2GJSA

The crystal structure of human rrad in complex with gdp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
168
structure length
150
Chain Sequence
b'VYKVLLLGAPGVGKSALARIFGGVGHTYDRSIVVDGEEASLMVYDIWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein RAD
publication title The crystal structure of human RRAD in complex with GDP
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 53
structure length 150
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gjsA00
1KO7A 1OHHA 1ZYUA 4HLQB 1OB5A 1G5TA 4CEIB 1E3MA 3GJ5A 4LJYA 1M74A 3TE6A 1XBTA 2QRNA 2AK2A 5P21A 5DHFA 1PUIA 4ZKEA 2DWOA 1M2OB 5DO9A 3FKQA 1A5TA 4CEHA 4US2R 1GNQA 3I8XA 3K8YA 2DYKA 3HJNA 1VTKA 2QBYA 3RS2A 3TSOA 4B3XA 3Q7PA 121PA 1F6BA 4OQLA 1CKEA 3HP1A 4JLJA 5FR2A 2WTUA 1W4BA 3SBEA 721PA 1KIMA 2PZFA 2O8DB 2GESA 3A58B 1P2TA 4DUGA 4XIGS 2QEQA 3SFVA 3L8ZA 4FWTA 2JDIA 1RZ3A 3KJEA 2I1VB 1UAAA 3B1YA 4LRWA 3CO5A 2NPFA 2BMDA 2RGNA 2WOOA 1JQJC 3EPLA 1OLOA 2VRWA 3NH9A 4CEJA 1H65A 4B3DA 4MRSA 1Z28A 1VYVA 4EIWA 1R6BX 1W2GA 2WJVA 3PITA 2RGGA 4FMDF 1E9SA 2FH5B 4OQNA 3SBDA 1U94A 1W36C 2WWXA 1G3MA 2BMFA 3GFPA 4Z54A 2Z83A 4KLZA 4NCNA 1NVWQ 2VF7A 2SHKA 4V03A 4DB4A 1UEIA 2G83A 1G41A 3RYTC 2IEZA 1E2EA 3WYGA 3VR2A 1M8PA 1LS6A 1KK2A 1VCNA 4JSYA 4Q4AA 5SZJA 1SVWA 1IONA 4XOIA 4FCWA 1COWD 3K0EA 4Y0VA 2IF0A 2QUZA 3IBGA 1G21E 3N2EA 1ZIPA 2D2EA 5JEEA 3ZH9B 3KJGA 4DDWA 1X6VA 2ZRHA 4QGGA 4C0QC 3OESA 2TMKA 2O8CA 4LBYA 2WIAA 4MUAA 3ZVMA 4IW3B 3H2YA 3TNFA 4F4CA 3AKYA 4A8JB 2NO9A 2PBRA 3BS4A 2J41A 5CM9C 4ESHA 4JVMA 3L0SA 1UBGA 2ZSFA 3SZRA 5HKKD 1AA9A 4UJ3A 2G9NA 2OHFA 4HLUC 4V0MA 2XXAB 3ZVNA 1B0UA 1JEEA 3MGCA 1HQCA 3QSYA 4BPBA 2OSBA 5F3WB 2ZI6A 4Y0AA 3V9PA 3GLGB 4R2IA 2O8FB 3NG1A 4TMZA 3AP2A 1QDEA 1TADA 1EK0A 3GJ8A 5DHAA 1XMJA 4PPGA 2ZE7A 2ZR7A 3AQ4A 2F43A 4HAVA 5EXSA 3NC1C 3RLFA 3ZZTA 1N6NA 5C46F 1SGWA 3I61A 4D4MA 4LC0A 3WP1B 2C78A 1CU1A 3K70D 4IOMA 2ZRJA 2C9YA 4HUQA 1EFRD 4V0LA 2FNAA 1E2MA 2IS2A 2CNWA 3GFOA 1WBDA 2OLKA 1E2IA 3I1FA 3U3RA 2LCFA 4XWOA 1ESMA 1ZD1A 3BD9A 4B47A 1IN7A 4G01B 5CJ2A 1HURA 4U00A 2DWPA 4POAA 2HLDD 3GEHA 4Z51A 4MDEA 4QGHA 2XGJA 1KI1A 2GEVA 4WZBE 3RS4A 2YNMA 3A1UA 5AJYA 4FW9A 4IRUB 2BJWA 3PENA 4UXIA 3I73A 3TQCA 2CL7X 5BW8A 3ZVRA 5TMPA 3ADBA 4BFYA 4QJ4A 5CK4A 4LV8B 4I1UA 1GVNB 1TAGA 2ZYTX 3BORA 2RB4A 5FPYA 1NI3A 1PUJA 4MUBA 2C8VA 2CHGA 2BM1A 5E7IA 1SXJC 1XTJA 4PSKA 1TF7A 1KDRA 2NQ2C 4ARZB 4F38A 3AF3A 1KK1A 2WPDA 1TNDA 3KQLA 4L16A 4NKRA 1Q3HA 1XD2A 4UQOA 5J4YA 5SZIA 3U7HB 2XNDA 4R2HA 2F1HA 1VG0B 2P5TB 2BKEA 4EAQA 4RCYA 3SEAA 1E0AA 3UK6A 4A0HA 4CT5A 4JLAA 4DKXA 3U6BA 3DMDA 3BGWA 4TZ0A 4PQFA 3FFBA 3BFKA 4DLSA 3MSXA 1P60A 1YQTA 4CEIA 1W36D 3OZXA 3MMPA 2ZJ2A 1I4LD 4LBZA 2ZJ8A 5FPKA 5EZ6B 2AD5A 4QGAA 1ZNWA 3AKCA 4KYUA 1G8HA 5AK0A 4O0MA 2I3BA 1Z0KA 4DEYA 1U8AA 3BAFA 1EESA 1D2MA 1SXJE 1R0WA 1XXHE 3DM5A 4M8NE 4B43A 1RIFA 2ANCA 3T34A 5AJVB 1TQ6A 1U8YA 3C7KA 5H1YA 4A0FA 1W4RA 3BJIC 5DI3A 3RNLA 3I5YA 2O8DA 5D3MB 2AWOA 1C1YA 1S0UA 3U3OA 3U3JA 3P27A 2OZEA 2PL3A 3PEWA 2OFWA 4C7OB 3EARA 5EE1A 1IN6A 2DHRA 5AUNB 2GJ9A 2FJUA 1E6CA 3ND8A 1XCMA 2WIBA 2C99A 1Z22A 4MRPA 5JJLA 2BCJQ 2OESA 2V7QA 5DLQC 4QJ3A 4B6EA 1KI8A 3GCGA 4MKFA 3B9QA 4BRWA 3FPAA 1FNNA 3FB4A 3FGNA 1CR1A 1XU4A 3Q3JB 3FVQA 3LX5A 3U4QB 4NBSA 1P9WA 1ZJ6A 2HXYA 3CW2A 4BZXA 3CPHA 1X8KA 2R2AA 4PQRA 4P4UA 1KSHA 1N0UA 1JI0A 8OHMA 2WAYA 3AV0B 2RGBA 2ZRDA 3ZGXA 4DCSA 1ZM4A 4OHVA 4IDOA 1S4QA 4KFTA 1LTQA 3GQBA 4G5QA 2DB3A 521PA 1RRPA 2PCJA 5KPJA 4A0GA 2QE7A 3U3MA 4AWXA 5BWMA 1DG1G 1E9EA 3K09A 4OHYA 2OAQ1 3UG6A 1ODFA 5EE0A 2QENA 2X1VA 5FPSA 2R6GA 4DDVA 1MRSA 3TK1A 3CX7A 1NBME 3LFUA 4FINA 4MGYR 2ORVA 2ZRFA 2OBLA 5TVKA 1EX6A 5KYKA 2XXAA 1KK0A 2G1KA 4DC9A 3WMFA 1S96A 2A3RA 4ACAA 3SOPA 4URXR 3W5IA 2H5EA 4PZZA 2QP3A 3M6AA 5F98A 1KK3A 4D4JA 2XITA 3GLGA 2O8FA 3AF0A 3E5HA 2F9LA 4B71A 1E2HA 3Q5DA 1R0YA 3PUWA 4IDNA 4OHXA 2NPIA 1SXJD 3FKSD 2X2FA 5EP4A 5IK2D 4V0OA 2LKDA 4D0GA 1KDPA 2BBSA 1U9IA 2O5VA 4EJSC 4YMVA 1R5BA 2XTNA 1P61B 2C04A 2R6AA 2W6JD 3ECCA 3PV0A 4DBLC 4NYMR 4GFDA 5FH9A 1E79A 1JR3D 1Q3TA 2WVJA 3AVXA 5D3QA 2KBFA 4OQFA 1IXSB 1W47A 4AD8A 2FA9A 2RHMA 2C96A 1AKEA 1E9RA 2AN9A 2NMVA 3LAWA 4B32A 4PC3A 2QGZA 2BKUA 4ON9A 4HB0A 4M1MA 1CXZA 1W0KA 3AKDA 4UNNA 1FPMA 4PO9A 4IEEA 3CR7A 1JEDA 4NCHA 3OAAD 3DPUA 3UATA 3VR5A 3BK7A 4PHHA 4DXAA 5GJCA 4Q1FA 4MGZR 5GADl 2JIZD 4A6PA 4JBWA 1ZBDA 1LB1B 2QSZA 2UVQA 1MR3F 1S1CA 1H8ED 2V6IA 4ARZA 1M6NA 4WVFA 2VP6A 2HV8A 4GPTA 4LJ9A 5KSZA 4ZPXA 2V9PA 3J81k 4MYUA 4G5OA 3FMFA 4BLRA 4AG5A 1W49A 2QPTA 1DVRA 4Z1MA 4CRWB 2JCSA 2IYWA 4NCIA 3X2SA 3CNLA 4JZKA 4PANA 3CONA 2F1IA 2IYVA 1E94E 2FPMA 5UKDA 3GLIE 5G41A 3ZZUA 1LV7A 2RGCA 1D8TA 1DAIA 4GT1A 1JJ7A 5FPTA 5J4LA 3F5FA 3I92A 3SNHA 2IXGA 5HPYB 1VHLA 4HLDA 1FNMA 1JPJA 3K0CA 1Z07A 3LRPA 1GKYA 3PR1A 3G0HA 1UDWA 4M1OA 3T12A 1N25A 1G3QA 1KI7A 4OK3A 1FW6A 2C77A 1Q1QA 1KSGA 5FL3A 1DOAA 1SVKA 2JAQA 2QG6A 3ZJYA 1KI6B 1VCOA 5D3MA 1FQJA 2B8WA 4D80A 4IXNA 3QXHA 3GJ3A 2VTKA 1I2DA 4DCNA 4C7OA 4HDQB 1G16A 1XCGB 2GRJA 4MRNA 1Q44A 3RABA 3RC3A 2DFTA 4GOJA 4YDHB 5AUQA 1D2NA 2A78A 4OQXA 4YQFA 