2GKVA

Crystal structure of the sgpb:p14'-ala32 omtky3-del(1-5) complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTLEYRPLCGSDNKTYANKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Structural Insights into the Non-additivity Effects in the Sequence-to-Reactivity Algorithm for Serine Peptidases and their Inhibitors.
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2gkvA00
1M8CA 4OVOA 1LR9A 2SGQI 2LEOA 1AN1I 1CGJI 2SGFI 2JZMA 2GKTI 2N52A 1YU6C 1CT2I 1CT0I 1SGEI 2M5XA 2SGPI 1SGQI 1SGDI 1UUCA 1OMTA 1Z7KB 1SGYI 1NUBA 1SGNI 2P6AC 1UVFA 3TJQA 5JHWC 1IW4A 1CSOI 1OYVI 2ARPF 2GKRI 1TGSI 1PJUA 1LR7A 1H0ZA 1SGPI 1N13A 2BUSA 1IY6A 1CGII 1DS2I 1R0RI 1MT1A 2NU1I 2GKVA 1IY5A 1TIHA 2WCYA 4HGUA 1Y1BA 1TURA 2NU4I 2SGDI 2F3CI 3QTLD 1M8BA 4GI3C 2ERWA 1BMOA 1SGRI 3HH2C 1OVOA 1TUSA 1FYBA 3OVOA 4SGBI 2QQCA 2KMOA 2NU2I 1KMAA 1OMUA 2KMQA 1CT4I 1UVGA 2B0UC 2KMPA 1HDLA 1BUSA 1Y1CA 1PCEA 3SGQI 2SGEI 2XRCA 2N17A 2V53A 1DS3I 2N71A 1CHOI 3SGBI 2KMRA 2QQDA 2JXDA 5DAEA 2KCXA 1CE3A 1PPFI 2NU3I 1LR8A 2JYYA 1HJAI 1YTPA 1TBRR 3B4VC 1TBQR 2OVOA 2NU0I 1HPTA 3SEKC
chains in the Genus database with same CATH superfamily
2OZUA 2N1AB 1M8CA 4OVOA 1Z2IA 1LR9A 1VDDA 2VRWB 2ENZA 2SGQI 1RFHA 2LEOA 1R79A 2JA1A 2J87A 2WGCA 1AN1I 3VDUA 2Y0MA 1CGJI 3UEJA 5CCMA 2SGFI 2JZMA 2CJSC 2GKTI 2LB7A 2N52A 1YU6C 3QWPA 1CT2I 1Y8FA 2CWFA 3UEYA 1CT0I 1SGEI 2M5XA 1U5KA 3OXFA 2SGPI 1SGQI 1SGDI 2W0TA 1UUCA 1MJBA 2DIPA 2RIJA 1OMTA 2GVIA 1MJAA 4UXJA 4L9MA 3RU0A 5E3RA 3TO7A 3UFFA 1KBEA 1Z7KB 2LUYA 1SGYI 1NUBA 1PTRA 1SGNI 2P6AC 1UVFA 4WP4A 3UOEA 2GIVA 2E73A 2ELIA 3TJQA 3VE5A 5CCLA 5JHWC 5FUYA 2CWGA 5E3QA 3BJIA 4UXIA 1IW4A 1CSOI 1OYVI 2ARPF 2CWHA 2GKRI 1WKXA 2YQPA 7WGAA 2OU2A 2UZ3A 1TGSI 2ODDA 1K7UA 3UGIA 1PJUA 1LR7A 1H0ZA 1SGPI 1N13A 1UHAA 2BUSA 3TO9A 5FUXA 1IY6A 2X3TA 1CGII 3TOBA 1DS2I 1R0RI 1MT1A 1ULKA 1FAQA 2NU1I 1TOTA 3FC3A 4JCVE 5J8FA 3OL0A 2GKVA 2PQ8A 1TIHA 1S20A 2QQ0A 1IY5A 2WCYA 3R5DA 1WGCA 4HGUA 3UGLA 1KBFA 1Y1BA 1TURA 2NU4I 2SGDI 3E2IA 3R5AA 2F3CI 2JW6A 2A20A 3QTLD 1W3SA 