2GKVE

Crystal structure of the sgpb:p14'-ala32 omtky3-del(1-5) complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Structural Insights into the Non-additivity Effects in the Sequence-to-Reactivity Algorithm for Serine Peptidases and their Inhibitors.
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gkvE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gkvE01
1FUJA 2ASUB 3BG4C 4GSOA 4I33A 4ZKSU 4D9QA 1QNJA 1ETSH 1NFUA 1LHFH 5ABWA 1GJ5H 4AFUA 1TBRH 3QUMP 5EOKA 1WCZA 2G8TA 3ZVGA 2XRCA 3LC5A 2O9QA 3RP2A 1GDUA 1D3TB 1PQ8A 3UIRA 1J14A 1HAYB 4IGDA 3QDZB 2ZHFH 3SUGA 1C2IA 1LKAA 2V3HH 3GDSA 5EPNA 1Q3XA 5TCAA 1C1TA 1KTTB 4DG4A 2FESH 5FX5A 5LGOA 2GV6A 1O2SA 3QGNB 1IQKA 2P3TB 1CA8B 4BAKB 1E34B 1O3GA 2P8OC 2F9PA 2GDEH 2H5DA 2V3OH 1ZR0A 2GZ8A 3GCOA 3R0FA 4ZXYH 3ZV9A 1ZYOA 2ZGJA 1GJ6A 1YPMH 2W7UA 2ZTXA 1O3HA 5ESTE 1XXFA 1G3EA 2G52A 3MNSA 2ZI2H 3LGWA 1YF4A 3BTEE 2QA9E 5DKMA 2WPMS 2SGQE 1W13U 1BBRH 1TQ7B 1C1WH 4JZ1A 1L0ZA 1G3CA 1DE7H 3TJUA 5EXLA 2GT7A 1OXGA 1INCA 2D8WA 2J34A 2R2WU 2GKVE 4WH8A 4X6PA 2Z6BD 3BN9A 4FVBA 3GDVA 1O3KA 1EZXC 1Y8TA 1RJXB 3TJNA 1O3MA 2HPQH 1FAKH 1O2IA 3A8CA 3KQEA 1O2WA 4XBCA 1HRTH 2KAIB 1YPLH 2VIWA 3SV9A 4H42U 1GVKB 3O8CA 2SGAA 5E0GA 3A8BA 1O2VA 3SU0A 1OP2A 1TNLA 1C4Y2 3PLKA 5HM9A 3AVZA 1TGTA 3GOVB 2V0BA 1TLDA 5A8YA 2ALPA 4AORA 3F9GA 1SLUB 3TK9A 1BMAA 3I29A 2QAAA 1EB1H 2Q6FA 1T8MA 3RXSA 1D3QB 2ZPRA 2A32A 2UUFB 3H7TA 2OLGA 4AYVB 3UUZA 1UCYE 2OP9A 3MTYA 4HGCA 1T7CA 4I8HA 2WINI 3U69H 3MH5A 5PTPA 4B71A 1OWHA 2GGVB 3VB4A 1QB9A 1C2KA 3QGJA 1JRTA 5F03A 4X8SH 3PYHA 1W3CA 5HYOA 1NU7B 3GY6A 1AUJA 2BHGA 2G81E 4JK5A 5EQSA 1C5PA 1QL8A 4I8JA 5L30H 1EUFA 4R8TB 4A1VA 4AX9H 4Y76A 2CHAB 1AY6H 3A84A 1C1OA 2Y5HA 4NCYA 2OC1A 4Q7ZA 1P2NA 4DVAU 3L6PA 3SU3A 1TAWA 1BTWA 1MKWH 3ENSB 2A4OA 2OC7A 4AFZA 1NFYA 1P2QA 3P6ZB 2ZPSA 4A7IB 3G01A 4K8YA 2NU1E 4FXGH 3VGCB 3T25A 3P95A 2Y82A 3LGIA 1NM6A 3IWMA 5DPAA 1ZTLA 1QA0A 2DUCA 1EJAA 3K6ZA 2J2UA 1F5KU 1GHBF 4UFEH 2BD2A 2Y7XA 5JDUB 2FLRH 2AGIX 3SV7A 1YP9A 4WMFA 1QRWA 3Q00A 2OBOA 3RMOH 1SGFG 3LH1A 4B74A 1X7AC 1P2IA 2SNWA 4WXIA 4RKOB 3VPKA 3M3VA 1VGCB 1O3FA 2ZFFH 3H7OA 5FPTA 5TCCA 2ZTYA 1GI2A 3FZDA 3D23A 1CHGA 5SGAE 2FOFA 2STAE 4BTUB 1GG6B 1LTOA 1TGBA 3IITA 3DUXH 1W8BH 1AKSA 2JH5D 2ZHWH 2Q6DA 3TGJE 1EX3A 1ANEA 4YOIA 1P3EA 1C1PA 1HJAB 3PMAB 4FU7A 1MAYA 2THFB 3UTUH 3Q3YA 1GBEA 4X1PU 3RXKA 2R0KA 1NPMA 4TPIZ 7LPRA 4X8UH 1LCYA 1AVXA 1FN6A 2XBXA 2VWLA 2BZAA 3A7TA 2XC0A 1VCQA 1WYKA 1C4U2 1Y59T 1THSH 1GMCF 2ZG0H 1V2RT 3TH4H 3OU0A 1NRNH 1AVGH 4IN2A 1NO9H 4OS5A 2BD3A 1O3DA 2F83A 1C1RA 1O2MA 1MU8B 2J95A 1HGTH 3ATKA 1BMNH 4FUHA 3SHCH 2G4UA 3F68H 2ZHDA 1GI6A 5T6GA 2CXVA 4J2YB 1GL1A 1B0FA 1HAVA 1TB6H 1GI8B 2ZO3H 3TJOA 3TH3H 2WYGA 1TPSA 1ANBA 3UOUA 1TONA 1MZDA 3LC3A 1XXDA 1G2LA 1MBQA 3A80A 2Q6GA 2FLBH 1A0HB 2UWPA 4BXWA 2W3KA 1A0LA 2BVXH 2CV3A 4ABJA 1YYY1 1VCWA 5L2ZH 1SGCA 4K1SA 1C5TA 3ODFA 3SUDA 1V2UT 1SGRE 2ZIQH 2SGDE 4ZMAH 4XDEA 3LU9B 5C1XA 1CO7E 1DVAH 4Y11E 1AZ8A 1O5DH 3EAJA 3ZZ9A 4IN1A 1LDTT 1L1NA 1ZLRA 3E0NB 3GYLB 5EG4A 4ABIA 1NRQH 1W7XH 3UPEA 3B23B 1KDQB 2ZU4A 3RXJA 2QCYA 1GWAA 1MQ5A 4A1XA 2ZDAH 2TIOA 3V13A 1FXYA 4ABAA 1VITF 1ZRBA 1EB2A 4DW2U 2ODPA 2FDAA 2BDYA 1AFEH 1HIAA 2J94A 1UCYK 2TGDA 4Y7BA 3V3MA 2Y5GA 3M36A 3P8GA 3MMGA 5A09A 1D3PB 1AQ7A 1GI7B 3T29A 4NIVA 4IS5A 3RXGA 1O2GH 2XBWA 4IMZA 2PGBB 3GY8A 2A5KA 1LPZB 3LH3A 2W26A 1PPHE 4Y71A 7KMEH 4THNH 1SG8B 1SGIB 3PO1C 1BHXF 1P12E 2RA0A 7GCHF 2Z9JA 3P8FA 3F9HA 1K22H 1YLDA 4AB9A 2ZFRH 4MPXA 4CHAC 2AMQA 1C2DA 2GTBA 3FFGA 1HAXB 4TWYA 3HGNA 1T8LA 2YNBA 1ZTKA 4JYTA 3V0XA 4IBLH 3BG4B 2GVFA 1L1JA 1H9HE 4O3TA 5GXPA 1G30B 1F7ZA 2BDCA 3KQCA 1ELBA 2WPIS 3ITIA 1GI1A 1ZSKA 3SV8A 4ZKOU 2VWOA 1SHYA 1QR3E 1QIXB 2VU8E 3KL6A 1TNKA 1GBHA 1UTKA 2ZDLA 4JZEH 1RIWC 4MPVA 1UMAH 2VINA 4JYVH 4BAOB 1EJMA 1UK2A 2BQ7B 3O8DA 1TGNA 1GJ9B 3DA9B 2AH4X 2NU0E 3KN2A 1NS3A 1P11E 3BTME 4I31A 2WUBA 1O2JA 3BIVH 3ZZ5A 2PSYA 1ZHMA 3BEUA 1HV7A 3DHKH 4X6OA 2P8OB 1QB6A 1JRSA 1L4DA 5J4SA 4AG1A 1JOUB 1BTPA 2QYIA 2RA3A 2ZNKH 3M5MA 3UR9A 2HNTF 4XE4A 1AFQC 2BDHA 1T31A 3KCGH 4OS7A 2PKSC 1V2QT 3AW1A 3FVFB 1BZXE 3TGKE 4X1QU 2F9OA 3O8RA 4Q2KA 5FBEA 1O3JA 1LHDH 1DS2E 1QRXA 3MNXA 3TJVA 2G4TA 2BQWB 3HATH 3HK6B 1CVWH 1BMLA 5DGJA 3VEQB 1OWKA 1XUFA 3TPIZ 2ZU2A 3QO6A 3BEIB 5JBTA 4ABGA 1SGNE 5LPRA 1GMDG 3M35A 2O8MA 1QURH 5BPEA 1FY4A 3T5FH 4Y8XA 1C5NH 2NU4E 1T4UH 2VWNA 2C8YB 3PMBB 5JB9S 1DUEA 1HAIH 1NU9A 5DK1A 2EA3A 1FY1A 5EQRA 2PUQH 1P04A 4FUJA 2XC4A 1SLXB 3V7TA 3ZZAA 1F0UA 1ETTH 2OUAA 3RXTA 4ESTE 1MZAA 3PV4A 5E0HA 3SN8A 2LPRA 2D1JA 3D65E 4X8VH 3SORA 1THPB 1QA7A 1GCTC 4NSVA 3PTBA 3P8NA 5FHTA 1K1NA 1Z7KA 2B7DH 1RS0A 8GCHF 1G3BA 3LGTA 1O2KA 4X1NU 1TMUH 2CF8H 2H2ZA 2XTTB 3FP7E 2ZWLH 1TGCA 2A4RA 3RXOA 1BRBE 1A7SA 1MBMA 1KTSB 2A31A 3TK6A 2V35A 1SFQB 3GCHB 2AMPA 1UVSH 3AW0A 3OYPA 1ANDA 4ASHA 1O2HA 1QL7A 2QIQA 3CP7A 4OS2A 5A0CA 3ATMA 3AAVA 1BIOA 1FPHH 2A7HA 3U9AH 3QN7A 1WUNH 3NZIA 3RXAA 1KLJH 1BBRE 1S0QA 1G37A 3M61U 5DO4H 1UTMA 1FLEE 2FS8A 2IN2A 4CRBA 1SHHB 2EI7A 2C8ZB 1JMOH 4I8KA 5A8ZA 3RLYH 1DXWA 1GMHF 2XCNA 