2GLIA

Five-finger gli/dna complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*TP*TP*CP*GP*TP*CP*TP*TP*GP*GP*GP*TP*GP*GP*TP*C
total genus 39
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 1993-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA05
2EMWA 5KL6A 2DGCA 2EM9A 3EPJA 2GLIA 2EPPA 1DGCA 2LVHA 3M99B 2WBTA 1A1LA 4M9VC 2EPZA 2EMFA 2YTOA 2EQ3A 1KJKA 1UN6B 2DMIA 1A1GA 1MEYC 1UBDC 2EOHA 1G2FC 2EMIA 1B69A 2WBSA 2YU5A 3EPKA 1X5WA 2J7JA 4IJDA 2EM6A 1X6FA 1BB8A 2EORA 2EOJA 2EM2A 2YTIA 1AAYA 1YUJA 2YTQA 2ENAA 1TF6A 2M9AA 3MHHC 2EM8A 2YU8A 2EN4A 2EQ1A 2EOIA 2D9HA 3MHSC 2EPAA 1A1JA 4X9JA 2EOSA 2YSPA 2EMBA 1X6HA 2EL4A 2VRDA 2EOFA 3VHTB 2CTDA 1ZU1A 2EOYA 1BBOA 4R2CA 2EMCA 2CSHA 2MDGA 4GZNC 1NCSA 1TF3A 2YTEA 2EPUA 2YSOA 2R1FA 2EMKA 1P47A 4R2DA 2LV2A 5KL4A 2EOEA 2EMAA 2EJ4A 2EM4A 1A1KA 1JK1A 2EMGA 2EPXA 2ELZA 4R2EA 2ADRA 2MKNA 2YRHA 1X6EA 5KL5A 2JPAA 4F6NA 2YTGA 2EMZA 2A25A 2JP9A 2EL5A 2EOXA 2EN1A 2YRMA 1ZAAC 2EN6A 4R2SA 1X3CA 2EM0A 2EMLA 3UK3C 2DLQA 1YUIA 1Z1BA 2GHFA 4R2PA 2EOOA 1A1FA 2CT1A 2EM3A 2YRKA 2DRPA 1TN9A 5KL3A 2NABA 1F2IG 2EQ0A 2EOZA 5KL7A 4IS1C 2WBUA 2DLKA 2EN8A 2EMHA 2EMYA 4R2QA 2EPRA 2EM7A 1RMDA 2EMXA 4FK5C 4WSGA 4R2AA 4F6MA 2YTDA 1ZR9A 2EOMA 2LCEA 2EOQA 2MKDA 2EL6A 2ELYA 1WJPA 2RPCA 3EPHA 2EM5A 2EN7A 2WCC3 2EP3A 2HGHA 1JK2A 2EN3A 5KL2A 4R2RA 3EPLA 4F2JC 2LT7A 1G2DC 2YTJA 2YTNA 1YSAC 2BB8A 2ENHA 1A1IA 2YTFA 2EE8A 2I13A 2EN2A 2EPCA 2E72A 2ENCA 2RSIA 2LO3A 1A1HA 2PRTA 2YTPA 1LLMC
chains in the Genus database with same CATH superfamily