1E99A 3QKSB 5KSOA 2QP9X 3RRNA 2GEUA 1CJVC 3GLFA 2FOLA 2J7KA 4YXWD 5L3SB 5CK5A 1G3UA 3HWSA 3OHMA 3VQTA 4R7ZA 1GSIA 2H92A 3T61A 3TW4A 1QHYA 3U4QA 5JLJA 3AGPA 4URWR 4WA7A 1YRAA 2JLZA 2H18A 4KBGA 3BH7A 1UFQA 1XZQA 2EQBA 4KJZA 4HSEA 5BYKA 1EX7A 4MRVA 2G1JA 5CIQA 3FYHA 4Q7MB 1N6RA 2WWHA 1M7HA 3H4MA 1TF5A 3NBFA 1GM5A 2G3YA 3BRWD 3ZS8A 4RFSB 2XAUA 3GJ0A 2GAAA 1P3JA 3KXKA 4JLKA 1E1QA 1FP7A 4TL8A 2E9SA 1DAKA 5A0FA 1M7GA 1P2VA 5FBLB 3TLXA 1XEFA 4O2RA 4HI0E 1NVUQ 1W44A 2QI9C 4GZMA 2ONKA 4P4TA 4TT3D 4WIAA 2CCKA 1R10A 1D5CA 4A1FA 2HJGA 3NBXX 1AS0A 2V1XA 1TQ4A 3EZFA 3JVVA 4PC6A 4Z8YA 4BFZA 2R6FA 4RFVA 4M22A 2ZJ5A 3B6EA 3IO5A 3W6OA 3UKDA 2HYDA 3QXCA 3TIFA 1AS2A 1IAQA 3Q5EA 2ZM5A 4K8OA 2Q3HA 4XSGA 1T3SA 1BMFA 1Z0DA 2G77B 5JSZB 3A4NA 4YDSA 4OKSA 4FD2A 2K5UA 4EUNA 3QEJA 1R0ZA 5DSZA 3DMNA 2VP4A 2IHBA 3RS5A 4ZV4A 2OO7A 1XTKA 4YLGA 1G7SA 3GLHE 3WXMA 3H1TA 1NIPA 3RAPR 5FR1A 1XD9A 1FUUA 1E2KA 2QSYA 1OXUA 2I4IA 3LWNA 2IYUA 2BJVA 1P73A 5H68A 4PO8A 3KX2A 4M1WA 4C0HA 3FWYA 3L0IB 3CKLA 1FZQA 5LB4A 1CJMA 2AHOA 5F9FA 3G5UA 4KAXA 2XTZA 2ZI5A 4CT4B 4LYAA 4TLEA 2FSIA 2ZS7A 1OXXK 2P5SA 2YVUA 3D6TB 4OJKA 1OKKD 1QHXA 1PV4A 4EQ6B 2RGEA 4Q21A 3ADKA 5IF9A 1SVOA 1WCV1 3SFZA 3TRFA 3EWSA 2ORWA 3P32A 1BKDR 2WMOB 3QF4B 1D2EA 5FOVA 5FTKA 2CK3A 2ZI3A 3JZAA 2GILA 4ASUA 4QJ5A 5JEDA 1RYHA 1KAOA 1Z0JA 2FPLA 2W58A 3L0OA 3WRXC 1VHTA 3CX8A 1X8JA 1X86B 3WYAA 2EFDB 3KL4A 5AWFC 4OHWA 2VHTA 3RDPA 5KDDA 1J70A 2AXPA 3T1OA 2J87A 2ZRLA 4RVCA 4KBFA 2BWJA 3VKWA 3ZD6A 3AGQA 2L0XA 3ZZ0A 4HAWA 3EZ6A 3FHCB 1NJFA 2J7PA 4OI4A 1JECA 5FBVB 1U98A 1YR6A 1IY1A 3KJHA 4DSTA 4OJQA 1RW4A 1ZM2A 1YRBA 2ZJOA 1W36B 2IUTA 3H84A 1UF9A 4RKFA 3BBPA 5FUXA 5FUYA 1WB9A 4C0JA 4PQYA 2OLJA 2QPAA 4LK2A 2YINC 4DJTA 4PHTA 5EJEA 1VG9B 3QG5A 4MKGA 2YC2C 1XEWX 2ZIAA 1KI6A 1WXQA 3KKNA 4ZDIA 4JS0A 4PPQA 4DT1B 4DSOA 1R5NA 3IHWA 1EG7A 4JBYA 4URUR 2OG2A 4NYMQ 3OIWA 2OAP1 2ODWA 4OBEA 3DHWC 3GPLA 4XVUA 3QKSA 1YZGA 2F6RA 1G20E 4XTCS 1HTWA 1XTRA 3VNVA 4GL2A 2QROA 1G5RA 3QKTA 2BBWA 1AK2A 5EZ5A 2XJ9A 2Z6VA 2QORA 4QM7A 2YOGA 1N6KA 3IPXA 1QG4A 3VX4A 1ELOA 3EIEA 2QAGC 1NL3A 3H86A 4TYNA 3E70C 3LH5A 1W7AA 4Q1AA 5J40A 4FMCF 4V0KA 3QG1A 4PAMA 2NTYC 1DO2A 3QUSA 2A9KA 2MSCB 3P20A 1OYWA 1Z83A 2BM0A 2GZHA 3IKJA 2XEXA 2CLSA 5BXQC 1COWA 2GBLC 3B60A 2BDTA 4MYTA 5A5GA 3VKGA 4WXPA 1KGDA 4TYPA 4M53A 1HUQA 2FWRA 3U7EB 2JLYA 1Z6YA 1BYUA 2GXQA 2CHQA 4X8MA 3W9YA 2QMUA 3AF4A 4FN5A 1NMYA 3NDBB 4JYCA 4GSYA 4BUJA 2EWWA 1T3HA 2ZYUX 2ZRPA 5DYIA 1F48A 1R8QA 2X8AA 4JYBA 1VG1A 5HKKA 5CDFA 4JKIA 4KCGA 1GAJA 3GEEA 4FMDB 5JBQA 1SKYB 4D2IA 4Z8XA 4LHYA 1GFIA 2WWGA 2ZQ5A 4LUCA 3B1VA 5JSZA 5BQ5A 4GOKA 3GP8A 4NPHA 3MUFA 2DPXA 5DE3A 4ABYA 1XRJA 5KU1A 1FMJA 3HPQA 4KVGA 4KYIB 3PUXA 2ZUDA 1NG1A 2IK8A 2OFOA 2QQ0A 1SXJB 1DAHA 4NDZA 1EFRA 5FI0B 4B48A 4LC1A 1ZINA 3KUCA 4BFWA 4JIMA 2OILA 2W83A 2PH1A 4WZAE 5LD2C 4UNPA 4WAUA 1T8UA 1XCPA 4D81A 2XB2A 5EXXA 1YZTA 1WDTA 3FMOB 4PC7A 3W6NA 1KI3A 1Z47A 2GCOB 4LCBA 2HLDA 4XD7D 2EYQA 3PEYA 2ZSAA 1PZNA 3I4LA 2HT6A 4EQ6A 3B2EA 3GFTA 1ZCAA 2FFBA 3NDPA 2ANBA 1G7TA 1QHHB 1TPZA 3IPYA 2AXNA 2ZETA 4RD3A 1SVIA 4F4IA 3IO3A 2A5FA 1HT2E 1S8FA 2OCPA 4V0NA 1YR8A 3QF4A 4QGFA 1KZGB 4C0AC 1ZD9A 4IJMA 4BLPA 4TWZA 4DB2A 1LF5A 2GA8A 3I62A 1YE8A 3PFIA 1II9A 2A2ZA 2D7CA 4LZZA 1E2JA 1L2TA 3B9PA 2Z0MA 3SJAA 4M1KA 1HQYE 3DM9B 1P62B 5HTKA 4W9MC 1OH8A 4PZLA 1QF9A 4N0DA 3CF2A 2W6ID 1OYYA 5IHPA 4O25A 1N6LA 4US1R 4KVAA 4C3ZA 2NO0A 1OFIA 4TN1A 3MFYA 3W90A 3DOFA 4KFSA 4B74A 2PZEA 3GD7A 3G82C 2WJJA 2A5JA 4WXRA 1DE0A 3CR8A 5J4KA 3O8CA 3W8NA 4RZ2A 2CLDX 1RPZA 3RRYA 5DISB 1OH6A 4DCTA 2IT1A 2QT1A 4I4LA 4LBWA 2IWHA 2VP0A 3NTUA 3KXIA 4DLYA 621PA 3THXB 4D25A 1ZU4A 2IL1A 5JRJA 4QL3A 4WOPA 3B13B 4A92A 2PX3A 4M2LA 4P3YA 3RSLA 1HYQA 1UKYA 5HZHA 1OIVA 1VECA 2FPKA 3IIJA 1OV4A 2PX0A 3MJRA 3PVSA 4M9SA 4NE2A 3PIRA 5EE5B 1TQ2A 2W0MA 4IOLA 2ZRAA 3ETLA 2QNRA 4M4SA 4B2IA 4IVPA 3REFA 5FOTA 4DLXA 4RJLA 1ONBA 4RSGA 2PMKA 2N46A 3CLVA 3VHXA 1P75A 1GRQA 2ATXA 2ZE6A 4JL6A 4Q7LA 1ZP6A 1U81A 4ZIRB 2OEPA 4XSHA 4PZYA 1KZ7B 4HLUA 3A36A 1NSFA 3GJ4A 3SJZA 4HEJA 4RD0A 1M1YE 4RD1A 4C2TA 2ZITA 4DIDA 4TTQA 3VKHA 1IJEA 4Q4JB 5KNDA 3ASZA 1U2RA 1KMHB 4V0ME 5AJWA 2KJQA 5AR1A 4JMPA 3KQHA 2ASEA 2GZDA 1US8B 3V4RA 2KBEA 2A5YB 4AC9A 4QM6A 1T0HB 3SE0A 2WKQA 1IN8A 2CEAA 5K8TA 3U61B 3K0AB 4TLAA 3BE4A 4B35A 2VPPA 4KV9A 4BQSA 3U7FB 3AH8A 4I81A 3EPKA 1CIPA 1KO8A 5CLQA 3A1TA 1IOZA 2IYLD 5EQTA 2ZI7A 1UPTA 2VYFA 2QL6A 4W7SA 5G40A 3W34A 1ZM9A 1HH4A 3F8TA 3EC2A 4YMWA 5CLLA 5B2ZA 3N5CA 2IYYA 2ZRBA 3T1TA 2ZRGA 4YMSA 1OXVA 1ZU5A 3VNUA 2XB4A 4U02A 4BFUA 2ORIA 3GLIB 2AWNA 4GMXA 1NLYA 4CGZA 3QXXA 3T5GA 1OB2A 1HE8B 1ESNA 2RHDA 3EG5A 3X1DA 3AVQA 4A6XA 1CJUC 1JAIA 3DEFA 3WHLA 3A1WA 4BRUA 2HT1A 2B7BA 2VHUA 1SXJA 3FKSA 1YZLA 4P33A 5IK2A 2H7VA 3LBNA 1AGPA 5L3QB 2KB0A 2YJTD 1C4OA 3U7GA 2JA1A 4IVQA 3RANA 2W6JA 1W1WA 1N0VC 2FMXA 1S3GA 1JR3A 1XDBA 3DKVA 4I1OA 1E2LA 2FZLA 2GNOA 4C30A 1S2MA 5IRCD 2JLWA 1A82A 4PSAA 3R20A 1UBCA 1CR4A 3P4XA 1NVVQ 3OEED 4PXAA 4B3BA 2ZUCA 2GCOA 5CB6A 3B5JA 3QJYA 1IHUA 2WWIA 1L4YA 2ZR9A 4DHEA 1XPOA 1QHHA 3A6PC 2RGAA 