4X1RU 2ZDKA 4MTBA 4A5TS 3LGVA 1KXAA 1OPHB 1EAUA 3SGAE 4MNXA 1RGQA 3ZVDA 3LDXH 4X8TH 5EQQA 4NGAH 3E91A 1VZQH 1FIWA 3M7UA 1WQSA 3SW2B 1W12U 1Q31A 2A0QB 3EQ0H 1V2TT 1AN1E 4RN6A 1UVTH 3T28A 1EAIA 3L3TA 4CBOA 2P3FH 4M7GA 2ULLA 2FYQA 4KTSA 3RXFA 1WU1A 1RD3B 1OKXA 1TX8A 5A2MH 1HPGA 2ZDMA 3MU0A 4A92A 3LIWA 1V3XA 4H4FA 3QX5H 1XM1A 3F1SB 1O3IA 2A5AA 3RXEA 3TK5A 2VIPA 2VGCB 2XWBI 4X1SU 3ZZ3A 1TBZH 1QL9A 1T4VH 2QGRA 3DT0H 1Q2WA 4YT6H 2ZF0H 1EOJA 1W10U 4GLYA 1O35A 1CGHA 2PTNA 4OS1A 3FANA 3SQHE 5LPEA 3IG6B 2QC2A 4U01A 2FOEA 4UFDH 1P05A 1DICA 1DX5M 3GISB 1GHYH 8GCHG 1WSSH 1VJ9U 1W0ZU 3TNTA 1SQOA 1A5HA 3OSYA 2Q1JA 3ATWA 2GCTC 2PGQB 1BTXA 1AB9C 4K69A 3U1JB 4UDWH 1TFXA 4B2CA 4GAWA 1SGDE 5F8XA 1LMWB 1Z6EA 3ZZCA 1UHBA 2A7JA 4FUCA 1YPJH 2OBQA 4IC6A 2PW8H 2WYJA 4B75A 1OWIA 1J8AA 1ETRH 1XKBC 1U6QA 1ESTA 2ZFPH 3RXHA 1ZGVA 4NFEA 1E35B 2Z9LA 2G00A 1RTLA 2GMTB 1EAXA 1O2ZA 2WV5A 3I77A 5J4QA 2ZFTA 1GGDB 3MWIU 1IAUA 5I46H 1ABJH 1AHTH 1ELAA 1GMHG 1OYQA 1O2XA 1WV7H 1H9IE 3U8TH 2Z3EA 1ZPBA 1O5EH 5JBCS 1HDTH 4OS4A 2A2QH 4ABEA 1GL0E 1C2LA 1O3BA 1GI4A 3S9AA 3OTJE 2BVRH 3C27B 3ZZ6A 1ZJKA 1QQ4A 2AIQA 1C5VA 2TGPZ 3KIDU 1KDQA 3CENA 2C3SA 1Z8IB 2RDLA 1A61H 4NG9H 2J92A 1CBWC 4DIHH 2B5TB 4WF8A 1SGFA 4I8LA 3M5NA 3QK1A 1MD7A 4AYYB 3ODDA 5C5OA 5DP9A 4INLA 4O9VA 4LOYH 1SSXA 1O3LA 1V2JT 2ALVA 1QTFA 1YCPH 2FOGA 2ANKH 5HGGA 1T32A 3M5LA 3TH2H 1HXFH 1E37B 1Y5AT 4XBDA 1C2EA 1O3OA 2JETC 3PWBA 1LPGB 2BX3A 2A45B 4JK6A 1JBUH 1GVZA 2GCHF 2OQUA 5C67A 4NWKA 4DOQA 1MTWA 2BTCE 3A8DA 1BTUA 5DP4A 1P57B 3PMJA 4GVUA 4CBNA 3LJJA 2HGTH 1MTSA 3AAUA 1N8OB 2GDDA 1PPEE 2FOCA 4DIIH 5H4IB 3SNDA 5GJ4B 1C2HA 1HAGE 5I25A 4K1TA 1GBTA 2K1QA 4KKDA 1C5OH 1CGIE 1PPZA 1WQVH 1D9IA 5JBAS 2ZCLP 2FOMB 3T27A 5AVDA 1FY3A 1P03A 4CRAA 1BBRK 1RTKA 1MTNB 2ZPQA 1AD8H 1NESE 1Y3YA 2BLVA 1K1IA 1V2OT 1BRUP 3UQOA 5EU8A 2STBE 3Q77A 1AMHA 1PPFE 4B73A 1K28D 2WPKS 3KGPA 1YCPK 3SNAA 3CS0A 4ZUHA 3SV6A 1GBDA 1OWJA 1W7GH 1TPOA 3ZZBA 3A7VA 3BTHE 4HFPB 2OQ5A 3T62A 4CRFA 4ZKNU 1O34A 1DSUA 2AEIH 1ID5H 1TX6A 3GICB 1RIWB 3BTQE 4X2WA 1O3NA 2ZZUH 1O5BB 1ESBA 4OGXA 3T2NA 2PKAB 3NK8A 1XVMA 2ZKSA 2BXTH 3A7ZA 2FPZA 1C4V2 3RDZA 1HLTH 1QB1A 3RXDA 3UR6A 2DE8A 1O2OA 1MH0A 1GJAB 5C5NA 4WMDA 2RG3A 1D4PB 2OC8A 4XFQA 1DOJA 4TY7A 3S69A 3D62A 1AFQB 2GCHG 3A7YA 2BLWA 3TU7H 1BUIA 3EGKH 1HJ9A 1MCTA 2QF3A 3SU5A 5K0HA 3S7KB 4D8NA 1AE5A 4MDSA 5C20A 2R2MB 1BRAA 1KXBA 3PM3A 2TPIZ 1TNIA 3BTFE 1C2GA 4UEHH 4AZ2B 1GCDA 1GHZA 1MD8A 2M5TA 3E0PB 1LVBA 1HAZB 1VR1H 3F9EA 3WY8A 1EJNA 1HUTH 1TPAE 1MKWK 3NCLA 4XSKU 1FJSA 3FZZA 4K1EA 1Z6JH 1WAYB 1MMJN 1SQTA 4NA9H 1J16A 1RTFB 1O2PA 5AFYH 3RM2H 1O2UA 2BZ6H 4IMQA 3BSQA 1H8IH 1SB1H 2O8WA 2VH6A 1ACBE 1JXPA 1P2KA 4J1YA 4DT7B 1EPTA 1YPGH 2IJOB 3E90B 3BV9B 2FOAA 5DG6A 1AI8H 1EOLA 3GY2A 4AB8A 1V2MT 1KXEA 1VCPA 5EXNA 6GCHG 1C9TA 4NSYA 1SBWA 3K65B 2PLXA 3A85A 2C93B 1DFPA 4BTTB 2AGEX 4JMYA 3EA8A 1ZHRA 1NC6A 2ZP0H 4LXBH 2XBYA 2BDIA 4YO9A 1WOFA 1EP5A 3T26A 2IOTA 4FUGA 1CA0B 1RFNA 2Y7ZA 1A4WH 2BX4A 2F9NA 3A7WA 3NUMA 2GZ9A 2NU3E 4INKA 3HK3B 1UTOA 1ZOMA 3TVJB 2Z9KA 1FI8A 4Y7AA 4UONA 1L1GA 1C9PA 3SZNA 2ODQA 1O37A 4DGJA 3DD2H 3KHVA 3ZZ8A 5JYIA 4E7RG 3MU8A 3BTKE 1S82A 3ZZDA 1EASA 3ZV8A 3N7OA 2FODA 2BY7X 1J9CH 1B5GH 3KNXA 3SNEA 4CREA 1SVPA 3RXBA 5LPFA 1C1VH 2IPHA 2QXJA 4ZAEA 4AFSA 8LPRA 4NIYA 2VVVA 2OINA 3P92A 1C5WB 3SGQE 1TGSZ 1F0TA 1MKXH 2HNTC 3SJ8A 4LZ1H 4BNRA 1CQQA 1C1MA 1J15A 3B9FH 4ZHMU 3U8OH 3Q3XA 3UFAA 3VFEA 5AHGH 2EI8A 1LQEA 2BD4A 3M37A 4GHTA 1C2JA 3A81A 1P9SA 1QJ1B 3RU4E 4YTAA 4K60A 1C5RA 1G32B 1BTYA 3V12A 3MYWA 1MAXA 3UY9A 4FUBA 1OYTH 1GJ4H 2ZU5A 4K3JA 1O0DH 3EA9A 1GI0A 3M3TA 1GMDF 1GHVH 1GBBA 1D6RA 2OC0A 4D7GA 2YOLA 1DWDH 1VJAU 1YM0A 3UNQA 1LO6A 1TABE 5FPSA 3RC4A 1CGJE 5EGMA 3KQBA 1Z1IA 2ZFQH 1P3CA 1G36A 5T3HA 2WUCA 2R3YA 2SGPE 2RCEA 2C90B 1BQYA 2O8UA 4WXVA 1O2NA 2FI5E 2VB0A 4FUDA 1DSTA 3PLPA 2W5EA 4LK4A 1BJUA 3H5CB 2GZ7A 2FOBA 1YPHC 2GCTB 4Y10E 4INHA 1SLWB 3O8BA 1A5IA 1ZMNA 1NN6A 2AIPA 3PB1E 4R0IA 2H6MA 1GJCB 1XX9A 1GI3A 4ZKRU 1BTHH 1D6WA 1QRZA 3JZ2B 2TRMA 3ZVCA 2AERH 1DM4B 1SOZA 3GCNA 4QT8C 1LPKB 2CGAA 1ELVA 1TOMH 2SNVA 4ISHH 2BY5X 2ZGHA 4PROA 1ARCA 1HAHH 1XVOA 2ZFSA 3FP6E 3VGCC 1EZQA 2P59A 1O32A 4HTCH 4VGCC 2A4QA 2P95A 5E0JA 5HMAA 1ESAA 1DANH 3SI3H 2KAIA 1Z71A 3F6UH 2FTLE 3ZZ7A 1C1NA 2AFQB 1CBWB 1NY22 3M3SA 4JYUH 2QN5T 1SLVB 4KGAA 4WY3A 1VGCC 4HI3A 1C1UH 1H4WA 3A88A 1ARBA 1NZQH 4RKJB 3A83A 1GG6C 4FU9A 2SFAA 1E38B 1GJDB 1GBMA 2FIRH 2TGAA 1PPCE 1HJ8A 3PROA 1E36B 3NPSA 4IW4E 4YT7H 5K7RA 3TGIE 4Y8ZA 2JETB 1YBWA 4MNYA 2PSXA 1B7XB 1LHEH 1BMMH 1BDAA 1HJAC 3MH4A 4DJZB 1K2I1 1DUAA 1FIZA 2UWOA 1TRMA 1DWEH 4A1TA 3LKWA 5FBIA 3L33A 1A46H 2ILNA 1SGPE 1HXEH 2B9LA 1FY8E 2ZCHP 4YLQH 1YPKH 3E16B 4DURA 5A0BA 1PYTC 3Q3KA 1T8OA 1F5RA 4CR5A 2HOBA 1O5AB 3RMMH 1ORFA 1L4ZA 2BXUH 1GBFA 1BTZA 2F9UA 2Z9GA 2A1DB 2ZHEH 4B2BA 4BOHA 3LOXA 3GDUA 1S84A 3GY5A 2ZA5A 1T8NA 2Z3DA 1GJ7B 3HPTB 3RMNH 1EKBB 2VWMA 1LHGH 1ZMJA 3OY5U 4TWWA 2PKAA 3OY6U 2BLQA 4ZHAA 1W0YH 1UTQA 1AVWA 2FMJA 2JH0D 3EA7A 1A2CH 2R9PA 2AMDA 5TJXA 2PV9B 2HWLB 2ZU3A 2WPJS 1MU6B 1O2TA 