA 2WAYA 3KT6A 4BU0A 1RLMA 1RC0A 3F7OA 3NHLA 2C2OA 2EZ9A 1XZCA 3SIPA 3M81A 1RBZA 2BEVA 3EE6A 4KPYA 4X5OA 1QP8A 2EGHA 3HP1A 3ASUA 4IMPA 5DRTA 4FB4A 4ZAXA 1HRKA 1E2EA 3LU1A 4G4IA 4WECA 2QV7A 4PGFA 5EJ5A 3EDRA 3PNYA 1II8B 3HSKA 1L7AA 1VBFA 1RRPA 4TQGA 3LUJA 4OJQA 1D0VA 2IP4A 4H1WA 3W6ZA 1BWQA 3FF1A 3CB4A 3EA4A 4U6SA 1TI7A 4A4DA 4BQQA 2IK8A 5PNTA 4U7DA 4QTYA 2F1HA 3R24A 3VV2A 2B7LA 1SOUA 2RBGA 2WD7B 3BWVA 3W5JA 3VXKA 4ER3A 4ZK2A 5A5DA 1RKXA 2WINI 2GZ3A 1U28A 2BV3A 2VR1A 3NWOA 3O82A 1NVUQ 3OWHA 3EMBA 4CV3A 4PG8A 2VDJA 4I3GA 5CIWA 1NF3A 1EFDN 1YOBA 1ZRHA 4OXYA 2ZREA 3G8BA 1EVLA 2AZTA 5K8UA 2ZG6A 3Q9SA 3AYZB 1IM2A 3QU7A 4Q01A 1CR1A 4BVHA 2HBRA 4O1HA 4XM0A 1FW6A 4NONA 3NOQA 2HU7A 1BSVA 4ETIA 3OM8A 3EOBI 2C9CA 2IT1A 3NM5A 2PZFA 1E7RA 4H6PA 4WBNA 1XQWA 3FCXA 3D6UA 5F1PA 3HFJA 1ZI8A 1SPBS 3T1OA 4NNJA 3PE6A 3TOVA 4PRLA 3E1SA 2FZCA 2Z3VA 3TFWA 4YB8A 1D4AA 3D4PA 1KTIA 1ZWLA 4YXWD 4HQ0A 1FW8A 4P22A 1E6EA 4N47A 4AKEA 2R96A 2FZEA 1ZP6A 4B81A 4OBBA 3ZGYA 4Q9HA 2V5UA 3GEMA 4E31A 3A8TA 1G5FA 3EGDA 4GOXA 4X8MA 1D6NA 5H4HA 1SBTA 3GLRA 2W11A 3NDRA 1B73A 4CL3A 2BY4A 4TZKA 3T7JA 4LWPA 1T0UA 4R2HA 1UJ4A 5DI3B 2A3RA 1QH0A 4H4CA 3WVNA 2VJKA 1V0JA 3INRA 2ZIWB 3MK31 4JHXA 4XSGA 3Q2KA 5CHYA 4ZGGA 1OAAA 5DHFA 4LGCA 2ESRA 4OHUA 4FFWA 1H1DA 1AGXA 2D62A 1E58A 1YACA 4KSBA 2ZQZA 5DLYA 3CNNA 3L1VA 5FOWA 3VPSA 4PCAA 7GPBA 3I39X 3G9TA 3R6GA 4ZD6A 4RK7A 4CIYA 3PFGA 4L0CA 4X0EA 1XMQB 3RRFA 4QARA 1Z7YA 3WGGA 1ZU4A 2BP7A 3OURA 1QDLB 4MQEB 5BN3B 3UWSA 4ZIRB 1LLFA 3RF7A 4X94A 3VU0A 3W5AA 4H7IA 4TV8F 2OLJA 3PB3A 3L8GA 1QIIA 1A76A 4NH4A 3CRVA 3T7CA 3SYRA 3W7AA 1GAQA 1CK4A 1N5DA 4M8KA 4MWGA 5ECGC 5A7GA 4YV0A 2I6SA 4GMDA 3UK7A 2FSFA 3FKSA 2WUEA 3FY4A 2I3ZA 3MT8A 3L6OO 2JHCA 4HEJA 4MR9A 1VGQA 2IW3A 4IYRA 4YRRA 3R75A 4TQUS 1EVZA 5HE9A 1XZMA 1CJBA 1RVV1 1AZSC 1GN8A 2OO3A 4JL8A 2R6AA 4OHMA 4KO4S 2VPIA 2ZAOA 1FS6A 1R66A 1UMCA 3UZUA 2ZYIA 3KEQA 4I46A 3GNQA 2GEBA 1T34A 3EMDA 2BFEA 2AG5A 2WTEA 5E2IA 3U80A 1NXQA 1EFAA 1K6EA 4EB6B 4O02B 4IDCA 3FVWA 5T4BA 1VQ1A 1G5HA 4KQKA 3SAJA 1OUMA 3WIEA 5A7HA 4R8KA 5JQGB 1W36C 1RXWA 2LCQA 4XD2A 2LWIA 4CMIA 4DTIA 1ZIYA 4EMTA 1LTQA 2Z2XA 2ZUVA 5FAKA 1RQ2A 1DC5A 1T4MA 3PQ2A 4I55F 1QIHA 2OO5C 2R7KA 2VHEA 5JTUA 5LZ2A 3H3JA 4EM6A 3JRXA 1BE1A 1GSIA 5IDYA 2GEFA 2ID9A 1SU6A 4G8CA 4C0BA 4MDFA 4TYMA 3DKKA 2R1VB 2WV9A 1AA9A 4UNRA 5HKOA 1W2WB 1NC1A 2FB9A 5EAIA 3PFNA 4DHEA 1S96A 4Q1FA 4DWVA 1DCTA 1NWCA 1QF9A 4P4SB 5AIAA 1CFZA 1KJQA 1O6CA 1GXSA 1H5UA 2BPOA 4YAEA 4Z3KA 5A5EA 2GZSA 3GWGA 4ASUA 1UDXA 3N3AC 4BZQA 2ZRGA 2JGIA 4J0DA 3D8NA 3ACBA 3S40A 2GYYA 4DUGA 5DNYB 5KQSA 2QJFA 3CNHA 4EPVA 5CB6A 4N6OA 4Y7DA 4YPOA 5HK9A 3SZ3A 3Q6IA 3TAUA 2HRRA 3HLYA 3KS9A 2F7SA 1U90A 4U00A 4M2LA 4MEBA 1UK8A 1E2MA 3EZXA 3KKEA 4WCFB 1GO2A 1QMGA 1Z56C 4I50A 4EG7A 2JA2A 4CRWB 3EXG2 1YKSA 5ANRB 3UQYS 3ITEA 3HCFA 3IUYA 2XDWA 4YPFA 3M49A 2P7IA 2CNOA 1NRJB 1YONA 3EXHB 4IXMA 3ZHOA 3PEYA 1JXQA 1QIEA 1E1CA 3LCUA 1V1JA 1J90A 2O07A 3L49A 4ZVKA 3TBHA 3O4VA 1BHJA 5CK4A 1M2VA 3UG6A 1P3JA 2IXBA 1L7EA 4K81B 2CLCX 1O1YA 3WGOA 4R16A 3ZGLA 4QC2A 1UFQA 2P4EA 4BNIA 4WLEA 4RY0A 3OI7A 3AF6A 2WY2D 1ZMOA 1QHSA 