1K7TA 5HI7A 1K7VA 3OXLA 1M8BA 3UGDA 1TBOA 2X52A 1WGTA 2L8EA 1BMOA 2ERWA 4GI3C 1SGRI 1XBTA 1TBNA 1FARA 3MEKA 3HH2C 2ENNA 1OVOA 3TO6A 1TUSA 1V1IA 1FYBA 3OVOA 1X74A 3R5BA 1HEVA 1XA6A 4SGBI 2QQCA 1W4RA 2KMOA 2NU2I 3OXGA 1KMAA 2L7XA 1OMUA 2DKVA 4B6DA 2KMQA 3CXLA 1CT4I 2WVJA 3D00A 1UVGA 2YUUA 2ORWA 2B0UC 2KMPA 1HDLA 1BUSA 3PDNA 1FY7A 2ROWA 1Y1CA 2E5RA 2ORVA 5J8CA 1PCEA 3FSXA 5EX3A 2DB6A 2SGEI 3SGQI 2XRCA 1P9ZA 2N17A 1ULNA 2K9HA 2V53A 1P9GA 1DS3I 2N71A 1CHOI 3SGBI 2QPOA 3VDPA 2KMRA 4E1PA 2QQDA 2JXDA 3FSYA 5DAEA 1ULMA 3R5CA 2RC4A 2V1CC 2KCXA 1XX6A 1CE3A 5FUWA 2OD1A 4AMLA 1X4SA 1PPFI 3KY9A 1WTJA 2NU3I 3QAHA 5E3PA 5EX0A 1LR8A 4DNCA 2JYYA 5FUVA 2V1CA 4E1RA 4A24A 2UVOA 2B8TA 5HQ8A 2QQEA 2FNFX 1HJAI 1Q9BA 3GOXA 9WGAA 1V1HA 1TBRR 1YTPA 1TBQR 2OVOA 3B4VC 4FKDA 3E59A 3TOAA 1NXUA 2NU0I 1HPTA 4UXHA 4MPIA 3SEKC 1PTQA 1MJ9A 2J9RA
chains in the Genus database with same CATH topology
2N1AB 1M8CA 4OVOA 2VRWB 1LR9A 1VDDA 2ENZA 2SGQI 1RFHA 2LEOA 1R79A 2JA1A 2J87A 1AN1I 3VDUA 1CGJI 3UEJA 5CCMA 2SGFI 2JZMA 2CJSC 2GKTI 2N52A 1YU6C 3QWPA 1CT2I 1Y8FA 3UEYA 1CT0I 1SGEI 2M5XA 1U5KA 3OXFA 2SGPI 1SGQI 1SGDI 2W0TA 1UUCA 2DIPA 1OMTA 2GVIA 4UXJA 3RU0A 4L9MA 3UFFA 1KBEA 1Z7KB 2LUYA 1SGYI 1NUBA 1PTRA 1SGNI 2P6AC 1UVFA 2E73A 2ELIA 3TJQA 3VE5A 5CCLA 5JHWC 5FUYA 3BJIA 4UXIA 1IW4A 1CSOI 1OYVI 2ARPF 2GKRI 2YQPA 2UZ3A 1TGSI 2ODDA 3UGIA 1PJUA 1LR7A 1H0ZA 1SGPI 1N13A 2BUSA 5FUXA 1IY6A 1CGII 1FAQA 1DS2I 1R0RI 1MT1A 2NU1I 1TOTA 3FC3A 4JCVE 3OL0A 2GKVA 1IY5A 1TIHA 2QQ0A 2WCYA 3UGLA 4HGUA 1KBFA 1Y1BA 1TURA 2NU4I 2SGDI 3E2IA 2F3CI 2JW6A 2A20A 3QTLD 1W3SA 5HI7A 3OXLA 1M8BA 3UGDA 1TBOA 2L8EA 4GI3C 1BMOA 2ERWA 1SGRI 1XBTA 1TBNA 1FARA 3MEKA 3HH2C 2ENNA 1OVOA 1TUSA 1V1IA 1FYBA 3OVOA 1X74A 1XA6A 4SGBI 2QQCA 1W4RA 2KMOA 2NU2I 3OXGA 1KMAA 2L7XA 1OMUA 4B6DA 2KMQA 3CXLA 1CT4I 2WVJA 3D00A 1UVGA 2YUUA 2ORWA 2B0UC 2KMPA 1HDLA 1BUSA 3PDNA 2ROWA 1Y1CA 2E5RA 2ORVA 1PCEA 5EX3A 2DB6A 2SGEI 3SGQI 2XRCA 2N17A 2K9HA 2V53A 1DS3I 2N71A 1CHOI 3SGBI 2QPOA 3VDPA 2KMRA 4E1PA 2QQDA 2JXDA 5DAEA 2V1CC 