3LPRA 1UTJA 1AO5A 3STIA 1G9IE 4AN7A 2ZGXH 3DFJA 3RM0H 1RRKA 4NIXA 1Y3VA 3HKJB 1F0SA 3M7QA 4SGBE 7ESTE 1L2EA 2V6NA 2Y6TA 2PFEA 2I6SA 1DPOA 1UTPA 3S9CA 3KEEA 3SJOA 1MUEB 5GWZA 4WMEA 1KXCA 1FN8A 1Z8JB 1PQAA 1LVYA 2FO9A 1N1LA 1Z1JA 5ETXA 1G2MA 1XUGA 4X6NA 4NFFA 1HB0B 1HBTH 1DWCH 3QZQA 1VITH 2G5NA 2ZU1A 3I78A 1PPBH 1TBQH 4GPGA 1GBAA 4ABDA 3U1IB 2JH6D 2AS9A 2ODYB 4D9RA 1ELEE 1K1JA 3UNRA 3MU5A 1AUTC 5FPYA 1S81A 1UK4A 1XUHA 1CU1A 3JZ1B 1QBOA 1F0RA 1BITA 2G51A 1J17T 1TMBH 1OP0A 2H1UA 3A86A 3RMLH 1GDNA 4D7FA 1S6HA 1Z8GA 1EZSC 3M5OA 1ZMLA 1O38A 3RXIA 1IQFA 4MNVA 5B6OA 1GI9B 2P3UB 4KELA 1XUIA 2ZQ1A 2H9TH 2EC9H 1FAXA 1GHWH 1TIOA 2BD7A 5LH8A 1XKAC 5C2ZA 1MTVA 1Z8RA 1TE0A 3RXMA 1E0FD 3W95A 4Q7YA 1ELCA 1W2KH 1WTGH 2VVUA 1JIMA 1DDJA 2HALA 1PPGE 4LZ4B 1YPEH 2A2XH 2XC5A 2P93A 2ANYA 3RU4D 1O5CB 5DP3A 1TYNA 3VB3A 2FX6A 1DLEA 1ANCA 1QQUA 3W94A 1P09A 4GCHF 2FI4E 2FP7B 1TMTH 3SQEE 2UUJB 3SOSA 1BA8B 1LVMA 4BAQB 3PMHB 4H6TA 1A5GH 3PTNA 1NRPH 1IHTH 3B8JA 5FCRA 1Y5BT 1ELGA 4ZHLU 5JPMH 2QY0B 3SU1A 3A8AA 2C4FH 4JZDH 2EEKA 3A87A 1GBJA 5CHAC 5IDKA 2HPPH 2QV1A 1SOTA 4K8BA 2VH0A 2XW9A 2PWXA 1O2QA 9ESTA 1GBLA 3NKKA 1C5YB 1QJ6B 3HKIB 1DWBH 4YOGA 1CSOE 2A7CA 3ZYDA 4KTCA 1KLIH 6CHAC 1LQDB 4F4OC 3UNSA 1FONA 1N6XA 2NU2E 4HZHA 2Y81A 1ZTJA 3K9XB 1NFWA 4NZQA 4WVPE 3ELAH 3VXEH 3UREA 1IQHA 1DY8A 2BD5A 4OGYA 1IQNA 3ATIA 1V2VT 3RXRA 4YLUA 1FY5A 1JIRA 1KLTA 4FUEA 1P02A 1IQEA 1SGYE 1TX7A 2XXLA 5E2OA 4SGAE 4NZLA 3RUOA 1GI5A 2CMYA 3P8OA 4JZIA 6LPRA 1DLKB 3QTVH 2HRVA 3GCTF 3GY4A 2ZHQH 4CR9A 1YKTA 1TRNA 1QBNA 1SQAA 3QZRA 2QXHA 2XCFA 3PLBA 4MLFB 4ZH8A 3PO1B 4ISLA 5AF9H 3NXPA 3ZVEA 2UUYA 1IQIA 3EE0B 4CH8B 1TNGA 1Y3XA 2BOKA 2ZEBA 4YZUA 4CHAB 2AYWA 5FCKA 1LHCH 3FP8E 4B76A 4AFQA 2QF0A 6GCHF 4GCHG 2F91A 4MVNA 5EW1H 2P16A 2ANWA 1NTPA 1P10A 4TYDA 1CHOF 3BTTE 1EPTC 3P17H 4DY7B 1KXDA 1GHXH 1BRCE 2CF9H 3BEFB 2GD4B 5GIBA 2ZGBH 3GCHC 3U8RH 5FXLA 3MO9A 2FXRA 1O2YA 5EPYA 3SUFA 1IOEA 2OXSA 3ATLA 4XOJA 2F3CE 4OS6A 1O3PB 3A7XA 4DCDA 1MCVA 5FAHA 1XMNB 2BQ6B 1TNJA 3ZZ4A 2CJIA 1GDQA 5L2YH 1IQGA 1SPJA 1ZHPA 4X0WU 3MHWU 1OWDA 3BTWE 1O2RA 4WWYA 2UUKB 4Y0YE 4VGCB 1FV9A 1W11U 1NROH 1H8DH 3URCA 2BDAA 2EI6A 3E1XB 4I32A 1V2PT 5IYTA 1FNIA 2GX4A 2CN0H 1PJPA 4NA7A 4F49A 1RXPA 2ZDVH 2PKSB 3VB5A 1B0EA 1OS8A 5JBBS 2WPLS 2R3UA 4BAHB 1WTHD 2ANMH 5C1UA 5A8XA 3VXFH 5BRRE 1QHRB 1MQ6A 5DP5A 1FMGA 3GCTG 2Y5FA 5HXFA 1V2KT 4B1TA 3OX7U 1P0SH 1ZSJA 3KF2A 4O03A 2Z3CA 1K1LA 5HM2A 2I6QA 1KIGH 1O2LA 3LJOA 4UFFH 2HLCA 5DJ7A 2VGCC 4WH6A 2F9BH 4K2YA 3TITA 3HGPA 1Y3UA 4Q7XA 3SJ9A 1FZZA 4I7YH 4YESB 1C5SA 1HFDA 3R3GB 3PWCA 3FAOA 1V2LT 1ZPCA 3D49H 1IQJA 1K1MA 1QJ7B 2FZZA 2PTCE 2G55A 5T6FA 2VVCA 1O5GH 3SV2H 2ESTE 5DP6A 1LKBA 3C1KA 4BTIB 5T6DA 4YOJA 1CHOG 1GCTB 1OOKB 1O3AA 2VJ1A 3LGYA 2H9EH 1S83A 1TOCB 2TGTA 4ABBA 3K2UA 1AWHB 2FOHA 3QWCH 3SI4H 1C1QA 5L6NH 2P94A 1UCYH 1Y3WA 5EXMA 4MG3A 2JKHA 3RXVA 5DP7A 2GMTC 3QTOH 1AZZA 1GGDC 1XUJA 1TQ0B 2ZQ2A 1QY6A 1C1SA 3RXQA 4GHQA 1BCUH 3A82A 4I8GA 3RXCA 5GCHF 1YCPM 2BB4A 2PR3A 4NIWA 3DFLA 3SHAH 1OX1A 1UHBB 3MH6A 2HVXA 5CMXH 4E7NA 1HCGA 1V2ST 1C5XB 1GHBG 3RXUA 1YGCH 2J4IA 1W14U 1ZGIA 4KTUA 4X6MA 3QLPH 5G4BA 4ISOA 1P9UA 1C5QA 2GP9B 1BJVA 5F8TA 1CT0E 1O39A 2O8TA 3MH7A 1OSSA 2FTMA 1C5ZB 1UTLM 3ZYEA 1P2OA 1SL3A 4MPWA 3SNBA 3SUEA 1BT7A 4ABHA 4BAMB 4Y6DA 4ZROA 1KYNA 3BTDE 1S85A 3K6YA 1CT2E 3ZVFA 1F92A 1NFXA 1SR5C 2VIQA 3MO6A 1TA2A 4ZXXH 2ZECA 3TNSA 2C8WB 5F6MA 3BF6H 1O3CA 5EODA 3MU4A 5C3NA 1ZJDA 1O3EA 2OTVA 2Z94A 1GBKA 2G5VA 1QGFA 1MTUA 2BD8A 4Q80A 5C1YA 1SGQE 1K21H 3RLWH 6ESTA 2BDGA 1KXFA 1N8OC 2SGEE 1GHAF 1GBCA 2OCVB 3MFJA 1GMCG 4O3UA 1TALA 3MNCA 1IHSH 1A3BH 2OD3B 3TIUA 4AG2A 3GYMA 2BLOA 1AB9B 2FX4A 3EYDA 3STJA 3S9BA 1MTNC 2CHAC 1UO6A 1TPPA 1MKXK 1KY9A 2Y80A 3E6PH 2BMGB 5GCHG 4CH2B 5F8ZA 3LT3A 1UTNA 2ZC9H 1TWXB 1UK3A 2A5IA 1BB0B 3NWUA 4CRCA 2BY9X 2TBSA 1AIXH 5EW2H 1LVOA 1PYTD 3AASA 3RC6A 4Y79A 3Q76A 1K9OE 1C5MD 2O8LA 2VNTA 2WPHS 8ESTE 5JB8S 3VB6A 5A0AE 3SJIA 4E06H 1P2JA 4MPUA 2YNAA 1ABIH 2UWLA 4ABFA 3A89A 4KP0A 1QCPA 3UOPA 1ZPZA 4GUXA 1PQ5A 3P70B 3RU4T 5CHAB 2H9HA 1TNHA 2XBVA 2BY6X 1AU8A 2WV4A 2D26C 2XYAA 2ZTZA 2VIDA 3BTGE 4FU8A 4B2AA 4Y8YA 2AGGX 4YM9A 1GJBB 8KME2 1AWFH 1VITG 4U2WA 1OWEA 1C5UA 1O5FH 1GBIA 4UFGH 6CHAB 3TLOA 3MNBA 1IQLA 1S6FA 1DY9A 3SU2A 5GDSH 1HAPH 3GY3A 1THRH 1KSNA 3UQVA 2A4GA 3MO3A 1GHAG 2H5CA 4JCNA 1IQMA 3MU1A 1YLCA 1H1BA 3ESTA 1Y5UT 2BOHB 1EATA 2F9VA 4AGKA 1EP6A 1JWTA 1BOQA 1HAOH 4TPYA 1WBGB 2PUXB 7GCHG 5E2PA 1PFXC 4E05H 1GPZA 2ZDNA 3S0NA 1TA6A 3SBKA 4CRDA 1NT1A 2BM2A 2FS9A 1AKSB 1HNEE 2BVSH 3BG8A 4Z0KA 1CT4E 3VB7A 1AGJA 1YC0A 3SU6A 1N6YA 1K1PA 1EXFA 4BANB 5E8EH 2FWWA 2ZCKP 1V2NT 2LNCA 2J9NA 3LONA 4TY6A 4K5ZA 1DITH 4U32A 1DXPA 1SC8U 1PQ7A 3M7TA 5AFZH 1QBVH 1FPCH 1TRYA 2PHBA 3SO3A 3SJKA 1G3DA 1NRSH 5CE1A 2GT8A 3F9FA 4RSPA 2VIVA 2XWAA 4CRGA 2FYRA 3BIUH 1SFIA 2DE9A 1FDPA 1CA0C 3RXPA 2FI3E 3UWJH 3RXLA 3CS7A 4ISIH 1EPTB 2B0FA 1UVUH 1EZUC 2GV7A 4ISNA 1O36A 4A6LA 2BYAX 5DP8A 2W3IA 1A3EH 2ZGCA 1S5SA 3U98H 2Z9IA 2HNTE 1QFKH 3SU4A 3GY7A 2QXIA 4FUIA 1M9UA 3ZVBA 1HAVB 4UE7H 1AE8H 2C8XB 1CE5A 1DT2A 4X2XA 1O33A 9LPRA 1UVOA 1ZRKA 3LGUA 3UWIA 3MOCA 1SI5H 2BDBA 4WJG2 1H9LB 4Z6AH 1S0RA 1F5LA 1EQ9A 1C5LH 1ZZZA 4O97A 1ZSLA 4FUFA 4IC5A 1SGEE 4U30A 5GPIB 4FVDA 4NWLA 2W7SA 3MI4A 1A0JA 2BD9A 1O30A 3E8LA 1P2MA 4MNWA 1OP8A 3S7HB 3RC5A 2Z7FE 1ELTA 1K1OA 1XUKA 1EAWA 2FEQH 3EDXB 4MQAA 3SGBE 4X2VA 1GJ8B 2FM2A 1FQ3A 2XNIA 1P8VC 1SMFE 2VIOA 1D3DB 5ESBA 4NA8A 2NWNA 3URDA 4JZFH 1C2MA 2D2DA 2R0LA 4AGJA 4AOQA 3KQDA 4Y0ZE 2J38A 1HYLA 1V6DA 3E3TA 1NRRH 1YPHE 3ZVAA 1F2SE 2SGFE 1V2WT 4UD9H 2QXGA 1ELFA 1ELDE 3SNCA 4H6SB 2BY8X 1P01A 1HIAB 2B8OH 1P06A 4XBBA 1GVLA 4X2YA 1UVPA 5FX6A 1UJ1A 1BHXB 4D76A 1A1RA 1SGTA 1O31A 4BXSA 1C2FA