3EQ1A 5KL6A 2B7VA 1N36E 4MLQA 4JI0E 2EPPA 2LVHA 3M99B 5IV8B 3JAMC 2MC6A 4R8OA 1A1GA 2EOHA 4BHCA 2LUPB 3EPKA 2WZOA 1T4LB 2EM6A 3P1XA 1EH6A 2EORA 1FJGE 2LRSA 3KZZA 2M9AA 5AE3A 4ZYDA 2D9HA 1N3GA 2I9IA 4X9JA 2NUFA 2VRDA 4DV7E 2LTSA 3VHTB 4X64E 2M7QA 1BBOA 3IWBA 4GKKE 2KHXA 3DJWA 2YTEA 2V85A 2R1FA 4O24A 2EMKA 4WYQB 1T39A 1EKZA 5KL4A 2EMAA 3QG5C 1GQEA 3KZYA 4F9CB 2EM4A 2EPXA 4LF7E 3ADLA 1GTKA 3VYXA 2L2NA 3JU0A 4KHPE 2YRHA 5KL5A 2JPAA 1BBGA 2EWLA 2YTGA 2A25A 2N8XA 4GEQB 2EL5A 2EPOA 2LJUA 5A69A 4BC9A 4BS9A 5IT9C 2FV4B 1T38A 2GHFA 4R2PA 2JOXA 2EOOA 4B3RE 4GKJE 1A1FA 2MC5A 1T4OA 4WXCA 4O43A 3HTXA 5A6KA 2V83A 2YT4A 4WFTA 3F6GA 4RHBB 4DV0E 1WHNA 4DMIA 4OOGC 2MDRA 1IMUA 3ADJA 2UUAE 2EOQA 2RPCA 2EN7A 2M4IA 2UXCE 1ZBTA 4JI1E 4L8NA 5IWAE 2LT7A 1G2DC 3KWRA 2BB8A 2LTRA 4F9BB 2G7HA 4X66E 2EPCA 3HXLA 1IBME 2EZ6A 2LO3A 2YTPA 4LFAE 4BBYA 3LLHA 2V8QB 2DGCA 2L8TA 2EM9A 4Q28A 2L2KB 2NA2A 4N4RB 3EPJA 1PDAA 2EPLX 1DQ3A 2YZTA 4M30A 3J81C 4M9VC 2EMFA 2YTOA 1HNXE 4P7DA 4Q35B 1MEYC 4DR4E 2JYAA 3IWCA 3J7AG 4IJDA 4R03A 3HQ1A 4NHRA 2YTIA 1NEIA 2EN4A 2EQ1A 1XMQE 1I94E 1A1JA 3THNA 2EOSA 2EPKX 3C4BA 5CFFE 5LMUE 3H09A 4LF8E 2V89A 1IBKE 1YFHA 2LJHA 3VK6A 3FIGA 1HR0E 2YSOA 3C4TA 3F6HA 4NZVA 4R2DA 4O4KA 1JK1A 2JXPA 2L3CA 1N33E 4TUGA 4LFBE 4M2ZA 5A6BA 5ADZA 1YYWA 5AASA 1X49A 3K6QA 2E1MA 2EN6A 4WXDA 4R2SA 2NUEA 1ZBQA 2EM0A 4JI3E 2EMLA 2V87A 3MSWA 1IQOA 4DV6E 5IXMB 1UILA 2IHR1 2RTXA 2CT1A 1J26A 1TN9A 2NABA 4DV2E 2EQ0A 2EOZA 1F2IG 4JI2E 1PJSA 4LTYA 2VQFE 4M0VA 4R2QA 2EPRA 4WSGA 2EM7A 4R2AA 1YYKA 1PJQA 4X65E 4DV4E 5A6JA 2FTXB 2MKDA 3EPHA 3ZOQB 2HGHA 1FKAE 4R2RA 3EPLA 3T1HE 5TSEA 4HEIA 2N3GA 2YTNA 5T6JA 2Q8UA 2YTFA 2L2MA 1A1HA 3MHHC 5F3WA 1UN6B 1XNRE 4TUIA 1LLMC 2NUGA 5LMNE 2L3JA 2K4VA 4DR2E 1GZ6A 5FLXC 2GLIA 5LL6R 3TQMA 1A1LA 1KJKA 4X62E 1UBDC 4DR6E 2WBSA 2YU5A 1X5WA 2J7JA 2EOJA 1WXRA 2K7IA 2EPMX 5A6BD 1TF6A 