2GJSA

The crystal structure of human rrad in complex with gdp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
168
structure length
150
Chain Sequence
VYKVLLLGAPGVGKSALARIFGGVGHTYDRSIVVDGEEASLMVYDIWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human RRAD in complex with GDP
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTP-binding protein RAD
total genus 53
structure length 150
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gjsA00
1J8MF 4DJTA 1TF2A 3GJ8A 2I3BA 1GKYA 4EPRA 2CHGA 5G3YA 1TX4B 1JJ7A 1XTJA 2KSQA 1EWRA 2XTNA 2GAAA 3BFXA 1DARA 4Q7JB 5EP4A 4P0TA 3GJ7A 4A2PA 4A0GA 4P32A 5FBWB 5IK2A 3OF5A 1Q3HA 3RANA 1DAGA 4R2IA 4G5SA 3FKSD 2WAYA 3TIFA 4HLUC 3CM0A 3LBIA 4TSFA 2OCYC 4LYAA 1AQUA 1KNQA 3TVTA 3EIQA 3FE2A 3Q5DA 2VHUA 4DCUA 3VKWA 3SR0A 2AK2A 1HQCA 1A82A 1E79A 1R5OA 3SS8A 3EWSA 4G5OA 5B58C 4WXPA 1XMSA 1E94E 2FZLA 3GCGA 3LA6A 4TMWA 4Q47A 3L0OA 1L4YA 4WZBE 4JSTA 1CLUA 4KHZA 5DGXA 3AB3A 4NYIR 1BS1A 5KDDA 1G4UR 1GIAA 3KJHA 1YR8A 4MA4A 5ELXA 3QKRB 1Z3IX 1N6OA 5L3SB 4MRNA 2O0JA 2C9CA 4DVGA 4YMUA 2XXAB 2HEIA 3QKSA 1T3SA 1XZPA 3RC8A 1ZIOA 3LWNA 4C7OA 2CLDX 4OQNA 5FUXA 1CTQA 4PO1A 5TMPA 121PA 2QPOA 2H18A 3AF3A 4BFSA 2PMDA 2AKYA 5DH9A 2QT1A 2ZRAA 4Q02A 1KI9A 2IA5A 4DRZA 1UPTA 3LFUA 2NOAA 4G5RA 3U7FB 3IIKA 1BOFA 1Z08A 2IK8A 1KI6B 4LRWA 4ZO4A 4BLRA 3KQKA 1XCPA 1QHYA 1CS4C 1XCMA 4L4UA 1N6NA 3BFVA 5FOTA 4Y0AA 4B6FA 5TDHA 1LV7A 1F2TB 1ZNWA 1JXMA 1IONA 2MSEB 4JS0A 1P9RA 1AIPA 4V0OA 4KJZA 1XRJA 4Q66C 2F9LA 4AI6A 4KVAA 1T91A 5JHGB 2DFTA 4WAUA 1XJCA 5JI2E 1QHXA 4E22A 4PO9A 5JZVA 1JQLB 2GJ8A 5FBRB 3CONA 2VHQA 2GJSA 5SZJA 2ECKA 4Z8YA 4DLSA 2QUZA 1XD2A 2J1LA 4JL5A 3WNBA 2D4HA 2CNWD 2P6RA 1US8A 5IRCD 5DYIA 3I62A 2GKSA 2J5XA 4ZCLA 5KPDA 1LTQA 3IEUA 1E1RD 1Z22A 3DL0A 2VP9A 1KI8A 2R6FA 3BD9A 3KXLA 4BLPA 3SU8A 4V02A 4A2WA 1Z0IA 3AF0A 3Q7QA 2MMGA 3GLIA 1WP9A 1NVXQ 1JEEA 1P7CA 4U5XA 3K9HA 4TL6A 4KFUA 5CDFA 2UZ3A 4D0GA 1NRJB 2FOLA 5L3SA 1W36C 4DSNA 4LI0A 1OF1A 2CEAA 1DELA 4EPXA 3R8FA 3ECCA 1PUIA 1SVKA 4MGKR 1K8RA 1TMKA 2YOHA 4HUQB 1KNXA 4WVFA 4ESVA 1G20E 1R0XA 5FPTA 5TVKA 3U44A 1TL7C 1OSNA 1EGAA 3OFND 2GJAA 2ZITA 1E9FA 3NEJA 3GLGB 5CM9C 1OE0A 2VSXA 4CW7A 3A58B 1YKSA 4PPNA 3QXHA 1YZKA 3QXSA 1F48A 3AP2A 4CVNA 4TT3A 4GP6A 2VSFA 2KB0A 3BBPA 4G0NA 3U7EB 2RAPA 3VHXA 2WJGA 1G16A 1XMIA 4JKIA 2WIAA 1Z0DA 3D31A 4NCIA 4PANA 2UVQA 2ZRBA 3FKSA 4WIAA 3SI7A 1TF7A 1TQ6A 1OHHD 1R5BA 2W0MA 4RSGA 1CXZA 3REFA 4PQRA 1IM2A 4MYHA 2BIFA 3QI2A 4US2R 3OIWA 4ACAA 2DFLA 5EE1A 3WYGA 2GVDC 4OI1A 4JLVA 421PA 5BN5A 3ICEA 4N0DA 2W6JA 5DLQC 4GI7A 4M1KA 2MMCA 3K09C 3VKGA 3B1XA 4M9XA 3SFVA 4WZ6A 1Z63A 1LF5A 3WY9A 2MSDB 1A5TA 1FOEB 5F3WB 2WWFA 3THYB 4PSKA 3NEYA 2W2TA 4FMCF 3T34A 1SQ5A 2WJYA 2FE4A 3A4LA 4M1YA 3UWOA 1OXSC 4EJSC 4AKIA 1G8FA 5KSOA 5EZ6B 1DAMA 2RGAA 3J81k 3KZ1E 3OEHD 2OO7A 2WTUA 3KKMA 1AA9A 1FNMA 4M53A 4II7A 3DDCA 3RWMB 3EAQA 1W44A 2GAOA 3B13B 2YV5A 2KE5A 3RS4A 1KK0A 3TE6A 1MO6A 1L8QA 5AUNB 3KQLA 1J8YF 3MD0A 4OK6A 5JECA 4V0ME 5JSZA 3I5YA 5G53C 2YWEA 3RNLA 2HXSA 3QQ5A 5FPYA 5L8VA 5BYJA 2OHFA 2LWIA 2BJWA 2HLDA 4I81A 4QRHA 2GESA 1CP2A 1A4RA 5JJKA 4OHZA 1MT0A 4HAWA 3RHFA 2WWXA 3PG5A 1N2CE 2QY9A 4HAZA 3P27A 3NHBA 3ZH9B 5H68A 1RYFA 2ZE7A 1JECA 3BB3A 4TT3D 1YHNA 1CBUA 3MUFA 2CK3D 1Y3AA 3V9PA 4HAXA 2NO6A 2YC4C 3FKQA 1DAFA 3G5UA 1FUUA 1Q3TA 1Q20A 1UBFA 1KK3A 1VDZA 1Q22A 2ZRKA 3FFAA 3TQFA 3LW7A 2WWYA 3RS3A 1I2DA 4Q7KA 5JS7A 4MDFA 3N2IA 1KI1A 4D82A 4HUTA 3QKRA 3IQWA 5FTJA 4CRWB 2HF8A 1KDOA 2EQBA 4KBFA 2AXPA 2W83A 1KO5A 3EASA 3QPVA 4X8LA 3AGQA 1P2TA 4KCGA 2Z6VA 1W0JA 2VH5R 4GMXA 4JL8A 1GZSA 2A5YB 3KUCA 4AYWA 4MGZR 1J2JA 2PT5A 1KMHA 1ZNYA 2YC2C 2C04A 1EX6A 4DLWA 1IJEA 3QNUA 3AVPA 4LGMA 1GL6A 4XSGA 4ARZA 3QXJA 5D3MB 4LHYA 2CVHA 2AD5A 2FX3A 3IILA 4PC3A 1GKIA 3ZGXA 3VNUA 1FNNA 2GF9A 4JIMA 5H1YA 3QEOA 4D0NA 1G9XA 1W7AA 2O8EB 4P4SA 1VCMA 2ZSEA 5JFGA 3PUWA 1E1QD 3Q9LA 4TYWA 1ELOA 4Q5IA 4B3CA 5TV2A 5JHHB 2ERYA 1VHLA 3MCAA 5FUVA 1XB2A 4M1MA 5FOSA 4C4PA 4KYIB 1E3MA 1NJFA 4YLGA 2PZFA 2ZXUA 4EFLA 1K6MA 3U4QB 3U2QA 3B8HA 1IXSB 3CW2A 1R8QA 4IDOA 4W5HA 1XEWY 2F7SA 2BBWA 4B76A 4TTQA 1M1YE 1NBMA 1C1YA 5SZHB 5EE0A 4LUCA 1XF9A 1DO2A 1DTSA 3ADBA 4JT2A 1E2PA 1B0UA 5LB2A 4DDVA 3VR4A 4O2RA 4FWTA 1H65A 2J9RA 1FZQA 1KO4A 3THXB 1UJ2A 1UKYA 4Q1EA 5FL7A 4M8NE 3SC3A 4PQYA 5KSYA 3DHWC 2Q9CA 1IJFA 3WBKA 1GL7A 1ZCAA 3K0FB 3AH8A 4R71A 3EPKA 2YVUA 4GSYA 1OIWA 1ETUA 1G7CA 1WRBA 4F7WA 2F6RA 1WDTA 1DO0A 3P4YA 1YJ5A 1BYUA 1OPXA 1EFUA 2R62A 2Z4SA 4Q7LA 3A1SA 3B2EA 3CX8A 4EJSA 1CRPA 1KJWA 4Q4HA 2B8WA 3QKTA 1IOZA 4URVR 1U2RA 1WE2A 4QFMA 4DUGA 4HLCA 2RGBA 1MABA 2Z5FA 1DPFA 621PA 2Q6TA 4JT4A 1XXHE 3LQRA 4BASA 2EFHB 3BB1A 4UNSA 5FTMA 5KSPA 1RRGA 4J0QA 3I4LA 4YMTA 1MH1A 3Q72A 3GJ0A 1WQ1R 3THYA 4M9QA 4OQLA 4KFRA 2J0UB 1FMJA 3A1TA 4EKDA 3GLFA 3RS7A 2WMOB 4MYUA 3T5DA 3AKYA 3DOEA 3GLHE 1E2FA 2JLYA 1FL9A 2PCLA 1VYVA 3FVQA 4ILEA 2WJVA 4FIDA 1HYQA 2IWHA 4I4LA 1OFIA 3GJ5A 3DM5A 4XIGS 3DMNA 3D6TB 1HY3A 2ZS7A 4OQXA 3QENA 2IS1A 1GL9B 1ZD1A 4IRUB 1YU9A 4BZXA 2H57A 4TLAA 1GDDA 3WMEA 2GCNA 3OIYA 3RS2A 1LY1A 1GSIA 1OV4A 