1MAHA 2GQ0A 1Z0DA 2CLDX 2J33A 3NXSA 2ZKIA 1T5IA 3N0WA 5BNIA 3LLVA 2ORIA 3JVUA 4FYYA 1Z33A 1I6KA 221PA 3UC5A 4UVDA 3UV7A 2P27A 3IB3A 1ENPA 4BLWA 4K0KB 1XTVA 4DB2A 4E14A 2ZJYA 2L42A 3O4HA 5BSUA 1EWYA 1UPUA 3CEJA 3QG1A 2IH2A 1NSYA 3VPDA 3DNMA 3PXBA 3MBOA 3KYCA 2AQIA 4AICA 4RQUA 2RH4A 4FVTA 3LJKA 1NXXA 2NTNA 4D9MA 2QQ0A 3ZHXA 4YC7A 3R5HA 4EIWA 1XEAA 5KNCA 3DL7A 4NQRA 5I45A 5CD9A 5H9WA 5CLHA 5FQNA 4KPEC 1ZNYA 3RVDA 2QROA 2EERA 4N7RA 1Q1BA 9ATCA 4UAGA 1S0UA 2AE1A 3EXHA 2ONKA 3TNDA 1FFXA 1QO0D 4PXYA 4RVOA 5KYYA 3BTUA 3LM8A 5ADWA 4G0MA 2GB4A 1RYEA 2NACA 1UC9A 1ZRMA 3KWLA 4NI5A 5ALPA 5F3DA 3U9TA 4AKTA 1FLDA 3MWDA 3PHHA 4QYWA 5K4AA 1C2TA 4IQ4A 3AVPA 3EJWA 1YVPA 3GZ4A 3P4YA 3RVNA 3IOBA 3VYRB 4EKDA 1GAJA 2B8JA 4HYYA 3BWMA 3LK7A 1ZSVA 5G1OA 1B0ZA 3PNMA 4FWTA 3ZE0B 1WP4A 3RAEC 2DTXA 4PBRA 4O5AA 3TZCA 3HH8A 3HU3A 1EMDA 5HOEA 3F2IA 1G0NA 3PXUA 3QE2A 4B85A 4E5DA 1W0KA 2X86A 3R7LA 1LTKA 4HWKA 4CM7A 2QG4A 1LBTA 1RP1A 1W1WA 5KJFA 1N1EA 3ER8A 4AWAA 3X1MA 3HO1A 3HG7A 1T91A 2D1QA 2YV3A 4K26A 5KQLA 5HGXA 2Z2JA 3QA9A 4KFTA 4JI8B 4YRCA 2ODAA 5JNWA 1HMYA 4ML3A 4B6JA 1I30A 2XA2A 3JR7A 3GFQA 4XB2A 4BE4A 5DHUA 4L95C 4PX3A 2H57A 3K32A 4RIEA 4XZ3A 3UJCA 5D8DA 3QQPA 1MAUA 2AOTB 1ZKDA 3A6JA 4OGKA 1QYVA 2FPIB 4GOOD 4NCKA 4BFLA 3JASA 3OZWA 4XCXA 1YFLA 3WBBA 4CIWA 4NNOA 2NYAA 4UBNA 2PRKA 1GTJ1 1EK6A 2WPDD 3O1LA 4M4SA 4YQZA 3GD5A 4JC5A 4BJ6A 1NX6A 1LA2A 1XQVA 3DEFA 3I52A 2D8AA 4OK5A 2PZAA 4MTLA 4WCFC 2PWAA 2ZSBA 3N6XA 3LZDA 4JJIA 3F47A 1ECPA 5TGZA 4LXHA 5IKOA 1WY5A 5BN3A 4JXJA 1DXHA 2HYIC 2QD2A 3C3MA 1Q92A 2Z08A 4UW9A 4ZEOA 3FFTA 3BVPA 1SY7A 1H6CA 4OK3A 3H13A 4XQEA 3GRYA 3OLCX 3U39A 4UCQA 4EAAA 4HEA1 4YRJA 4DZTA 1QVRA 3DQPA 3LHIA 1TM7E 3C8HA 3EXEB 2W6NA 4M37A 4AN0A 1JIIA 3MZ0A 2R11A 4UPDA 1Q15A 4IIBA 1OWPA 1S5PA 3ETJA 3ER9A 4YIKA 3RK0A 2YC4C 2A9VA 2IOYA 4ZDKA 2EDAA 2WAXA 2G83A 4KWIA 5DBOA 5JJ5A 3DO6A 4AO7A 4NIMA 2J1LA 5A5VA 3L4JA 4DDWA 1BVHA 3TZHA 1HT1E 1MDBA 1THTA 3BMNA 4B6GA 2HN9A 4HTFA 4OV6B 4S2EA 3PDIA 4C0SA 4LXYA 3FPSA 4DLSA 1BWSA 3KR9A 1S4MA 3B78A 4O2BB 1GEEA 3WV4A 3VTAA 4XW2A 4HTAA 3KJXA 4B2LA 4FJ1A 5BMVF 1NQUA 5KEIA 1SVSA 1YFKA 4D98A 5A4MS 3EY4A 4M0PA 1N2XA 4X54A 4ZI7A 4QVIA 3BB4A 4X65B 1G18A 1U2DC 4JT9A 4RWEA 3LP8A 5EP4A 5FWAA 4JUFA 2HLDD 2TMKA 4NFSA 1PBNA 4BLTA 3GCDA 4WASA 3D8SA 3HRIA 1XFAA 5FNZA 4MWEA 5EWJA 1V16A 3WGNA 2QB5A 1FFBA 3LMKA 3D3JA 3N2GA 5KAMA 3FWNA 4M8NE 2YYAA 3KJHA 4HMQA 3AUXA 5CVJA 1QRDA 2UZ0A 1AY0A 1RLJA 3H84A 4PANA 1L2TA 4YDRA 5JARA 5JH7B 4HLUA 3L4KA 3X1JA 2I5PO 3V7NA 1KWKA 3DOFA 5E7QA 2BN4A 4JJ8A 3LVRE 2A7XA 1A88A 1RQLA 5ALWA 5J63A 4BV9A 5FUVA 3C5HA 5JD6A 2V7TA 2ECPA 3L46A 2YNMA 3FTDA 2WWWA 1QGED 4CEIA 3L6RA 4P83A 3CEAA 3TGWA 5IC5A 3EVZA 1W9MA 4D5EA 1FTGA 7YASA 3NIBA 1CB0A 3R6LA 1JG4A 1G7RA 1NVAA 2VDLB 1PVOA 1A27A 5EWMB 1JJ7A 1Z6PA 4BL5A 4RU1A 3UATA 3BORA 4C30A 2A1IA 2GEKA 1I8TA 2W6JA 4QYTA 4P5EA 5A2GA 2FKAA 3CUEF 4ZV7A 5JR3A 2IS6A 4L6CA 2JCBA 2LCIA 1LU9A 1BS2A 4NAVA 4L2IB 1XTKA 3CUTA 1UBKS 2QQ5A 2GXSA 4U7GA 4JR0A 4DADA 3O1IC 5FWNA 2DLDA 3R6WA 1Y4UA 1JQLB 1UFKA 3QU9A 3IJ5A 1RDFA 5EWJB 2XSZD 1M2FA 4WKNA 1AA6A 5EIXA 1UBJS 2IYPA 1VG9B 2C2KA 