chains in the Genus database with same CATH superfamily
1FUJA 2ASUB 3BG4C 4GSOA 4I33A 4ZKSU 4D9QA 1QNJA 1ETSH 1NFUA 1LHFH 2V7QD 5ABWA 1GJ5H 4AFUA 1TBRH 3QUMP 5EOKA 3KYFA 1WCZA 2G8TA 3ZVGA 3F2FA 2XRCA 3LC5A 2O9QA 3RP2A 1GDUA 1D3TB 1PQ8A 3UIRA 1J14A 1HAYB 4IGDA 3QDZB 2ZHFH 3SUGA 1C2IA 1LKAA 2V3HH 3GDSA 5EPNA 1Q3XA 5TCAA 1C1TA 1KTTB 4DG4A 2FESH 5FX5A 3FOAA 5LGOA 2GV6A 1O2SA 4YXWD 3QGNB 1IQKA 2P3TB 2F4LA 1CA8B 4BAKB 1E34B 1O3GA 2P8OC 2F9PA 2GDEH 2H5DA 2V3OH 1ZR0A 2GZ8A 3GCOA 3R0FA 4ZXYH 3ZV9A 1ZYOA 2ZGJA 1GJ6A 1YPMH 2W7UA 2ZTXA 1O3HA 5ESTE 1XXFA 1G3EA 2PP6A 2G52A 3MNSA 2ZI2H 3LGWA 1YF4A 3BTEE 2QA9E 5DKMA 2WPMS 2SGQE 1W13U 1BBRH 1TQ7B 1C1WH 4JZ1A 1L0ZA 1G3CA 1DE7H 3TJUA 5EXLA 2GT7A 1OXGA 1INCA 2D8WA 2J34A 2R2WU 2GKVE 2VBCA 4WH8A 4X6PA 2Z6BD 3BN9A 4FVBA 3GDVA 1O3KA 1EZXC 1Y8TA 5DSFA 1RJXB 2LP6A 3TJNA 1O3MA 2HPQH 1FAKH 1O2IA 3A8CA 3KQEA 1O2WA 4XBCA 1HRTH 2KAIB 1YPLH 2VIWA 3SV9A 4H42U 1GVKB 3O8CA 2SGAA 5E0GA 4ZCNA 3A8BA 1O2VA 5EJ1A 3OTPA 3SU0A 1OP2A 1TNLA 1C4Y2 3PLKA 5HM9A 3AVZA 1TGTA 3GOVB 2V0BA 1TLDA 5A8YA 2ALPA 4AORA 3F9GA 1SLUB 3TK9A 1BMAA 3I29A 2QAAA 1EB1H 2Q6FA 1T8MA 3RXSA 1D3QB 2ZPRA 2A32A 2UUFB 3H7TA 2OLGA 4AYVB 3UUZA 1UCYE 3AK5A 2OP9A 3MTYA 4HGCA 1T7CA 4I8HA 2WINI 3U69H 3MH5A 5PTPA 2AHME 4B71A 1OWHA 5EJLA 2GGVB 3VB4A 1QB9A 1C2KA 3QGJA 1JRTA 5F03A 4X8SH 3PYHA 1W3CA 5HYOA 1NU7B 3GY6A 1AUJA 2BHGA 2G81E 4JK5A 5EQSA 1C5PA 1QL8A 4I8JA 5L30H 1EUFA 4R8TB 4A1VA 4AX9H 4Y76A 2CHAB 1AY6H 3A84A 5C17A 1C1OA 2Y5HA 4NCYA 2OC1A 4Q7ZA 1P2NA 4DVAU 3L6PA 3SU3A 1TAWA 1BTWA 1MKWH 3ENSB 2A4OA 2OC7A 4AFZA 1NFYA 1P2QA 3P6ZB 2ZPSA 4A7IB 3G01A 4K8YA 2NU1E 4FXGH 3VGCB 3T25A 3P95A 2Y82A 3LGIA 1NM6A 3IWMA 5DPAA 1ZTLA 1QA0A 2DUCA 3F0OA 1EJAA 3K6ZA 2J2UA 1F5KU 1GHBF 2KCYA 4UFEH 2BD2A 2Y7XA 5JDUB 2FLRH 2AGIX 3SV7A 1YP9A 4WMFA 1QRWA 3Q00A 2OBOA 3RMOH 1SGFG 3LH1A 4B74A 1X7AC 1P2IA 2SNWA 4WXIA 4RKOB 2LELA 3VPKA 3M3VA 1VGCB 1O3FA 2ZFFH 5C0UA 3H7OA 4XRNA 5FPTA 5TCCA 2ZTYA 1GI2A 3FZDA 3D23A 1CHGA 5SGAE 2FOFA 2STAE 4BTUB 1GG6B 1LTOA 1UW7A 1TGBA 3IITA 3DUXH 1W8BH 4Q63A 1AKSA 2JH5D 2ZHWH 2Q6DA 3TGJE 1EX3A 1ANEA 4M9FA 4YOIA 1P3EA 1C1PA 1HJAB 3PMAB 4FU7A 1MAYA 2THFB 3UTUH 3Q3YA 1GBEA 2EQNA 4X1PU 3RXKA 2R0KA 1NPMA 4TPIZ 7LPRA 4X8UH 1LCYA 1AVXA 1FN6A 2XBXA 2VWLA 2BZAA 3A7TA 2YMSB 2XC0A 1VCQA 1WYKA 1C4U2 1Y59T 1THSH 1GMCF 2ZG0H 1V2RT 3TH4H 3OU0A 1NRNH 1AVGH 4IN2A 1NO9H 4OS5A 2BD3A 1O3DA 2F83A 1C1RA 1O2MA 1MU8B 2J95A 1HGTH 3ATKA 1BMNH 4FUHA 3SHCH 2G4UA 3F68H 2ZHDA 1GI6A 5T6GA 2CXVA 4J2YB 1GL1A 1B0FA 1HAVA 1TB6H 1GI8B 2ZO3H 3TJOA 3TH3H 2JIZD 2WYGA 1TPSA 1ANBA 3UOUA 1TONA 1MZDA 3LC3A 1XXDA 1G2LA 1MBQA 3A80A 2Q6GA 2FLBH 1A0HB 2UWPA 4BXWA 2W3KA 4P00A 1A0LA 2BVXH 2CV3A 4ABJA 3ZIAD 1YYY1 1VCWA 5L2ZH 1SGCA 4K1SA 1C5TA 3ODFA 3SUDA 1V2UT 1SGRE 2ZIQH 2SGDE 4ZMAH 4XDEA 3LU9B 5C1XA 1CO7E 1DVAH 4Y11E 1AZ8A 1O5DH 3EAJA 3ZZ9A 4IN1A 1LDTT 1L1NA 1ZLRA 3E0NB 3GYLB 5EG4A 2KR7A 4ABIA 1NRQH 1W7XH 4OM9A 3UPEA 3B23B 1KDQB 2ZU4A 3RXJA 2QCYA 1GWAA 1MQ5A 4A1XA 2ZDAH 2TIOA 3V13A 1FXYA 3VG8A 4ABAA 1VITF 1ZRBA 1EB2A 4DW2U 2JDID 2ODPA 2FDAA 2BDYA 1AFEH 1HIAA 2J94A 1UCYK 2TGDA 4Y7BA 3V3MA 2Y5GA 3M36A 3P8GA 3MMGA 5A09A 1D3PB 1AQ7A 1GI7B 3T29A 4NIVA 4IS5A 3RXGA 1O2GH 2XBWA 1VKYA 4IMZA 4DT4A 2PGBB 3GY8A 2A5KA 1LPZB 3LH3A 2W26A 1PPHE 4Y71A 3PV2A 7KMEH 5DN6D 4THNH 1SG8B 1SGIB 3OEHD 3PO1C 1BHXF 1P12E 2W6JD 2RA0A 7GCHF 2Z9JA 3P8FA 3F9HA 1K22H 1YLDA 4AB9A 2ZFRH 4MPXA 4CHAC 2AMQA 1C2DA 2GTBA 3FFGA 1HAXB 4TWYA 3HGNA 1T8LA 2YNBA 1ZTKA 4JYTA 3V0XA 4IBLH 3BG4B 2GVFA 1L1JA 1H9HE 4O3TA 5GXPA 1G30B 1F7ZA 2BDCA 3KQCA 1ELBA 2WPIS 3ITIA 2YMSD 1GI1A 2KCAA 1ZSKA 4Q4LA 3SV8A 2M2AA 4ZKOU 1QZ8A 2VWOA 1SHYA 1QR3E 1QIXB 2VU8E 3KL6A 1TNKA 1GBHA 1UTKA 2ZDLA 4JZEH 1RIWC 4MPVA 1UMAH 2VINA 4JYVH 4BAOB 1EJMA 1UK2A 2BQ7B 3O8DA 2OK5A 1TGNA 1GJ9B 3DA9B 2AH4X 2NU0E 3KN2A 1NS3A 1P11E 3BTME 4I31A 2WUBA 1O2JA 3BIVH 3ZZ5A 2PSYA 1ZHMA 3BEUA 4RT0A 1HV7A 3DHKH 4X6OA 2P8OB 1QB6A 1JRSA 1L4DA 5J4SA 4AG1A 1JOUB 1BTPA 2QYIA 2RA3A 2ZNKH 3M5MA 3UR9A 2HNTF 4XE4A 1AFQC 2BDHA 1T31A 3KCGH 4OS7A 2PKSC 1V2QT 3AW1A 3FVFB 1BZXE 3TGKE 4X1QU 2F9OA 3O8RA 4Q2KA 5FBEA 1O3JA 1LHDH 1DS2E 1QRXA 3MNXA 3TJVA 2G4TA 2BQWB 3HATH 4I86A 3HK6B 1CVWH 1BMLA 5DGJA 3VEQB 1OWKA 1XUFA 3TPIZ 2ZU2A 3QO6A 3BEIB 3WWFA 5JBTA 4ABGA 1SGNE 5LPRA 1GMDG 3M35A 2O8MA 1QURH 5BPEA 1FY4A 3T5FH 4Y8XA 1C5NH 2NU4E 1T4UH 2VWNA 2C8YB 3PMBB 5JB9S 1DUEA 1HAIH 1NU9A 