1RZ3A 4HATA 4LBVA 4M4SA 2OG2A 2ZYVX 2WKRA 3B1YA 4FMDB 4NMMA 2V7QD 4Q9IA 1TTTA 1FQJA 1II9A 4PHFA 3JZMA 4EQ6B 5LBIA 1Z6YA 5CYOA 2BEJA 1G6HA 1E6CA 1Z28A 2XB4A 3O8DA 1XMJA 4JL6A 3DEFA 1ZC3A 2HLDD 2X77A 3S1AA 1DBSA 4YMSA 2A9KA 2JJ1D 2D7CA 2GCOB 2PEZA 2OLKA 2XGJA 1KZGB 2ZVPX 1NN3A 2WWIA 5B2ZA 2NTYC 4A8JC 1SHZA 1TPZA 2JLUA 1I4LD 3BE4A 2HYIC 2WWWA 1GM5A 3GFPA 1QHNA 3KL4A 3WHLA 1VPLA 4O25A 2FU5C 3FPAA 2OBNA 2G1JA 1V5WA 3AKEA 2EFEB 5KDOA 2Q3MA 4UQOA 3TW8B 4W5WA 1VHTA 4HLUA 4OKSA 1MRNA 5JI3E 5GJVC 4C0KA 4AWXA 2EW1A 2H8KA 3ZVNA 3AVVA 4A6XA 3HYRA 4XH9B 5B57C 5IK2D 2R6AA 2Z83A 2A7QA 3AVWA 5G3ZA 3VTKA 3VQTA 4TQAA 2OE2A 1G291 5IF9A 2HF9A 3CZPA 2IS6A 4JVMA 2FEMA 4D25A 3RSOA 1GNPA 2W2XA 5AJYA 4Q4JB 2EYQA 2R6DA 1DEKA 3W5JA 1SKYB 1RRCA 5JWHA 2NO7A 4LV6A 4Q9LA 2BEKA 1QHIA 3KB2A 1KSGA 2W58A 4ACBA 4LHXA 2IYSA 4FMBB 4B48A 4ITRC 3NXSA 4KLNA 4PXAA 5SZIA 5AUPB 2V1UA 2F3RA 2FSFA 2GXUA 1HT1E 5AR1A 5KOYA 1E2LA 1U99A 2A5DA 3AP3A 2WSSA 2FSGA 3A1VA 1TF5A 4DT1A 1W2HA 2RGGA 1KYIA 1Q0UA 1KDRA 2ZJZA 3EZFA 4IVQA 3TBKA 1KI6A 3NDPA 1U8YA 3TR0A 3U7GA 2ZSAA 5DYGA 5F9FA 4UXHA 1F5NA 4W9MC 5KU1A 1FFHA 2O52A 4FWIB 2ZYUX 3REGA 1F2TA 3FHCB 3I1FA 4L15A 1GRRA 4PFSA 3UWKA 5AJVB 1I4TD 2RGNA 2BMDA 4C30A 2VYFA 3EZ2A 1KK2A 2IUTA 2XSZD 5KDLA 4F4IA 5LD2B 4LY6A 4NYMQ 4A36A 4UNNA 3NH9A 3ZD6A 4RKFA 3X1WA 1KMHB 4IXNA 2W00A 3RVBA 5GJCA 2FA9A 4ARZB 4M22A 3CR8A 2ZRDA 3LAWA 1E2QA 1SVIA 2QQEA 3C4JA 1ZYUA 3BB4A 4PPFA 4DSOA 1KK1A 1Q44A 3AVXA 2P5TB 2CK3A 4D4LA 4XJXA 4AG5A 4D4KA 5DI3A 4NYJR 1IN8A 5FOUA 5FPHA 1AQYA 2QE7A 3LH5A 2GK7A 2G77B 4F92B 4RZ3A 2JASA 1E0JA 1G8PA 1UM8A 1UBGA 2GCOA 3MAAC 1NJGA 1N25A 2BBTA 4C2TA 1DAKA 5E7MA 4HAVA 1IN4A 4QGHA 1FQKA 1ZBDA 2VLIA 4PO8A 3W6NA 2B6HA 1DAIA 2JLRA 4TYPA 1GUAA 1JR3E 5L3VA 2FSHA 5TXGA 3OE7D 3FDIA 1U0JA 4NCHA 4CEHA 5CLQA 3K1JA 3SBDA 2PMKA 1MRSA 1TEVA 3PUVA 3I73A 1MO4A 2Q3FA 4I1SA 2D2FA 2B7CA 3L8ZA 3EA0A 3TMKA 4LHVA 4AC9A 4C0QC 2V55B 2ODNA 1W2GA 2B21A 1UKVY 1JXOA 2O8FB 4BFXA 3ZVLA 1X6VA 1YZQA 3BORA 1NMYA 5CJPA 4QJ4A 3FYHA 4M2LA 2KBEA 2VP2A 1G4AE 821PA 5FPKA 1NF3A 4QG7A 2F43A 3W34A 1II0A 1VG8A 2LCFA 2ASEA 2CE7A 4LZZA 3RABA 1PJRA 4JLJA 4DXAA 1KI4A 3A8TA 1R0ZA 2ZVQX 3C41J 2R6GA 3A1UA 3QY0A 3U61B 3PQCA 1OFUX 1CEEA 1U81A 4QGAA 5JRJA 3ICQB 1ANKA 3U3OA 1WB9A 2X19A 3W3ZB 1G5RA 4R2HA 4KU4A 1VECA 4Z1MD 2AL7A 1KHTA 2OESA 4RZXA 2XEXA 1U8ZA 4IOMA 4R98A 2V1XA 4LYFA 3TSZA 5JMTA 3SQXA 2QAGA 1Z07A 2IYYA 1NNEA 3ASYA 1BKDR 3KKNA 4P33A 2WPDD 1RRPA 3FOZA 3VU9B 1OW3B 2CHVA 2QGZA 2RGEA 3R9WA 2J0QA 3SZRA 4D26A 5J4KA 4QHTA 2F55A 4US0R 2JJ8A 2JEOA 5BQ5A 4NZYA 4UNRA 4JVSB 1U9IC 1W49A 1OHHA 2BC9A 4K81B 1ZM7A 3B78A 2HXYA 1EFCA 1QVRA 2BM1A 4OHVA 4V0MA 2JLXA 1J70A 3U7HB 1IN7A 2QAGC 3H0KA 4DIDA 1HUQA 1E2MA 4D81A 4IDNA 4BRUA 2HYDA 3O8RA 4Q4JA 1YR7A 3SJBA 4LJ4A 5CB8A 1JPJA 5TY0A 1AM4D 3RRMA 5DN6D 5K8LA 4AYXA 3CPJB 3HP1A 1UEIA 3K0EA 1XTSA 3IKJA 3LRPA 3CRQA 1WF3A 5FBLB 1JR6A 2ZEJA 2IHBA 3PXGA 5CIQA 2J7KA 2HJVA 5FH9A 1T3LA 3AVOA 4JBYA 1AS3A 3L82B 2E1RA 1TUEA 4U00A 4XVRA 1CR0A 1KDPA 1JR3D 1M7HA 1PZNA 3TW4A 3K0AA 1GOTA 3BC1A 1KOFA 4LPKA 4Q19A 3X1ZA 2XXAA 2JLSA 4RD3A 4L9WA 4Q48A 2CL6X 2ZJOA 5J4HA 3EZ7A 4LBZA 2CL7X 4GT1A 4A0RA 2FMXA 2ZIAA 4Z54A 1SVMA 3NKVA 4TL9A 5FTKA 4ZIRB 3I92A 1RE0A 3KKPA 4H1UA 4OI4A 1W48A 4M1OA 4NCJA 1G1MA 4PTLA 2YZ2A 4OJQA 1N5JA 4WBSA 1BYIA 3MLEA 2P0EA 2P6NA 2ZRJA 3WYFA 3PFIA 3THOA 4B35A 3UPUA 5GVSA 2JLWA 4Q4AB 1JI0A 1US8B 5HE9A 1TAGA 3CBQA 2ZRPA 1AJEA 4MH0R 2GNOA 2WAXA 3H4MA 1XEXB 2X8AA 4ASUA 1PLLA 5A4JA 4GDFA 2W2VA 4EAQA 4QGGA 3PEWA 3EIHA 3KQUA 3B7GA 3NG1A 3MRSA 4R7ZA 3L2OB 3FMIA 2F9MA 2XZOA 2ZS8A 4PC7A 4TYQA 2ZAOA 2D7DA 5KHOC 4YDHB 1W0JD 3BH0A 3HPRA 3KFVA 1I4DD 1NI3A 2OEPA 6Q21A 4GOXA 2ZI9A 1BMFA 1M7BA 2LKDA 2DWQA 1OIVA 1NLYA 1T5LA 4PC1A 3MWYW 4NH0A 2C96A 1N6RA 2P2LA 5AUQA 5BXQC 4B47A 3O8CA 1KKLA 4CYMA 3W6PA 3IPYA 3R8CA 3QF4A 4RCYA 2QAGB 3TKLA 1ZUHA 3FB4A 5GJWC 4LC0A 4A0FA 4HYYA 2NGRA 1R0WA 3CH5A 4BLOA 4JVLA 1LF0A 2JGNA 2QQ0A 3MWJA 3LBHA 4TWZA 4DHEA 4BFVA 2ZANA 3CRW1 1G7TA 2V6IA 3KJEA 3TR5A 3MJHA 4XWKA 1LNZA 3HU3A 1W1WA 1W0KA 3CRVA 2CCKA 4ZDWA 4FD2A 5DHAA 2AN9A 3C15C 1Q21A 2NIPA 3VR3A 1OH5A 2FDCA 3VR1A 3QXCA 4DLXA 5HCIA 2F1RA 3UMRA 4B33A 2WM9B 1VIYA 4F4CA 1W5SA 4YQFA 1C4OA 5SZKB 3TK1A 2WPDA 1IY0A 4IXMA 4IDQA 4GZLA 1P2VA 4X8OA 2DY1A 1NLFA 2NG1A 4QJ5A 5JLJA 1YRAA 2FPMA 2XNDA 4JLAA 4V0KA 2GRJA 4IOLA 3W90A 4CF7A 2QI9C 3ZIAA 3U60B 2VP0A 1HT2E 4KVGA 1G8YA 2XNDD 1G7RA 4IVPA 3VAAA 3TUIC 2JLZA 4LCBA 3D7MA 3Q3JB 4LYHA 1KAOA 1S1CA 4L5BA 1S1MA 1S3GA 1P5ZB 3ADDA 1P60A 5KNDA 1MO5A 3IQXA 1GRQA 1RRFA 2ZAMA 4TLCA 3H84A 1N6IA 2B8TA 2YOFA 5BN3A 1JNYA 4TN1A 4B34A 4QC2A 5KO2A 1CR1A 4TLDA 1AZSC 4PZZA 3F5FA 2PLFA 2QTFA 3KQNA 2VP4A 1IN6A 4NU0A 2XX3A 4EUNA 4IOKA 1VIAA 1SXJB 1W36B 2BBSA 2J7PD 2FH5B 4DB4A 1S2MA 2BJVA 2EU8A 1UF9A 5AJXA 3K9NA 4ZDKA 1S3SA 2GDJA 1Q1ZA 2P5SA 3CRRA 3GQBA 4BECA 4JZKA 3BWDD 2HUPA 2J3EA 3O8BA 2FFQA 5DSZA 4QHYA 4DSUA 5LDDC 3MG9A 2R65A 3SE0A 4DLZA 4JYBA 1ZMXA 4QBFA 1EFHA 4JBWA 4EPWA 1AKYA 1LS1A 4NCKA 1E2DA 3HYTA 4EIWA 1PLJA 2ZI6A 3DOFA 4LJ5A 3VKHA 4ZPXA 1OT3A 3HJNA 1KY2A 