3GLHE 5AXBA 4B2IA 4DEVA 3GVIA 1ZLYA 2NV2B 1NRWA 4I8IA 5P8WA 1A5AB 1JKFA 2ZBEA 4B3TB 3FETA 2OR3A 4LCEA 5IARA 3ZY3A 5C0OE 1SBZA 3WQSB 2EX4A 2R44A 2WTXA 3QIAA 5CGZA 3DMFA 2C9MA 2Z4TA 2TMDA 3TD2A 4OLFA 4RNDB 2WIJA 3U4HA 2H4JA 1A8HA 3I42A 3NAQA 4MUXA 3AUYA 1XO1A 4EF6A 3JW8A 4QJBA 1D6JA 1YS2X 2FOXA 1PWEA 2FVXA 5CTAA 2F9FA 3WGIA 3M9WA 2O1SA 4G0YA 1W0CA 1VBMA 3KQTA 3CCCA 1A0OA 1AGPA 4QECA 4YVFA 4D4LA 3CKYA 4YDHB 1PUIA 1UPFA 3WOVA 2VKTA 4LWZA 4PX5A 4Y1RA 1VMAA 3R8CA 3UB4A 2PEYA 3VVCA 3F73A 1FF9A 3WYNA 4BFXA 1RJDA 3VSDA 3OPYA 4IEEA 1LZKA 3ESDA 3O8OB 4C4YA 4LDNA 1NMEA 3THOA 3TLGB 4RK4A 4MYTA 1N6IA 4QHTA 4L9RA 4R84A 5THKA 1RR6A 2VP0A 5C1PA 3LCVB 2WV7A 1NN0A 3C5EA 4PYLA 1HK7A 3DE2X 3HKCA 4RJJA 1FLAA 4KWHA 4P3OA 3IAM6 3W3AA 1X1BA 2WYOA 1Z25A 1GUZA 4HC4A 4B40A 2NSLA 2X4DA 2R6ZA 3KJGA 3K0FB 2VKQA 1F5NA 3P9XA 3DL4A 5DHAA 2YWFA 3SDZA 1G20A 3AKYA 1SHLA 3W04A 3WRYC 2ZUSA 2CK3A 1Z28A 4LTDA 4PBSA 4QBHA 1LD3A 2EG5A 2AS0A 1IRIA 1Y34E 1F3LA 4O33A 1Y4DE 2CXXA 4HMOA 1GL9B 4ARBA 5DT9A 5DM70 2RAFA 3CLUC 4DIDA 1F8XA 4BYGA 4K9PA 1FNSA 1FOEB 4IFBA 3Q72A 1IHYA 1XMJA 2FW6A 1JMKC 2IQIA 3K73O 1PJZA 3G1WA 1WUIS 1LF5A 2J3MA 3MLBA 5C7LO 4B82A 9GPBA 1I6WA 4BUCA 3K8YA 2HRBA 1NVMB 1UOQA 1QRRA 5CM9C 2A5DA 5JEDA 4OUDA 4DIMA 1YKGA 1O0SA 2CHFA 1R6AA 1JHPA 2QW8A 4G1CA 4G5QA 4PQEA 3ZOKA 1NYRA 3Q12A 4NJEA 3OQNA 1KRWA 1RWWA 4JROA 1IHUA 1NHWA 1OBCA 2VDOB 1YULA 5EE0A 5JS6A 1SUEA 2QLFA 1RAAA 4WBXC 1V5EA 5G0VA 1TCUA 1JQBA 1O94C 4FUQA 5L3VA 4BE9A 1SC4A 5HJ5A 1PK8A 4HI0E 4ALLA 3ZQJA 2X1LA 2PMBA 3GJZA 3Q7RA 2IGTA 1WD5A 3AP1A 1AX9A 1YR9A 3Q5GA 1ISHA 4A2QA 5KOIA 4KOEC 1UDAA 1XRMA 3LDAA 1WMSA 4NCHA 1Z5OA 4HDAA 4NU5A 3GRVA 1P9OA 2I9KA 2D6FA 1E5XA 4L4XA 4RW0A 1QIGA 4FN4A 4CWAA 2QTLA 2HRDA 2II6A 3B7WA 3SHFA 4LXGA 4ZO6A 4Z7QB 3TUZC 3RYIA 1VLLA 2QTMA 3TCNA 2L82A 3V2GA 3N70A 4EUFA 2VHJA 3NVMB 2Z6UA 1HZZC 1U3TA 4I4CA 3ZDDA 4JI0B 5DGDA 2UZIR 2OTCA 4GC5A 1QZZA 1J8DA 1TMGE 2P3SA 4GE3A 2WUDA 1CLEA 1FFXB 2JBAB 1P73A 4KWCA 3OM1A 4Q24A 2I1QA 4F97A 1X0VA 3VH1A 1H6BA 3JQ7A 3VU9A 3HCCA 1E5LA 4LE0A 1LSSA 3VPGA 3MJSA 1X7XB 5KTNA 5UKDA 2QLMA 4CEJB 3BHJA 1LDGA 5FOXA 1N5OX 4DQKA 2NO9A 4R51A 1C3OB 4PVCA 4ZQCB 5B1IA 1TIPA 4BFZA 2YJGA 3IAXA 1WIWA 1C1YA 2CBXA 4HNHA 1G60A 1W49A 2AOXA 2HDOA 4M1TA 4ZCPA 5DLEA 3O9MA 5KOHB 3A0RB 4UHHA 1E6CA 4EYQA 4BXOB 2BI7A 4DT1A 1USUA 2GK3A 2PT9A 2EKPA 1Q77A 4QOEA 1JMVA 3PKJA 1EFLA 3VR0A 4G65A 2CV1A 4Y2TA 2NNLD 3GL9A 1CU1A 2V55B 3D6MA 3RF6A 2O59A 5KDLA 1VCOA 1ATIA 3RRBA 3QFCA 4UTOA 1E2HA 6ADHA 3EEQA 1D2GA 4NEHB 4Z2AA 5HP4A 1NV8A 2ZBRA 4R1UA 1TFUA 1NJGA 1S1MA 2E3JA 2QQFA 3NHAA 2O0JA 4ARSA 2CW5A 3PGMA 3A1VA 3TBKA 1BVYF 3KZMA 1UWLA 3OPNA 4AUEA 1GSHA 4HEA6 4K28A 2PD6A 2VNJA 2FP3A 4B5LA 5LCXA 1W87A 5CD1A 2RG1A 1ZY2A 2QIPA 1HYQA 2QRVA 3JD2A 2WWTA 3HFSA 4X64B 2VJBA 1KDZA 3PDIB 5K0NA 4R3NA 2HH9A 2QTGA 4WN9A 1RQXA 3NYRA 1DXQA 1TK9A 4FR2A 4DF3A 5ITWA 4M0EA 5C31A 4KQWA 3AI1A 1PD1A 1U0JA 3MS7A 2Q2QA 3OETA 2GNAA 2GPJA 5AKXA 3UW1A 4BMCA 4C20A 1GRVA 2GRJA 2YR0A 3HCBA 3AEQA 1GPMA 5GM1A 3Q6NA 3QPUA 4Y0NA 5ITZB 2FDCA 2C4NA 1XPRA 3WB0A 2GZRA 4DWWA 5D5PA 1UBFA 5IJWA 2EGGA 4D3FA 1NPTO 1N7IA 3LVBA 3WRXA 