4N1AA 4Q9HA 5H70A 1XTQA 3OAAA 5E7JA 1GTVA 1OT3A 3CBQA 3IQWA 3X1ZA 5FBWB 2GF0A 4LHZA 2WM9B 4QBIA 2NG1A 2JIZA 2QM8A 3RWMB 421PA 4EPRA 2JLXA 3AVWA 3CPEA 4MGIR 3W3ZB 2IS4A 3IIMA 2GCNA 2VP2A 4NMMA 5TY0A 1H8EA 2WJHA 5FBRB 3RRMA 2YZ2A 4JT2A 1SZPA 3SS8A 1Z29A 2NIPA 1IY0A 5TB5A 1P2SA 1G6HA 2ZU0C 3C5CA 4DVGA 5CB8A 1T4GA 1GL9B 5KSYA 4NP6A 2Q0HA 3CRQA 3W5JA 1JJVA 2ZROA 1F3OA 2FSGA 3P26A 3VTKA 4B75A 1NVXQ 2QQEA 2YOFA 2QPOA 1OFUX 4IOJA 4LY6A 3D31A 1KDTA 3F3YA 4NCKA 1CULC 4A36A 4GI7A 3K09C 4KLNA 2ERXA 1E9DA 1NLZA 2FSHA 4A8JA 3AM1A 5JZVA 1CF4A 1E1RD 1MO4A 1G3RA 1U99A 2WWFA 4UJ5A 3EZ9A 2XOKD 3UANA 3THXA 3IQXA 1AQYA 4E07A 2VBCA 3CWZA 1H8HD 1DEKA 5EXPA 1FTNA 1XWIA 1AZTA 1SVMA 3P4YA 4N3NA 1P5ZB 4Q02A 3PEUA 1G8GA 3TQFA 3EZ2A 5TARA 3A37A 4B76A 3ZLJA 4GDFA 2C95A 4G0NA 4IFBA 3UPUA 4BLOA 2ZTSA 3GLHB 3ICEA 4JBXA 3TUZC 2DFKB 3K9NA 3WNDA 5DGXA 2N1BA 1Y3AA 3SYNA 4DCUA 2DFLA 2J3EA 2ZU6A 1U9IC 3BB4A 2J1LA 4EPWA 3V00A 1E2PA 1KJYA 3KKOA 2DFNA 4FMBB 4J0QA 4K46A 1ZC3A 2NZJA 4YXWA 4KU4A 4ZIRA 2EFGA 4LBVA 3R8FA 3UG7A 4ERNA 2CVHA 3UMSA 2ZI4A 1J2JA 5C2JB 4OI2A 3WBKA 1DTSA 2P6NA 1TEXA 2WOJA 2QA5A 1U8ZA 2VH5R 5DYGA 2XJ4A 4Q4JA 3R7WB 3QPUA 5JJKA 1KMHA 1P7CA 3ASYA 1LS1A 1US8A 3QPWA 5KDOA 4F7WA 2WKRA 2IXEA 5KOYA 1MABB 4M9XA 2VSXA 3VX3A 3K0AA 1JXOA 5IT5A 5GJBA 2H1LA 3GLGE 4EPVA 4AKGA 4ILEA 1AIPA 3R9IA 4CIDA 1QHIA 5L8VA 5AUOB 3ADCA 4MYHA 1UBEA 1AQUA 2GHIA 1UKVY 2FFQA 4N0EA 4DCVA 3NH6A 3U5ZB 4ZCLA 5B64A 4TT3A 1AGRA 1E0JA 4MQBA 4EPXA 3T1VA 4JJKA 2JATA 5C18A 5JWOA 2YWFA 4XH9B 1ZM3A 3KKMA 4JVNA 2J59A 3S1AB 5FTNA 3SDZA 4AG6A 3I5XA 2QY9A 1S9HA 1K5DA 1R2QA 3B7GA 4DEXA 1KJWA 2ZSBA 3FHTA 1JPNA 3B1WA 2J45A 2R9VA 1RRFA 4TLCA 1Q1ZA 4LGMA 1T8TA 3NBZC 2CLCX 4HAUA 3DVLA 4EPYA 1ZRHA 1NBMD 1VKJA 1ZUNB 2ATVA 2LWIA 2IYRA 4S35A 3LQRA 4QNMA 1VG8A 5B57C 2ZAOA 1UBFA 3P1JA 5L3QA 1DAEA 1FOEB 1SQ5A 3B8HA 2P67A 1CS4C 3B82A 3FMPB 4L9WA 2J0QA 1TX4B 4XJXA 3WRYC 2Z4RA 3X1WA 4A2PA 4JT4A 4CF7A 4MYCA 4LV6A 2YV5A 3PQCA 1Q12A 4GOXA 1JAHA 2D4HA 4M1TA 1OJLA 3KXLA 4JLBA 1G64A 2V8OA 5J4VA 4DDTA 4NU0A 3QBVA 1G3IA 2PMDA 3LNCA 4PFSA 5HCIA 1HE1C 2W2TA 3TR0A 3QKRB 2ODEA 3VR3A 3VR4A 1S1MA 4D4LA 5GVRA 3U6KA 4V02A 1EFUA 3Q9LA 1Z6GA 3C15C 1E2FA 1OKKA 2PJZA 3QNUA 3RS0A 3UXMA 4DWJA 4TL7A 4D82A 1G8FA 2OXRA 3AVPA 4Q4HB 4QKQA 1N5JA 5FI1B 2QT0A 3LBHA 4YMUA 4A9AA 3WYFA 4NHOA 3OFND 4KSBA 1F60A 4ZDJA 3FMIA 2QGNA 1DG3A 2GAOA 1KI2A 1T3LA 3CH5A 2H16A 1FMLA 4B3GA 1NF3A 4W5JA 4FWIB 4F92B 2IX3A 4C0KA 1T91A 4OK6A 4LDJA 3BFVA 2B6HA 4B2PA 3ZIAD 3CWQA 4RD2A 2IA5A 1X3SA 3DO6A 1N0WA 5FL7D 4D26A 4IDQA 4NZYA 2DWQA 3SJCA 3QKUA 3VU9B 1K8RA 1XJCA 4QBGB 1YZKA 5GVSA 4X8LA 1ZUHA 3CH4B 1N6OA 1CR2A 3N2IA 1E79D 2WJIA 2ZR0A 4LJ4A 2QMOA 1G9XA 2VEDA 3GLFE 3D3QA 2OBMA 1AZSC 1KY2A 2BEKA 3M0EA 2WBLC 1WRBA 2QAGB 2VSFA 3HU2A 3GJ6A 5J4HA 1F2TB 4C2UA 1L7VC 4Q9KA 1NG9A 5L3RA 1W2HA 4B3FX 2OCBA 3AVOA 4XTRA 1L4UA 1OXTA 1Q20A 4ZI2A 2FEOA 1E98A 1CRQA 3QEOA 3EC1A 5GJVC 4DZZA 1KJZA 5KHOC 1EWRA 4URYR 4R71A 3ZDQA 2HUPA 3B78A 3AVYA 3GLHA 4B6FA 3QXJA 3PCRB 1N3BA 1F5NA 4MKHA 1NMXA 3OEHD 2HYIC 4HB4A 4CW7A 1N6PA 1NMZA 4Q1EA 4IHQA 1MH1A 2ZSDA 4Q18A 1IQPA 3QF7A 4AI6A 1GILA 1EXMA 1P72A 4NCJA 1G18A 2YWHA 2FFAA 3AVVA 1P6XA 3SJBA 4B33A 1GRRA 2FZ4A 3FDIA 2YYZA 4RD4A 3C5HA 2E1RA 3EW9A 3TBKA 2ZRNA 1E2DA 3R7WA 1WBBA 3T35A 1G19A 2A7QA 3MWKA 1ZAKA 4KO8A 4UXJA 1G6OA 1YZUA 1QRAA 4NYIR 1MABA 2WJYA 3EZ7A 3TVDA 1TMKA 1CRPA 4QHYA 4ZCMA 1KKLA 1DS6A 2VLIA 1T5LA 1BH2A 2G88A 1JR6A 1TUIA 3LV8A 2Y8EA 4HB3A 1X1SA 5EE9A 3LLMA 4JLPA 3AVTA 2DR3A 4URZR 1E96A 1II8B 2Q9BA 2UZ3A 2V3CC 1NN1A 5LD2B 5C1BA 3U44B 2AKAB 2WSMA 3HPRA 3TSWA 3S1AA 1NKTA 3TAHA 1OSNA 1FUKA 2VHCA 4KODA 4DIEA 2VHQA 4TTRA 3NIBA 3VR1A 1PVOA 1Y63A 1FFHA 1G4AE 1GIAA 5DN6D 1KAGA 1GG2A 1R8SA 1YU9A 4PO1A 1K5GA 3MD0A 1DBSA 1Z08A 4FMCB 3O8DA 1W4CA 3AF2A 2JLUA 1E32A 4I1SA 1OF1A 3I72A 3TR5A 2V54A 4S2EA 1XEWY 1G291 1XFAA 2FEMA 4KHZA 1MT0A 2GXUA 4G5GA 1Z2AA 1HV8A 2AK3A 1IJFA 3LVQE 2F3TA 2H57A 3A4LA 4QXAA 1NKSA 1R7RA 3IEVA 2P6UA 1A2BA 1KO4A 2NGRA 1OFTA 1EFTA 2IYZA 2ZYVX 3THOA 4DLTA 2PJRA 2CL6X 3KKPA 1GL6A 2XTMA 3BC1A 4PR0A 4Q4AB 2GXAA 4GRAA 3CF0A 2VHJA 3DL0A 1Z6AA 3DKPA 3QKRA 3W3AA 4KFUA 4W5WA 4WZ6A 3TH5A 5K8LA 1IN4A 1A4RA 5HE9A 1Q0UA 3K0FB 4BFSA 1QG2A 3HDTA 4XD7A 5EUQB 4OQMA 2O8CB 3E1SA 2IXFA 3KFVA 3HU3A 3BB3A 3E2IA 3PUVA 2A30A 2GCPA 2JJ1D 1OE0A 4Q4HA 5AJXA 1UDXA 4D4KA 4HUTA 4KFRA 3LVRE 1NVVR 2RGDA 5L3SA 3X1XA 1YR9A 3Q85A 1NY6A 3CZQA 4JVLA 1UKEA 4GP7A 4Q47A 2WSSD 2O8EB 4U7DA 2NOAA 3GEIA 1G8PA 3MG9A 1XEXB 4E22A 1D9XA 2C5LA 4B34A 3ZVLA 1KNQA 5JRZA 1R5OA 3DZ8A 1Z06A 2Z5FA 3VU9A 2KSQA 5KTYA 1AM4D 2W6IA 3W8RA 2GJKA 3NBYC 3K9GA 3T06B 5BYJA 2EYUA 3HYRA 1WF3A 2REOA 4RFSA 1Z63A 2QU8A 2EFHB 2FDCA 2ZJYA 3PEVA 4ZO4A 3QY0A 2ZVQX 1Q1BA 4HUQB 1Z2CA 2H17A 3AP1A 3RVBA 2OE2A 1G5PA 1PJRA 1YZQA 2O0HA 2VO1A 3SQWA 1M34E 1XP8A 2OXCA 3SHWA 1J8MF 5BN4A 1DO0A 4TLDA 2EFEB 4C0LA 2PT7A 4JSTA 3EPJA 2QAGA 2CJWB 3MJHA 4PPNA 2OV2A 3PUZA 5JCZA 4EPTA 1GZSA 5FTLA 4R98A 3CF6R 3HU1A 4DRZA 3LXXA 3HYTA 4LYJA 3UWKA 4UXHA 2FX3A 2J5XA 2GBLA 4BFXA 2ZAMA 4RKEA 5SZKB 1CTQA 3KB1A 4LPKA 2JLSA 