2KCXA 1XX6A 1CE3A 5FUWA 2OD1A 1X4SA 1PPFI 3KY9A 2NU3I 5EX0A 1LR8A 2JYYA 5FUVA 2V1CA 4E1RA 4A24A 2B8TA 5HQ8A 2QQEA 2FNFX 1HJAI 3GOXA 1V1HA 1TBRR 1YTPA 1TBQR 2OVOA 3B4VC 4FKDA 3E59A 4UXHA 2NU0I 1HPTA 3SEKC 1PTQA 2J9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8C A;  4OVO A;  1LR9 A;  2SGQ I;  2LEO A;  1AN1 I;  1CGJ I;  2SGF I;  2JZM A;  2GKT I;  2N52 A;  1YU6 C;  1CT2 I;  1CT0 I;  1SGE I;  2M5X A;  2SGP I;  1SGQ I;  1SGD I;  1UUC A;  1OMT A;  1Z7K B;  1SGY I;  1NUB A;  1SGN I;  2P6A C;  1UVF A;  3TJQ A;  5JHW C;  1IW4 A;  1CSO I;  1OYV I;  2ARP F;  2GKR I;  1TGS I;  1PJU A;  1LR7 A;  1H0Z A;  1SGP I;  1N13 A;  2BUS A;  1IY6 A;  1CGI I;  1DS2 I;  1R0R I;  1MT1 A;  2NU1 I;  2GKV A;  1IY5 A;  1TIH A;  2WCY A;  4HGU A;  1Y1B A;  1TUR A;  2NU4 I;  2SGD I;  2F3C I;  3QTL D;  1M8B A;  4GI3 C;  2ERW A;  1BMO A;  1SGR I;  3HH2 C;  1OVO A;  1TUS A;  1FYB A;  3OVO A;  4SGB I;  2QQC A;  2KMO A;  2NU2 I;  1KMA A;  1OMU A;  2KMQ A;  1CT4 I;  1UVG A;  2B0U C;  2KMP A;  1HDL A;  1BUS A;  1Y1C A;  1PCE A;  3SGQ I;  2SGE I;  2XRC A;  2N17 A;  2V53 A;  1DS3 I;  2N71 A;  1CHO I;  3SGB I;  2KMR A;  2QQD A;  2JXD A;  5DAE A;  2KCX A;  1CE3 A;  1PPF I;  2NU3 I;  1LR8 A;  2JYY A;  1HJA I;  1YTP A;  1TBR R;  3B4V C;  1TBQ R;  2OVO A;  2NU0 I;  1HPT A;  3SEK C; 
#chains in the Genus database with same CATH topology
 2OZU A;  2N1A B;  1M8C A;  4OVO A;  1Z2I A;  1LR9 A;  1VDD A;  2VRW B;  2ENZ A;  2SGQ I;  1RFH A;  2LEO A;  1R79 A;  2JA1 A;  2J87 A;  2WGC A;  1AN1 I;  3VDU A;  2Y0M A;  1CGJ I;  3UEJ A;  5CCM A;  2SGF I;  2JZM A;  2CJS C;  2GKT I;  2LB7 A;  2N52 A;  1YU6 C;  3QWP A;  1CT2 I;  1Y8F A;  2CWF A;  3UEY A;  1CT0 I;  1SGE I;  2M5X A;  1U5K A;  3OXF A;  2SGP I;  1SGQ I;  1SGD I;  2W0T A;  1UUC A;  1MJB A;  2DIP A;  2RIJ A;  1OMT A;  2GVI A;  1MJA A;  4UXJ A;  4L9M A;  3RU0 A;  5E3R A;  3TO7 A;  3UFF A;  1KBE A;  1Z7K B;  2LUY A;  1SGY I;  1NUB A;  1PTR A;  1SGN I;  2P6A C;  1UVF A;  4WP4 A;  3UOE A;  2GIV A;  2E73 A;  2ELI A;  3TJQ A;  