4ESVA 3OA0A 5L7YA 3T9AA 2MYTA 3UMVA 2Q1UA 5ER6A 3S2GA 2A5LA 1N5RA 3CVXA 3NOOA 4FM9A 2YC2C 1DELA 4L75A 1TMOA 2GEJA 2IHBA 4FW9A 3RT9A 5G1PA 2HF8A 3DT9A 5T5QA 5BV1A 3P19A 2B30A 1SXJA 4MRMB 1MR3F 2OCPA 5LM3A 4AUNA 5SY9A 3P8ZA 3SF8A 3BXOA 1VHTA 4YDSA 4JJ7A 3QKRB 2H2WA 5CVVA 4HSGA 1E4OA 1HYBA 2EL7A 3VR1A 1J25A 1NJ6A 4CMIB 4IV8A 1Y4AE 4YRDA 1VLJA 2FQWA 1E1RA 1P1KA 1TGVA 3H1PA 1O96B 1OSNA 4NYJQ 1WNTA 2EWMA 3EODA 2VZ9A 5AICA 3MCUA 1NXOA 2LUOA 1Z4PX 4DUYB 1UKEA 3DC7A 4AXXA 2G5CA 2MSNA 2R4TA 1KPHA 4DIUA 3EGXA 2I2CA 5F5XA 1H66A 1FMCA 4F7DA 3MJRA 5SZIA 3QHPA 1NI4B 2BGJA 3CT6A 4BFTA 1YC2A 1JQDA 2B4QA 4ND2A 2H7XA 2NO4A 3H2KA 2I7TA 4QGBA 2GCPA 4DR7B 5HQ3A 1PFQA 2XNJA 1XVAA 3VC7A 3ZGOA 5BN1A 5FOQA 1UEXC 1RQNA 4JI6B 3H5IA 4LQ4A 1JX6A 3U44A 2JGRA 1E62A 3P4XA 2EWVA 2YQZA 3AHJA 4TWIA 4C04A 5A6SA 2P0YA 4IDBA 3VHRA 3MB8A 3Q3HA 1IB6A 2C07A 1VKNA 3KKPA 4LZPA 2GTIA 2H4YA 3WHLA 2ADFA 5BR7A 3EXIB 5T41A 3NTOA 5C46F 1DJLA 2QVXX 1DEOA 4FI3F 4OXNA 3THSA 2G63A 3MN1A 3W1EA 3QYJA 2YDYA 1TMKA 4PCVA 2DHDA 1UAGA 3EPRA 4LJ5A 4JLBA 4KAAA 1REQB 1WMFA 2ACEA 4Y2GA 3ROKA 5KQPA 2NYVA 5KU1A 1H9BA 2X1VA 3IH5A 3R3UA 4R9UC 5TJ9A 5A4JA 4X66B 2BHRA 2H18A 3AF2A 1FX1A 2NUTA 4M0DA 3SEQA 4EYKA 2OV2A 5IAOA 2PU5A 1XA0A 3UHFA 1UM9A 3WWOA 4PSAA 1PR4A 1G8HA 3FGOA 2AG0A 3FTCA 4XJXA 1LSJA 1PO7A 5HK8A 3H2IA 2P68A 3EIHA 4GRDA 4O1MA 4TRRA 3ZWBA 3WBJA 1ZGBA 4D1YA 2CLOB 1RHRA 3A04A 3ILYA 3IAAA 4E6EA 2UXCB 3LG2A 1O6BA 3IPLA 3CX6A 4XJSA 2GN9A 3EIEA 3RE1A 3K2EA 2VQFB 1K8ZB 4CLOA 5JALA 1LW7A 3IRVA 1GQ2A 2NOAA 4H6XA 1XK6A 3A9RA 1LV8A 1G7SA 1GPNA 2XXJA 3ZWMA 3A6EA 3MJTA 3BMXA 4CETA 3IKLA 2QAJA 4RF5A 3STHA 4DQDA 1AS3A 2W43A 2RK3A 4O4JA 5HGJA 2HWUA 1S2LA 1PEAA 2VDNB 2C5SA 4QXRA 1JEYB 2Z6VA 4TL8A 1H4SA 2HW8A 2D2VA 2P67A 4Q4JA 3PX2A 5REQA 2QL6A 5DDIP 3ZXUB 4JOSA 3C1OA 1J7JA 2HI0A 4QUHA 4C9BA 2A9RA 4Z4GA 2G08A 1D3AA 2WJWA 2J0SA 2G9VA 1NNEA 4J4BA 4ARAA 3ZHQA 2AV6A 1GAWA 1SNYA 4BZZA 2BRUA 1YIDA 2EEPA 5LU9A 1T1JA 4UNIA 4OHPA 3E82A 2YRWA 1M9NA 4RHXA 3REGA 2HCFA 1DIGA 4HDNA 4U2CA 1DWUA 4LZAA 1KSFX 4P7BA 3O6VA 3TVYA 4FFPA 2D1FA 4I5FA 4XQGA 5KTMA 2AYYA 3P94A 2R8RA 4HH0A 2B1GA 1Z75A 2JIDA 2Y0DA 4JQYA 1EBUA 5BYBA 3T3PB 3WI7A 4F2DA 5CITA 4M60A 1YQWA 3P2OA 1Y0BA 3H4IA 3AOGA 1ZHHA 3WXBA 1L8XA 3JCZA 6Q21A 1AOXA 4D96A 1WUKS 1KO8A 3F74A 4MUKA 1OA0A 4KH0A 3UYLA 4TKMA 2JBAA 2RBKA 3GCGA 4OLBA 4F85A 1N2GA 3P0JA 4FJ2A 4OQZA 4CKBB 3FMPB 3WWPA 2RI0A 1U6KA 4HNGA 2R1VA 4YHHB 1SUAA 1CQIB 1UIMA 4EY5A 1T9ZA 4P1ZA 3G1UA 3VR2A 2PSEA 2XUHA 1Y7TA 3I9OA 4B4UA 3DEIA 1YE5A 2OV6A 2W0SA 4BTEA 1VIVA 3QUSA 4LZNA 4HVCA 4QQRA 5K0ZA 1L5LA 3NIGB 1OROA 2P0EA 1ZAKA 3MLAA 2Q6TA 2FMIA 3BRWA 3JPWA 3QA3E 4V0LA 4C08A 4TVSA 2RD2A 3BXZA 1FDUA 4DDVA 2H3EA 3ONDA 1D07A 2FEMA 4LQLA 1DDIA 2TRSB 2C97A 2C3UA 5GV8A 3TSWA 2FLKA 1ODSA 1RJFA 3L9XA 5I9TA 3DUFA 4F4FA 1B7GO 3AHDA 3R0IA 1U1GA 5JLAA 1GKYA 2ZJZA 3ZHSA 2R62A 3MBIA 4LZZA 3QRWA 2BMEA 2PKXA 2VP9A 2B34A 3H2BA 4L6AA 1N25A 1N6HA 4WLOA 4ITVA 4MYUA 3II6X 3OKFA 4IJUA 3AIOA 5LQSA 1BG6A 2W5UA 5K8JB 1YRAA 2UZ1B 3AR6A 2I4RA 4HAIA 5DRYA 2BT4A 4UUBA 1FDOA 4WLNA 2GKOA 3C7CB 3D31A 1KH3A 3CUWA 3O3OB 4WSOA 1V8ZA 2Z4SA 