5DK1A 2EA3A 1FY1A 5EQRA 2PUQH 1P04A 4FUJA 2XC4A 1SLXB 3V7TA 3ZZAA 1F0UA 1ETTH 2OUAA 3RXTA 4ESTE 1MZAA 3PV4A 5E0HA 3SN8A 2LPRA 2D1JA 3D65E 4X8VH 2J5UA 1THPB 3SORA 1QA7A 1GCTC 4NSVA 3PTBA 3P8NA 5FHTA 1K1NA 1Z7KA 2B7DH 1RS0A 8GCHF 1G3BA 3LGTA 1O2KA 2W6ID 4X1NU 1TMUH 2CF8H 2H2ZA 2XTTB 3FP7E 2ZWLH 1TGCA 2A4RA 3RXOA 1BRBE 1A7SA 1MBMA 1KTSB 2A31A 4Z1MD 1BMFD 2J97A 3TK6A 2V35A 1SFQB 3GCHB 2IJD1 2AMPA 1UVSH 3AW0A 3OYPA 1ANDA 4ASHA 1O2HA 1QL7A 2QIQA 3CP7A 4OS2A 5A0CA 3ATMA 3AAVA 1BIOA 1FPHH 2A7HA 3U9AH 3QN7A 1FX0B 1WUNH 3NZIA 3RXAA 1KLJH 1BBRE 1S0QA 1G37A 3M61U 5DO4H 1UTMA 1FLEE 2FS8A 2IN2A 4CRBA 1SHHB 2EI7A 2C8ZB 1JMOH 4I8KA 2KM0A 5A8ZA 3RLYH 1DXWA 1GMHF 2XCNA 4X1RU 2ZDKA 4MTBA 4A5TS 3LGVA 1KXAA 1OPHB 1EAUA 3SGAE 4MNXA 1RGQA 3ZVDA 3LDXH 4X8TH 5EQQA 4NGAH 3E91A 1VZQH 1FIWA 3M7UA 1WQSA 3SW2B 1W12U 1Q31A 2A0QB 3EQ0H 1V2TT 1AN1E 4RN6A 1UVTH 3T28A 1EAIA 3L3TA 4CBOA 2P3FH 4M7GA 2ULLA 2FYQA 4KTSA 3RXFA 1WU1A 1RD3B 1OKXA 1TX8A 5A2MH 1HPGA 2RFKC 2ZDMA 3MU0A 4A92A 1MABB 3LIWA 1V3XA 4H4FA 3QX5H 1XM1A 3F1SB 1O3IA 3FKSD 2A5AA 3RXEA 3TK5A 2VIPA 2VGCB 2XWBI 4X1SU 3ZZ3A 1TBZH 1QL9A 1T4VH 2K8IA 2QGRA 3DT0H 1Q2WA 4YT6H 2ZF0H 1EOJA 1W10U 4GLYA 1O35A 1CGHA 2PTNA 4OS1A 3FANA 3SQHE 5LPEA 3IG6B 2QC2A 4U01A 2FOEA 4UFDH 1P05A 1DICA 3OAAD 1DX5M 3GISB 1GHYH 3FO8D 8GCHG 1WSSH 1VJ9U 1W0ZU 3TNTA 1SQOA 1A5HA 3OSYA 2Q1JA 3ATWA 3DSOA 2GCTC 2PGQB 1BTXA 1AB9C 4K69A 3U1JB 4UDWH 1TFXA 4B2CA 4GAWA 1SGDE 5F8XA 1LMWB 1Z6EA 3ZZCA 1UHBA 2A7JA 4FUCA 1YPJH 2OBQA 4IC6A 2PW8H 2WYJA 4B75A 1OWIA 1J8AA 1ETRH 1XKBC 1U6QA 1ESTA 3N7DA 2ZFPH 3RXHA 1ZGVA 4NFEA 1E35B 4B6FA 2Z9LA 3DSGA 2G00A 1RTLA 2GMTB 1EAXA 1O2ZA 2WV5A 3I77A 4HG6A 5J4QA 2ZFTA 1GGDB 3MWIU 1IAUA 5I46H 1ABJH 3CNRA 1AHTH 1ELAA 1GMHG 1OYQA 1O2XA 1WV7H 1H9IE 3U8TH 2Z3EA 1ZPBA 1O5EH 5JBCS 1HDTH 4OS4A 2A2QH 4ABEA 1GL0E 1C2LA 1O3BA 1GI4A 3GS9A 3S9AA 3OTJE 2BVRH 3C27B 3KQ5A 3ZZ6A 1ZJKA 1QQ4A 2AIQA 1C5VA 2TGPZ 3KIDU 1KDQA 3CENA 2C3SA 1Z8IB 2RDLA 1A61H 4NG9H 2J92A 1CBWC 4DIHH 2B5TB 4WF8A 1SGFA 4I8LA 3M5NA 3QK1A 1MD7A 4AYYB 3ODDA 5C5OA 5DP9A 4INLA 4O9VA 4LOYH 1SSXA 1O3LA 1V2JT 2ALVA 1QTFA 1YCPH 1H8HD 2FOGA 2ANKH 5HGGA 1T32A 3M5LA 3TH2H 1HXFH 1E37B 1Y5AT 4XBDA 1C2EA 1O3OA 2JETC 3PWBA 1LPGB 2BX3A 2A45B 4JK6A 4FETA 1JBUH 1GVZA 2GCHF 2OQUA 5C67A 4NWKA 4DOQA 1MTWA 2J98B 2BTCE 3A8DA 1BTUA 5DP4A 1P57B 3PMJA 4GVUA 4CBNA 3LJJA 2HGTH 3H09A 1MTSA 3AAUA 1N8OB 2GDDA 1PPEE 3MQKC 2FOCA 4DIIH 5H4IB 3SNDA 2L74A 5GJ4B 1C2HA 1HAGE 5I25A 4K1TA 1GBTA 2K1QA 4KKDA 1C5OH 1CGIE 1PPZA 1WQVH 1D9IA 5JBAS 2ZCLP 2FOMB 3T27A 5AVDA 1FY3A 1P03A 4CRAA 1BBRK 1RTKA 1MTNB 2ZPQA 1AD8H 1NESE 1Y3YA 2BLVA 1K1IA 1V2OT 1BRUP 3UQOA 5EU8A 2STBE 3Q77A 1AMHA 1PPFE 1WDIA 4B73A 1K28D 2WPKS 3KGPA 1YCPK 3SNAA 4RI0A 3CS0A 4ZUHA 3SV6A 1GBDA 1OWJA 1W7GH 1TPOA 3WWBA 3ZZBA 3A7VA 3BTHE 3FN8A 4HFPB 2OQ5A 3T62A 4CRFA 4ZKNU 2WSSD 1O34A 1DSUA 2AEIH 1ID5H 1TX6A 3GICB 1RIWB 3BTQE 4X2WA 1O3NA 2ZZUH 1O5BB 1ESBA 4OGXA 3T2NA 2PKAB 3NK8A 1XVMA 2ZKSA 2BXTH 3A7ZA 2FPZA 1C4V2 3RDZA 1HLTH 1QB1A 3RXDA 3UR6A 2DE8A 1O2OA 1MH0A 1GJAB 5C5NA 4WMDA 2RG3A 1D4PB 2OC8A 4XFQA 1DOJA 4TY7A 3S69A 3D62A 1AFQB 2GCHG 3A7YA 2BLWA 3TU7H 1BUIA 3EGKH 1HJ9A 1MCTA 2QF3A 3SU5A 5K0HA 3S7KB 3PRDA 4D8NA 2EY4C 1AE5A 4MDSA 5C20A 2R2MB 1BRAA 1KXBA 1E79D 2TPIZ 3PM3A 5B6LA 1TNIA 3BTFE 1C2GA 4UEHH 4AZ2B 1GCDA 1GHZA 1MD8A 2M5TA 3E0PB 1LVBA 1HAZB 1VR1H 3F9EA 3WY8A 1EJNA 1HUTH 1TPAE 1MKWK 3NCLA 4XSKU 1FJSA 1H8ED 3FZZA 4K1EA 1Z6JH 1WAYB 1MMJN 1SQTA 4NA9H 1J16A 1RTFB 1O2PA 5AFYH 3RM2H 1O2UA 2BZ6H 4IMQA 5CDFE 3BSQA 1H8IH 1SB1H 2O8WA 2VH6A 1ACBE 1JXPA 1P2KA 4J1YA 4DT7B 1EPTA 1YPGH 2IJOB 3E90B 5EIYA 3BV9B 2FOAA 5DG6A 1AI8H 1EOLA 3GY2A 4AB8A 1V2MT 1KXEA 1VCPA 5EXNA 6GCHG 1C9TA 4NSYA 1SBWA 3K65B 2PLXA 3A85A 1OHHD 2C93B 1DFPA 4BTTB 2AGEX 4JMYA 3EA8A 1ZHRA 1NC6A 2ZP0H 4LXBH 2XBYA 2BDIA 4YO9A 1WOFA 1EP5A 3T26A 2IOTA 4FUGA 1CA0B 1RFNA 2Y7ZA 1A4WH 2BX4A 2F9NA 3A7WA 3NUMA 2GZ9A 2NU3E 4AC9A 4INKA 3HK3B 1UTOA 1ZOMA 3TVJB 2Z9KA 1FI8A 4Y7AA 4UONA 1L1GA 1C9PA 3SZNA 3N99A 2ODQA 1O37A 4DGJA 3DD2H 3KHVA 3ZZ8A 5JYIA 4E7RG 3MU8A 3BTKE 1S82A 3ZZDA 3PRBA 1EASA 3ZV8A 3N7OA 2FODA 2BY7X 1J9CH 1B5GH 3KNXA 3SNEA 4CREA 1SVPA 3RXBA 5LPFA 1C1VH 2IPHA 2QXJA 4ZAEA 4AFSA 8LPRA 4NIYA 2VVVA 2F43B 2OINA 3P92A 1C5WB 3SGQE 3SZEA 1TGSZ 1F0TA 1MKXH 2HNTC 3SJ8A 4LZ1H 4BNRA 1CQQA 1C1MA 1J15A 3B9FH 4ZHMU 3U8OH 3Q3XA 3UFAA 3VFEA 5AHGH 2EI8A 1LQEA 2BD4A 2L6OA 3M37A 4GHTA 1C2JA 3A81A 1P9SA 1QJ1B 3RU4E 4YTAA 4K60A 1C5RA 1G32B 1BTYA 3V12A 3MYWA 1MAXA 3UY9A 4FUBA 1OYTH 1GJ4H 2ZU5A 4K3JA 1O0DH 3EA9A 1GI0A 3M3TA 1GMDF 1GHVH 1GBBA 1D6RA 2OC0A 4D7GA 2YOLA 1DWDH 1VJAU 1YM0A 3UNQA 1LO6A 1TABE 2KZ4A 5FPSA 3RC4A 1CGJE 5EGMA 3KQBA 1Z1IA 2ZFQH 1P3CA 1G36A 5T3HA 2WUCA 2R3YA 2SGPE 2RCEA 2C90B 1BQYA 2O8UA 4WXVA 1O2NA 2FI5E 2VB0A 4FUDA 2WZQA 1DSTA 3PLPA 2W5EA 4LK4A 1BJUA 3H5CB 2GZ7A 2FOBA 1YPHC 2GCTB 4Y10E 4INHA 1SLWB 3O8BA 1A5IA 1ZMNA 1NN6A 2AIPA 3PB1E 4R0IA 1S6LA 1NBME 2H6MA 1GJCB 1XX9A 1GI3A 4ZKRU 2XOKD 1BTHH 1D6WA 2XNDD 1QRZA 3JZ2B 2TRMA 5KGOA 3ZVCA 2AERH 1DM4B 1SOZA 3GCNA 4QT8C 1LPKB 