3VE5 A;  5CCL A;  5JHW C;  5FUY A;  2CWG A;  5E3Q A;  3BJI A;  4UXI A;  1IW4 A;  1CSO I;  1OYV I;  2ARP F;  2CWH A;  2GKR I;  1WKX A;  2YQP A;  7WGA A;  2OU2 A;  2UZ3 A;  1TGS I;  2ODD A;  1K7U A;  3UGI A;  1PJU A;  1LR7 A;  1H0Z A;  1SGP I;  1N13 A;  1UHA A;  2BUS A;  3TO9 A;  5FUX A;  1IY6 A;  2X3T A;  1CGI I;  3TOB A;  1DS2 I;  1R0R I;  1MT1 A;  1ULK A;  1FAQ A;  2NU1 I;  1TOT A;  3FC3 A;  4JCV E;  5J8F A;  3OL0 A;  2GKV A;  2PQ8 A;  1TIH A;  1S20 A;  2QQ0 A;  1IY5 A;  2WCY A;  3R5D A;  1WGC A;  4HGU A;  3UGL A;  1KBF A;  1Y1B A;  1TUR A;  2NU4 I;  2SGD I;  3E2I A;  3R5A A;  2F3C I;  2JW6 A;  2A20 A;  3QTL D;  1W3S A;  1K7T A;  5HI7 A;  1K7V A;  3OXL A;  1M8B A;  3UGD A;  1TBO A;  2X52 A;  1WGT A;  2L8E A;  1BMO A;  2ERW A;  4GI3 C;  1SGR I;  1XBT A;  1TBN A;  1FAR A;  3MEK A;  3HH2 C;  2ENN A;  1OVO A;  3TO6 A;  1TUS A;  1V1I A;  1FYB A;  3OVO A;  1X74 A;  3R5B A;  1HEV A;  1XA6 A;  4SGB I;  2QQC A;  1W4R A;  2KMO A;  2NU2 I;  3OXG A;  1KMA A;  2L7X A;  1OMU A;  2DKV A;  4B6D A;  2KMQ A;  3CXL A;  1CT4 I;  2WVJ A;  3D00 A;  1UVG A;  2YUU A;  2ORW A;  2B0U C;  2KMP A;  1HDL A;  1BUS A;  3PDN A;  1FY7 A;  2ROW A;  1Y1C A;  2E5R A;  2ORV A;  5J8C A;  1PCE A;  3FSX A;  5EX3 A;  2DB6 A;  2SGE I;  3SGQ I;  2XRC A;  1P9Z A;  2N17 A;  1ULN A;  2K9H A;  2V53 A;  1P9G A;  1DS3 I;  2N71 A;  1CHO I;  3SGB I;  2QPO A;  3VDP A;  2KMR A;  4E1P A;  2QQD A;  2JXD A;  3FSY A;  5DAE A;  1ULM A;  3R5C A;  2RC4 A;  2V1C C;  2KCX A;  1XX6 A;  1CE3 A;  5FUW A;  2OD1 A;  4AML A;  1X4S A;  1PPF I;  3KY9 A;  1WTJ A;  2NU3 I;  3QAH A;  5E3P A;  5EX0 A;  1LR8 A;  4DNC A;  2JYY A;  5FUV A;  2V1C A;  4E1R A;  4A24 A;  2UVO A;  2B8T A;  5HQ8 A;  2QQE A;  2FNF X;  1HJA I;  1Q9B A;  3GOX A;  9WGA A;  1V1H A;  1TBR R;  1YTP A;  1TBQ R;  2OVO A;  3B4V C;  4FKD A;  3E59 A;  3TOA A;  1NXU A;  2NU0 I;  1HPT A;  4UXH A;  4MPI A;  3SEK C;  1PTQ A;  1MJ9 A;  2J9R A; 
#chains in the Genus database with same CATH homology