3QF4B 2O6LA 4B79A 2PT5A 3NBAA 4DQLA 3ND7A 1BD3A 1CLUA 1CPYA 1LF0A 1K4YA 4IIYA 4RD0A 4RM3A 1U7TA 4R1TA 5JSZB 4XQCA 1O54A 1U9JA 4R1LA 3F71A 1J2TA 4IZOA 3WBKA 3A6KA 4QFBA 3UFBA 1EGAA 2FU5C 1G6HA 3TZ6A 4K6CA 4D44A 3PWTA 3PQFA 1OXVA 2M98A 2A57A 1PL7A 3QG5A 3QVWA 5LQJA 3IKTA 2ZB3A 1N36B 3M9LA 2OV3A 3JX9A 3GPCA 2VRCA 3HFRA 4GQAA 3TMYA 2ASVA 4M1SA 4J1QA 2Y76A 3F5FA 1MEOA 3DE0X 3O2JA 3PI7A 2WD9A 1VJ1A 2X6RA 2BGTA 3H9CA 3TLAA 3EAGA 3FTPA 4W8HA 1W4AA 1J1IA 1PR0A 1Y6GA 2VHWA 2Z57A 1U2GC 1DWQA 2PQ0A 3OZVA 4GBMA 5TQJA 4XCVA 1CQZA 1YFZA 3H0CA 1DTEA 3WFIA 3ZCTA 1CY7A 4R1NA 4RULA 1PR2A 3MF4A 2B98A 2C99A 5GIPE 4ZQEA 2VK2A 3BRSA 3IBTA 5F52A 2EIXA 3AFIA 4ZAYA 1SPXA 2JHGA 4TVKA 3OM0A 2WP8J 5DMXA 4RHUA 2NU6B 2JAHA 2HCRA 3SSNA 1LRJA 1I2AA 4D6XA 3V80A 1VB3A 2DUUA 2CDAA 1XRNA 3HNPA 1EFRD 3KKNA 4I2NA 4TSRA 1S8OA 2ZU6A 3Q9NA 3NHPA 4FI3C 3FTQA 1WOMA 1U1DA 2YOHA 2ONYA 1V48A 2P7HA 3JYQA 2HREA 2VNIA 1NUHA 2ZRMA 1TGYA 1X1QA 1XA3A 4C7OA 3T3IA 4BE7B 3CJTA 2I3BA 3BH6A 1SVNA 3CW2A 1HMPA 4WTOA 3RLFA 3TOSA 4BKRA 4DLZA 4DSOA 5B2FA 1LK0A 4Z0HO 5LP6F 2CF6A 1IEQA 3FB1A 3T7IA 2HCJB 1RMTA 1ZITA 2EQ5A 3PFIA 2C98A 2FSUA 1ZL0A 3PR3A 3RTBA 3FIJA 3U7QB 4C88A 1HQKA 1Y80A 1WDLA 2AFRA 4D8YA 2HJVA 3F3SA 3MOIA 4JSYA 4PE5B 3CJRA 2HMSA 2XUIA 3FAKA 4YCCA 2MMCA 2B21A 4MCJA 4D3ZA 4K6MA 2OHFA 1R4MB 1NW3A 1B8VA 4ZKEA 2DWPA 3BRCA 3D2AA 4KIJA 4OAQA 4RV4A 5H16A 4LF4B 3AKCA 4RETA 5JCZA 2V7EA 3IKVA 1AQIA 3TW8A 3G7UA 4MRRA 2YASA 4CKZA 3NTUA 1SBIA 1U80A 3EEIA 1X80A 2Y4NA 4V38A 4NHEA 1HOXA 3JZAA 3HS3A 2IXGA 1CJCA 2QE6A 4GUDA 2F59A 3ZHUA 3IJPA 3LSTA 2QJOA 1VBKA 3KWMA 1G55A 2JGFA 4EGCB 2JAQA 3IJRA 2D5CA 4I5DA 1T25A 4Q9NA 3RADC 4NL4H 2F48A 2G4LA 2BFDA 2WT9A 3LT2A 4U7FA 2IIBA 3X1WA 3R5SA 1Q0SA 4A0GA 2NXNA 3Q9UA 5KTKA 2HF9A 2E18A 2YYYA 3I9V1 2BFCB 2J6CA 4H1HA 1P1RA 2CLEB 4R8SA 1AV7A 1WXXA 2X5KO 4QGFA 4QTXA 4BB5A 3D4LA 2QRPA 4B75A 3R9KA 1KY5A 1UWCA 4HNSA 3HZZA 3HVIA 2XQJA 1QK5A 4JFAA 3RS2A 4D8WA 3GQBB 3T9EA 1XHEA 3EQZA 3FNIA 2W42A 3WIVA 2FWMX 3PHCA 3WLHA 2W00A 2ZI7A 2P9TA 2WM8A 3KTOA 3RJTA 3MMXA 2VPZA 1IJEA 2RGCA 2X9NA 3GGJA 3I09A 1J8QA 4H6WA 1K6XA 1IQ0A 3N28A 1UPCA 3FLAA 3MOGA 3PS9A 3EFHA 2OLKA 3E9RA 4NWIA 3WIUA 4F86A 2K7FA 2RC6A 2GTHA 1L5SA 1P9LA 2O7RA 2WM9B 5DGHA 1I1OA 1JHXA 3GD7A 4FMDF 2G09A 4ND5A 2F8SA 1Z4JA 1E1DA 1JQ5A 3PR1A 2H4WA 1ABEA 5JE8A 2JG3A 2QL9A 3RYCA 3ZQ4A 2CK3D 1PVDA 2Q5OA 4Z4FA 4JAVC 4RENA 5H81A 2HNAA 1CX9B 3PLRA 5BV8A 4A2CA 2ZSEA 4Y2XA 3M4YA 2FNAA 2GAFA 2VK4A 3B51X 1MT0A 3HA2A 1DINA 4H3HB 4OREX 3TW0A 1N7HA 4LBWA 2GYVA 3UMRA 4FR5A 1U0NA 2HA6A 1NW5A 2OD2A 4MV5A 1G17A 1EKXA 1EUCA 1KE1A 3AVTA 1Q7CA 1V96A 3MWKA 1VCHA 2HPZA 2ICAA 2XW6A 1BOFA 2HT6A 4IDAA 4O8CA 2O1EA 2PJRA 4V0MA 1VE6A 3GU3A 3SP1A 3MUFA 4PFQA 1Y6RA 2BRUC 4CEJA 1QHNA 1KI3A 2VK1A 3PXAA 4MGKR 2JFVA 5F2EA 5E4TA 4BUJA 3JQGB 2RKBA 2WSBA 2HF7A 3L6CA 4HDRB 4HLDA 4K9SA 4GBJA 3MJDA 4ND1A 4Y18A 2XGOA 5EJAA 4IXWA 3MMZA 4QDOA 5EMLA 1L3IA 4CR7A 5AK6A 3HXQA 3AHCA 1H85A 1P3DA 2ILTA 2NUPB 1Z0KA 3KBBA 3QBDA 1QCDA 1QFYA 4JT8A 3E22A 4LQDA 4PYKA 2I87A 2IUTA 1ICIA 4ECEA 4QJ3A 5FO1A 2H4XA 1VHDA 1SCUA 3NTVA 3O94A 3KV1A 1U8FO 3NWJA 4HH1A 2GJAA 2ODEA 