3IGFA 2BC9A 2JLQA 5CM8B 4MGKR 4GBMA 4QFMA 5G53C 4I99A 4ZDKA 2W2XA 1VPLA 3LDAA 4Q4LA 4TLBA 3RC8A 1XPRA 2CBZA 4JJZA 3WNCA 1J90A 2F1RA 1F2UB 4UNQA 4F93B 4PHFA 4TQ9A 3K70C 1XXHB 1E2NA 1N5IA 2GK7A 3LQQA 1P4SA 3IUYA 3NKVA 2JJ2D 5F2EA 1CBUA 2H8KA 2N42A 4G1UC 3K1JA 1OIWA 2PZGA 4TSFD 1Z0AA 1NJGA 2D2FA 4HDOB 4AYTA 5E3HA 4TQUS 3CUEF 1NNEA 3KDSE 4KI0A 4QG7A 2R44A 5EP2A 1CEEA 5TXGA 1KDOA 1XTSA 3U60B 1GL7A 3GMTA 2YWGA 4TYQA 1N6IA 2V55B 2X77A 4NH0A 5JCPA 1T0JB 4BZPA 5JI2E 3QIAA 3MCAA 2WWYA 2BOVA 4D0NA 4US0R 2RGNC 1II8A 3EX7C 4PHGA 1MO3A 4Q9JA 2XSZD 4BWYA 5JMTA 2QN6A 4C0BA 3U44A 2BHRA 4TQAA 3KQNA 1BS1A 4DLWA 3R9XA 3OF5A 1GP2A 2GXSA 2O52A 4Q1DA 4D0LB 1SHKA 3LA6A 5DI3B 3EA0A 3KFXA 4IXMA 4LJ7A 3BOSA 4TMTA 3U2QA 4KITB 4OK5A 4UKDA 4EFMA 4E09A 4E03A 4RY2A 5JHGB 4Q01A 2CHVA 2RGXA 1OH5A 3R8CA 4JLNA 4LJ5A 4TMVA 2C98A 4CZ2A 2BBTA 2F7SA 3OE7D 1LY1A 2BV3A 3OIUA 1W0JD 4M9QA 1FL9A 3BWDD 2AR7A 5LBIA 3EIHA 4FIDA 1HY3A 3IHLA 3K0SA 4BFTA 4MITA 2CCJA 4Q9IA 1DARA 4Q66C 1RJ9B 1ZMXA 2EWVA 4HAXA 1I4DD 3ZQJA 2R8RA 1YJ5A 1AJEA 3QI2A 2BMJA 1ZCBA 2GZAA 1M7BA 1P9RA 4DT1A 2YKGA 1B23P 3OEEA 3K0FA 4QC2A 4AYXA 5DIFA 5JI3E 1OXSC 1VYTA 5LB2A 4JL5A 4LYFA 2NZ8A 3BB1A 3IDQA 3KQUA 2W0SA 1XB2A 4GP6A 4QRHA 1A7JA 4GZLA 3ADDA 1VIAA 4G5SA 4LJ6A 1J7KA 3AP3A 2MSEB 2VP5A 2ZS8A 3FOZA 2ZJZA 2HCBA 5DH9A 3WMEA 4PSVA 4NYIQ 2OM2A 4HB2A 1YKSA 2D7DA 1II0A 4L15A 4JVSB 1G1MA 2O8EA 3IEUA 5IDVA 2FGKA 1XEXA 1E9AA 3DDCA 1GDDA 2GETA 4PC2A 3TJZA 2GTPA 2O0JA 1MO6A 3CRW1 2FV8A 3WY9A 1FQKA 5CJPA 3Q7QA 2IHYA 2QM7A 3BERA 1I2MA 1OHHD 2HXSA 3C41J 1FTSA 4BLQA 2GKSA 2IUSA 3SN6A 3CRRA 2E87A 3C14C 5G3YA 1RRGA 4ZI3A 2PT5A 4EJSB 5KNBA 3RSOA 2GJSA 1RFLA 4Q03A 4NL4H 3EWAA 1SVSA 2CJWA 1WA5A 3N70A 2HF8A 1E1RA 1WQ1R 1T5IA 1VYUA 4CDGA 1EFCA 2EFCB 2GJAA 2XOKA 4LHXA 4F4JA 4IFEA 4NONA 5TDHA 3EPHA 4DUGD 1GRNA 4CVNA 2IS6A 1E9CA 4HLCA 5BN5A 2JDID 1H8HA 1EFHA 1JXMA 2YHSA 3HR8A 3PUYA 3BXZA 4IDHA 3EA5A 4HYYA 4A2WA 2EU8A 4Q00A 2D06A 4LHVA 1RKBA 4UNSA 2IEYA 5TV2A 5E95A 2HDNB 3T1QA 3BIFA 3BH0A 5B30A 1KY3A 2Z4SA 1F2UA 2FN4A 3L82B 3NWJA 2V1UA 1XXHA 5JWHA 3QPVA 5B58C 4E5UA 1NP6A 2D62A 4MH0R 4P31A 1IM2A 3A4MA 4DLZA 4TZ6A 4QOSA 1G8YA 4QBHA 4LX0A 3M4YA 1ZD8A 2ZJAA 2F3RA 1LFDB 4Q1CA 2B8TA 3TVTA 1SKYE 2GVDC 2RCNA 4OL0A 4YC7A 2FU5C 2ERYA 2X2EA 4HDCA 1ZUIA 1XJQA 2P65A 2HJVA 2R6CA 1LW7A 1W46A 1MV5A 3I3SR 2MMCA 5DNYB 1U90A 2WWWA 1HT1E 2OBNA 1VMAA 4TMKA 4B3CA 5EE3A 3UWOA 1EGAA 1N5KA 4LPSA 5AUPB 5F9HA 2R6DA 2F55A 1T6NA 2ZUBA 3K53A 1ZNYA 1KYIA 1QVAA 1MOZA 2A5GA 1N6HA 3NEJA 4Q19A 2ZREA 4FI3C 1TL7C 2FG5A 4IVRA 1JR3E 3KB2A 1IXZA 4TMWA 3MAAC 4DLUA 4BECA 5ANRB 3THYB 1TU4A 3CB4A 2B21A 1JB1A 1X1RA 2VL7A 2W00A 3CRVA 4H1UA 3RS3A 3T15A 4TYWA 2YWEA 4C4PA 3REGA 2O8BB 3QBTA 1XPUA 1AKYA 4MKIA 1K6MA 2F1JA 1O87A 3GLFB 4BE7B 2WZQA 2P6RA 4EFNA 2QP4A 2CNWD 3WNBA 2R62A 5FPHA 1S3SA 2FGJA 3CZPA 4KXFB 1NBMA 2CCGA 1YZNA 4A8JC 3MRSA 4RZ3A 2OT3B 2PEZA 4H9GA 1ZM7A 5H8WA 2ZVPX 4AIIA 1JQLB 4YMTA 2ZS9A 1RJ9A 4ESVA 4TYYA 3BFXA 3TAUA 4W5HA 3CNOA 1UEJA 2ZEJA 3I32A 4DSNA 2KI5A 2Q6TA 2BEJA 4DLRA 4JKYA 3KTAB 1DPFA 4P0TA 4OI1A 5GJWC 3GJXC 3QQ5A 1TUEA 2I1QA 3AEZA 3H0KA 4EKDA 1I4TD 5E4FA 3UMRA 1E0SA 1E0KA 1Q1EA 3EXAA 4URVR 1T9HA 5FTMA 5KNCA 2NO6A 3A1VA 4YONB 2BMEA 2DCUA 4C9BA 3DZDA 6Q21A 2WPDD 4LJ8A 2ZRCA 3W6PA 3B1ZA 3OFNA 1VCMA 2WHXA 2XNDD 4EDHA 1PLLA 4FCVA 1Z3IX 4HZIA 2UKDA 4FCTA 2QMEA 4LJAA 1VCIA 4H1VA 1S9DA 2KWIA 4NYJR 4AKHA 3VHLB 1WP9A 3ZIAA 2IYSA 5EP1A 1D6JA 3LW7A 5FL7A 1HEIA 221PA 4BEBA 1G7RA 1WE2A 1D9ZA 3WHKA 1KO5A 4QBFA 4M1YA 3M1IA 4EJSA 1KMQA 1Z8FA 3VR6A 2WJGA 3ZS9A 5JJIA 2J9RA 4KSCA 3QVVA 3BH6A 2GJ8A 3TGPA 1RVDA 1CLUA 1RC8A 1Q21A 3KJIA 2PEYA 4HAYA 2ONJA 1V43A 4RZUA 1KSJA 3QOFA 2HF9A 1A1VA 5JFGA 1W4AA 1ZNZA 4Q5IA 5HZKA 2XZOA 2ZYWX 1JALA 2Q3FA 3SU8A 2ZE8A 2V4ZA 3SYLA 2ODBA 2NO7A 4HZUB 2FSFA 3UMFA 1QVRA 2REBA 3GLIA 1QHGA 1KI4A 3ZQ6A 2BBOA 3QENA 5A4JA 4G5RA 1UJ2A 3LX8A 1EWQA 3FTQA 5FOWA 2JLRA 3IIKA 2V7QD 1NIJA 1RYFA 1ZVQA 4BEJA 3JZMA 3OEHA 3ND9A 2IW3A 3MWYW 2ZRKA 2OCYC 2WICA 4M1SA 2G6BA 3PG5A 1P2UA 3FHOA 3LLUA 4G3XA 3ZD7A 2D3WA 1NLFA 1NRJB 2WMNB 3TMKA 1XD8A 3K0CC 5E7MA 2WKPA 3AF1A 1R0XA 1PLKA 4M21A 2G0NA 1AN0A 3L43A 2XZLA 3Q72A 1QHSA 4HATA 3EASA 3CNNA 3GJ7A 4LI0A 3R9WA 4MDFA 4O2LA 1BOFA 2QE7D 4BFVA 2REXB 4WBSA 3LO5A 3F0TA 3SC3A 1R4AA 3RS7A 4O3MA 5L3VA 2IWRA 4XVRA 1OIXA 5KUTA 3PJRA 1Z0FA 1N2CE 2D74A 3NHBA 1XX6A 1C9KA 3T5DA 4AURA 2RH5A 4A4DA 1GOTA 1U0LA 4LHWA 4U5XA 2ZPTX 4RD6A 5DI9A 2J46A 1E4VA 2J0SA 3FE2A 4A2QA 2QMHA 1OW3B 2Q9CA 5EP3A 2CMKA 2OUKA 4PAOA 3RHFA 4D6PA 3THYA 3RWOA 1LNZA 1W48A 2OFXA 3LD9A 3X1YA 4AY2A 2QRZA 5G3ZA 2P0EA 4FXPA 2O8BA 3MLEA 2DBYA 4PC1A 5FTJA 1TEVA 5DN6A 5BN3A 1XF9A 4Q9LA 5CYOA 1NN3A 2J0VA 3IILA 4PPFA 2KE5A 2IUUA 3AVUA 1MRNA 1GUAA 5KSPA 1VIYA 2Q3MA 2XNSA 4WW0A 5CYPA 2HCJB 1XJ0A 1DAGA 3CPJB 1KOFA 5KPDA 4RZXA 5K8UA 1XMSA 1ZW6A 1TU3A 1NY5A 3WP0A 1GWNA 2GF9A 3NVAA 4GMDA 3SYKA 2ECKA 2JJ8A 2ZRMA 3MWJA 2OCAA 4LSGA 4P4SB 1W0KD 1XZPA 1KSFX 1E4YA 1XTIA 2WAXA 1ETUA 2J0UB 3TKLA 3D8BA 3KTAA 2GWHA 4F91B 2QAJA 1GKUB 2MSDB 3OIVA 4XVQA 4IDPA 1LF0A 3NHAA 1E2QA 1XMIA 3O47A 