2CGAA 1ELVA 1TOMH 2SNVA 4ISHH 2BY5X 2ZGHA 1COWD 3OEED 4PROA 1ARCA 1HAHH 1XVOA 2ZFSA 3FP6E 5F53A 1EZQA 2P59A 3PV5A 3VGCC 1O32A 4HTCH 4VGCC 2A4QA 2P95A 5E0JA 5HMAA 1ESAA 1DANH 3SI3H 3W1EA 2KAIA 1Z71A 3F6UH 2FTLE 3ZZ7A 1C1NA 2AFQB 1CBWB 1NY22 3M3SA 4JYUH 2QN5T 1SLVB 4KGAA 4WY3A 2J98A 1VGCC 4HI3A 3WW7A 1C1UH 1H4WA 3A88A 1ARBA 1NZQH 4ACBA 4RKJB 3A83A 1GG6C 4FU9A 2SFAA 1E38B 1GJDB 1GBMA 2FIRH 2TGAA 1PPCE 1HJ8A 3PROA 1E36B 3NPSA 4IW4E 4YT7H 5K7RA 3TGIE 5HKKD 4Y8ZA 2JETB 1YBWA 4MNYA 2PSXA 1B7XB 1LHEH 1BMMH 1BDAA 1HJAC 3MH4A 4DJZB 1K2I1 1DUAA 1FIZA 2UWOA 5T1VA 1TRMA 1DWEH 4A1TA 3LKWA 5FBIA 5GNDA 3L33A 1A46H 2ILNA 1SGPE 1HXEH 2B9LA 2YMSC 1FY8E 2ZCHP 4YLQH 1YPKH 3E16B 4DURA 3DSPA 5A0BA 1PYTC 3Q3KA 1T8OA 1F5RA 3NRLA 4CR5A 2HOBA 1O5AB 3RMMH 1ORFA 1L4ZA 2BXUH 1GBFA 1BTZA 2F9UA 2Z9GA 2A1DB 2ZHEH 4B2BA 4BOHA 3LOXA 3GDUA 1S84A 3GY5A 2ZA5A 1T8NA 2Z3DA 1GJ7B 3HPTB 3RMNH 1EKBB 1EFRD 2JJ2D 4TT3D 2VWMA 1LHGH 1ZMJA 3OY5U 2V3MA 4TWWA 2PKAA 3OY6U 2BLQA 4ZHAA 1W0YH 1UTQA 1YWUA 1AVWA 2FMJA 2JH0D 3EA7A 1A2CH 2R9PA 5KEDA 2AMDA 5TJXA 2PV9B 2HWLB 2ZU3A 2WPJS 1MU6B 1O2TA 3LPRA 1UTJA 3OE7D 1AO5A 3STIA 1G9IE 4AN7A 2ZGXH 3DFJA 3RM0H 1RRKA 4NIXA 1Y3VA 3HKJB 1F0SA 3M7QA 4SGBE 7ESTE 1L2EA 2V6NA 2Y6TA 2PFEA 2I6SA 1DPOA 1UTPA 3S9CA 3KEEA 3SJOA 1MUEB 5GWZA 4WMEA 1KXCA 1FN8A 1Z8JB 1PQAA 1LVYA 2FO9A 1N1LA 1Z1JA 5ETXA 1G2MA 1XUGA 4X6NA 4NFFA 1HB0B 4TSFD 1HBTH 1DWCH 3QZQA 1VITH 2G5NA 2ZU1A 3I78A 1PPBH 1TBQH 4GPGA 5HIZA 1GBAA 4ABDA 3U1IB 2JH6D 2AS9A 2ODYB 4D9RA 1ELEE 1K1JA 3UNRA 3MU5A 2IPQX 1AUTC 5FPYA 1S81A 2RDEA 1UK4A 1XUHA 1CU1A 3JZ1B 1QBOA 1F0RA 1BITA 2G51A 1J17T 1TMBH 1OP0A 2H1UA 3A86A 3RMLH 1GDNA 4D7FA 1S6HA 1Z8GA 1EZSC 3M5OA 1ZMLA 1O38A 3RXIA 1IQFA 4MNVA 5B6OA 1GI9B 2P3UB 4KELA 1XUIA 2ZQ1A 2H9TH 2WV9A 2EC9H 1FAXA 1GHWH 1TIOA 2BD7A 3UB0A 5LH8A 1XKAC 5C2ZA 2JJ1D 1MTVA 1Z8RA 1TE0A 3RXMA 1E0FD 3W95A 4Q7YA 1ELCA 3OFND 1W2KH 1WTGH 2VVUA 1JIMA 1DDJA 2HALA 1PPGE 4LZ4B 1YPEH 2A2XH 2XC5A 2P93A 2ANYA 3RU4D 1O5CB 5DP3A 1TYNA 3VB3A 2FX6A 1DLEA 1ANCA 1QQUA 3W94A 1P09A 4GCHF 2FI4E 2FP7B 1TMTH 3SQEE 2UUJB 3SOSA 1BA8B 1LVMA 4BAQB 3PMHB 4H6TA 1A5GH 3EE7A 3PTNA 1NRPH 1IHTH 3B8JA 5FCRA 1Y5BT 1ELGA 4ZHLU 5JPMH 2QY0B 3SU1A 3A8AA 3SYJA 2C4FH 4JZDH 2EEKA 3A87A 1GBJA 5CHAC 5IDKA 2HPPH 2QV1A 1SOTA 4K8BA 2VH0A 2XW9A 2PWXA 1O2QA 9ESTA 1GBLA 3NKKA 2CK3D 1C5YB 1QJ6B 3HKIB 1DWBH 4YOGA 1CSOE 2A7CA 3ZYDA 4KTCA 1KLIH 6CHAC 1LQDB 4F4OC 3UNSA 1FONA 1N6XA 2NU2E 4HZHA 2Y81A 1ZTJA 3K9XB 1NFWA 4NZQA 4WVPE 3ELAH 3VXEH 3UREA 1IQHA 1DY8A 2BD5A 4OGYA 1IQNA 3ATIA 1NBMD 1V2VT 3RXRA 4YLUA 1FY5A 1JIRA 2KCPA 1KLTA 4FUEA 1P02A 1IQEA 1SGYE 1TX7A 2XXLA 5E2OA 4SGAE 4NZLA 3RUOA 1GI5A 2CMYA 3P8OA 4JZIA 6LPRA 2KFWA 1DLKB 3QTVH 2HRVA 3GCTF 3GY4A 2ZHQH 4CR9A 1YKTA 1TRNA 1QBNA 1SQAA 3QZRA 2QXHA 3U28C 2XCFA 3PLBA 4MLFB 4ZH8A 3PO1B 4ISLA 5AF9H 3NXPA 3ZVEA 2UUYA 1IQIA 3EE0B 4CH8B 1YLNA 1TNGA 1Y3XA 2BOKA 2ZEBA 4YZUA 4CHAB 2AYWA 3DCLA 5FCKA 1LHCH 1E1RD 3FP8E 4B76A 4AFQA 2QF0A 6GCHF 4GCHG 2F91A 4MVNA 5EW1H 2P16A 2ANWA 1NTPA 1P10A 4TYDA 5CHBA 1CHOF 3BTTE 1EPTC 3P17H 4DY7B 1KXDA 1GHXH 1BRCE 2CF9H 3BEFB 1WXRA 2GD4B 4FOUC 5GIBA 2ZGBH 3GCHC 3U8RH 5FXLA 3MO9A 2FXRA 1O2YA 5EPYA 3SUFA 1IOEA 3F0PA 2OXSA 3ATLA 4XOJA 2F3CE 4OS6A 1O3PB 3A7XA 4DCDA 1MCVA 5FAHA 1XMNB 2BQ6B 1TNJA 3ZZ4A 2CJIA 1GDQA 5L2YH 1IQGA 1SPJA 1ZHPA 4X0WU 3MHWU 1OWDA 3BTWE 1O2RA 4WWYA 2UUKB 4Y0YE 4VGCB 1FV9A 1W11U 1NROH 1H8DH 3URCA 2BDAA 2EI6A 3E1XB 4I32A 1V2PT 5IYTA 1K0HA 1FNIA 2GX4A 2CN0H 1PJPA 4NA7A 4F49A 1RXPA 2ZDVH 2PKSB 3VB5A 1B0EA 1OS8A 5JBBS 2WPLS 2R3UA 4BAHB 1WTHD 2ANMH 5C1UA 5A8XA 3F2HA 3VXFH 5BRRE 1QHRB 1MQ6A 5DP5A 1FMGA 3GCTG 2Y5FA 5HXFA 1V2KT 4B1TA 3OX7U 1P0SH 1ZSJA 3KF2A 4O03A 2Z3CA 1K1LA 5HM2A 4F48B 2I6QA 1KIGH 1O2LA 3LJOA 4UFFH 2HLCA 5DJ7A 2VGCC 4WH6A 2F9BH 4K2YA 3TITA 3HGPA 1Y3UA 4Q7XA 3SJ9A 1FZZA 4I7YH 4YESB 1C5SA 1HFDA 3R3GB 3PWCA 3FAOA 1V2LT 1ZPCA 3D49H 2GJGA 1SKYE 1IQJA 1K1MA 1QJ7B 2FZZA 2PTCE 2G55A 5T6FA 2VVCA 1O5GH 3SV2H 2QE7D 2ESTE 5DP6A 1LKBA 3C1KA 3F2GA 4BTIB 5T6DA 4YOJA 1CHOG 1GCTB 1OOKB 1O3AA 2VJ1A 3LGYA 2H9EH 1S83A 1TOCB 2TGTA 4ABBA 3K2UA 1AWHB 2FOHA 3QWCH 3SI4H 1C1QA 5L6NH 2P94A 5C0TA 1UCYH 1Y3WA 5EXMA 4MG3A 2JKHA 3RXVA 5DP7A 4ACAA 2GMTC 3QTOH 1AZZA 1GGDC 1XUJA 1TQ0B 2ZQ2A 1QY6A 1C1SA 3RXQA 4GHQA 1BCUH 3A82A 4I8GA 3RXCA 5GCHF 1YCPM 2BB4A 2PR3A 4NIWA 3DFLA 3SHAH 1OX1A 1UHBB 3MH6A 2HVXA 5CMXH 4E7NA 1HCGA 5HIYA 1V2ST 1C5XB 1GHBG 4RT1A 3RXUA 1YGCH 2J4IA 1W14U 1ZGIA 4KTUA 4X6MA 3QLPH 5G4BA 4ISOA 1P9UA 1C5QA 2GP9B 1BJVA 5F8TA 1CT0E 1KMHB 1O39A 2O8TA 3MH7A 1OSSA 2FTMA 1C5ZB 1UTLM 3ZYEA 1P2OA 1SL3A 4MPWA 3SNBA 3SUEA 5IK2D 1BT7A 4ABHA 4BAMB 4Y6DA 4ZROA 1KYNA 3BTDE 1S85A 3K6YA 1CT2E 3ZVFA 1F92A 1NFXA 1SR5C 2VIQA 3MO6A 1TA2A 4ZXXH 2ZECA 3TNSA 2C8WB 5F6MA 3BF6H 1O3CA 5EODA 3MU4A 5C3NA 1ZJDA 2WPDD 1O3EA 2OTVA 2Z94A 1GBKA 2G5VA 1QGFA 1MTUA 2BD8A 4Q80A 5C1YA 1SGQE 1K21H 2QF4A 3RLWH 6ESTA 2BDGA 1KXFA 1N8OC 2SGEE 1SQRA 1GHAF 1GBCA 2OCVB 3MFJA 1GMCG 4O3UA 1TALA 3MNCA 3UAIC 1IHSH 1A3BH 2OD3B 3TIUA 4AG2A 3GYMA 2BLOA 1AB9B 2FX4A 3EYDA 3STJA 3S9BA 1MTNC 