3SMVA 3VDNB 2BONA 4D8TA 4TKVA 2TSYB 3DHVA 1CQPA 2FFAA 4LHEA 4MV3A 1KETA 2PZJA 1MJFA 2FY8A 2D0IA 4G41A 1QGOA 1UODA 4HEHA 3TRJA 4IY1A 5EKSA 3TQTA 1K5DA 2I6GA 2QE7A 4DV4B 1Q3TA 2W93A 4MVJI 3E35A 2E4YA 2QTWB 3KVNA 2AOUA 3TQRA 1M5RA 2QTTA 3TKYA 3ZWDA 2J08A 3Q8MA 1ACMA 2DUNA 3KU4A 3S7ZA 1RWQA 1XCJA 2ZJ8A 2QP9X 4TV8B 1YCHA 3GGDA 3KXPA 4YAWA 1EX1A 1S2GA 2P2YA 5TVGA 1BRMA 2WMOB 4A1OA 1RSZA 2Q3HA 5G3ZA 1C8VB 4G0UA 3I9JA 4XCQA 4D99A 1U7OA 3H5LA 3OMXA 1JIUA 1FRNA 2ZATA 3MJ4A 3F46A 4G36A 3UGTA 4DV2B 5K3EA 1QHHA 3VAYA 2ZRJA 1VI5A 3HY3A 1KQ3A 1TVEA 5BN5A 2W6MA 4HWRA 4Q4HB 4X20B 4MICA 1K98A 4QGGA 3AEXA 2V58A 2H4HA 2WUWE 4KI0A 2DTDA 1LNQA 5BW4A 4TV9A 2ETXA 4FN5A 2PHZA 3BXPA 4RTOA 5KYYB 1O9HA 1Y6FA 2Z3WA 3KALA 2IITA 3O7WA 2A1UB 4RXTA 4DLAA 2IF0A 3ZWQA 2VZ0A 5E9QA 3A1NA 3KJFA 2O14A 5HNKA 4GKAA 2XCUA 3T3GA 1IC6A 4BTLA 3E23A 4HDOB 3K1ZA 4XPZA 2PL9A 5JSZA 1NBEA 2ZTHA 3HTXA 3Q8LA 5FFFA 3FYUB 3QBEA 5IJ9A 3K2QA 4JUBA 2GCIA 3CW8X 3NCTA 4QLAA 4CMBA 4M36A 3WQBA 2B78A 1BKYA 2XOKA 3RTCA 1COWA 3ZWAA 3BHNA 3ILXA 4EGQA 2AXQA 3GC6A 4RSRA 1JAZA 1DTWB 5TLSA 3IV9A 5ALKA 1VKRA 1JSLA 1PGOA 2CHQA 2VLBA 4UUOA 4IXTA 1WUHS 1Y1RA 4ALJA 4C6TA 3LLSA 5J2UB 3EN0A 3I0ZA 3P0IA 3NAZA 1PR1A 2X5NA 3DUFB 4GW3A 2YXEA 3HYNA 1U0BB 2YHIA 2RONA 2W48A 3SS7X 5JCJD 9LDTA 3VO8A 2C61A 1SVOA 4QBIA 5KNCH 2ZRLA 4UHDA 5FWXB 2E2WA 1ICEA 3TQOA 2A2ZA 3E9EA 3OOSA 2I3AA 3CGGA 3RC8A 1E1CB 4G8JA 4JUIA 4AJIA 3GLFE 2DWOA 4RXUA 5C1IA 2C59A 2V6MA 4QJIA 3I9LA 2QRKA 4OX9Y 4B5KA 2J3EA 2WSIA 1T9DA 1Q22A 4HZIA 1GZ3A 4AURA 4BN4A 4M1OA 1KORA 1KFKB 1YD7A 3ND6A 5JJKA 1DWPA 4BNLA 5CJPA 3PHJA 2ZJ4A 4W1RA 3TEJA 3TW4A 4C0AC 2O54A 1K8XB 1ZUD1 3QEMA 3IULA 4LWQA 1AG9A 1KK3A 2GCNA 3NFYA 1YL5A 4W1QA 4YAJA 5KYUA 5LQUA 1FTYA 1TEZA 2QBYB 5E9WA 3AKDA 1JS1X 4OQDA 5EWLA 1C0KA 3HKEB 3ROGA 5HIIA 4JIMA 2I66A 3DXFA 2FWRA 3AF3A 3AGQA 1V9LA 1UR5A 1M7GA 3D7LA 1Z4QA 3PCRB 5JSUA 1GTSA 1JLRA 3BAZA 4F3RA 2H2GA 2PDAA 4MGEA 3RROA 1AZTA 4RZSA 1QLJA 3DV9A 2XE6A 2QZ4A 4XGIA 4UMFA 3G5UA 1QC5A 1G8YA 2OXEA 4BVBA 3AHGA 3AVQA 4XWKA 4MITA 1MENA 1E9SA 3I23A 2FR1A 2PO5A 4M53A 4FBMA 3TKAA 1TM2A 2B69A 2CLLB 1GZVA 2N46A 4JHLA 3VR4D 3ZE9A 5AIBA 5AVVA 4RDHA 2R6HA 4WGGA 5JY1A 2D4HA 3WZMA 3R5JA 3I9KA 2QX6A 4FTWA 3DXZA 4D45A 3KJEA 3RKRA 4RA6B 3TIFA 2BD0A 1JHVA 1S2MA 3QPCA 3KTAB 5E8JA 3N8GA 4S1WA 5FFMA 2YUIA 2HV8A 2K6GA 3LGXA 1KEUA 1TLTA 4HVLA 3EVDA 1W0JD 2UV8A 4KBGA 1AXEA 1E3WB 2G07A 4MRSA 4NS1A 4OGGA 1GPWB 4OB8A 3J81k 2XIJA 4N3AA 2PANA 4MIKA 5IASA 4LF7B 1AQ6A 2P3LA 5C8YB 1DCMA 3IPRA 4L08A 1LDNA 1ODIA 2A4MA 1GQQA 4HCJA 5EJMA 1TZKA 4L9SA 2DR3A 5LYYA 4RM2A 2C04A 1SXPA 2Q50A 1X94A 4Y2VA 5CXQA 1BYIA 1VTKA 3EPHA 4M9XA 4M1MA 1IY1A 2G0TA 5LB2A 5GINE 1OW3B 2OG2A 4OXRA 3Q5DA 1ORWA 2FSPA 1BXZA 1K75A 2H63A 2NUBA 1XEXA 3AZPA 3L7NA 4OHOA 3WBFA 4MR7B 4AAYA 4CJXA 5HR5A 1UDBA 1Q74A 3SEFA 2YHUA 1EJ2A 2NM0A 4XSVA 5M34A 2FSSA 3OQIA 3HDVA 3UCXA 5SYMA 5IMSA 1FXSA 4CEHA 5EKXA 4RCZA 1FC0A 4IVNA 4UOEA 1GY8A 1CIJA 4KKXB 4YFYA 1E5QA 1AUXA 4MULA 4E5MA 2V97A 4OBWA 1KYZA 4EPTA 3UPUA 1IOVA 2J9GA 2M1XA 1GUFA 3OTWA 2HPHA 2Z9BA 3PUYA 3DV0A 4BEJA 2GO1A 4JU8A 2GVNA 1JLLA 2YHAA 2I76A 2QT0A 4H7KA 