1TU4A 4GNKA 4UJ5A 2XAUA 1YZGA 1SVLA 3VFDA 5KNBA 3KKQA 1HA3A 3EZ9A 2WHXA 5AWFC 3T1OA 2BMEA 2NO9A 3BJIC 2TMKA 2V8OA 1E9AA 2QBYA 1EWQA 2JJ1A 2IT1A 1MO3A 2OFOA 4JKYA 4OHYA 2ZI5A 2EFDB 3CB4A 5EE9A 221PA 3ZLJA 2QTHA 4DLRA 2XSZA 3THWB 4JLDA 1NIJA 4KLZA 4ASUD 4DB2A 3MGCA 1FP7A 3WRYC 2AX4A 3AVYA 2YJTD 1II8A 2CL0X 3IHLA 2V7QA 3TVDA 3WP0A 3DKPA 3UIEA 3RS0A 3OESA 4Q21A 5GADl 1FP6A 2C98A 1G3UA 2BKEA 2WJJA 3NC0C 2JDIA 2VF7A 4BFYA 5FR2A 1NKSA 2IW3A 4L9SA 4XWAA 4PAQA 4GMDA 4JJZA 1W46A 2IYWA 2VEDA 1OFHA 4D6PA 2GK6A 1G8GA 1U9IA 4KBGA 1OXUA 5G41A 1EFRA 5KYKA 2ODBA 2ZU0C 4FW9A 3KTAA 5IHPA 2QEQA 4LJ7A 3TAUA 4ZKEA 2VPPA 2ZJ5A 1G17A 2P3SA 2QTVB 4MRSA 2UZIR 1SVWA 4G5QA 4TMXA 3T35A 4NYMR 4ZCIA 2BCGY 4NE2A 3K09A 1X3SA 4C3ZA 2FZ4A 1T4GA 5E4FA 4C0LA 1UEJA 2DFKB 1SXJA 1VCNA 2H1LA 1E0KA 4LBWA 2RGNC 3GEEA 1KY3A 1YZLA 2QM7A 4JLKA 4DCNA 5EP1A 1YR6A 2F1HA 4URXR 4O0MA 4MGYR 2GWHA 4RFSB 3FHTA 1XX6A 3FMOB 3IUYA 1P62B 1AGPA 1Z6TA 4XTRA 3OZXA 1KO8A 1N6PA 3CWZA 3OEHA 2AD1A 5LB4A 3BH7A 1M34E 2W6ID 521PA 2B7BA 1DG1G 2QSYA 2Q9AA 4GPTA 3WXMA 1W5TA 2R8RA 1HH4A 4U7DA 1F2UA 4LJAA 3AVUA 1X8LA 3K0SA 3TLXA 2O8EA 2IS4A 2ZRHA 1XPUA 4A4DA 3FWYA 2IX3A 4XVQA 2VBCA 3FFBA 2WOOA 2WSMA 3C14C 3B85A 2IHYA 4QM6A 4Q1CA 1NVVR 4AK9A 1TADA 1YRBA 4B2LA 3WMGA 1EFRD 1P61B 2ZJYA 1ZUIA 4YMWA 3L0SA 2NZJA 2GEDA 3NH6A 2RGCA 2J87A 2QP4A 5J5CA 3JVUA 2GCPA 4DEYA 4IW3B 4IHQA 3LLUA 2F3TA 2O8BA 1AKEA 5FR1A 1XFAA 3ZQ6A 3O47A 4Q18A 4RKEA 3GLHB 4OYHA 5H8WA 3SYLA 3TQCA 1ODFA 1F3OA 2FN4A 2SHKA 1G3IA 3VR5A 4KITB 1NBME 4DCVA 3Q5EA 2GXQA 1VG1A 4M0LA 3DO6A 4OJKA 3LV8A 1NL3A 4URUR 2JJ2A 3M1IA 3VX4A 4LWZA 2AK3A 4H1VA 5JJLA 2FWRA 3OAAA 2A3RA 4EFMA 2LKCA 2QRNA 1EX7A 2Q21A 4G5GA 3EPLA 3GJ4A 3TNFA 4Z8XA 4URZR 1T3HA 4BZQA 4NHOA 1G8HA 4B3DA 3GPLA 1D9XA 4WOPA 2DFNA 1FW6A 1CR2A 1VKJA 2OSBA 1RKBA 1OH8A 1PVOA 4AKEA 3ONWA 2QMUA 1XD2B 2ZUCA 3PIRA 1YZTA 1BH2A 2JLQA 1SZPA 4P4TA 5FFMA 1SKYE 3HU1A 2VA8A 1OFTA 4Q9KA 2D3WA 4KSCA 2QRZA 3LW8A 2XZLA 1RJ9B 4CZ2A 2YHSA 1UDWA 2G83A 2QNRA 1JBKA 3QKUA 3M4YA 4LHWA 2RHDA 3KB1A 4NPHA 3Q8XB 2CNWA 3W6OA 4B44A 2JCSA 3NWJA 1GITA 4RD1A 2FSIA 5HPYB 2IXGA 2OCPA 2VO1A 3R7WA 3QPWA 3F0TA 5IDVA 4B75A 2J59A 2CE2X 3B1ZA 2J7PA 2QE7D 4CEIA 5CJ2A 2RHMA 3VNVA 4YMVA 2FGKA 4C0JA 1GP2A 1G3MA 4MYCA 1E79D 1E2HA 4DDWA 1ZU4A 2IBMA 2ZI4A 4OBEA 5EUMA 4QOSA 4DWJA 2N46A 5J40A 4W7SA 5H70A 4RFVA 4ZIRA 2R2AA 3CX6A 3RYTC 4ZKDA 4A1FA 3ZZ0A 4IEEA 4MYTA 1Z83A 4IOJA 1Z6AA 4UJ3A 3A4NA 2OFXA 1N5IA 2FFHA 2GHIA 1CJKC 2D06A 2ZRLA 1U90A 2N42A 1ESNA 4GZMA 2AHOA 5BYKA 4PZYA 1ZVQA 4RD6A 2I4IA 4I1OA 4ESHA 2DCUA 4FMCB 4BFUA 4HB2A 3MSXA 4AYTA 2ZETA 3KUDA 2NQ2C 4PQFA 2CBZA 1MR3F 2PJZA 1QZXA 2XJ4A 3IHWA 4JLNA 5DHFA 3WRXC 2GBLC 4ZCMA 3ZVRA 2QA5A 2FNAA 3H1TA 3SEAA 1J7KA 1Q1EA 2GZAA 3TSWA 3EX7C 3L43A 1P73A 1HURA 4Q4AA 2GILA 3QBTA 1HTWA 2Y8EA 4KFTA 1XP8A 3A6PC 1W47A 3EZ6A 1FTSA 3SYKA 4DBLC 2GJKA 1DG3A 2IEZA 3PENA 3AVTA 4OHWA 1RPZA 1UAAA 3TRFA 2QMEA 4TZ0A 1KIMA 1RIFA 1AS2A 2KJQA 3CZQA 4YDSA 2C8VA 3LXRA 1ZM4A 1NSTA 4V0LA 2PJRA 1E0AA 4HZUB 4QNMA 1R7RA 2BDTA 3OE7A 4TMZA 3SJCA 2O8BB 1QRAA 5B30A 4TYNA 3FMFA 1FX0B 3CF6R 4RCZA 3GJXC 4GBMA 1N0VC 2ZRFA 2GETA 2UKDA 2PBRA 2R9VA 3RAPR 4CEIB 1KTVA 1F60A 1U98A 4PHHA 1LFDB 2Q9BA 1WA5A 1E4YA 2CJWB 1NVUQ 2XNSA 4A2QA 3PUZA 3I5XA 2A30A 2PX3A 3LQQA 4TTPA 3ZZUA 4DCTA 4MRRA 4PR0A 1QF9A 3MWKA 3T06B 1F6BA 2IEYA 4QHSA 2AXNA 1VG0B 5FUYA 2IF2A 3OIUA 1H8ED 2DR3A 1VCIA 3IIJA 1M74A 4ZV4A 3T15A 2AWOA 1A7JA 1Z47A 4Q9JA 3NHAA 4BFZA 4PX9A 2QMOA 2Z43A 3D8BA 2BM0A 2RGXA 1WMSA 4PZLA 1NG9A 1F2UB 5FTLA 2VP6A 3C7KA 2I1QA 3T12A 1FUKA 3CX7A 4A0HA 4BLSA 1CJTC 4F38A 4IFBA 3U44B 1G64A 1ZCBA 1N5KA 2GEVA 3PVSA 4FCVA 4B3BA 4N0EA 3P32A 3ZS9A 2H5EA 1E0SA 3EPHA 4S2EA 3VU9A 3SYNA 5F9HA 1U0HC 4OL0A 2GVZC 3DKVA 4CEHB 2YNMA 2ONJA 4PPQA 2W0SA 1AN0A 3P1JA 3AM1A 1XDBA 4G1UC 3CWQA 4F4JA 1XTKA 4BRWA 5AUOB 1E2JA 5HE8A 3T1VA 1E69A 5EXSA 4E07A 5EUQB 4EPYA 2HT6A 1E96A 3DMDA 3NBZC 1DADA 1W4BA 1XCGB 2ZYTX 1Z5ZA 2KI5A 4LHZA 1X1SA 1EK0A 1RC8A 1NKTA 5E3HA 3GMTA 4CT4B 3LO5A 1KAGA 1ZC4A 4NCNA 3PUXA 3E5HA 5A5GA 1XU4A 2WICA 2EYUA 3PEUA 4PPGA 4FINA 1GTVA 1E9DA 1OYWA 4N1AA 4B3XA 3U6KA 1L2TA 4UXIA 3AV0B 1NLZA 1XTRA 3TUJC 1E2IA 3GLIE 4LJ8A 4WA7A 3QF7A 2QG6A 2QL6A 4Y0VA 2GF0A 1P72A 4FCTA 4GL2A 4FXPA 1W0KD 3AKCA 1U8AA 2RMKA 2GZHA 2V4ZA 4W5JA 4JLPA 3NIBA 1ZRHA 3SDZA 1U94A 4PSAA 5KNCA 3X1XA 5L3RA 1X8KA 1JJVA 1NY6A 3N5CA 2YYZA 4RJLA 1T9HA 2FV8A 1UDXA 3GLGA 4PSVA 2ZE8A 3T1QA 4OQMA 1KSJA 2QPAA 4G3XA 1SKQA 1XPOA 4O2LA 1N0WA 2XTMA 1JEDA 4A8JA 2YOGA 3HWSA 1TU3A 3QPUA 3CF2A 1KKMA 3GEIA 1KJZA 1OLOA 3IBYA 1P3JA 4RZUA 4XSHA 5FBVB 1D8TA 3B9PA 4BLQA 3NC1C 3R7WB 2R6CA 5DNYB 2IS2A 3R20A 2IYXA 1GRNA 1N3BA 2QAJA 1EXMA 4NYJQ 3MWLA 1AK2A 1XXHB 5FL3A 3UANA 4CIDA 4XTCS 2DWOA 1G5TA 1XD9A 4JMPA 1GWNA 2O8DB 3IPXA 3WMFA 5BW8A 2ZM5A 4E09A 1IAQA 3P20A 4A82A 5AK0A 2BCJQ 4X8HA 3GLIB 4LJ6A 5JWOA 4HSEA 2JA1A 4B43A 2J0SA 2NPFA 4DZZA 2QORA 4HDQB 4QBIA 2G0TA 4GP7A 1YZNA 4KV9A 1PUJA 1G5PA 2FPLA 1P9NA 1KSFX 1H8HA 3BH6A 3IDQA 3KFXA 2ODEA 1ZUNB 2WJIA 1JAHA 5BWMA 5EXTA 3AGPA 1R2QA 2ZJAA 3CPHA 3A4MA 3OEEA 4LX0A 