2CHAC 1UO6A 1TPPA 1MKXK 1KY9A 5C94A 2Y80A 3E6PH 2BMGB 5GCHG 4CH2B 5F8ZA 3LT3A 1UTNA 2ZC9H 1TWXB 2KX4A 1UK3A 2A5IA 1BB0B 3NWUA 4CRCA 2BY9X 2TBSA 1AIXH 5EW2H 1LVOA 1PYTD 3AASA 3RC6A 4Y79A 3Q76A 1K9OE 1C5MD 2O8LA 2VNTA 2WPHS 8ESTE 5JB8S 3VB6A 5A0AE 3SJIA 3F3BA 4E06H 1P2JA 4MPUA 2YNAA 1E1QD 1ABIH 2UWLA 3N7EA 4ABFA 3A89A 4KP0A 1QCPA 3UOPA 4P02A 1ZPZA 4GUXA 1PQ5A 3P70B 3RU4T 5CHAB 2H9HA 1TNHA 2XBVA 2BY6X 1AU8A 2WV4A 2D26C 2XYAA 2ZTZA 2VIDA 3BTGE 4FU8A 4B2AA 4Y8YA 2AGGX 4YM9A 1GJBB 8KME2 1AWFH 1VITG 4U2WA 1OWEA 1C5UA 1O5FH 1GBIA 4UFGH 6CHAB 3TLOA 3MNBA 1IQLA 1S6FA 1DY9A 3SU2A 5GDSH 1HAPH 3GY3A 1THRH 1KSNA 3UQVA 2A4GA 3MO3A 1GHAG 2H5CA 4JCNA 1IQMA 3MU1A 1YLCA 1H1BA 3ESTA 1Y5UT 2BOHB 1EATA 2F9VA 4AGKA 1EP6A 1JWTA 1BOQA 1HAOH 1W0KD 4TPYA 1WBGB 2PUXB 3KYGA 5E2PA 7GCHG 1PFXC 4E05H 1GPZA 2ZDNA 3S0NA 1TA6A 3SBKA 4CRDA 1NT1A 2BM2A 2FS9A 5FL7D 4ASUD 1AKSB 1HNEE 2BVSH 3BG8A 4Z0KA 2K0QA 1CT4E 3VB7A 1AGJA 1YC0A 3SU6A 1N6YA 1K1PA 1EXFA 4BANB 5E8EH 2HVYB 2FWWA 2ZCKP 1V2NT 2LNCA 2J9NA 3LONA 4TY6A 4K5ZA 1DITH 4U32A 1DXPA 1SC8U 1PQ7A 3M7TA 5AFZH 1QBVH 1FPCH 1TRYA 2PHBA 3SO3A 2KCOA 3SJKA 1G3DA 1NRSH 5CE1A 2GT8A 3F9FA 4RSPA 2VIVA 2XWAA 4CRGA 2FYRA 3BIUH 1SFIA 2DE9A 1FDPA 1CA0C 3RXPA 2FI3E 3UWJH 3RXLA 3CS7A 4ISIH 1EPTB 2B0FA 1UVUH 1EZUC 2GV7A 4ISNA 1O36A 4A6LA 4B6EA 2BYAX 5DP8A 2W3IA 1A3EH 2ZGCA 1S5SA 3U98H 2Z9IA 2HNTE 1QFKH 3SU4A 3GY7A 2QXIA 4FUIA 1M9UA 3ZVBA 1HAVB 4UE7H 1AE8H 2C8XB 1CE5A 1DT2A 4X2XA 1O33A 9LPRA 1UVOA 1ZRKA 3LGUA 3UWIA 3MOCA 1SI5H 2BDBA 4WJG2 1H9LB 4Z6AH 1S0RA 1F5LA 1EQ9A 1C5LH 1ZZZA 4O97A 1ZSLA 4FUFA 4IC5A 1SGEE 4U30A 5GPIB 4FVDA 4NWLA 5EJZA 3MI4A 2W7SA 1A0JA 2BD9A 1O30A 3E8LA 1P2MA 4MNWA 1YY3A 1OP8A 3S7HB 3RC5A 2Z7FE 1ELTA 1K1OA 1XUKA 1EAWA 2FEQH 3EDXB 4MQAA 4XD7D 2WHXA 3SGBE 4X2VA 1GJ8B 2FM2A 1FQ3A 2XNIA 1P8VC 1SMFE 2VIOA 2QF5A 1D3DB 5ESBA 4NA8A 2NWNA 3URDA 4JZFH 1C2MA 1W0JD 2D2DA 2R0LA 4AGJA 4AOQA 3KQDA 4Y0ZE 2J38A 1HYLA 1V6DA 3E3TA 1NRRH 2HLDD 1YPHE 3ZVAA 1F2SE 2SGFE 1V2WT 4UD9H 4F55A 2QXGA 1ELFA 1ELDE 3SNCA 4H6SB 2BY8X 1P01A 1HIAB 2B8OH 1P06A 4XBBA 1GVLA 4X2YA 1UVPA 5FX6A 1UJ1A 1BHXB 4D76A 1A1RA 5KECA 1SGTA 1O31A 4BXSA 1C2FA
chains in the Genus database with same CATH topology
1FUJA 2ASUB 3BG4C 4GSOA 4I33A 4ZKSU 4D9QA 1QNJA 1ETSH 1NFUA 1LHFH 5ABWA 1GJ5H 4AFUA 1TBRH 3QUMP 5EOKA 1WCZA 2G8TA 3ZVGA 2XRCA 3LC5A 2O9QA 3RP2A 1GDUA 1D3TB 1PQ8A 3UIRA 1J14A 1HAYB 4IGDA 3QDZB 2ZHFH 3SUGA 1C2IA 1LKAA 2V3HH 3GDSA 5EPNA 1Q3XA 5TCAA 1C1TA 1KTTB 4DG4A 2FESH 5FX5A 5LGOA 2GV6A 1O2SA 3QGNB 1IQKA 2P3TB 1CA8B 4BAKB 1E34B 1O3GA 2P8OC 2F9PA 2GDEH 2H5DA 2V3OH 1ZR0A 2GZ8A 3GCOA 3R0FA 4ZXYH 3ZV9A 1ZYOA 2ZGJA 1GJ6A 1YPMH 2W7UA 2ZTXA 1O3HA 5ESTE 1XXFA 1G3EA 2G52A 3MNSA 2ZI2H 3LGWA 1YF4A 3BTEE 2QA9E 5DKMA 2WPMS 2SGQE 1W13U 1BBRH 1TQ7B 1C1WH 4JZ1A 1L0ZA 1G3CA 1DE7H 3TJUA 5EXLA 2GT7A 1OXGA 1INCA 2D8WA 2J34A 2R2WU 2GKVE 4WH8A 4X6PA 2Z6BD 3BN9A 4FVBA 3GDVA 1O3KA 1EZXC 1Y8TA 1RJXB 3TJNA 1O3MA 2HPQH 1FAKH 1O2IA 3A8CA 3KQEA 1O2WA 4XBCA 1HRTH 2KAIB 1YPLH 2VIWA 3SV9A 4H42U 1GVKB 3O8CA 2SGAA 5E0GA 3A8BA 1O2VA 3SU0A 1OP2A 1TNLA 1C4Y2 3PLKA 5HM9A 3AVZA 1TGTA 3GOVB 2V0BA 1TLDA 5A8YA 2ALPA 4AORA 3F9GA 1SLUB 3TK9A 1BMAA 3I29A 2QAAA 1EB1H 2Q6FA 1T8MA 3RXSA 1D3QB 2ZPRA 2A32A 2UUFB 3H7TA 2OLGA 4AYVB 3UUZA 1UCYE 2OP9A 3MTYA 4HGCA 1T7CA 4I8HA 2WINI 3U69H 3MH5A 5PTPA 4B71A 1OWHA 2GGVB 3VB4A 1QB9A 1C2KA 3QGJA 1JRTA 5F03A 4X8SH 3PYHA 1W3CA 5HYOA 1NU7B 3GY6A 1AUJA 2BHGA 2G81E 4JK5A 5EQSA 1C5PA 1QL8A 4I8JA 5L30H 1EUFA 4R8TB 4A1VA 4AX9H 4Y76A 2CHAB 1AY6H 3A84A 1C1OA 2Y5HA 4NCYA 2OC1A 4Q7ZA 1P2NA 4DVAU 3L6PA 3SU3A 1TAWA 1BTWA 1MKWH 3ENSB 2A4OA 2OC7A 4AFZA 1NFYA 1P2QA 3P6ZB 2ZPSA 4A7IB 3G01A 4K8YA 2NU1E 4FXGH 3VGCB 3T25A 3P95A 2Y82A 3LGIA 1NM6A 3IWMA 5DPAA 1ZTLA 1QA0A 2DUCA 1EJAA 3K6ZA 2J2UA 1F5KU 1GHBF 4UFEH 2BD2A 2Y7XA 5JDUB 2FLRH 2AGIX 3SV7A 1YP9A 4WMFA 1QRWA 3Q00A 2OBOA 3RMOH 1SGFG 3LH1A 4B74A 1X7AC 1P2IA 2SNWA 4WXIA 4RKOB 3VPKA 3M3VA 1VGCB 1O3FA 2ZFFH 3H7OA 5FPTA 5TCCA 2ZTYA 1GI2A 3FZDA 3D23A 1CHGA 5SGAE 2FOFA 2STAE 4BTUB 1GG6B 1LTOA 1TGBA 3IITA 3DUXH 1W8BH 1AKSA 2JH5D 2ZHWH 2Q6DA 3TGJE 1EX3A 1ANEA 4YOIA 1P3EA 1C1PA 1HJAB 3PMAB 4FU7A 1MAYA 2THFB 3UTUH 3Q3YA 1GBEA 4X1PU 3RXKA 2R0KA 1NPMA 4TPIZ 7LPRA 4X8UH 1LCYA 1AVXA 1FN6A 2XBXA 2VWLA 2BZAA 3A7TA 2XC0A 1VCQA 1WYKA 1C4U2 1Y59T 1THSH 1GMCF 2ZG0H 1V2RT 3TH4H 3OU0A 1NRNH 1AVGH 4IN2A 1NO9H 4OS5A 2BD3A 1O3DA 2F83A 1C1RA 1O2MA 1MU8B 2J95A 1HGTH 3ATKA 1BMNH 4FUHA 3SHCH 2G4UA 3F68H 2ZHDA 1GI6A 5T6GA 2CXVA 4J2YB 1GL1A 1B0FA 1HAVA 1TB6H 1GI8B 2ZO3H 3TJOA 3TH3H 2WYGA 1TPSA 1ANBA 3UOUA 1TONA 1MZDA 3LC3A 1XXDA 1G2LA 1MBQA 3A80A 2Q6GA 2FLBH 1A0HB 2UWPA 4BXWA 2W3KA 1A0LA 2BVXH 2CV3A 4ABJA 1YYY1 1VCWA 5L2ZH 1SGCA 4K1SA 1C5TA 3ODFA 3SUDA 1V2UT 1SGRE 2ZIQH 2SGDE 4ZMAH 4XDEA 3LU9B 5C1XA 1CO7E 1DVAH 4Y11E 1AZ8A 1O5DH 3EAJA 3ZZ9A 4IN1A 1LDTT 1L1NA 1ZLRA 3E0NB 3GYLB 5EG4A 4ABIA 1NRQH 1W7XH 3UPEA 3B23B 1KDQB 2ZU4A 3RXJA 2QCYA 1GWAA 1MQ5A 4A1XA 2ZDAH 2TIOA 3V13A 1FXYA 4ABAA 1VITF 1ZRBA 1EB2A 4DW2U 2ODPA 2FDAA 2BDYA 1AFEH 1HIAA 2J94A 1UCYK 