3VM6A 4KXYA 4R5MA 4D25A 4ZYVA 3MINB 1AK9A 3EC7A 5M3BA 2ERYA 3S7TA 1PNTA 1N2SA 2VPYA 2QW1A 3ZH2A 3GLIB 3I61A 3EPKA 3RAFC 2C9ZA 2HGZA 4RVUA 4HNAB 4WESA 5LC1A 5JADA 1XL0A 3KT0A 5EKTA 1I80A 3TW6A 2CFTA 2OORA 1WCV1 3DVAB 2VF5X 3AU8A 3H5VA 2Z04A 3TZKA 4H0CA 2I80A 2Y66A 4O4IB 5FUWA 2W0MA 3ZK8A 2O7SA 2EKQA 1PX2A 1CUGA 3HXLA 3W1VA 4CM9D 4RJTA 1RKUA 4I4TA 2ZIUB 1UQTA 4UE2A 2A0KA 2BTEA 1SRQA 4I7EA 3V7WA 5DYGA 4EJSA 4PQYA 4Z54A 1B43A 2AH5A 1WD7A 3MD9A 1KI2A 3FAZA 1NKVA 3DFMA 2R3SA 3OCJA 4GSLA 1HDCA 4DG9A 2VYFA 4Y0VA 1GKLA 4HLCA 1DTSA 1N9KA 2B92A 1ZSNA 3N7TA 4JLAA 4NFLA 3VNVA 1NVTA 4GHWA 1C4XA 1KP9A 2ZR8A 5A5FA 4Y9RA 3ZWVA 5EFOA 2IC5A 1T8YA 1WPRA 3KKLA 1CY8A 1Q0HA 3H8WA 1L1EA 4N5DA 1I4EB 3C3EA 3MXTA 4X9XA 5JRDS 4YYZA 4G4JA 3DF9A 3HV2A 5FV4A 2UYQA 3COPA 2YICA 4R2JA 1EHIA 2VTVA 3UWDA 1AGNA 4ABYA 4AYXA 4EEKA 5JZMA 3LX4A 1R0WA 3VZRA 1U2ZA 5DX8A 4V0NA 2P6MA 5LYJA 1VE1A 2ISQA 3D6TB 1XXHB 4PR3A 5CVEA 4C0XA 4A8JA 4MRPA 1IUOA 4KB5A 2BDEA 4TKUA 4QOFA 1JQAA 4UHBA 3ASYA 4FMDB 1MIHA 3L0IB 5H1YA 1GTL1 1KYIA 4NENA 1Y3HA 3U1TA 2WT8A 4N5NA 4B3XA 3QVKA 4H3KB 2JGAA 2ZI3A 2DHEA 4Z7OB 2V6FA 3IUSA 3CT4A 3CRW1 2O52A 3K9NA 3QVXA 5LB4A 3QVJA 1KIMA 1L3CA 1G4HA 3LY9A 2QF7A 3MGBA 1ZJYA 4GX2A 2P2ZA 2HK6A 1C7QA 2QRVB 2YIMA 3C8DA 1ADFA 2ZE7A 1ZZEA 4ZCTA 3FRIA 1NMYA 3N1UA 3P0HA 5KC8A 1W19A 1TJPB 5U1PA 1ZM7A 4UDXX 5FX2A 4GM0A 1I2BA 4WEQA 2X6TA 3VTFA 3LY5A 3RTAA 1SD5A 4RY8A 3SJUA 1CF9A 1L4NA 4RY9A 5GOTA 1SXJE 2WU1A 2X9QA 4OB7A 3R09A 1AKYA 1CCWA 2OE2A 1CNEA 4ZCIA 3VX3A 1K2VN 3A28A 1NMSA 4CN9A 4DSAA 2YV2A 1J97A 1T2DA 1X2BA 1NMZA 4E2YA 3F6SA 3FBTA 2GASA 4AJ9A 3HUFA 2GD1O 1RD4A 1RYBA 4PHTA 3S2UA 2JFXA 4YYEA 1TUBB 1Z62A 3HP7A 1WSBA 4GRIA 2VSXA 5KWJA 1I4LD 4JEUA 1I1HA 5DF1A 2FPSA 1I0LA 4DAEA 2W6ID 3AINA 3SQOA 3ZHRA 1YQDA 1MZVA 4KAFA 2CGEA 2PK3A 3E2MA 4JVLA 3PTAA 4J76A 4DM7A 5DHPA 5TEWA 2EQBA 1P2SA 4C87A 4XOUA 3PC4A 2YIJA 4PLFA 2OHIA 4H7EA 2BGGA 2PLFA 3IERA 5LP6B 2VT3A 1ADGA 4P3YA 3CN7A 1KI7A 2YVAA 4QX6A 1DMSA 2V7PA 1OFVA 3H6GA 3OEEA 1P9NA 2PXCA 1T8TA 2PL3A 3QWHA 2PBZA 5DBGA 4TX1A 2H1VA 3THYB 4PY2A 3V32A 1UJCA 3TBFA 1BVUA 1JDBC 4I50F 5K45A 3H2YA 1F2TA 2MT9A 4RFVA 1J99A 3JD1A 3QP9A 5I9MA 1GG8A 2H8KA 4LF5B 2H5IA 1RJEA 1H6DA 3S2FA 2J0QA 4XIGS 5HF9A 1A8IA 2ZVQX 2WIGA 3K9WA 3RSOA 3I62A 1NHGA 1W88A 2R6JA 3OOHA 2DQZA 2QN7A 1SQGA 3AM4A 4F6CA 3QEBZ 1A9XA 2XQVA 3VPAA 5GONF 5BV2P 2GCGA 1R4AA 4AJLA 5IKMA 1XTRA 3GH3A 1YAJA 2ZBGA 3JQBA 3OZSA 3LAWA 1E5VA 3P20A 3Q1LA 3ITKA 5FL7A 4CV0A 4G1BA 2G67A 1LKZA 4HUQB 3FZNA 1RWPA 2IYXA 4GYWA 4CMGA 2JVIA 4PC7A 5KYNA 4MWBA 1EFVB 5DX0A 4IHKA 2P9BA 4MW2A 4N39A 3IESA 1FPQA 2V7BA 1KMNA 1QPZA 2HSEA 3TM5A 3NT5A 2BDUA 5CFPA 1QVZA 2Y1WA 1UBCA 4LBVA 3OJXA 4UUNA 5G0TA 3TDKA 4HEQA 4MWDA 2VP2A 3L4SO 5IEBA 5BP7A 2H7YA 1IULA 4KUHA 2GK7A 3EQ7A 4N65A 5T4HA 2CJYA 3A6HA 4O3MA 1Y3IA 1KYWA 1NVBA 4LHZA 1UBLS 5IAEA 3TB4A 3O73A 4UBMA 2DUJA 1ECGA 1ZIDA 5JMPA 2ACVA 5AM3A 1FYWA 4E5YA 1X13A 4H31A 2GK4A 4LJRA 3HADA 2QMZA 1DKUA 3BFVA 3OQ6A 3QMWA 2AQHA 2EBHX 3NTLA 3O0TA 1IZ8A 1E0JA 3EWNA 4P92A 3W77A 4PGHA 2XCRB 4C2UA 3S27A 4DCTA 5BW6B 4E7PA 3QEJA 4AKHA 2H9YA 3FJOA 1OU0A 4HHEA 4X1KA 