1P75A 1T8UA 2FPKA 1LB1B 2IUSA 2CMKA 1OH7A 1KI2A 4KODA 3F8TA 1S4QA 3SHWA 4A92A 5FOXA 2C77A 2WZQA 1E9SA 1MV5A 5FI0B 3A37A 2GZDA 1G19A 1P2UA 3A1WA 4C0SA 4ZDJA 5E7IA 2ZRIA 3DPUA 4WZAE 4E03A 3FTQA 2J45A 2ZR7A 4LYJA 3AVQA 5EXXA 1CR4A 1GVNB 1L4UA 4OQFA 2QT0A 2O8CB 4C0BA 5J47A 4A9AA 1DE0A 4RY2A 4NKRA 1TQ2A 4KSBA 4LDJA 2O5VA 1AGRA 3SQWA 2F1JA 2DHRA 1W4AA 4URWR 1P2SA 1Z2CA 2JDID 3DZ8A 4RVCA 5P21A 2WJHA 5ANRB 3EC1A 1P4SA 3CRMA 2YWFA 1OYYA 2C03A 3X1DA 4E5UA 3E70C 3HU2A 3OFNA 3NBYC 2O8DA 3WNDA 3KXIA 3QVUA 2ZUDA 2YWGA 1KI3A 4XD7A 2OM2A 1Z06A 5HR5A 3I61A 3C16C 4Q1BA 4C2UA 1GAJA 4RZ2A 2ODWA 2ZUBA 2CLCX 3T1TA 3ZYCA 4Z51A 4NTZA 1RW4A 4NYIQ 1FTNA 3SJZA 2XJ9A 3LX8A 4Q01A 4D80A 3OAAD 3KJIA 3VX3A 1A1VA 1T5IA 3ADCA 2PZGA 1NN1A 2QM8A 2J41A 5B64A 1KSHA 4DLVA 5CK5A 1QVAA 5J4VA 3LLMA 2VHTA 3I8SA 2D74A 4OI2A 4UNQA 5IT5A 1KJYA 2ORVA 2WBLC 3GD7A 3UMSA 1NG1A 4NDZA 4HDCA 3CNLA 1Z6XA 1CJUC 2O0HA 4B3FX 3KJGA 1XD8A 4AURA 2XITA 4KXFB 1D2EA 3ZIAD 3BAFA 3PCRB 5DO9A 1X1RA 2HV8A 1E32A 2WKPA 4P4UA 4I1UA 3BGWA 4BEJA 1QHHB 1Z0FA 3D3QA 2DBYA 2FGJA 3TAHA 1XJQA 4ERNA 1XTIA 4FI3C 5KTYA 2CVFA 3F3YA 3RRZA 4IJMA 1ONBA 3QUSA 2ZI3A 4UNPA 3GLFE 3AEZA 1S0UA 2IYRA 3WNCA 1S9DA 1Z29A 2OFWA 3CO5A 1CIPA 2V6JA 1DVRA 1UFQA 1Y63A 1XXHA 4KYUA 2FF7A 3K70C 3NBXX 2VIIA 3PV0A 4TSFD 4MRPA 4GOJA 2L0XA 1NBMD 4XWOA 1OB2A 1EESA 2ZRCA 4Q9HA 1QHSA 1SHKA 1O87A 2H16A 2QU8A 3QJYA 3K9GA 3K0CC 2OXCA 5JCPA 1Z6GA 4DT1B 1D6JA 1Z0KA 3CNNA 5HCNA 4Q4LA 1ZU5A 2ZE5A 4ON9A 3IEVA 5M04A 1E98A 4B6EA 1IXRC 2G0NA 5K8IA 1DAHA 2V9PA 1E1QA 2F1IA 3U3KA 2A5FA 2NO0A 3C5CA 3I32A 2PLRA 4S35A 1N6LA 2PZEA 3V4RA 3WHKA 1BIFA 2GXSA 1IY2A 2A5GA 3EW9A 2DWPA 3A36A 5FTNA 2FEOA 1SXJE 2X2EA 3CIOA 3LY5A 1YVDA 2VSOA 3GLFB 5HKKD 5C18A 3GP8A 4LBYA 5L3QB 3CUEF 3PEVA 1E99A 2OLJA 3RDPA 3WP1B 1IY1A 4MUBA 3UG7A 3ASZA 4V03A 4ZI2A 4TMKA 5C2JB 4JLMA 3Q85A 1GNRA 4QL3A 1E4VA 4LC1A 2V3CC 4MKIA 5E95A 4ABYA 3EG5A 1NMZA 2BOVA 1XZQA 3U3JA 3TJZA 4JVNA 2AFIE 3DM9B 4D4JA 3VR6A 1COWD 1TEXA 3LDAA 2IYTA 2J46A 4KFSA 1K5GA 2A2ZA 4B32A 1XJ0A 4QGFA 3MFYA 4FMDF 3K53A 1NP6A 2A5JA 3LBNA 1SVSA 4AIIA 2ZPTX 2ZRMA 1JAIA 3GFTA 3NDBB 1N0UA 3SN6A 1NN5A 2WWHA 3UMFA 2H7VA 2ZROA 1HV8A 3K70D 1KZ7B 1X8JA 3QG5A 4PC2A 4YXWA 1I2MA 1YR9A 3BERA 8OHMA 1ZINA 4MUAA 1WBBA 3KDSE 1HE1C 3CF0A 3ZQJA 3IO5A 5EZ5A 5JJIA 4IKEA 2WWGA 1XEFA 4NBSA 4YONB 2BMJA 1E9EA 4DDUA 1TUIA 2FFAA 4YXWD 3CR7A 5CYPA 2IYLD 5FL7D 2D62A 1UBCA 2ZS9A 1GFIA 4HB0A 2IXEA 2YWHA 1D2NA 5CK4A 3WBJA 4EPTA 1GILA 1ZAKA 4BFTA 4FN5A 5DN6A 3EXAA 3PJRA 1OXVA 2OILA 3UK6A 3V4FA 1D9ZA 1H8HD 1ZD9A 2BWJA 3U5ZB 3X1YA 2GXAA 4BWYA 4HAUA 5D3MA 5CLLA 1MKYA 3KTAB 1ZW6A 4LJYA 2ORIA 5JSZB 1KI7A 4RD2A 4M9ZA 3AF4A 2PH1A 3UXMA 1G18A 3NTUA 4Q00A 2RCNA 1Q1BA 2WKQA 1XPRA 2X2FA 2B92A 3TUZC 2JIZD 2HDNB 2RB4A 2ANBA 4MKGA 4BPBA 4BQSA 4HZIA 4URYR 4BZPA 3R9XA 3GEHA 5AJZA 2DB3A 4F91B 1UBEA 2DPXA 4DIEA 4AKHA 5GVRA 1G6OA 3KXKA 2OZEA 4H9GA 4TMTA 3ZDQA 2HJGA 5CB6A 3TH5A 1II8B 2KWIA 2ZU6A 4DKXA 3Q7PA 3AUXA 4WXRA 4B3GA 1M6NA 3B9QA 3GLGE 1XMVA 3JVVA 1XBTA 1ZNZA 2A78A 2QGNA 1XTQA 4JYCA 3HDTA 2VP5A 1CJMA 1QHGA 2I1VB 4JBXA 2JIZA 4D0LB 3THXA 4Q1DA 1RJ9A 2QMHA 2RH5A 4DLUA 4NONA 3U6BA 2C9YA 3QSYA 1NSFA 4MITA 4AD8A 4DC9A 1J99A 2O0KA 3EWAA 4EDHA 5KUTA 2RKOA 2C99A 5G40A 3SOPA 1S8FA 3W9YA 2WIBA 2XOKD 2AKAB 5DIFA 1YZUA 1GKUB 5C4GB 2HT1A 2ZJ8A 2V54A 4P3YA 5L3QA 2Q3HA 4KI0A 1OXTA 3BXZA 3U3MA 1N6HA 1XNJA 5D3QA 1R4AA 4DUGD 3M6AA 5FPSA 2P67A 1H8EA 3SFZA 1G41A 2QN6A 4CDGA 5J4LA 2BMFA 1ZM9A 3W5IA 5EP3A 1R0YA 2GTPA 1Q57A 1E2GA 3QXXA 3BK7A 3SBEA 4DDTA 3DZDA 3N2EA 1V43A 4QKQA 3IBGA 4Q1AA 1AZTA 1E1RA 3KKOA 1T8TA 4MKFA 4P31A 2Z0MA 3N70A 2CJWA 5C1BA 4O3MA 1CJVC 3RLFA 1IN5A 3BIFA 3M0EA 1HQYE 1ZM3A 2CDNA 2G1KA 4IVRA 4Q03A 4RD0A 2NO1A 3H2YA 4BFWA 3K70B 4CGZA 4RD4A 2PX0A 1DOAA 1NVWQ 4TYYA 1VCOA 5CDFE 5FOVA 3B6EA 3ETLA 3BS4A 5CM8B 3TGPA 2HCJB 3PR1A 4JLBA 2VHJA 1SGWA 3K0FA 1NIPA 3KQHA 3K8YA 1UKZA 3CH4B 3ND9A 4CEJB 2C9OA 4PHGA 3T5GA 4BEBA 2IXFA 3GFOA 2ZR9A 3PUYA 1IXZA 1R5NA 4Q1FA 4A15A 1LS6A 3I8XA 1JB1A 2FFBA 3LX5A 4L8GA 1SVOA 3UG6A 4LV5B 5F2EA 1KO7A 1BMFD 1J90A 1R8SA 2DYKA 4LJ9A 4M1WA 3RRYA 1E2KA 3OIVA 1E2EA 1YE8A 2ZE6A 4JSYA 4NP6A 4V0NA 4QJ3A 2O8FA 2OUKA 1ESMA 4Z1MA 2GEUA 4DLTA 4HLQB 2ONKA 3VMFA 2IF0A 3PEYA 2G9NA 4PC6A 3W8RA 2JATA 2PL3A 3BFKA 3FMPB 3THWA 2WSSD 3ZD7A 4IFEA 2IYQA 1LW7A 5UKDA 4TL8A 3K0CA 3B82A 3QE0A 4HLDA 1EFTA 3H86A 4B2PA 4GFDA 4HI0E 4TQ9A 1XEXA 4XD7D 4KO8A 3ZS8A 2W6IA 1FX0A 1G21E 4US1R 4Q7MB 1SULA 1C9KA 2E9SA 4BE7B 1ZD8A 2VL7A 5JRZA 1G7SA 2OV2A 1E2NA 5HZHA 2AR7A 1B23P 1NVVQ 1NN0A 1VMAA 5J4YA 1A2BA 1MOZA 4A6PA 3U3RA 4QNRA 1NY5A 1OJLA 4IDHA 2BV3A 2RGDA 3K9LA 3K0AB 4TL7A 4EPVA 2Q0HA 1U0LA 4PAOA 2NZ8A 5EP2A 1WCV1 3EIEA 4U02A 1CRQA 4LV8B 5C4MA 5HKKA 3ZVMA 1GG2A 3X2SA 2O8CA 2BHRA 4PAMA 5GJBA 5JEEA 5JS8A 3LNCA 3CNOA 3T61A 3PITA 4DCSA 3BRWD 4OK3A 1JQJC 1HE8B 3KX2A 3CKLA 3I3SR 3OHMA 4GOKA 2OT3B 2EWVA 2ATVA 3B1WA 4HAYA 2C78A 4MKHA 4RFSA 2H17A 1FPMA 5E7JA 4EQ6A 2ZRNA 2CHQA 4LPSA 1M2OB 4HDOB 2QBYB 3NBFA 5JCZA 3GJ6A 2IYUA 1XWIA 3B60A 4XVUA 2VF8A 3B5JA 1EG7A 4AG6A 2K5UA 4TLEA 4EFNA 