 2N1A B;  1M8C A;  4OVO A;  2VRW B;  1LR9 A;  1VDD A;  2ENZ A;  2SGQ I;  1RFH A;  2LEO A;  1R79 A;  2JA1 A;  2J87 A;  1AN1 I;  3VDU A;  1CGJ I;  3UEJ A;  5CCM A;  2SGF I;  2JZM A;  2CJS C;  2GKT I;  2N52 A;  1YU6 C;  3QWP A;  1CT2 I;  1Y8F A;  3UEY A;  1CT0 I;  1SGE I;  2M5X A;  1U5K A;  3OXF A;  2SGP I;  1SGQ I;  1SGD I;  2W0T A;  1UUC A;  2DIP A;  1OMT A;  2GVI A;  4UXJ A;  3RU0 A;  4L9M A;  3UFF A;  1KBE A;  1Z7K B;  2LUY A;  1SGY I;  1NUB A;  1PTR A;  1SGN I;  2P6A C;  1UVF A;  2E73 A;  2ELI A;  3TJQ A;  3VE5 A;  5CCL A;  5JHW C;  5FUY A;  3BJI A;  4UXI A;  1IW4 A;  1CSO I;  1OYV I;  2ARP F;  2GKR I;  2YQP A;  2UZ3 A;  1TGS I;  2ODD A;  3UGI A;  1PJU A;  1LR7 A;  1H0Z A;  1SGP I;  1N13 A;  2BUS A;  5FUX A;  1IY6 A;  1CGI I;  1FAQ A;  1DS2 I;  1R0R I;  1MT1 A;  2NU1 I;  1TOT A;  3FC3 A;  4JCV E;  3OL0 A;  2GKV A;  1IY5 A;  1TIH A;  2QQ0 A;  2WCY A;  3UGL A;  4HGU A;  1KBF A;  1Y1B A;  1TUR A;  2NU4 I;  2SGD I;  3E2I A;  2F3C I;  2JW6 A;  2A20 A;  3QTL D;  1W3S A;  5HI7 A;  3OXL A;  1M8B A;  3UGD A;  1TBO A;  2L8E A;  4GI3 C;  1BMO A;  2ERW A;  1SGR I;  1XBT A;  1TBN A;  1FAR A;  3MEK A;  3HH2 C;  2ENN A;  1OVO A;  1TUS A;  1V1I A;  1FYB A;  3OVO A;  1X74 A;  1XA6 A;  4SGB I;  2QQC A;  1W4R A;  2KMO A;  2NU2 I;  3OXG A;  1KMA A;  2L7X A;  1OMU A;  4B6D A;  2KMQ A;  3CXL A;  1CT4 I;  2WVJ A;  3D00 A;  1UVG A;  2YUU A;  2ORW A;  2B0U C;  2KMP A;  1HDL A;  1BUS A;  3PDN A;  2ROW A;  1Y1C A;  2E5R A;  2ORV A;  1PCE A;  5EX3 A;  2DB6 A;  2SGE I;  3SGQ I;  2XRC A;  2N17 A;  2K9H A;  2V53 A;  1DS3 I;  2N71 A;  1CHO I;  3SGB I;  2QPO A;  3VDP A;  2KMR A;  4E1P A;  2QQD A;  2JXD A;  5DAE A;  2V1C C;  2KCX A;  1XX6 A;  1CE3 A;  5FUW A;  2OD1 A;  1X4S A;  1PPF I;  3KY9 A;  2NU3 I;  5EX0 A;  1LR8 A;  2JYY A;  5FUV A;  2V1C A;  4E1R A;  4A24 A;  2B8T A;  5HQ8 A;  2QQE A;  2FNF X;  1HJA I;  3GOX A;  1V1H A;  1TBR R;  1YTP A;  1TBQ R;  2OVO A;  3B4V C;  4FKD A;  3E59 A;  4UXH A;  2NU0 I;  1HPT A;  3SEK C;  1PTQ A;  2J9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...