3SYLA 3ZWWA 4YK7A 4C21A 3HWSA 4EI8A 3FXAA 3X1YA 4EHIA 1QB8A 2R7LA 2IZZA 1M10A 3X1KA 3DBHB 4QUDA 4IHQA 4LVUA 1IXKA 4CM4B 2GZAA 3EAQA 4YAKA 1U8XX 1X8XA 4WFQA 3HA7A 3R3VA 4RIGA 1WDWB 4WLFA 3U40A 1UMDB 1WEKA 3TQQA 3LW7A 1GN9A 4GI3A 4WXPA 4PPGA 4ZZ1A 4CGYA 3HU1A 1U94A 1VRWA 3RYFA 4MDYA 2IU0A 3B2NA 2GGSA 1ZXXA 1X8KA 2CLIB 3ZV7A 3VYVA 1LPAB 3I3OA 4NP6A 2PXHA 3UPDA 1MB9A 4PGGA 1PZXA 3W8EA 4K9MA 3IIKA 3DTVA 3I6BA 2HXGA 4MGYR 3M8KA 2REQB 3OOJA 3GJXC 5CAEA 4BQNA 3BMOA 2LKCA 3AY6A 4TVOA 1QVVA 2GYWA 3GMDA 3SC4A 2PVSA 3OMLA 3ANMA 1H1LB 3Q41A 4MMZB 5EA2A 5BRNA 5GZ1A 2XGGA 3OEWA 2ZOSA 3GDGA 4DVGA 1HNXB 2I6XA 1XLVA 1JSCA 4NCNA 5CCXA 2P77A 2QPAA 3ML1A 5H80A 1UMBA 3BX1A 1FJGB 4R8MA 2WMYA 5CH3A 4DCPA 1U3DA 3S1SA 3LPAA 1QGYA 1YVUA 3VZDA 4BUZA 1XDGA 2G5PA 3KQQA 1YK0A 1V5GA 3C39A 4PTZA 1WV0A 3BFXA 3URKA 1VKZA 4Z9YA 1BAPA 1Y1SA 5CX1A 4A2PA 2WWVD 4TTRA 3LVQE 2ZQYA 3E3MA 3DNPA 3RWOA 3ABOB 4Y1GA 4RJ2A 1CQJA 4M6WB 2A5GA 1VPWA 5C7IO 1TQ6A 2NVWA 3BJMA 3GLUA 1PFKA 3TIIA 4BDTA 1F8FA 4G0NA 4YBZA 4P3KA 1NP3A 3SX0A 3SXJA 3GLGB 1R12A 1CW2B 4DN6A 1JDPA 3HFGA 3TZEA 4BVKA 3WXMA 1E1QA 4K9LA 3U9LA 4CQLA 4P8RA 3IDQA 1G2IA 1I3LA 2QY9A 5EN4A 4E13A 2FZGA 3PYXA 5AVOA 3O84A 1Z26A 1VKJA 4EVIA 3C4QA 2GVZC 1HQDA 3R76A 3TQIA 2I4IA 2VDMB 3MCWA 4PXAA 1MC8A 4BKUA 3PJEA 5F78A 2CXUA 4YMSA 5EZYF 5G02A 3KDAA 4WLVA 1BRTA 1JG3A 2OZLB 2AUTA 2ZUDA 4JN6B 3LKVA 3SF0A 2CE2X 3AUFA 3LX6A 1YBMA 2G9ZA 5CCEA 5KTRA 3OQ1A 2XCTB 4U2GA 2GM5A 2WWIA 1L0BA 3Q88A 4M87A 4RPGA 5JQWA 2QTAA 5A0VA 1ZC4A 1ONPA 1RHQA 2Z1MA 3ETCA 4L27A 4MQBA 5BMVB 3IE1A 3SNHA 2AG6A 4NY1A 3T4UA 4FFNA 2O8NA 1P3Y1 3WLKX 2WSSA 4QWWA 1K5PA 4OJYA 4UMDA 5AJZA 5LQKA 3ZDEA 2K7ZA 4ESHA 1MPTA 1JQEA 1T4CB 2GLUA 2ZBVA 4TUYF 2VXCA 4YP9A 1KAEA 4RTMA 4BHTA 1DDGA 4MTCA 1J8MF 5JC8A 3FWPA 3WWZA 5IM5A 2WHXA 3A4TA 3FPFA 3WMRA 4PR0A 4WK6A 5KNDA 3BRQA 5DYWA 5IK2A 3RV3A 2HT1A 1FP4B 3GOHA 4XIJA 1J9GA 3KEFA 4DE5A 2AJ8A 2F3TA 2OQ2A 1W5BA 5JH7F 1AKVA 4MSUA 3A27A 3LRTA 3HUTA 1V25A 3OAAA 3IKMB 1V8OA 2HA5A 2P79A 4FHCA 3VUFA 2JLZA 1DQPA 4DW8A 2C7RA 1GRCA 2ENUA 5CNMA 4UAJA 2GCOA 4W6ZA 1MEJA 4KQ6A 5JD4A 5THQA 1W2HA 2AEFA 3R0XA 4BV3A 4V2IA 5KKCA 3DHYA 4OEHA 1TTTA 1SR8A 3TSZA 1I51A 3H99A 3VO9A 4MXDA 3WB1A 4TS3A 3WHIA 4CR8A 4KN6A 3ZZ1A 2ZRFA 5B58C 3S1AA 4C5BA 1EXVA 1NXWA 1ZN2A 3VH3A 5CK5A 4E4TA 4B34A 1PUXA 1YSCA 4WXRA 1RJ9A 2A9PA 1A71A 4FX5A 1TM3E 4XDZA 4YECA 4KFSA 4ZVTA 3CCFA 1OTYA 3KD2A 1Z0ZA 1BE8A 7REQB 3RVPA 1VMEA 1ZWKA 5HDQA 1TOAA 2DBYA 4W5JA 3DLIA 1NBAA 1O89A 3CVJA 5JAMA 3D0OA 1CVLA 2Q4OA 3T52A 5G53C 1UINA 4X1YB 4I08A 1JT2A 3RI3A 4AFNA 2JJ1D 3HBLA 1TD1A 4UKDA 4S35A 4LV6A 5HDBB 4F60A 4TSKA 3I53A 5AJHA 3RBVA 4E5VA 5IG2A 2VH1A 4HNAA 4WESB 4B3CA 5F2KA 2GZ2A 2HAEA 2PT6A 3T0GA 4QUJA 3EW7A 4E5PA 3MWFA 2KLBA 1POXA 2FQXA 3LRXA 1H6AA 4G1EB 5HF5A 3V46A 5F21A 2ECFA 4C07A 3OOWA 3IR7A 1IYZA 3A9CA 1LBEA 1K86A 3Q5EA 4RVGA 4G0XA 3IIEA 2IYRA 4RE5A 1DAMA 2BDTA 1KSHA 3HJBA 4KBFA 3BULA 4TMXA 3UK2A 1QU3A 4HNRA 1RWXA 2ZYTX 5HKLA 4MRMA 2FKNA 3KFLA 3DOEA 4YO7A 1ZW6A 2GEVA 2YWEA 1GZ7A 3DOOA 3KHKA 4MP3A 3DL0A 2EARA 3BCUA 3K9BA 4NFHA 4G4SO 4D4IA 1VG8A 3OZXA 2CZQA 4RL4A 1FIUA 3T3HA 5K8IA