2AD1A 2VF8A 3AKEA 2Q21A 1KNXA 2X19A 2C2HA 3SR0A 1XMVA 2ZI9A 1QHNA 4OI0A 4Q1BA 1Q57A 2JJ1A 5JECA 1YHNA 1IXRC 1YR7A 3THWB 1JNYA 1PLJA 1MO5A 1KI9A 4B73A 4JLOA 3K9HA 3TSZA 1SKQA 1UKZA 5J5CA 1KHTA 4Z1MD 1UM8A 5M04A 2WSSA 3NEYA 5HCNA 3TW8B 3ZYCA 4AKIA 5ELXA 3HR7A 4R9UC 3OIYA 3C4JA 3DOEA 1KKMA 1NN5A 4OHZA 3TUIC 2C03A 4B2LA 4HAZA 1FX0B 2FF7A 1SVLA 2LKCA 4JLVA 5C4GB 1G7CA 1XNJA 1O3YA 4IOKA 3C8UA 4C0SA 2CXXA 2RMKA 4M9ZA 4Q48A 4A82A 1L8QA 4JLMA 5CITA 3K70B 4DSUA 1CP2A 4L9SA 2IBMA 1OFHA 1OH7A 1N5LA 3D7MA 2IYQA 5FFMA 3PXGA 2EW1A 4QHTA 2R65A 2JGNA 4CEHB 3LBIA 2FFHA 3IBYA 1KTVA 1UADA 3L8YA 5FOUA 2QBYB 1DELA 2ZJBA 5HE8A 1QBKC 2B92A 4HZUA 1Z0IA 4L4UA 2A5DA 3NXSA 2CL0X 3CM0A 1CJKC 2GK6A 2PCLA 1IN5A 2XZPA 3Q8XB 821PA 2EVWX 1RE0A 1E69A 1VDZA 2HEIA 2QTVB 3QVUA 4QNRA 4LYHA 4AK9A 4B44A 4AKEA 1DAFA 4ZKDA 4PX9A 2WV9A 3I8SA 4CEJB 2IYXA 2NO1A 3FFAA 5CIWA 1TTTA 1HA3A 4TMXA 4LWZA 2AFHE 5FUVA 2MMGA 2JEOA 1DADA 4MRRA 2IS1A 3LW8A 2ZSEA 5EXTA 3UIEA 4XWKA 1Z6XA 1CR0A 2C9CA 1IBRA 5FBQB 3B1XA 3O8BA 1BO6A 4IKEA 1AS3A 4QHSA 4X8OA 4BZQA 3WBJA 2JJ2A 4L5BA 5FOXA 4XWAA 1BIFA 3L0PA 2QZ4A 3U3KA 1BYIA 4P32A 4TSFA 1ZIOA 1LVGA 3KUDA 2AX4A 3K9LA 1E1QD 5LDDC 1RRCA 3ONWA 2BIFA 4TTPA 3O8RA 4JLDA 1NN0A 2CE7A 2Z43A 4M0LA 4CYMA 2YOHA 2RKOA 4LV5B 5EUMA 3AUYA 3A8TA 4DLVA 4NYJQ 3L2OB 4AYWA 3B85A 1KO1A 3VAAA 5JWRA 2QTHA 2ZRIA 4Q7JB 3SQXA 1TQDA 1FP6A 1IY2A 3KQKA 1V5WA 2XSZA 4JL8A 1JBKA 2W2VA 5FUWA 4A0RA 4GNKA 4II7A 4RCZA 1NSTA 1E2GA 4PTLA 2VSOA 4BASA 2ODNA 3VFDA 1W5TA 1BMFD 1ZNXA 3KZ1E 1E9FA 2P2LA 3WMGA 4EFLA 5JHHB 3VMFA 2ZXUA 2BVNA 4A15A 4TL9A 4ACBA 2XX3A 1GNRA 4Q7KA 1G4UR 1QZXA 1GITA 4I1VA 3AUXA 3CIOA 3SHFA 2F43B 2Q9AA 3V4FA 1J99A 1ZC4A 1P9NA 4NTZA 5C4MA 3OE7A 2CE2X 4X8HA 2F9MA 2GEDA 1X8LA 1W0JA 5HR5A 1MKYA 3CRMA 1OPXA 2VIIA 1GNPA 1J8YF 3EIQA 4P4SA 2B7CA 1F2TA 3TUJC 2FE4A 3KKQA 2J0UA 3A1SA 5JS7A 5K8IA 1ANKA 2UZIR 2RAPA 2JLVA 5LPNA 1SHZA 2IYTA 2BCGY 2YC4C 1DAMA 5JS8A 2IF2A 4PAQA 4L8GA 3C16C 2AFIE 5AJZA 2AKYA 3ICQB 1Q22A 1TF2A 4IEIA 1E9BA 5J47A 1W5SA 4UNRA 2CK3D 4ASUD 1GKIA 4MA4A 1A2KC 4LOAA 3JVUA 3THWA 2G0TA 5FOSA 1U0JA 2QTFA 3QE0A 1Z5ZA 4ZCIA 2IC5A 5KO2A 4BLTA 3LXRA 3RRZA 3LY5A 2AL7A 2V6JA 2GVZC 2CVFA 2PLFA 3EAQA 1WMSA 1SULA 3NC0C 4ITRC 1XD2B 4K81B 1U0HC 2ZE5A 3AB3A 2GDJA 2VA8A 3QXSA 5KDLA 4DDUA 2O0KA 4BGDA 5SZHB 3MWLA 1Z6TA 4BLSA 2ZANA 1YVDA 2P3SA 3CX6A 1G17A 1FX0A 2PLRA 2CDNA 2J7PD 2VQSA 5CDFE 1CJTC 3SI7A 2JASA 4OYHA 2VP9A 2C9OA 4TL6A 4ZDWA 2DY1A
chains in the Genus database with same CATH superfamily
2C7GA 1M2FA 1OHHA 2HA0A 3WQHA 1I5EA 3ZPXA 4HTFB 2C5FA 4IIXA 4RC9A 4LJYA 3TE6A 2CHEA 5G4LA 4CMGA 1E3MA 2QRNA 4DPLA 1OOEA 4QDJA 1CS0B 1XRRA 2DWOA 3QMMA 3RTEA 1XROA 3UMGA 4CM7A 3TGLA 3FKQA 5LYJA 3H1GA 1YVEI 3FOFC 3F6SA 2DYKA 2DUMA 3RK1A 3UBTA 4YPOA 3AU8A 2FXIA 3Q7PA 4JLJA 4YP5A 1NX9A 3COZA 5FR2A 3VKVA 1N2SA 1W4BA 3MGBA 4JBIA 3K9FC 3RSSA 3F9RA 3T1HB 1TVKA 3C6QA 2PZFA 5INTA 4ND7A 2O8DB 2GESA 2A86A 2QSUA 2EHJA 2VPTA 4RORA 5FNVF 3P96A 2I9KA 2QEQA 4NR0A 5KNLA 3CUKA 3D1VA 2I34A 4KK4A 3RJMA 1RADA 2BGMA 4JB8A 1Z2EA 1G55A 2I1VB 1UAAA 2CUZA 2F1KA 4FSHA 4FEEA 2G17A 5EJ6A 2I71A 2OCDA 3AOGA 2NPFA 3UJPA 4EGFA 2RGNA 3LPCA 4HPXB 2ZKLA 2GRUA 1OLOA 2VRWA 4FYKA 4HVAA 4O5OA 2FMFA 1E3SA 3AYZB 3HA2A 2YN2A 1KBZA 1EAMA 1GCIA 1Z28A 2DERA 1JE1A 1W2GA 4FMDF 3AI2A 3PITA 3HCDA 5IKMA 1U94A 3GJSA 2WWXA 2ZBQA 2NV6A 1NQOA 3GFPA 4KLZA 1NVWQ 2G1PA 1W30A 2SHKA 3IELA 2XF8A 4UM7A 2B36A 2YWCA 4M60A 5CT4A 3BL5A 3EN0A 3VM6A 4P6VF 4EHKA 1OAAA 5JAQA 1FRQA 1KK2A 3IP9A 3U49A 4JSYA 2H2GA 1OLXA 1SVWA 1IONA 3WLHA 5DB4A 4FCWA 4Y0VA 4ZZ2A 2IF0A 4NIMA 2QUZA 3T0IA 4BGIA 3I0ZA 1HSZA 3UWMA 3KSMA 3UMCA 3KU1A 2G04A 4KQ9A 1UMDA 2DJ5A 2EERA 2F2TA 2ZRHA 4C0QC 2TMKA 4IW3B 2RSLA 3R74A 1EBBA 5LU9A 1H4QA 3JARA 3HI4A 3PDIB 2NO9A 4RAOA 4NNJA 3DAPA 1ZZEA 2PXAA 3BS4A 4K87A 1FUIA 1IJBA 1Y1SA 3PWSA 1V4VA 2Z8ZA 5LQMA 1YVUA 3G8YA 1OC2A 4I9UA 4PF1A 3AXSA 1KS2A 2XTJA 1OLSB 3HA3A 3GXBA 1EVZA 3K6KA 3WL6A 2G9NA 2I1WA 5ALRA 3WKAA 5CEFA 5EHXA 1CUUA 1PFVA 4JI2B 4X3PA 3IKTA 3UJNA 4UE6A 3E3MA 1B0UA 7REQA 3MGCA 4XQCA 3LQ2A 3TOSA 4ZVVA 1KERA 1EI9A 1TTQB 2WI8A 2XAAA 3DH0A 3R0ZA 4Y0AA 5J2UB 3D59A 2B3TA 3RC7A 1YC5A 3NCHA 1GU7A 3AP2A 5BQOA 3UK7A 2O8FB 1KETA 1XMJA 3F7NA 3AQ4A 1M5TA 2ZR7A 2NU6B 2XMGA 3AEYA 3RLFA 2CSXA 1PZFA 1SGWA 3I39X 2C78A 1CU1A 3WWZA 5K8VA 2QOEA 4V0LA 1R27A 4GMFA 4K6GA 1X70A 3ZQUA 4J49A 3L7MA 4CXMA 3GFOA 1SD1A 2OLKA 3I1FA 3F98A 2QUKA 2LCFA 5DCYA 2ODAA 4CKWB 2JCYA 3BD9A 4BCDA 4G01B 2FPIB 5CJ2A 2DPGA 4NS1A 3VVLA 1DFHA 4KE6A 3H7AA 4EVRA 3EEQA 4HPWA 2HTEA 4CIVA 1Z6ZA 1GPMA 2DWPA 1NOJA 2EX1A 2HLDD 3GEHA 2FG7C 3IQEA 3MILA 1HETA 3A9CA 3NT2A 4JGBA 4Z51A 4DJ5X 5IMBA 3M6FA 1SU6A 2GEVA 3QE2A 4WZBE 4DUYB 1PWXA 4G0OA 2EZTA 3A1UA 1KZ1A 2CFSA 3F96A 1MCZA 2OVFA 3O1JC 4I6JA 2QRHA 3PENA 5DYWA 3WISA 3FRJA 2DWUA 5BVGB 4OYRA 5G0UA 2UYOA 4WKNA 5ER6A 4BFYA 4J1TA 1GPYA 4BO7A 4IKPA 4I1UA 2N3ZA 3OZTA 4FDLA 4YWJA 1J0EA 4BGVA 3I58A 1PUJA 1R15A 2C8VA 1XZKA 2OCLA 3V3TA 5FULA 3EXFA 2PYZA 2BM1A 3KALA 4H1HA 1SXJC 2UYHA 1LBHA 2NQ2C 3FETA 1H5NA 2GEKA 3MSCA 1KK1A 1Z12A 2GYYA 5CB4F 1UODA 