1OH6A 1ZIPA 2GJ9A 2R44A 2ZRGA 3L0PA 4M1SA 3IIMA 3MJRA 3LXXA 3E2IA 3SJAA 1QBKC 1CF4A 2G88A 5CIWA 3G0HA 2OAP1 2WV9A 3U4QA 5C46F 2REXB 3VR2A 5KPJA 1JPNA 2ZSFA 5DI3B 3G82C 2VHCA 4HB4A 2QP3A 2IYVA 1S9HA 4BLTA 1NMXA 2JAQA 4DSTA 3L8YA 2W6JD 4CT5A 1QDEA 5JEDA 4HUQA 5FUWA 3LVQE 4K46A 4B71A 1M7GA 1UADA 1X86B 2P65A 1HEIA 1T0JB 2XTZA 1W4CA 3AF1A 1R6BX 4QBHA 3P26A 1M8PA 1ZJ6A 2VTKA 4M1TA 1CU1A 2EFCB 2REOA 1RYHA 1D5CA 2GA8A 2QSZA 2OBLA 3HPQA 4K8OA 1TQ4A 2ANCA 1WBDA 1E9CA 4JJKA 4LK2A 4D4MA 2ORWA 3C5HA 3UKDA 5JBQA 1AS0A 5LD2C 3RC3A 4QXAA 2EFGA 5DI9A 4Q4HB 2CXXA 2ZSBA 1QHHA 3LD9A 5K8UA 2ZYWX 1Q1QA 2FG5A 4IEIA 5EQTA 4OI0A 3CLVA 1N6KA 2D2EA 3ZJYA 1Z8FA 4G01B 2EVWX 4C9BA 2XB2A 4BGDA 2KBFA 3IO3A 1YQTA 1KMQA 2WVJA 2YINC 1VYUA 4NL4H 1O3YA 2QROA 4OK5A 1G3RA 3LVRE 5K8TA 4CEJA 2GBLA 3HR7A 2OCAA 2EWWA 5EE3A 3VHLB 4DLYA 1RFLA 4WW0A 1JR3A 4L16A 5KSZA 2OXRA 5LPNA 2NMVA 1A2KC 3L0IB 2ZREA 4HB3A 3SNHA 5EJEA 2OAQ1 4MRVA 2ATXA 3RSLA 2J0VA 3QVVA 2CCJA 2QENA 1P6XA 2X1VA 1T6NA 4POAA 2JJ2D 1OIXA 2PT7A 2ZR0A 4TZ6A 3AUYA 5EE5B 5DISB 3GLHA 3I72A 4C0HA 2IC5A 4OHXA 721PA 3RWOA 3WYAA 1G3QA 1Z2AA 2G3YA 4QM7A 2WMNB 4TQUS 1WXQA 4I99A 4MGIR 1E9BA 4P4SB 2C5LA 3QOFA 1D2MA 1JALA 2QPTA 2VRWA 1QG2A 2XOKA 2JLVA 2BVNA 1KDTA 2IUUA 4M9SA 5DE3A 4C7OB 3GJ3A 3IGFA 5FOWA 1QG4A 4HZUA 3S1AB 4BUJA 1VTKA 4X8MA 1KGDA 1UKEA 1XEWX 1TQDA 1Z0JA 3QF4B 4B73A 2ZQ5A 2VQSA 3DVLA 4I1VA 1PV4A 1ZM2A 1COWA 4UKDA 4A8JB 3R9IA 5HZKA 4PHTA 2FJUA 1IBRA 1S96A 2PCJA 4MDEA 2IYZA 2AFHE 2C2HA 5EXPA 2N1BA 4HEJA 4UXJA 2P6UA 4IDPA 2AWNA 3EC2A 5TARA 2YKGA 4B2IA 3JZAA 4D2IA 5F98A 4B74A 3AKDA 1KO1A 1CKEA 1OXXK 4LSGA 5FI1B 3AQ4A 1PLKA 1N5LA 2IL1A 2ZI7A 3QBVA 1OKKA 3W3AA 4AY2A 3RRNA 2Z4RA 2REBA 2CLSA 3OEED 2BBOA 3FGNA 3V00A 1BO6A 2G6BA 3QEJA 3AP1A 3RS5A 3TSOA 4FCWA 3BOSA 3UATA 3AF2A 1Q12A 1ZNXA 4XOIA 5AJWA 4GRAA 2QZ4A 5CITA 3ADKA 3ND8A 4AKGA 1VYTA 3QG1A 1SXJD 4YC7A 1SXJC 2QP9X 1IHUA 4TMVA 4MQBA 1ZP6A 2ZJ2A 4DEXA 1MABB 5JWRA 2BKUA 2HCBA 4TLBA 4ZI3A 1P9WA 2PEYA 4N3NA 1L7VC 3ZZTA 1FMLA 2NPIA 2WOJA 3FHOA 4EJSB 3MMPA 3EARA 1Z0AA 4LOAA 4KAXA 3B1VA 1OKKD 3SHFA 4R9UC 1CULC 1DAEA 3E1SA 3P4XA 3C8UA 1OB5A 2J0UA 1LVGA 3EA5A 3CPEA 2ZTSA 5A0FA 2C95A 3HR8A 3QKSB 1K5DA 2ZJBA 1GNQA 5FBQB 3NVAA 4F93B 1R10A 1IQPA 2E87A 3EPJA 1E9RA 2OBMA 1DS6A 2MSCB 1VG9B 4QBGB 2IWRA 4ZDIA 4C0AC 5TB5A 1W36D 2F43B 2H92A 2CCGA 2ERXA 1RVDA 2OCBA 3QIAA 2XZPA 3W8NA 5BN4A 4JLOA 4TTRA 1T0HB 4M21A 1W4RA 2ZSDA 1TNDA 5HTKA
chains in the Genus database with same CATH superfamily
1VPDA 2BHLA 3A9CA 4D96A 4DJTA 1A98A 1I2AA 3GJ8A 2I3BA 3OQNA 1OU0A 1ABBA 1GKYA 4BX2A 4H4DA 1JIXA 2XCSB 2BW0A 5AKEA 5GZ3A 3L4BC 1EWRA 5EHZA 1A8HA 1M6WA 3LX6A 2GAAA 3C1AA 1YKGA 1DARA 3AR9A 1QCZA 3MB8A 4L57A 3UN1A 3C3JA 4CKEA 1JAZA 1LRJA 4E11A 4P0TA 5EZYA 4A2PA 1ZY2A 5FBWB 2BJHA 5G0WA 1Q3HA 3JAKB 2ZLBA 5IW8A 1U1GA 4JIGA 3FKSD 3OX4A 1CRZA 1BGWA 1RBMA 2B2CA 3FMVA 2E21A 3TIFA 1SCIA 2VXCA 3UM9A 1QAMA 2D8AA 1NC1A 1O7JA 3MINA 2OCYC 1XP5A 3BMCB 3TZBA 5KWVA 4ZVKA 2XADA 3VKWA 1Z15A 3O9MA 2EHDA 3E9CA 4QO7A 4EGAA 5LXTF 1A82A 3F5DA 3UMGA 5LP1A 1R64A 3DMTA 2R7LA 4JP1A 2WT4A 4G5OA 4Z9XA 4WXPA 3RC9A 1MIHA 3LA6A 1TKCA 1YRYE 3ORYA 3DEHA 1L4YA 3BJZA 5DGXA 1CLUA 1E7YA 4NYIR 1KS2A 4KW7A 1JQ3A 3O4JA 3OM8A 1JDJA 1JXQA 1Q17A 3I04A 4F3RA 1G4UR 1GIAA 1L4GA 2PKWA 3KJHA 1I24A 3H7AA 2IY7A 3OT1A 1WHTB 3NM5A 1KEKA 1QGED 4MRNA 1YZVA 4YT8A 1UWKA 1PHPA 1CUFA 4QFBA 1TFUA 1ZIOA 3ZCQA 4C7OA 2CLDX 3D2AA 3WQBA 1CTQA 1V4VA 4L9RA 2D13A 2X8JA 2ZIZA 4P7FA 3UT5B 121PA 2SKEA 4B0PA 4CQMA 1D0IA 4EHIA 2PM8A 4A5SA 2DM6A 4Z99A 4FFLA 2WHPA 1VLJA 2R97A 1KI9A 3NT2A 3PNLA 4DRZA 2Q49A 5AHWA 1BOFA 2IK8A 1KI6B 4LRWA 4ZO4A 1YS4A 4C4XA 1A9XB 4OAOA 4RZHA 2Z2IA 2PL9A 1CS4C 4KJXA 1N4AA 3RVNA 1XCMA 4IV0A 2PV0A 1WY5A 1SOVA 5FOTA 5BV1A 4ND6A 4Y0AA 2XZDA 1LV7A 3MUOA 4RVHA 3PHJA 1F2TB 4N8SA 3VR0A 3RYIA 3TRDA 4W8HA 3DOOA 3P9XA 2MSEB 1GU7A 2QRMA 1ISRA 2IPOA 1P9RA 3N6XA 3K96A 4V0OA 3ZDFA 4Q66C 2WV7A 4HX2A 3NQ41 4AI6A 2WDPA 4KVAA 5FPPA 1VKHA 1FNSA 3H9UA 2DFTA 1AHNA 4TTSA 4HQFA 4WAUA 1NVKA 5IHXA 4E22A 1M66A 5FHRA 4AULA 1JQLB 3VR3D 2WIJA 1NX6A 2VHQA 2GJSA 4Z4FA 4CN8A 4ZAWA 1Z88A 3MAGA 2C2WA 2XR1A 3KZVA 4KLRA 2ECKA 2QX9A 5H81A 4G63A 5CVVA 4DLSA 1XD2A 1JG3A 4QLBA 3WNBA 2D4HA 3EGIA 2CNWD 3HSSA 4M1QA 2PMEA 4L5CA 2Q3JA 1Y33E 3E7DA 4AZVA 5IRCD 3I62A 1A71A 2ZIXA 2GZ1A 4ZCLA 4GLLA 2OBXA 3IEUA 3OLVA 1E1RD 4IIJB 1WCIA 1NLUA 1XO1A 2BHSA 2R60A 2OZVA 2VP9A 1A5AB 1A50B 3ODGA 3GAFA 3G0OA 2IVFA 3BD9A 2Q8NA 3MEQA 4ANFA 5ES4B 3EGXB 1RLUA 3JALB 2QW0X 3AWDA 3Q7QA 5CVCA 5LQJA 4JZYA 5E6RB 5LU9A 3GLIA 2W90A 1W88B 1WP9A 3B2NA 3B1KA 3G5AA 1JEEA 4UZFA 3BL8A 2XGJA 4ND8A 4U5XA 5J1TB 2NO5A 2QJFA 4YP5A 4F56A 4TL6A 3HK2A 4R81A 3DE7X 2B4QA 3AOEC 3HEBA 4DPMA 1NRJB 3UJ8A 1QH9A 4MVJA 5L3SA 1TW2A 3O5AA 4M6WB 4Q37A 4O8ZA 3KHUA 2OQRA 1SUIA 2CEAA 1DELA 3ZHBA 3WB0A 3NHLA 3ECCA 3FSGD 3OZBA 5BRAA 5EI5A 3TJMA 2YOHA 2AXEA 4CM8B 4WUTA 4G89A 4YAKA 3U13A 5IZCA 1TYDE 1P0MA 1TQ8A 1UBJS 1XTVA 2P69A 2PZBA 2QRJA 2PNJA 4ESEA 4OD0A 3CGWA 4LISA 4ZV9A 3AUAA 5TVKA 1D07A 4EG3A 2FDXA 3OCXA 4PYOA 2DR0A 1Z62A 4UQLA 1E1CA 5IFKA 