2TGDA 4Y7BA 3V3MA 2Y5GA 3M36A 3P8GA 3MMGA 5A09A 1D3PB 1AQ7A 1GI7B 3T29A 4NIVA 4IS5A 3RXGA 1O2GH 2XBWA 4IMZA 2PGBB 3GY8A 2A5KA 1LPZB 3LH3A 2W26A 1PPHE 4Y71A 7KMEH 4THNH 1SG8B 1SGIB 3PO1C 1BHXF 1P12E 2RA0A 7GCHF 2Z9JA 3P8FA 3F9HA 1K22H 1YLDA 4AB9A 2ZFRH 4MPXA 4CHAC 2AMQA 1C2DA 2GTBA 3FFGA 1HAXB 4TWYA 3HGNA 1T8LA 2YNBA 1ZTKA 4JYTA 3V0XA 4IBLH 3BG4B 2GVFA 1L1JA 1H9HE 4O3TA 5GXPA 1G30B 1F7ZA 2BDCA 3KQCA 1ELBA 2WPIS 3ITIA 1GI1A 1ZSKA 3SV8A 4ZKOU 2VWOA 1SHYA 1QR3E 1QIXB 2VU8E 3KL6A 1TNKA 1GBHA 1UTKA 2ZDLA 4JZEH 1RIWC 4MPVA 1UMAH 2VINA 4JYVH 4BAOB 1EJMA 1UK2A 2BQ7B 3O8DA 1TGNA 1GJ9B 3DA9B 2AH4X 2NU0E 3KN2A 1NS3A 1P11E 3BTME 4I31A 2WUBA 1O2JA 3BIVH 3ZZ5A 2PSYA 1ZHMA 3BEUA 1HV7A 3DHKH 4X6OA 2P8OB 1QB6A 1JRSA 1L4DA 5J4SA 4AG1A 1JOUB 1BTPA 2QYIA 2RA3A 2ZNKH 3M5MA 3UR9A 2HNTF 4XE4A 1AFQC 2BDHA 1T31A 3KCGH 4OS7A 2PKSC 1V2QT 3AW1A 3FVFB 1BZXE 3TGKE 4X1QU 2F9OA 3O8RA 4Q2KA 5FBEA 1O3JA 1LHDH 1DS2E 1QRXA 3MNXA 3TJVA 2G4TA 2BQWB 3HATH 3HK6B 1CVWH 1BMLA 5DGJA 3VEQB 1OWKA 1XUFA 3TPIZ 2ZU2A 3QO6A 3BEIB 5JBTA 4ABGA 1SGNE 5LPRA 1GMDG 3M35A 2O8MA 1QURH 5BPEA 1FY4A 3T5FH 4Y8XA 1C5NH 2NU4E 1T4UH 2VWNA 2C8YB 3PMBB 5JB9S 1DUEA 1HAIH 1NU9A 5DK1A 2EA3A 1FY1A 5EQRA 2PUQH 1P04A 4FUJA 2XC4A 1SLXB 3V7TA 3ZZAA 1F0UA 1ETTH 2OUAA 3RXTA 4ESTE 1MZAA 3PV4A 5E0HA 3SN8A 2LPRA 2D1JA 3D65E 4X8VH 3SORA 1THPB 1QA7A 1GCTC 4NSVA 3PTBA 3P8NA 5FHTA 1K1NA 1Z7KA 2B7DH 1RS0A 8GCHF 1G3BA 3LGTA 1O2KA 4X1NU 1TMUH 2CF8H 2H2ZA 2XTTB 3FP7E 2ZWLH 1TGCA 2A4RA 3RXOA 1BRBE 1A7SA 1MBMA 1KTSB 2A31A 3TK6A 2V35A 1SFQB 3GCHB 2AMPA 1UVSH 3AW0A 3OYPA 1ANDA 4ASHA 1O2HA 1QL7A 2QIQA 3CP7A 4OS2A 5A0CA 3ATMA 3AAVA 1BIOA 1FPHH 2A7HA 3U9AH 3QN7A 1WUNH 3NZIA 3RXAA 1KLJH 1BBRE 1S0QA 1G37A 3M61U 5DO4H 1UTMA 1FLEE 2FS8A 2IN2A 4CRBA 1SHHB 2EI7A 2C8ZB 1JMOH 4I8KA 5A8ZA 3RLYH 1DXWA 1GMHF 2XCNA 4X1RU 2ZDKA 4MTBA 4A5TS 3LGVA 1KXAA 1OPHB 1EAUA 3SGAE 4MNXA 1RGQA 3ZVDA 3LDXH 4X8TH 5EQQA 4NGAH 3E91A 1VZQH 1FIWA 3M7UA 1WQSA 3SW2B 1W12U 1Q31A 2A0QB 3EQ0H 1V2TT 1AN1E 4RN6A 1UVTH 3T28A 1EAIA 3L3TA 4CBOA 2P3FH 4M7GA 2ULLA 2FYQA 4KTSA 3RXFA 1WU1A 1RD3B 1OKXA 1TX8A 5A2MH 1HPGA 2ZDMA 3MU0A 4A92A 3LIWA 1V3XA 4H4FA 3QX5H 1XM1A 3F1SB 1O3IA 2A5AA 3RXEA 3TK5A 2VIPA 2VGCB 2XWBI 4X1SU 3ZZ3A 1TBZH 1QL9A 1T4VH 2QGRA 3DT0H 1Q2WA 4YT6H 2ZF0H 1EOJA 1W10U 4GLYA 1O35A 1CGHA 2PTNA 4OS1A 3FANA 3SQHE 5LPEA 3IG6B 2QC2A 4U01A 2FOEA 4UFDH 1P05A 1DICA 1DX5M 3GISB 1GHYH 8GCHG 1WSSH 1VJ9U 1W0ZU 3TNTA 1SQOA 1A5HA 3OSYA 2Q1JA 3ATWA 2GCTC 2PGQB 1BTXA 1AB9C 4K69A 3U1JB 4UDWH 1TFXA 4B2CA 4GAWA 1SGDE 5F8XA 1LMWB 1Z6EA 3ZZCA 1UHBA 2A7JA 4FUCA 1YPJH 2OBQA 4IC6A 2PW8H 2WYJA 4B75A 1OWIA 1J8AA 1ETRH 1XKBC 1U6QA 1ESTA 2ZFPH 3RXHA 1ZGVA 4NFEA 1E35B 2Z9LA 2G00A 1RTLA 2GMTB 1EAXA 1O2ZA 2WV5A 3I77A 5J4QA 2ZFTA 1GGDB 3MWIU 1IAUA 5I46H 1ABJH 1AHTH 1ELAA 1GMHG 1OYQA 1O2XA 1WV7H 1H9IE 3U8TH 2Z3EA 1ZPBA 1O5EH 5JBCS 1HDTH 4OS4A 2A2QH 4ABEA 1GL0E 1C2LA 1O3BA 1GI4A 3S9AA 3OTJE 2BVRH 3C27B 3ZZ6A 1ZJKA 1QQ4A 2AIQA 1C5VA 2TGPZ 3KIDU 1KDQA 3CENA 2C3SA 1Z8IB 2RDLA 1A61H 4NG9H 2J92A 1CBWC 4DIHH 2B5TB 4WF8A 1SGFA 4I8LA 3M5NA 3QK1A 1MD7A 4AYYB 3ODDA 5C5OA 5DP9A 4INLA 4O9VA 4LOYH 1SSXA 1O3LA 1V2JT 2ALVA 1QTFA 1YCPH 2FOGA 2ANKH 5HGGA 1T32A 3M5LA 3TH2H 1HXFH 1E37B 1Y5AT 4XBDA 1C2EA 1O3OA 2JETC 3PWBA 1LPGB 2BX3A 2A45B 4JK6A 1JBUH 1GVZA 2GCHF 2OQUA 5C67A 4NWKA 4DOQA 1MTWA 2BTCE 3A8DA 1BTUA 5DP4A 1P57B 3PMJA 4GVUA 4CBNA 3LJJA 2HGTH 1MTSA 3AAUA 1N8OB 2GDDA 1PPEE 2FOCA 4DIIH 5H4IB 3SNDA 5GJ4B 1C2HA 1HAGE 5I25A 4K1TA 1GBTA 2K1QA 4KKDA 1C5OH 1CGIE 1PPZA 1WQVH 1D9IA 5JBAS 2ZCLP 2FOMB 3T27A 5AVDA 1FY3A 1P03A 4CRAA 1BBRK 1RTKA 1MTNB 2ZPQA 1AD8H 1NESE 1Y3YA 2BLVA 1K1IA 1V2OT 1BRUP 3UQOA 5EU8A 2STBE 3Q77A 1AMHA 1PPFE 4B73A 1K28D 2WPKS 3KGPA 1YCPK 3SNAA 3CS0A 4ZUHA 3SV6A 1GBDA 1OWJA 1W7GH 1TPOA 3ZZBA 3A7VA 3BTHE 4HFPB 2OQ5A 3T62A 4CRFA 4ZKNU 1O34A 1DSUA 2AEIH 1ID5H 1TX6A 3GICB 1RIWB 3BTQE 4X2WA 1O3NA 2ZZUH 1O5BB 1ESBA 4OGXA 3T2NA 2PKAB 3NK8A 1XVMA 2ZKSA 2BXTH 3A7ZA 2FPZA 1C4V2 3RDZA 1HLTH 1QB1A 3RXDA 3UR6A 2DE8A 1O2OA 1MH0A 1GJAB 5C5NA 4WMDA 2RG3A 1D4PB 2OC8A 4XFQA 1DOJA 4TY7A 3S69A 3D62A 1AFQB 2GCHG 3A7YA 2BLWA 3TU7H 1BUIA 3EGKH 1HJ9A 1MCTA 2QF3A 3SU5A 5K0HA 3S7KB 4D8NA 1AE5A 4MDSA 5C20A 2R2MB 1BRAA 1KXBA 3PM3A 2TPIZ 1TNIA 3BTFE 1C2GA 4UEHH 4AZ2B 1GCDA 1GHZA 1MD8A 2M5TA 3E0PB 1LVBA 1HAZB 1VR1H 3F9EA 3WY8A 1EJNA 1HUTH 1TPAE 1MKWK 3NCLA 4XSKU 1FJSA 3FZZA 4K1EA 1Z6JH 1WAYB 1MMJN 1SQTA 4NA9H 1J16A 1RTFB 1O2PA 5AFYH 3RM2H 1O2UA 2BZ6H 4IMQA 3BSQA 1H8IH 1SB1H 2O8WA 2VH6A 1ACBE 1JXPA 1P2KA 4J1YA 4DT7B 1EPTA 1YPGH 2IJOB 3E90B 3BV9B 2FOAA 5DG6A 1AI8H 1EOLA 3GY2A 4AB8A 1V2MT 1KXEA 1VCPA 5EXNA 6GCHG 1C9TA 4NSYA 1SBWA 3K65B 2PLXA 3A85A 2C93B 1DFPA 4BTTB 2AGEX 4JMYA 3EA8A 1ZHRA 1NC6A 2ZP0H 4LXBH 2XBYA 2BDIA 4YO9A 1WOFA 1EP5A 3T26A 2IOTA 4FUGA 1CA0B 1RFNA 2Y7ZA 1A4WH 2BX4A 2F9NA 3A7WA 3NUMA 2GZ9A 2NU3E 4INKA 3HK3B 1UTOA 1ZOMA 3TVJB 2Z9KA 1FI8A 4Y7AA 4UONA 1L1GA 1C9PA 3SZNA 2ODQA 1O37A 4DGJA 3DD2H 3KHVA 3ZZ8A 5JYIA 4E7RG 3MU8A 3BTKE 1S82A 3ZZDA 1EASA 3ZV8A 3N7OA 2FODA 2BY7X 1J9CH 1B5GH 3KNXA