1I2ZA 2LXNA 2CUKA 2HZ7A 3N9IA 3BCRA 4L16A 4UQOA 5ELLA 2YMQA 4D6XA 4JJGA 3LFTA 4R2HA 1EE2A 1GGVA 3LY7A 2EKZA 5AT1A 3TIXB 5IVPA 2WHYA 5KJ6A 4EAQA 2WZBA 3MHTA 3S5JA 2Z57A 4REQB 1KH2A 1O5OA 1Y4UA 4A0HA 4DLBA 3PTAA 4B3IA 5IYZA 4GLOA 3BGWA 5DGCA 2C3UA 4BFLA 1Y33E 4RIFA 1PRYA 1PQUA 4YFVA 4YV0A 3DDNA 4B7UA 1ZI8A 4MEJA 1HXHA 1YQTA 4AMZA 4CG3A 4DC0A 4RK4A 5JQGA 4KXVA 4FFSA 4R1PA 4ZAFA 4TKZA 3F9IA 1I4LD 2PKWA 3B52X 4JUAA 1DRWA 2VXBA 5EZ6B 1Y3FE 1FXSA 4B7AA 5JYEA 3AKCA 3T9CA 4ZAWA 3KYDB 1I3KA 1Z0KA 5AOBA 1U8AA 3BAFA 4RVDA 1N2GA 3PNPA 3MNFA 4GWLA 1P2DA 3KKLA 2ANCA 3OTHA 3K9BA 2WK1A 3EGIA 3C7KA 2FTKE 1C50A 1Y6QA 2WNHA 1W4RA 2JFQA 4S1TA 4XRRA 3O2NA 4G4SP 3I5YA 2ON6A 2XXJA 4W63A 2C4TA 1KDVA 1S0UA 2XKKA 5NLLA 2ZXFA 1CEQA 2OZEA 4J1NA 4TS1A 3DG9A 2OFWA 2OGUA 1L5SA 2TS1A 1ZMRA 2WC1A 5EIAA 5A5DA 2XBMA 4DV4B 1N8TA 3TLBA 2Z95A 4HDMA 4MS4B 3QMPA 4MV5A 4R6XA 4BZWA 2BCJQ 1ZGAA 5G0SA 4RMNA 4QJ3A 5IJWA 3AEQB 5HZMA 4UAGA 1MENA 4FDMA 5EN4A 1OU4A 1CR1A 1XU4A 3UV3A 2R85A 3FVQA 3DFFA 3K5WA 3OQIB 1P9WA 1QK4A 4ZMBA 5A05A 1JYSA 2AZDA 4DWVA 1WXFA 1U8TA 2FOIA 4FC7A 4G8CA 5CVCA 3RW9A 1RXWA 4P4UA 1L7MA 1N0UA 3WWOA 4RH0A 8OHMA 4HH4A 3AV0B 1QAOA 1CF9A 4Z53A 1KY4A 5HA5A 3ANYB 1DTEA 4NATA 2OBBA 4EW6A 4XGIA 2X6RA 4G67A 3AMVA 2IZ1A 3F3KA 4AJ1A 5IEBA 4HWOA 1PQ4A 1Z9BA 3PGKA 4FFBB 4LOHA 4E3WA 4ZC8A 4G5QA 2Y0CA 5FI3A 3U3MA 1TFRA 1VFNA 3COPA 1O54A 2V0NA 5AJTA 2I87A 1B4DA 3UG6A 1ODFA 1H2WA 1D6MA 2X1VA 3KSUA 3P2YA 1XWWA 3E3LA 3TK1A 4UTRA 3UGQA 1XALA 5KTOA 2H5LA 4RTPA 3UJ9A 2IP2A 2IW1A 1EX6A 1P91A 3QSGA 3IPAA 4CKCA 5BVHB 1J2YA 3FDZB 2JGLA 3GAMA 3PZRA 4R8LA 3W1EA 3WMFA 4ACAA 4TS3A 1BEUB 1GSAA 3F71A 4M54A 3UBMA 5T4HA 3W5IA 4PZZA 2I6XA 4E31A 4EMUA 5AVRA 2I8LA 4DV5B 1EIWA 1KK3A 1YS6A 2XITA 4D4JA 4L78A 4CQMD 2YS7A 2FDRA 2F9LA 4JUDX 3ZWMA 3ZWWA 3EG9A 4EB6A 1R0YA 3O2SB 1U7HA 5TMEA 4TXLA 1EQAA 3PPVA 4OG2A 1GQOA 4V0OA 1FLNA 2V7XA 3BILA 2X8WA 1KDPA 3NDJA 4D0GA 2O5VA 4IJQA 4ES6A 1R5BA 1XLTA 2R3SA 3VYWA 2W6JD 2XODA 5AW8A 1R4MA 1ST2A 4RTOA 3KCNA 3AIOA 3QPAA 3OH8A 3AVXA 4RELA 1INLA 3C4QA 1B0AA 2YVQA 2KBFA 1YBHA 4OQFA 1P0QA 3UT5A 3D3WB 1SIWA 3AG5A 4KDRA 1AKEA 1EZZA 4XIFA 3X44A 1ZIDA 2NN3C 3B38A 5CLJA 3V8VA 4Y2GA 4HQOA 3M1LA 4FFDA 2ABWA 3ZG6A 5KMGA 4PC3A 2QGZA 2ZSIA 4HB0A 3JQGA 1OTHA 3IIEA 5AKEA 4JEIA 3N2KB 1H85A 3AKDA 5T4BA 1FPMA 3IULA 1EH5A 1GGKA 4TS4A 4KRFA 4JYMA 1JEDA 1GGMA 1Q2XA 1MAAA 3UATA 5I4CA 3MFQA 2BFMA 1UXGA 2OORC 4M1ZA 3RUEA 4FZJA 1IBLB 4PHHA 3KPWA 1U2ZA 4L72A 5GJCA 4DXAA 4MGZR 5IBCA 2JIZD 5JOQA 3VDRA 3B9RA 1ZBDA 1ODLA 3DKKA 3PZBA 4HG2A 4FD3A 4ZC1A 3GQVA 1PF7E 1H9AA 1S1CA 1MEJA 1H8ED 1XYYA 3DHYA 4EHHA 1DRUA 2FG6C 4KNWA 4WVFA 4DBLE 2MR6A 3GWGA 2VP6A 4LJ9A 5F2OA 2BEWB 2G80A 3V1TC 4BEWA 3EF0A 5SV2A 5KWEA 1OBOA 4X7PA 4BB0A 4O4LF 1EFPB 3AR2A 1N1EA 3GD5A 4I4IA 4MYUA 4C22A 4ND2A 4AG5A 2QPTA 5BUZA 1DVRA 3LKZA 4Y2JA 3JPWA 3M6XA 3MWDB 4CRWB 2JCSA 5AW5A 4AJHA 2AMJA 3RUPA 4U5QA 1N3IA 3CNLA 4JOBA 3JAWB 2FPMA 2VDQB 3PYMA 4IUBS 4WK2B 5UKDA 2SICE 3SQOA 1TIPA 3GLIE 2EL7A 3ZZUA 3U7QA 2ZUEA 4ZO8A 1DAIA 3GFQA 1JJ7A 1BJKA 3N8IA 4X60A 5BQPA 4HGPA 4C6HA 1R0KA 1S02A 4YRJA 5LQAA 4ZOLA 2W5UA 1DKOA 1UXJA 2D54A 3I92A 4XJSA 3M9LA 4YASA 1TTHA 2JFOA 2ZP1A 1G9SA 3A6EA 3PC3A 4AZTA 3G0HA 2HXGA 4KBYA 3JR3A 1UDWA 1T1JA 1Z36A 2VJAA 4HLNA 1RCFA 4N6GA 4Q3NA 5DCUA 1VPVA 2C77A 3K4PA 1SVKA 3LPNA 2JAQA 3BMNB 3ZJYA 4C3VA 1KI6B 2GBFA 3DE7X 4QVKA 4EO9A 2B8WA 2AJDA 2GAIA 3AYXB 3I2GA 1IDN1 1NFFA 1NQVA 4XB6B 4KPGA 3GJ3A 1UMBB 2VTKA 4Z1OA 5COBA 1V8DA 2CLFB 2VEOA 4NJEB 1E20A 3DEHA 3T4EA 3RC3A 2DFTA 3K15A 4DMFA 4U7JA 4GOJA 1BE1A 2A78A 4UW9A 1E99A 5KSOA 4F6RB 2GEUA 3ETDA 2FOLA 2VUUA 4GSKA 1AKNA 4HY3A 1I7SB 2JLAA 4RM3A 3HWSA 3VH1A 3U37A 4NLLA 3MXTA 3RU2A 3Q8MA 3LHSA 1XAJA 3T61A 1QHYA 1WUKS 4U7PB 4HWSA 4U8GA 1XTPA 1QGDA 2H18A 4NWIA 3RTDA 2BMAA 3BH7A 3L8HA 1G98A 2EQBA 4JC4A 2BFEA 2HADA 3W5VA 4CIAA 2WF7A 2LIPA 3KR2A 4G0UA 1DINA 1FSZA 4IILA 3CINA 4MRVA 4OA5A 3HZRA 1NNSA 4MI6A 3E8XA 4YAWA 5LBUA 1M7HA 1HRKA 4O02B 3E15A 3AESB 3MT8A 3W9BA 1DP4A 2GAAA 4MARA 1E1QA 1FP7A 2R1VB 3DONA 4TL8A 4IQ0A 3SC6A 3GIDA 2MIIA 4NV3A 3KEMA 2HW8A 4D41A 5ICEA 1OPRA 1SOMA 1ATIA 3EBOA 4YDRA 3TKAA 4HI0E 4BVKA 4IXWA 4WLNA 2ONKA 1A5BB 1G2PA 4QPZA 5JS1A 1D5CA 4WJLA 1N2HA 2HJGA 5GGXA 4J8PA 1SCIA 1TQ4A 3JVVA 1W35A 3DBRB 4PC6A 4Z8YA 3WZ2A 1P1KA 1T25A 1VKOA 2PBLA 3PFKA 4NABA 5CNMA 1IK6A 1KHHA 3WGJA 1FLVA 2HYDA 4RKRA 3L7DA 1WY7A 1FXUA 4QOGA 1JQEA 5BRAA 5JLAA 2Q3HA 2XWSA 3V8PA 3IEKA 3DHEA 1DPGA 5HIMA 3O4VA 1NVKA 1PEYA 1VHQA 1W93A 2G77B 3WZLA 1J56A 3IA7A 4FOOA 1W1IA 4YUYA 5JSZB 4YDSA 5AYVA 1P31A 4L6AA 4EUNA 4LG1A 1BRTA 1FFDA 3N2ZB 3NQ41 5LQKA 1P8AA 1NVDA 3REQA 2VP4A 2XNKA 3OKCA 4R1TA 1HLPA 2A92A 2VPZA 1D4OA 2HN9A 3NRJA 4UEQA 3SQLA 3WXMA 3H1TA 4E6PA 2VHZA 4I8XA 1G42A 1XD9A 2PS9A 4L9RA 5C5DA 1OXUA 2I4IA 3U4HA 1G5HA 2F4VB 2YFYA 3KX2A 1C7IA 1D09A 3O90A 4JB3A 4RMIA 3L0IB 5ENZA 1NT4A 3FW1A 4IZ6A 1D4FA 5H02A 1E6UA 3G5TA 4GBED 4E2ZA 5F9FA 3GCZA 3G5UA 3NGXA 4I4TA 2XTZA 2WFMA 3VR3D 4I5DA 4LYAA 3VR4D 1CK4A 4J29A 2FSIA 1W96A 1LWNA 3CPSA 3OIDA 4QO8A 4OJKA 4FZ5A 3ZHRA 4IUDS 3ANXA 4YJ3B 