1GGJA 5BMVB 4GWKA 3OFND 4R9RA 4JBNA 2X3YA 5I8PA 1WOMA 4J6FA 2IIVA 4CLOA 3HCDA 4TXHA 1I0IA 3ZV5A 3T95A 4LGYA 5LLDA 3QGMA 4RSHA 3OCZA 2JGMA 5CM9C 3RM3A 1OE0A 1WZUA 3QMMA 4JJIA 1YKSA 1U8XX 2QRVA 1J56A 3LUFA 3PIIA 4L74A 4NBWA 3AP2A 4CVNA 1CJBA 3W04A 4TT3A 1ZICA 2AMJA 4HQ6A 3BBPA 3LUGA 3HUEA 4DA9A 1PJ3A 3FCAA 2DU8A 3ZU2A 5BWLA 1G16A 4PANA 4JKIA 2WIAA 4Q4DA 1PR0A 2UVQA 4N9WA 1IXKA 2B3TA 2CBXA 1JZSA 2OZPA 3PRYA 2EKDA 2O3UA 4Z9YA 2W0MA 1R5BA 4PGHA 4PQRA 1B7GO 2ZDHA 5C9ZA 2H1SA 1JWBB 2FZWA 1PNQA 3R4CA 3OX3A 2DFLA 1SCQA 2EEZA 3LP6A 4DR3B 1HLPA 3VPDA 3D7SA 4ENRA 3NVDA 3OCUA 3MTQA 2O2XA 4CCYA 3EOBI 2DY0A 2HKIA 1ARZA 4KVFA 1WUKS 4EF5A 4LJRA 2H1IA 3I23A 4URHA 1ML3A 4M9XA 5AQ1A 2IGTA 1Z63A 1CDEA 1LF5A 2VYNA 4HNRA 1ZK1A 1Y81A 2ZIWB 1A5TA 1V7PC 5F3WB 2WWFA 2IHZA 5JSQA 2V65A 3JARA 1X1DA 3DZFA 4FE7A 1SCKA 3CURA 2WJYA 2FE4A 3KAKA 2O5CA 5IWAB 3UWOA 4EHKA 2R1UA 3EJWA 1G8FA 4WI1A 5EZ6B 4W99A 4DPKA 4EJSC 3KZ1E 3GEDA 3IEIA 4UTPA 2OO7A 5L4LA 4M37A 4MULA 4J29A 2PSSA 4JI2B 3HN2A 4MIEA 1W44A 2GAOA 3D4BA 5I7RA 1UIMA 1CNMA 2YV5A 2KE5A 1OAOA 1MO6A 2VWHA 3AJEA 1L8QA 2IIPA 1O5IA 2JHAA 1I3LA 1VM6A 3PRKE 1JR4A 4AZ0B 2YQ5A 4QJIA 5G53C 4D9JA 1HLGA 1SOMA 2YWEA 3PR3A 1QQ6A 1USUA 2HXSA 1QIGA 5L8VA 4MW6A 1AE1A 4YRRA 3KTDA 3G0GA 1CG6A 1A4RA 1LC0A 2X5XA 4H1WA 4OHZA 1GSOA 4H7PA 3KBBA 2GPNA 5BNFA 2VHVA 1I5OA 2Q0SA 1N2CE 3EZLA 1GARA 3CG4A 3GGSA 1F06A 3PG5A 4P3PA 1A4IA 1GGFA 4TT3D 1CBUA 2WVAA 2B9EA 2XKAA 5DZSA 3Q6NA 1VDZA 1UBFA 2B1JA 3FFAA 3TQFA 4BKQA 1AQNA 2LCQA 3RS3A 1GQOA 3NETA 1E3WB 3QBDA 1Y9ZA 1PJQA 4W6ZA 3N2IA 1KI1A 1JDUA 4D82A 4X44A 1L5VA 2HSJA 4TX1A 2I7XA 1KDOA 1DOZA 2QT9A 3E3OA 4LVNA 1EUCB 2W83A 3WGUA 4XWYA 2FOIA 1P2TA 3HACA 2Z6VA 4GMXA 2VH5R 4OLFA 1E1LA 4V39A 2A5YB 4UCFA 1C5KA 2DLDA 5C3UA 5JSFA 1MG5A 1GCUA 3EAGA 2PT5A 3L3BA 3MMXA 2YC2C 1ZNYA 3TOSA 1KEEA 1GHTA 4IX9A 4DV2B 3EDMA 3KSZO 4JBHA 2Q2OA 4Y1GA 3BDVA 3IVGA 3QXJA 4Y1RA 1M0SA 1G59A 4LHYA 3T3DA 2CVHA 1NFFA 4PC3A 3JRNA 3TRJA 2MYUA 4RM3A 1ETHA 4JIMA 1Z73A 4KPGA 1U5BB 3G6KA 4P4SA 3QIVA 1GZHB 3KTFA 3L07A 3PUWA 1PK7A 2ATCA 3QLVA 4M8IA 4K0KB 2XZTA 1E2UA 1J0XO 3MBKA 4YVFA 4QU0A 1IIBA 1KZ1A 1UMCA 1P4GA 2V45A 1BHJA 1UAYA 4MQ6A 2M6LA 4F5ZA 3LZ6A 3OQBA 3IODA 4YTEA 4M0EA 3HMQA 3V6MA 1YS9A 4MW2A 4KDFA 2PZFA 3B5EA 2FR8C 1FS6A 1T5BA 3KB8A 3JRXA 2I8CA 2ZXUA 4QYXA 4RBNA 2H4YA 3U4QB 3U2QA 1IXSB 3QW2A 2EHJA 1YOVA 4YQZA 4GMHA 4EHNA 2F7SA 2BBWA 3WXBA 2Y6VA 2CFCA 1NLMA 2JK1A 1M1YE 1NBMA 1B6GA 1C1YA 3LF1A 4HF7A 2G8NA 4LUCA 4Y18A 5ERXA 4B48A 2X8WA 2HU8A 3DAPA 3IUNA 1AQJA 2C82A 5CB0A 2IV2X 2FN3A 1G2PA 2NQ8A 2C97A 2A92A 2GK3A 3LU1A 2X0FA 2EG5A 3VR4A 3KEGA 3ZK7A 5BVGA 4QVKA 5C3MA 1FZQA 1GYRA 4RQBA 1XAGA 3T3IA 3CUWA 4Q1EA 2O7QA 2KS6A 5FLYA 2J9GA 4J2OA 1IJFA 2XQKA 5TJ9A 1ZI8A 4YUVA 4E5MA 1ZJYA 4AJJA 1XELA 3MW8A 3OC0A 4DGQA 2PNFA 4X3PA 3QLUC 1W5BA 3QYAA 2JD2A 4F7WA 3DFFA 3UNXA 1H2ZA 1TIKA 3ND7A 2CUTA 1OPXA 3N8KA 4Q7LA 4ZMRA 1E3DA 2Z2JA 2BFDA 3RTGA 3CX8A 4LOJA 2GEBA 4EJSA 4F84A 3SE7A 2X9LA 4Y98A 3H1AA 3AJ9A 4URVR 1WE2A 4J0HA 1D8AA 1L5GB 3UAZA 2PS1A 1WJGA 2C8KA 1UP4A 3L7AA 5IVKA 2Z5FA 1BFDA 1DPFA 1HDCA 2BGTA 3PICA 1Z17A 4ZQIA 2P9CA 1Z36A 2GM4A 1QM5A 5ITZB 1XXHE 3RSQA 3USZA 4CFSA 1U2SA 3DQZA 1RRGA 3R6WA 1AGYA 3R75A 5DF1A 2Q45A 3W2HA 2XUGA 4KFRA 3HRIA 1VE3A 2BM8A 4YUWA 3ZHYA 3MPUA 2FE1A 3L7DA 3FW1A 5H3HA 1Q7CA 3GLFA 2NYAA 1JAYA 2WMOB 5CD9A 3B48A 3T5DA 2F9FA 4Y6QA 4LQCA 1FYVA 4BYMA 3DL7A 3RVDA 3SGLA 1FL9A 1A3CA 4BB6A 3QBJA 2DHQA 4EYEA 4FIDA 2IWHA 4LVOA 4I4LA 4TV8B 4DABA 4AY2A 2X4DA 3DM5A 3RASA 3ZY3A 2QW1A 3LIPA 4BFCA 2PHZA 3D6TB 4MS1A 4RY0A 4QXPA 2ZBVA 1KPGA 2EJVA 5SY9A 1RI3A 3L0DA 4JCOA 5ICFA 5DK6A 4AJNA 3U26A 1DQPA 4B7XA 4BZXA 3BICA 1AMNA 1EUDA 3RKRA 3VOAA 2NVOA 3RS2A 4BMNA 1GSIA 4HATA 1FU4A 1W52X 2AH5A 3AEQB 1Y5LA 3B1YA 3G1UA 2V7QD 4FMDB 5AI0A 1U2TA 5ALKA 5T7BA 2I33A 1TTTA 2P1ZA 3ETNA 4ZT3A 2VT2A 3DZKA 4FYMA 1YZ3A 4OGKA 4DR5B 1Z28A 3E7XA 3O8DA 1XMJA 4ZQCB 3HZHA 1Y8CA 5JSKA 1INLA 3ROMA 1PZXA 4HWGA 2I65A 4XW2A 2PLNA 4NQZA 3S1AA 5HIJA 4MJLA 5A9TA 4IIXA 3CQ9A 5F51A 2JFQA 3LDFA 5A3SA 3A11A 3DPIA 3N8DA 1NN3A 3LUKA 3TRIA 1P0QA 4DMLA 1FUEA 3Q7IA 1P91A 1X0XA 3LTNC 2JLUA 4C1BA 2WWWA 4F6RB 3OU2A 3G13A 5DT2A 1QHNA 4XYGA 1VPLA 3AIKA 4KWIA 3DNPA 4KFCA 1JDZA 1MOPA 2OBNA 1BXRB 2G1JA 2Y1KA 2ZR8A 3E9EA 3FPAA 4FT4A 4KYVA 5E2AA 3W5CA 4W5WA 1R4NB 1ZFNA 4C0KA 2REQB 2EW1A 4CI9A 1KVUA 1N7GA 3ZVNA 4ER0A 3RADC 3Q2IA 4C03A 2C3PA 3BXXA 5BN3B 1LK7A 1B76A 2Y05A 3VNAA 1MOSA 5D5PA 4Z4EA 3AVWA 1BE0A 2BEVA 2HO5A 3HSKA 3VTKA 4BO8A 1V8BA 2V3VA 4L8FA 1UXOA 2OE2A 4Y2YA 3OBIA 1A8UA 4E5DA 2C3UA 1HDZA 4JVMA 4D25A 2NLOA 1D2AA 1GNPA 3OZRA 3RREA 3QTTA 1QOPB 2WAMA 3KYJB 5H3LA 2HMTA 1GUDA 4I2NA 1E64A 3AESA 4MVJM 1NONA 3Q9UA 2A1TR 3NHMA 3OLYA 1ECCA 1LLFA 4XPIA 3QU7A 4BWVA 4W5TA 2BGRA 1LH0A 1NQUA 1TECE 1OMOA 1ISIA 3VTAA 3WLQA 2V7VA 4WOBA 1BQEA 3IP6A 1RXUA 2X42A 4ITRC 4KLNA 4ZRDA 5B3JA 3WG9A 5A9SA 4PXSA 5AR1A 1QWSA 1JZQA 1E2LA 4RMGA 5KOYA 2A5DA 3GCXA 1LFAA 2HIGA 1PR2A 1ND6A 1M1UA 1PGJA 2DUUA 2O3JA 3AP3A 3OOWA 4PZEA 2C84A 3A1VA 4DSAA 2WWTA 1WW2A 4U8HA 5AVJA 1KYIA 1Q0UA 1KDRA 5I9IA 