4CLDA 1HKHA 1QHXA 1V6SA 1FYVA 2I6UA 2RGEA 4ND1A 3UXYA 4N47A 1B8VA 5TEVA 1Y5RA 3DDUA 4LOIA 4M0MA 4ZZ3A 2QRJA 1YRWA 1WCV1 5C7OO 1QZUA 5IF9A 3P32A 5ALGA 4PNEA 4U0KA 2Q6IA 5DGIA 3TXXA 1HDEA 2J85A 2CK3A 1FP4A 2GILA 4QICA 4PX3A 4QJ5A 3M9WA 3TZEA 3HCPA 4AY4A 1EE1A 4EY3A 2YCBA 3CN9A 1ZH4A 4K9LA 3P4UA 2J9FB 1A9ZA 1U3FA 2I54A 3NTVA 1GKLA 3WYAA 3A27A 3ETHA 3IKLA 4AF8A 1L5OA 5KDDA 3KTOA 1I10A 3HA7A 3PC8A 4GM0A 1J70A 2AXPA 1T35A 1TAQA 3GZNB 3KPVA 3KR1A 4AT1A 1UJ6A 1Y98A 2UZ1B 2XDWA 3AGQA 2L0XA 3O21A 3ICWA 3DTVA 4IGFA 4MCIA 3RWBA 4AUNA 4KW7A 4UZEA 3HKBB 3JQRA 2YW2A 1BHJA 1RM0A 4RK7A 1M8GA 2I4TA 3SS7X 1DT5A 3IV6A 3WL5A 4JDUA 3O31A 3RJ5A 1HKUA 1R12A 1QIDA 1Z5PA 5IC4A 1KORA 4WT7A 1N9GB 4NNPA 4RKFA 5CVVA 2I6FA 3RREA 3UCEA 2OD2A 1DQZA 4XFKA 4BTEA 2NP6A 1X39A 4RV4A 2EIHA 1K6EA 2OLJA 1X3LA 1ZXBA 4HGZA 4LK2A 4PHTA 5IKPA 3UMMA 4DAOA 4MKGA 2AS0A 2RKWA 1QH1A 1XEWX 1G5QA 2PR7A 2YC2C 3KKNA 1TM3E 1U2GA 1YRQA 3VV2A 1D8AA 1GPUA 4BO8A 4L5JA 3I09A 4RV9A 2Y67A 1BW9A 3DDZX 3QWAA 3TIIA 3VO9A 1Y9ZA 1IXKA 3NJ4A 1X1EA 4OBEA 1B3RA 1C1DB 1TYEB 1HWYA 4NMLA 1JXAA 5EMLA 4OGFA 2FP4B 4LTDA 4EYQA 2I9PA 1YZGA 3WK4A 1U0BB 1Q92A 2F6RA 3G23A 4P36A 2Z58A 4O1HA 3H8WA 4GL2A 3GUCA 4GQBA 2FWIA 3UXEA 1JDZA 4C7VA 1BVHA 1QQAA 1FTGA 1MVOA 2O2ZA 1RABA 1GZHB 4IZIA 2DB3A 5MN6A 1N6KA 3BGSA 1QG4A 3NEPX 3NOVA 4IZOA 4ARBA 3HKDA 1V7CA 4L4ZA 1FS6A 3G88A 3EIEA 4F96A 2QAGC 4YT8A 2RAFA 3H86A 1P2BA 4WZBB 1L7PA 4TYNA 2ZAGA 3G5LA 4Q1AA 5DYTA 1W7AA 8MHTA 3D6FA 1H1LB 3QG1A 1DO2A 1J2UA 3ND6A 2A9KA 2AFIA 4BE9A 2MSCB 4G5YA 4LOJA 2GZHA 3OT1A 2BZ0A 2VYND 5BXQC 1I30A 4OB8A 1JSCA 1COWA 5JDIC 1E4EB 1AKQA 3CLUC 1R6UA 4EG5A 3O2QB 4IYRA 5DOZA 3KO8A 4UUNA 5AVOA 3HZZA 1Q0ZA 1U8CB 4IGEA 1KGDA 4Q05A 1NVEA 3U7EB 2VS1A 3W4IA 1WLSA 2JLYA 4PCLA 4YGXB 3HJCA 1BYUA 1K68A 2CHQA 2GXQA 3DOHA 3ER9A 1ZR4A 4FN5A 4ZVTA 4X92A 3NDBB 4L02A 1Z4LA 1CVRA 4GSYA 4CN9A 5E6SB 1R8XA 1T3HA 5ALFA 2QHXA 4HJXA 2GM9A 3HSSA 3D6MA 4D9BA 4B3MB 2YIMA 2AOUB 1IUKA 1TMOA 1D03A 2ZPAA 1ULUA 4GX2A 4JKIA 2R79A 1V5FA 3MXOA 4LN1A 3VSBA 5ECYA 5HIAA 1W85B 4Z8XA 5JBQA 3Q8LA 1RIIA 3GDHA 5H81A 3TI9A 3TECE 4QRDA 3EVAA 3W2EA 4DR1B 2P4UA 3L5KA 4G4SO 1KFBB 2AI3A 4GOKA 5H4HA 3GP8A 4NPHA 2VWQA 3C3WA 3MUFA 4ROTA 1QU3A 1D7OA 4ABYA 1S8AA 1LTHR 4CQMB 1FMJA 3HPQA 1Y3IA 1QLJA 3ZDXB 5EKSA 2XMCA 5DK6A 2XXBA 4TKVB 1S2OA 4MCAA 2H06A 4O2BB 3U7RA 1IXYA 2AH5A 1V71A 1EFRA 4B48A 1GFZA 1UBJS 4LC1A 4PG4A 2WUFA 5F1OA 4L0CA 3AY7A 1B8PA 2H07A 3LXMA 1UL1X 1JPVA 3CGGA 4WZAE 4UNPA 2ORED 4WAUA 1XCPA 3D8SA 3EEYA 4JBLA 1CIVA 3RIEA 1D2RA 4D81A 4J4HA 3I6ZA 4JEMA 1CY2A 4YCNA 1UC5B 4PC7A 3O8QB 4KTVE 4YP0A 3QBDA 2V45A 1ZJWA 4X7MA 3RSZA 5IKXA 3PEYA 1JBQA 1PZNA 4PYLA 4CL2A 4DV3B 5ESRA 4C08A 4F9GA 5TE9A 1VA5A 4ILKA 1NFQA 2D2IA 3OM1A 1QHHB 2XRFA 3I37X 2AXNA 4F4IA 3IO3A 2ECOA 2Y1CA 1S2IA 1XF1A 3BIXA 1BDJA 3LNTA 1XU7A 4FNMA 4KACA 2Q28A 4QGFA 3R1IA 4RGYA 4EB3A 2WA2A 4P8RA 7MDHA 3EFBA 3RJZA 4BLPA 5A7FA 4DB2A 5EJ5A 1RLJA 3FJYA 1KMCA 2AV6A 4NBRA 1DQRA 3ED1A 3B9PA 4UTOA 3EPPA 3PDCA 4F56A 3VNQA 3NGLA 4M1KA 3J81A 2EAUA 1NF9A 3G5MA 3JV7A 1G66A 3R0VA 3F67A 3LYLA 2OFFA 3IOBA 3O75A 3O4GA 1MFZA 2JH8A 4N0DA 4PZLA 5GINE 1M2KA 2W6ID 1OYYA 4BBJA 4O25A 1N6LA 1OI4A 2CC2A 4PLZA 1HGXA 4KVAA 1XVAA 5JRDS 2JHCA 2WM3A 1YI1A 2O48X 4XOUA 3T3DA 4YRBA 1OFIA 3NNNA 3R2JA 3D54D 2Z1NA 4RA6B 2EP8A 3DOFA 4CG1A 2D8MA 5D5HA 3AI1A 4UEKA 3G82C 3A7DA 2R00A 3IMFA 3CUVA 1PS0A 2A5JA 3QUTA 5FKJA 4IJ5A 3O8CA 2Y93A 3W8NA 1EIZA 2CLDX 3RRYA 2YN0A 5MGNA 1OH6A 2IT1A 5IJ9B 4LZOA 4LBWA 3I9JA 1CRLA 3GBVA 2FYTA 3VV3A 4YAOA 2BELA 1WXDA 4JC5A 5DLYA 3KXIA 1YB2A 3JQQA 3T3PB 2K87A 4M7WA 5CGQB 3K5IA 4HQ6A 3MTEA 3MN1A 2ZUTA 3RGGA 3TJMA 3WB1A 1IBKB 3PXDA 5CFOA 4YREA 2C7RA 2QLMA 1GHTA 1MBZA 2GN8A 4P5EA 4WOPA 3LTEA 4XYLA 1C8BA 1BXRB 2XKAA 4TVSA 3EBPA 3NM4A 1DXYA 2IHVA 4HWRA 2JBAA 1OIVA 1AUXA 2YBEA 1OV4A 3MJRA 3PVSA 1U5BB 4NE2A 3TOCA 4LWOA 3RRXA 3GGCA 2A14A 4IOLA 1OILA 1RXSA 2ZJ7A 4QASA 2XECA 1PR5A 2E89A 5FOTA 4R8MA 3QHAA 4DLXA 1ONBA 3NATA 3VHXA 4BLUA 2ZE6A 3CH7A 2ICAA 5KU7A 2HMUA 4ZIRB 1KZHA 2MINB 4XSHA 4HNSA 2GHQA 2IVFA 3TIVA 4ALMA 3ZU2A 4RD0A 1DDGA 3Q6NA 4QOFA 4K7JA 3G0BA 3T7IA 4RD1A 2K2QB 2Q7XA 1XAHA 4DIDA 3HVHA 4G0WA 4Q4JB 4X9XA 5KNDA 1LPBB 1KMHB 4L27A 4V0ME 5CVEA 3WLIA 4BATA 2BHSA 4JMPA 1Z6PA 2I6QA 3MOSA 4P92A 3BTSA 3SXUB 2A5YB 1XVUA 4GRDA 4LRYA 2HOQA 1GZUA 2BGRA 1SIBE 4MI9A 4TRJA 1DX9A 3RAEC 4L5IA 4KV9A 2QX4A 5DMXA 4BQSA 4J1TC 5IZCA 3EPKA 1N36B 5K3BA 4DBVO 3OZWA 1QFSA 4IIFA 4L28A 5EQTA 5ITVA 2YYYA 1HNZB 4HMPA 4GR9A 1C0PA 4U63A 1UPTA 4YBZA 1AKWA 3O8LA 3EF1A 3N2YA 4DJDC 1E9VA 3NKFA 2PUHA 3F8TA 4UTPA 3EC2A 1F14A 2Q7DA 2XUKA 5CLLA 2X3UA 3ZDEA 2IYYA 4XPIB 1E64A 1WW2A 2OKGA 1OQAA 2ZRGA 1XTUA 3MBIA 2GYWA 1NUTA 1ZU5A 5B53A 4WD3A 4BNZA 2XB4A 3H3XA 1P1BA 3GLIB 2AWNA 1NLYA 1QRSA 4ZEWA 2EL9A 1CJUC 1PSDA 3DEFA 5K3EA 3WHLA 2BEUB 1NYQA 4MV1A 4RAQA 5DWVA 2VJQA 1YMQA 2HT1A 1O94A 1QGOA 2ZK7A 4M3NA 2B7BA 4XDHA 2BCEA 4PN3A 3HRHA 5LXTF 2DOKA 5IK2A 2JKVA 3LBNA 1AGPA 1D3AA 4MSUA 3E9QA 2JA1A 2SNIE 3CRZA 2Q6VA 4NV0A 2C3YA 1FVXA 2FMXA 3BRSA 3PSAA 3MJSA 4I1OA 1JR3A 4UE3S 4KR7A 1KARA 