1PT7A 1GGHA 3U9SA 4BMOB 2I3DA 1YVPA 4D97A 1FUIA 1Q7GA 3FWNA 4QXOA 4D8YA 4D9MA 1Z13A 1CIVA 2AYZA 2EDAA 3KVRA 3EFEA 4FWIB 1UBSB 3REGA 1SZJG 1WMBA 3I1FA 3KSRA 4W1RA 3UWKA 1X74A 2BGJA 4MDYA 1GZ6A 2RGNA 1NR7A 4UU8A 2WLSA 2PZ8A 5KDLA 4BQEA 4NYMQ 5JU6A 4UNNA 2V97A 4EG0A 3ZD6A 1MVOA 4RKFA 5BR1A 3JVIA 2X6RA 4JVOA 3EMKA 5DMHA 3PNQA 2WJZB 2IDKA 4D6XA 1RWMA 2W00A 2HM7A 3RVBA 4NBTA 4H27A 1BA3A 3TI7A 1AY0A 2I1WA 1SB8A 1ZYUA 2FHSA 3BB4A 4W6QA 2ZZMA 3AVXA 3WAKA 1IPEA 2P8JA 5GONB 3FTDA 2CHUA 1IN8A 3C85A 4L8LA 5FPHA 5I4CA 1XQVA 4RHYA 4LZWA 2G77B 4UHHA 4L4YA 3TIGA 3TMAA 1W9MA 2PUJA 5B7GA 5JANA 3VPHA 1NR1A 2CZQA 1UBGA 1ZOPA 4W8OA 3MAAC 4XB6B 4MS3B 4B6SA 2IQIA 5BNIA 2PA0A 1AF7A 4L85A 1SH7A 4LRXA 1FVOA 3EVAA 5JIBA 4PO8A 4J0JA 1TYZA 1N2OA 1W96A 2A9JA 3N6RA 3TQRA 3ZI4A 4C7BA 4QREA 2O2SA 3V32A 2ABWA 2BZ0A 1M0WA 2FSHA 3OE7D 1QKJA 5EIEA 3AFMA 1R16A 3UCFA 4JU8A 4CEHA 4RF5A 3K1JA 3WRYA 4Q0MA 1MRSA 1CE8A 1FP1D 1TEVA 2VTVA 2WTAA 1NATA 3PUVA 3UJCA 1XRNA 2Q3FA 2ZBPA 4CR6A 3S2ZA 4R1NA 3P7MA 1NYQA 4KE8A 1T26A 5SY4A 4DMFA 1P7YA 1YXMA 5CG1A 4D9GA 4F2DA 1UWVA 3CZAA 4FYYA 4DS3A 1N2JA 1M2KA 1X13A 2P1RA 3A6HA 4BFXA 1JH8A 1X6VA 1YZQA 3ROEA 1SBCA 5CJPA 2WRZA 4QJ4A 3FDZB 4JLUA 1KAMA 1YRWA 1TQHA 1R0CA 2VP2A 3IQHX 1G4AE 4A23A 3C6ZA 1NF3A 1O6CA 4QG7A 3W34A 3ICVA 2NT3A 3PC8C 1OGYA 4LZZA 1L1QA 4I1RA 3O84A 4EMUA 4JLJA 5LC1A 3SKVA 2R8PA 2EEPA 1Z12A 1XMOB 1O54A 2ZBUA 3A1UA 3QY0A 4GI3A 2D2IA 3MJTA 1U81A 2GDZA 1XCLA 4F6RA 1N2SA 1BN7A 1OLUB 1XZIA 2ZVDA 1WW8A 1SZCA 3W3ZB 4KU4A 1VECA 4EK9A 5C81A 2OCXA 5C53B 4IOMA 3M3HA 2ZT6A 2C5GA 3N2YA 1RJWA 3HHPA 1ZIDA 1EVKA 3P5SA 1MJNA 3L9XA 3TSZA 5JMTA 4PX3A 2AG8A 2MCFA 3VRHA 1DMSA 1Z07A 4C5AA 5I4IA 4QVIA 1GA4A 3BXFA 4P33A 1NNSA 2A9RA 2WPDD 3PHCA 1WBJB 2XD9A 1YVEI 2CHVA 2QGZA 2RGEA 3CS3A 3Q41A 1RAGA 4N18A 3UTDA 1GZDA 4D26A 1Z4JA 4PXYA 2FJPA 4QHTA 2F55A 4US0R 3EDOA 2DWCA 4XJTA 3QYPA 2JJ8A 1LNQA 5LFAA 4NG5A 1FRQA 5BQ5A 4IGKA 4QAQA 3WSTA 3DMHA 2UZ1B 3FYSA 3M6VA 4M1EA 4NZYA 1VJRA 4F1KA 4UNRA 2BC9A 1NW5A 1OHHA 4MS1B 2HA5A 3T9CA 4N40A 4OYLA 1W30A 3GIDA 4UMFA 5AESA 3GHHA 4GIBA 4BN5A 1NAIA 4D98A 3FUXA 5AM4A 3H2JA 3EXG2 4RJJA 1HUQA 1E2MA 3RKSA 4BNMA 5FI5A 2DPLA 4B82A 1O0SA 4MI9A 2PUFA 1AM4D 3DE1X 2JD1A 3FCCA 4GAEA 1EPUA 1GD1O 1TB4A 2L17A 4G9GA 1C8VB 1BCRB 4K6CA 2J3LA 3W7AA 3SSAA 3T9FA 4BTLA 5HQ3A 3PQ7A 5LQAA 1XTSA 5JARA 1PG5A 5FBLB 1JR6A 3OX1A 5A0VA 1KJIA 5CIQA 4DYVA 3DXXA 1WV1A 4EY3A 4X62B 2HJVA 2QLFA 2VXYA 3KZNA 1T3LA 3AI7A 4PGAA 4R1SA 2H59A 2OVBA 1ECBA 5FAKA 2E1RA 1ORRA 4F46A 5A7HA 1YZYA 4Y67A 5LZ9A 1Z2DA 1C3OA 1M7HA 2JKYA 1TA4A 4FHCA 4JI8B 4JXZA 1KOFA 1FDVA 3DFMA 1CDZA 1K7FB 2P3QA 2H4ZA 5B6PA 1J8FA 4MW4A 3VYWA 2Q1UA 4DDMA 4IIDA 4W9NC 3UPDA 4Q48A 4CNQA 3IB6A 2ZJOA 3G1TA 3JWHA 1TZ2A 1Y98A 3EZ7A 4YUXA 4GT1A 1T4BA 3T5MA 1K08A 1ZA1A 4RHTA 1SVMA 4TL9A 1WB5A 3KJXA 3ZKAA 1M3SA 3AU8A 1G21A 2BDUA 1RE0A 2DC1A 1DJQA 3H6GA 3KVYA 3VR2D 4RIHA 3RI3A 5JYBA 5LYJB 4OI4A 3DTVA 3IL2A 2VN8A 2R5FA 4NCJA 3HO8A 1G1MA 2PUBA 5EKXA 2QV0A 4OJQA 4WACA 5AW5A 3KO8A 1JV2B 1Q1AA 2OPBA 2P0EA 4XM0A 5IJXA 3V1TC 4B35A 1FFGA 2A0WA 1TLTA 1V41E 4G67A 3QRWA 5CX4A 5GVSA 5K5EA 1JEQA 1U0SY 3IAHA 2H08A 2JFWA 5ALJA 2VT7A 3LOUA 1HFWA 2OA0A 1US8B 3HEAA 4JP8A 4JXJA 5ALXA 1V16A 1GGMA 1OAAA 1RXIA 4RYDA 5JJ5A 5K0FA 2GNOA 4UATA 3H4MA 4CKCA 3B70A 5A4JA 4KVZA 4C1NA 1SG9A 5JCJD 4GDFA 1BN6A 2HUNA 2W2VA 4Z3DA 1BD4A 3MRXA 3W05A 1THMA 2B69A 4CM4B 1K1EA 1OWNA 4NAUA 4R1UA 2PV7A 5EMJA 3VAZA 1QZUA 3C5EA 3FMIA 3AERB 4ZYLA 3IIEA 5JALA 4PC7A 3NJ4A 2IXBA 3UAGA 4U2DA 5JG7A 3A14A 3ZXIA 4ARBA 2FLVA 4RSRA 4UD6A 5FADA 3UFBA 4NU6A 4UTNA 1C9EA 2YJ3A 1J2EA 3PNPA 3LPCA 4INOA 5D3KA 4AJLA 3HPRA 4ZOBA 3ZQUA 3FNFA 4H0CA 2B3DA 2ZI9A 3ET4A 1M7BA 1NM5C 5TT0A 2LKDA 2ACKA 2DWQA 4FKZA 1U2DC 3X1JA 1J33A 2P9JA 3W5DA 4CG0A 5ALGA 4A1OA 1IULA 4O4LF 1N6RA 1ECPA 2P2LA 2XLBA 4AZTA 4B47A 4FZ5A 1KKLA 1NQOA 3PDWA 4YK7A 3V34A 3WYBA 4ZYYA 2KHZA 2XE8A 2RGYA 3OOSA 1WUJS 3F6BX 1Y89A 2N1MA 4QEKA 1RMTA 3QVLA 2IYAA 1GCGA 2QAGB 2XCQA 3G9XA 2C5SA 3M5CA 4LRTB 4PLWA 3TKLA 3GZJA 1OLUA 1RSZA 4N5IX 2ZUEA 4J7UA 1R0WA 4JT8A 5HIMA 1K68A 1YE5A 4P7JA 4DRXA 4GSKA 4GEKA 4I5FA 2I6FA 3NR2A 4I5EA 3VZPA 4EF4A 1TCCA 2EERA 4BFVA 2FQ1A 2PWAA 2ZANA 3A06A 1XZFA 4ED9A 1P0FA 3MJHA 3UV3A 1XXLA 1REQA 1V8OA 1IATA 1LNZA 3FOAA 3HU3A 4L7VA 5DB4A 3UJNA 2D0DA 1XF1A 1YJBA 2WAOA 3GI1A 3SIPA 1Q21A 4GP9A 5KVSA 3QYJA 3JQAD 3OLXA 3NWBA 3VR1A 4ISBA 4DLXA 4WEOA 2F1RA 2V5UA 3H8JA 1TVEA 4YQFA 1C4OA 3NYIA 2WPDA 3AF6A 1IY0A 4IXMA 4CF3A 1MQ8B 3HC7A 4BNXA 3B5IA 3GGOA 5TRTA 4C0WA 3ZXYA 4QE3A 4HT3B 4A73A 5LXTA 1D1QA 3UMJA 2XNDA 1H94A 3R7LA 1RQ7A 3ROXA 4WY5A 4JLAA 1E7RA 3AK4A 2GOYA 3CNEA 3FYDA 4Q12A 2JD0A 1UPCA 2QI9C 3DT9A 3PSHA 1WIWA 3U60B 1E6MA 2XCLA 3K9CA 3LZDA 3V7NA 4EB8A 4WLVA 2I6GA 2WF8A 2BEWA 4KVGA 3KLMX 4XR9A 3EOZA 4GNRA 3DLHA 3TUIC 4K2HA 3ZYZA 3Q3JB 3TSCA 4CJXA 2AJCA 1S1MA 1N2GA 1S3GA 1JI3A 1YHYA 3IQXA 5K6TA 1RRFA 2EV9A 2Y77A 2AR0A 2DHCA 3OTHA 4AG3A 3HU5A 1YQEA 2CXSA 4NSNA 1LV8A 1SC3A 3H3JA 3R74A 2D00A 1JNYA 3F6SA 4CLOB 5BN3A 3ND5A 4YRAA 3GG9A 4FZRA 3ELDA 5FNVA 1K3FA 1AZSC 2O1SA 3OUTA 2GN1A 2VP4A 4MLDA 2WT8A 3AM5A 2XX3A 4EUNA 4IOKA 3D0RA 1WF6A 4R1OA 1JE0A 3LWDA 3CPSA 1EP3B 1U3FA 3LWBA 2P35A 3UW3A 3EVGA 1E89A 3VTFA 1CZUA 1OXMA 5EVJA 4ZDKA 1Q1ZA 1NBWB 1SXHA 4BECA 2HUPA 5CLFA 1YWGO 5IC5A 4U3JB 2W5UA 3DE5X 2JBWA 1J06A 2WMDA 3FI9A 5C7IO 2AX3A 1E3LA 4QHYA 4B4VA 3GCZA 1E5DA 1PJZA 3SE0A 4MPJA 1FMTA 4JB3A 4KQMA 3O2NA 3O6VA 1LWOA 4TXMA 2C83A 4MR9A 1V1RA 2VQFB 5I5GA 1SEVA 4O4IA 3K1AB 1LS1A 1LX6A 2WM3A 3MQ4A 4MAFA 4MRAA 1HOXA 2IXDA 4B80A 5K8CA 3OTOB 1ZCFA 4MHOA 4LJ5A 2CMFA 4P4GA 2YWDA 3VKHA 1LK0A 4DC1A 1ZX1A 4YRSA 4RQTA 5CDTA 2AOTB 1BE1A 4UJ5A 3RSZA 3VAYA 3X1MA 2XAUA 4YJ3B 2ZBQA 1SVLA 3SD7A 1UC5B 4FFOA 3H9JA 1J0EA 2XBUA 2AVNA 1P31A 3EZ9A 1V8DA 4TV9A 4K9QA 2IEGA 1X2EA 4RZIA 2TMKA 5F12A 1K89A 1E9AA 2INGX 4B6QA 4DJJA 2I67A 1MO3A 2Q0XA 4JKYA 1Z5WA 5LZ2A 2LNDA 2P2DA 2ZI5A 3F5SA 3HEMA 3ZI7A 3ZW7A 3ELWA 5GOTA 2OKGA 221PA 1Z5NA 3HYLA 2QTHA 4Y2VA 1VLZA 4N8EA 4D3XA 3CVWA 3IEMA 4ASUD 1E6WA 2UUPA 4Y0NA 1FP7A 2AX4A 4LXQA 3STYA 3IHLA 2V7QA 5E6UB 3TVDA 1Q1GA 1X7ZB 3GT7A 1NUAA 2E48A 4MUNA 2BGUA 3VSBA 3UHOA 4DCPA 4RTJA 3RLIA 4BUCA 1I8TA 4MR8B 3IKTA 1KARA 1NKSA 1B8UA 1TZBA 2IW3A 3N2LA 3HI4A 3URMA 5TC4A 1BG6A 4MYDA 3K71B 3S2UA 3T7EA 2Z2KA 4PAQA 3IELA 1DZ3A 3IA2A 4KKXB 1BVHA 4D6PA 1IWOA 2G9UA 2VEDA 2G1PA 3K1YA 5DP2A 1OXUA 5MHTA 1FNBA 2ODBA 4HK4A 2QEQA 3NM4A 4RH0A 3CN7A 4ZKEA 1SG6A 5L7TA 4TPKA 4C43A 4G5QA 5DGHA 3T35A 4NX2A 1PN3A 4KUEA 1XTUA 2BCGY 1C9DB 3WK5A 4C0LA 4C3ZA 3DOUA 1T4GA 5E4FA 5GM2A 4OU5A 1M1YB 4TKVB 3DMFA 1SXJA 2VRCD 4Y6PA 3EDYA 3H2HA 2CY0A 1R8YA 1YJ8A 2FG6C 2H1LA 3E1KA 4K87A 4LBWA 4J91A 5K3OA 2QM7A 1ZZGA 3QVGA 3IOEA 3JQCA 2BR3A 2X15A 2BL4A 1YQWA 4R8MA 2GWHA 1L5MA 4Q05A 3FMOB 1RFGE 4Y2XA 2O0MA 3HB4X 4R9SA 3P97A 3OZXA 5FLEX 1FCJA 1QYIA 2DLNA 4E51A 3BH7A 3ZE7A 2O0LA 4W5OA 1M34E 2W6ID 4IXTA 2H4HA 4R0VA 4DG8A 4HDSB 5KYXB 2R8RA 3C43A 1GPWB 1C9YA 1MAUA 4YECA 1QF6A 2H54A 4YUAA 2FUG6 2Z98A 2NYVA 3LCMA 3A1DA 2ZRHA 2AI3A 1YFKA 2F3QA 4LSZA 4DR2B 3FWYA 2XKKA 4QYIA 2NZXA 5EYPB 1T8YA 3C14C 1DIAA 2DP4E 5REQB 4IGAA 4DLKA 2PAAA 1QIHA 3KXDA 4MW1A 1Z0ZA 3UK7A 1GO2A 1WPGA 1BKSB 2C8LA 2OHHA 4AK9A 4B2LA 2YZ7A 3BMQB 1XDWA 1ZUIA 4DM7A 1OWLA 3E9YA 1Y1KE 3BILA 5FRDA 3KQYA 2IOQA 1IBSA 2H31A 3NH6A 4IS3A 3EVEA 1CJSA 2VI5A 3LQ1A 4YJ3F 3LSTA 4IHQA 3LLUA 2F3TA 4BVLA 1AKEA 5FR1A 1XFAA 4DNOA 4Q18A 1ONSA 1SQGA 4JX9A 1QLJA 4KITB 2FN4A 1G3IA 4CCWA 4ALKA 4IZHA 1DL5A 4M0LA 2CZGA 3DO6A 2EF0A 3LV8A 1ENYA 1PGOA 1C3VA 3LLVA 4ZYWA 2OHIA 2JJ2A 5IFLA 2FX5A 1EXNA 3EXHC 3VX4A 3WGMA 4YPVA 2FWRA 1J24A 1W19A 1DJPA 4GXNA 3UJPA 3B36A 5I9TA 2Q27A 5HTKA 1P74A 2FUNB 3H5TA 3HYNA 3LPDA 1EX7A 2Q21A 3V33A 3NJ8A 4G5GA 4C14A 5BOSB 1F1BA 2P2ZA 3GJ4A 5TE9A 4EVQA 4TWIA 4Z8XA 4G24A 4U2EA 5CHEA 5AXCA 1T3HA 4K6HA 1SKMA 1CD5A 5K0BA 2PA3A 4NHOA 1MDFA 4L4RA 5A02A 4YCMA 1U2PA 4B3DA 5G1NA 1D9XA 2K7FA 2QVYX 1RKBA 3KELA 4YP9A 1OPRA 2QK4A 3FNEA 3HUTA 1MZPA 2QMUA 1CCWA 3GZNB 1YZTA 1M2VB 3PIRA 2JLQA 1EFVA 4CMEA 1Y4UA 4EKGA 1PK9A 5EOVA 1CQJA 1HL7A 4CZ2A 3JAWB 1KP3A 2Y99A 2YHSA 4N6OA 1XAJA 4PLPA 2X0RA 1MX5A 1QYDA 2CFIA 5TMEA 5TT1A 4KXYA 3V8MA 2BELA 2G83A 2QNRA 3ROTA 1N9GB 5IDXA 4EX7A 4M0DA 4ENWA 3I9OA 2PRYA 3LL4A 1XYYA 4QPNA 2B5OA 3Q8XB 2B9VA 2YYAA 4B44A 3W6OA 3GV0A 2P9YA 1M72A 5LCXA 4ZHQA 1GZ4A 1ACJA 1OTXA 2CLOB 4KAAA 4OLHA 2J59A 4RWEA 4UU1A 4CEIA 3AZPA 2XUAA 4EJ0A 3VNVA 3H1FA 2FSPA 8ATCA 2CWWA 1OLXA 2QRGA 2YY7A 5ESDA 5LLTA 3GX1A 3SXJA 4IG4A 3PHIA 2CWDA 5EUMA 3N2GB 5EUCA 3RUHA 4MWDA 1IM5A 1RACA 4W7SA 2AT1A 2B37A 2WD7B 4RFVA 4NBKA 4YRJA 3TPZA 1T9CA 3AW9A 3DKIA 1LZKA 3HXKA 3P2EA 3RYTC 5BUQA 4IEEA 5LMNB 3DYIA 1SJ9A 2ID7A 1CJKC 3AW8A 2N42A 4UVEA 5AKKA 2YZKA 1XLWA 3R7FA 4PZYA 2PQMA 5KJEA 2RGRA 4ESHA 1PKXA 1HFEL 1N2CB 2F90A 4WLOA 2RG1A 3K9BA 1E1NA 1RWVA 2ZIEA 4R7TA 4XJVA 1Y4ZA 3HN6A 1DEAA 4HDSA 1N8TA 1YIAA 2B98A 2ZETA 3KUDA 3JYPA 4PQFA 4X1IA 3QYFA 5K1ZA 1O95D 2XJ4A 1LQUA 4JLNA 4U6QA 3FVRA 3BWXA 5EJMA 1NMEA 1NKVA 2CLKB 2QA5A 3H1TA 1FYWA 4RPKA 5CFOA 3TSWA 3PX7A 3L43A 4KL8S 2CV2A 3DAGA 4KSYA 4YAEA 2GILA 1WULS 2Y8EA 3G2HA 5KNDH 3A6PC 1W47A 2Q5LA 3I6IA 1MW9X 1VLLA 1DG3A 4OH1A 1L5QA 1N2CA 3LYUA 4M99A 1UBMS 2PUHA 3DDUA 4OHWA 4ZVQA 3RAGA 1RPZA 3RQIA 4ECAA 2GPJA 4IYJA 3A7DA 3REQA 2DWUA 4BWFB 3WWYA 4P5EA 5JNSA 1KPIA 2FPIB 1KIMA 3GK3A 1RHMA 2KJQA 3LXRA 1ZM4A 1EVEA 2PKYX 4Q3BA 4V0LA 1MDBA 1ST3A 3AM3A 5EHXA 2BDTA 3OE7A 2UU9B 4CCAA 4UMVA 3D1JA 5B4TA 4IF6A 5B30A 2DHEA 1IZ0A 1J97A 3P9IA 3CF6R 1H2BA 3GCWA 2PH5A 4RCZA 3ZZMA 1MB4A 2ZRFA 4E1AA 3G7NA 2UKDA 4Q4CA 3SM9A 4CV2A 1QLWA 2PBRA 1P9OA 2P6OA 1J39A 1PFWA 5A2GA 1CUCA 1IB0A 1LFDB 3EW7A 1WA5A 1E4YA 2XNSA 1VRWA 4A2QA 4V1CA 3LP8A 4JJ6A 4OKNA 4DR7B 1JU4A 5JSHA 4TTPA 3ZZUA 1O8CA 2Y0PA 4MRRA 4DWWA 4DRYA 1XJWA 3K16A 1O97C 3OCCA 5TSDA 3C74A 3EH2A 4GF5A 1GPMA 1X7WA 1Y1QA 4IJ5A 3TPCA 3M7IA 4EJ2A 3HXTA 1WZEA 3T3EA 1QPZA 4M0PA 2APJA 1S2NA 1T6YA 1MIOB 3PC7A 4IRMA 3EULA 3PNKA 1M74A 1U6JA 3T15A 1A7JA 1S7GA 2P6MA 3B3GA 3L8EA 3L7CA 1B3BA 2AZTA 3V3TA 1GTSA 3UH0A 4BMDA 1C9JA 3DD5A 2IELA 2RGXA 1NG9A 1KMIY 4KDRA 3SWWA 1F2UB 3PL5A 3WGQA 4FGKA 4XVCA 4NULA 5EXDA 4PZ0A 1AHPA 2HDOA 3SC2B 3BE6A 1WX1A 3T12A