1E2LA 2JGKA 2J5QA 1VHDA 3C0KA 4C30A 4K5QA 4GL4A 4Y9RA 1CR4A 4PXAA 1RI3A 4HX5A 4ODIA 3AR3A 4IDAA 5KQGA 5BMVF 2ZUCA 1CUDA 5LFAA 5IUNC 5CU7A 4MS1A 5CA1F 1UZAA 4Q15A 1L9KA 3EGXB 1Q0HA 4DHEA 1L4YA 4JXZA 3OURA 3ZWQA 3P8ZA 5GOZA 4HRXA 3KG2A 3A6PC 1SXIA 4R6WA 4YUXA 3RHSA 3MVEA 3ZX5A 4Y1GA 1C3VA 3AHDA 3WNVA 2J3HA 4L76A 2OBFA 3IUMA 3LOQA 4FLMA 1PT5A 2XWBF 2FWPA 4NMMA 2VP2A 2IS4A 3J7TA 4W1PA 3RVNA 7ADHA 3BXHA 1YBFA 3TFWA 1CWUA 3ERCA 5CW1A 3ZHOA 5LLDA 1SZPA 1KRXA 2VYVD 4ZVOA 2HA6A 1IY0A 3RYCA 1ZFNA 1FLDA 2ZU0C 3I2FA 1L5HA 3ZGYA 5LNK6 2Z6AA 4AN4A 4C0XA 2OMEA 1T4GA 1JSLA 1QR2A 2JAWA 4NP6A 5T57A 3W5JA 4DTIA 5CB8A 5HXAA 1M8KA 5IX8A 1N4DA 3STWA 1ONPA 1FSFA 2AZMA 1Y8RB 3B3FA 2YV1A 1DIAA 3C3JA 3UZUA 2FMKA 1VE6A 2QQEA 3SR4A 1QHEA 1M3SA 1YKGA 2QPOA 1RPNA 3BSWA 4X7BA 4XEHA 3ZWKA 3F3YA 1KDTA 2IYEA 5C53B 3HXQA 4C78A 4MO2A 4ZU1X 1ENZA 1ZGHA 1SCQA 5F3RA 4RK6A 4G36A 4KLNA 3L4BC 4OP2A 5I9LA 5JZVA 4DMMA 2AMYA 3FYUA 3NV7A 4HCJA 1X77A 3U48A 2E21A 3CS3A 1EVIA 2XOKD 3AEKB 4MRMA 3PHHA 4BWVA 3IQXA 4H59A 2QLBA 4P7KA 3WL4A 1AQYA 1RKVA 1RRMA 1WMDA 5BR7A 2GN2A 5IH7A 1E3JA 1IBSA 3CWZA 4K28A 2J33A 5EXPA 1FTNA 3P4YA 3QPBA 2AYXA 4DR4B 1EUZA 3JQ8A 4Q02A 1D0IA 1G8GA 3PEUA 4LKRA 3TQFA 4CFYA 1T5BA 3A37A 3JYPA 3W8EA 4B76A 3ZLJA 1WCIA 2B78A 4G0NA 2WYVA 4D6YA 2VZ9A 2PGXA 2VDWB 3DLCA 4DV1B 4JX9A 4Z6KA 3ICEA 2F48A 1JAYA 3I5UA 3ZCSA 2ONCA 2DQ4A 3I4CA 2N1BA 4YAEA 3S2ZA 4RHTA 3LPLA 5GMOA 1JEYB 3BB4A 1XLTC 4IH9A 5A3RA 1E2PA 3LUDA 1A8SA 1DV1A 4K46A 4J0QA 4KWHA 1SHTX 4OVKA 4MNTA 2DM6A 3F7TA 1DJOA 3H16A 3DZJA 4MHSA 4U6SA 1GQQA 1ZWKA 3OU6A 5C2JB 2NAFA 2P6NA 2QD5A 3DE0X 5KYXA 1HYEA 4BX9A 1U8ZA 2VH5R 4ID3A 2WHPB 2XJ4A 5MF6A 2WRZA 3QPUA 5JJKA 2C9ZA 4G0VA 3DAOA 1RI4A 3A9VA 4HC4A 5CCEA 3TTWA 5KDOA 2H5IA 4F7WA 2WKRA 4UU8A 2IXEA 1IULA 3T5AA 1OXKB 3BWXA 2VSXA 4M9XA 5T3UA 4DABA 3K0AA 5FDFA 4OQ4A 4ZVKA 1RLUA 1T3TA 1B6RA 4WMLA 3BRWA 5AHOA 1VIVA 4AKGA 3HN2A 1C3LA 4WNAB 4ARCA 1AQLA 1GQSA 4O08A 2R7AA 2PJUA 5H83A 2GHRA 3TZLA 4E88A 4FOLA 3EUWA 5L8VA 5AUOB 1ZHOA 2HWWA 1D2AA 3GY0A 1KIAA 1DL5A 1LDNA 3EGWA 5KJFA 3RKRA 1AQUA 1TEHA 3O4RA 2FFQA 2PSDA 4N0EA 1LV8A 3HFRA 4HFJA 3TTUA 5AW7A 2GTIA 1E0JA 1WW3A 4MQBA 1MB3A 1P3Y1 2XCUA 3H99A 4AWBA 4BGEA 1CC1S 1RYBA 1ZQ1A 3U4AA 3CEHA 5FA6A 4AXXA 3GC6A 2ADMA 3T38A 3VBCA 1JA1A 2J59A 1XL1A 3KETA 1FMTA 3BEDA 5FTNA 4J03A 1YL6A 1VZ2A 1WX1A 4TV9A 2LP4Y 2WIFA 2ZSBA 3K94A 4KYVA 2ZTLA 5GIOE 2WV7A 1JDBB 2PN1A 2J45A 2R9VA 3ANNA 3B1WA 1RRFA 3GLRA 1Q1ZA 1XE3A 5CYFA 3RGWS 4ZI7B 3UUWA 4GW3A 1E60A 4LGMA 5TSDA 5ADVA 3P2EA 2AQHA 2PGLA 1VKJA 2ATVA 3AUAA 5HJ7A 2IYRA 4TROA 10MHA 4QYTA 1ETHA 2IPMA 2R8XA 1M6WA 3ADPA 3MTGA 3SICE 4L6IA 1GA6A 1FOEB 4MYSA 3X1JA 2P67A 5TQ2B 1FXWA 4PNPA 4DMUB 3WSTA 3O95A 4J0HA 3O73A 5E6UA 3YASA 2ZYSA 2J0QA 4D9FA 2ZB3A 2QD1A 1GPBA 2N47A 4A2PA 3PE3A 3HLKA 4MYCA 4CF7A 1JKJA 2YV5A 3BHIA 2O2JA 1L4BA 1JAHA 1UZLA 1LRKA 2XBLA 4KTTE 3SLGA 3UKOA 1Z4PX 2V8OA 3U9TA 5J4VA 2Y92A 4NU0A 1DEHA 2D0IA 2PMDA 3LNCA 1FFBA 4X93A 1BCSB 3TR0A 1ZJZA 2IHTA 2ODEA 3D7SA 2F00A 1K08A 4E70A 2H1WA 2NXJA 3PLAE 2ZZNA 1M75A 1Z68A 3KWJA 3QGMA 4EF5A 4G9BA 3PA6A 3LT2A 3RS0A 3UXMA 1W87A 4DWJA 5KNCD 1G8FA 3NAZA 1UXIA 3RSGA 1C1XA 4Q4HB 3RF6A 3S2FA 1C3EA 3CR3C 4MRAA 1T4CA 3BGDA 3GJZA 4YMUA 3EIWA 3WYFA 3OFND 1H94A 1YL5A 1J97A 1JDSA 4Q3EA 4EJ0A 3ESBA 4MVJA 1P0IA 2GAOA 1AMOA 2IXBA 1KI2A 1EFAA 3E9NA 5AXCA 1FMLA 4W5JA 1K7SN 1MC8A 5EINA 2W2OA 3KT8A 4Q6BA 3HDYA 4OK6A 4LDJA 3RBVA 4B2PA 3NVKI 2JKZA 2UVPA 2MTBA 3CWQA 4C3UA 1O5TA 1C4KA 1KC3A 1P0FA 2IA5A 3KAPA 4F2DA 5GM1A 4Q3LA 2DXIA 3NCTA 1QOPB 4IDQA 2WG2A 3B6MA 2PQ2A 1VJGA 3F5SA 4QSHA 1CR6A 5E9JA 3SJCA 1G0OA 3I1IA 4FDAA 1YZKA 3L7NA 4Z4QA 1R0LA 2AZ4A 1D4ZA 4GGMX 4FGUA 5BV7A 2VSNA 3N2IA 4EARA 1YK1A 3FH0A 2OO3A 5DM1A 2IOHA 1EEXB 3ZXUB 3NM6B 2ZYGA 4UHJA 1G9XA 5BYAA 3GLFE 1P0CA 1ZD2P 4TWBA 1H3EA 1GUDA 1WB6A 1KY2A 1EDZA 2QKYA 3FBGA 1DIGA 1WRBA 1KYQA 2O3SA 3O0DA 3GJ6A 1YR3A 1J8VA 4MEBA 3V4SA 1N1GA 4ZFNA 1L7VC 3IEMA 4II3A 1B41A 1NG9A 2PUCA 1W2HA 4B3FX 4NMHA 3AVOA 2E48A 2P1DA 3EAFA 1OXTA 2FW7A 2O5EA 5DHUA 2FEOA 3VR5D 1E98A 1QONA 4LCJA 3TQTA 4YJHA 1W34A 1FYFA 1FRNA 1EA5A 1QO9A 4R71A 5IBPA 2XDQA 2HUPA 3A6FA 1T5DX 3ZDQA 2XMQA 4EEZA 3AVYA 3H1EA 3MPOA 3HL4A 2CZGA 4XZ3A 4TWRA 4EMBA 1KZ4A 1WHTB 1JL3A 2PXXA 4MMXB 4X84A 5HFAA 2UU9B 1ZKDA 3LSYA 5JD6A 4P3XA 2ZSDA 1PR4A 3L1KA 5CFZA 2JFGA 1NBOA 2K2WA 3CSSA 3KC2A 4ER0A 1IQPA 3QF7A 4WZAB 5IS2A 3NBKA 4ZZ1A 4BKRA 2Z3VA 5CTJA 4ZHSA 1G18A 3AVVA 2FFAA 2C31A 2VXOA 3K32A 2XUOA 1GRRA 2QY6A 2G25A 3KXDA 3AFHA 3VSEA 3ZGNA 5JJBA 2E1RA 3EW9A 3G2OA 5JTUA 2ZRNA 4MA5A 2O06A 2QG4A 5JD5A 1GTRA 3R7WA 3ZTTA 4H17A 3GFRA 3MWKA 3FOCA 1OCEA 1UEXC 3OTWA 3LZ6A 3N2KA 3DV2A 3F2VA 1U8FO 4DG9A 2O59A 4R3UC 3UJAA 4U2GA 3JS5A 5I7VA 3EZ7A 1T0UA 2HU5A 2WIJA 1RAFA 1RWVA 1IC6A 3EDMA 1CRPA 4I2VA 4TTTS 1KKLA 4ZCMA 1EUCA 2OAEA 2ZUUA 3GWZA 1NTOA 1AE1A 1X1QA 2B5OA 3E7XA 2Y8EA 3LV8A 5TMDA 2QIOA 3LLMA 2NW6A 3AVTA 2XGGA 5IJ0B 1BVRA 4NEGA 3BD8A 1FVOA 1KEUA 1HZZA 1II8B 4GOLD 4F7DA 3W5BA 1EWKA 1NN1A 1YDFA 2CEKA 4DRYA 3U44B 2AKAB 1WKBA 5LZ4A 1VKNA 1L5KA 3QEMA 2O2XA 4OQPA 3OCZA 1K7XB