2LE2A 2EM8A 2YU8A 4F54A 4NXNE 3MHSC 3AUZA 2EPAA 5LLQA 1J5EE 1N32E 2YSPA 1X6HA 2EOFA 2JVAA 2L6MA 1IQSA 1ZU1A 2EOYA 4WSPA 4DV5E 4DR1E 2H36X 2CSHA 4RH8A 4OX9E 1IBLE 1TF3A 1NCSA 4JV5E 1RC7A 1P47A 2LV2A 2UXDE 4P78A 1XNQE 1A1KA 4F9AB 4BCAA 2FGGA 1SFEA 4R2EA 2ODRC 2R76A 2MKNA 4JI6E 1X6EA 4F6NA 1YYOA 4AQYE 4O5GA 4DKKA 1EH8A 4KWYA 4DV1E 2EOXA 2CPNA 2E5LE 1QU6A 3T1YE 3VYYA 4JI5E 2DB2A 3RMPA 2KOUA 4YY3E 1Z1BA 2F4VE 2JWOA 1L4SA 4DUZE 2M1SA 3BGHA 3LMLA 3IWDA 5KL7A 4IS1C 1WHQA 2RQLA 1EH7A 2WBUA 2EN8A 2JOBA 3THOB 2EMYA 4KZSA 1RMDA 4FK5C 1X48A 4J8ZA 1ZR9A 1PKPA 2ELYA 1WJPA 4ZYHA 2EM5A 2WCC3 2DIXA 2EP3A 4ZYGA 2EN3A 3ADGA 2BBGA 5KL2A 4F2JC 1HNZE 4JI4E 4BHBA 1X47A 4DR7E 5BR8E 1YSAC 2KONA 3ADIA 2EE8A 2RSMA 2RSIA 2L33A 5DNYA 3J7Yp 5A6AA 4JI7E 2ODRD 2EMWA 2F8BA 2ZM6E 4JYAE 3BF2A 1DGCA 2DSYA 2EPNA 1MGTA 1QNTA 3HPZA 2WBTA 4HTGA 2EPZA 4BC7A 2EQ3A 2JR1A 2DMIA 5AC4A 5AC5A 1G2FC 2EMIA 2HHHE 4LF9E 1DI2A 1B69A 4B3ME 4LU9A 1X6FA 1BB8A 4X8WA 4L5NC 2EM2A 2B3TB 3DF6A 4WX9A 1AAYA 1YUJA 2YTQA 2ENAA 4K0KE 4ZYEA 3HPSA 2LMZA 2EOIA 2LBSB 3C6KA 1N34E 3OTOE 2EMBA 2EL4A 3C6MA 2CTDA 2GPIA 3JTZA 3BIDA 4R2CA 2EMCA 2MDGA 4GZNC 4DUYE 2EPUA 4B3TE 1UHZA 1YZ9A 2B9DA 2EOEA 4I8OA 2EJ4A 2EMGA 4YHHE 2YWQA 2V86A 2ELZA 4MLVA 4LF6E 1SR9A 4BMJA 2ADRA 5AE2A 4B3SE 2B7TA 2EMZA 2YPNA 2JP9A 2EN1A 2YRMA 1ZAAC 1YPNA 1AH5A 3BBGA 3OMLA 4JI8E 2JY9A 1X3CA 1WRJA 2RS6A 3UK3C 2N3HA 2DLQA 1YUIA 2DMYA 2VQEE 3AV0A 1KYQA 2UXBE 1HNWE 1XMOE 2UUBE 2HC5A 2EM3A 2YRKA 1RQ0A 3L00A 4DR3E 2DRPA 3J80C 5KL3A 1PJTA 5AE1A 2UU9E 2RS7A 2DLKA 1T4NA 2EMHA 2V88A 2EMXA 4F6MA 1O0WA 4LFCE 2VF1A 2YTDA 2EOMA 2LCEA 2EL6A 1STUA 3ECRA 4LF5E 4WPYA 2UUCE 2HJJA 1JK2A 4LF4E 4DR5E 2LUQA 2VE7C 2YTJA 2ENHA 1A1IA 4NXME 2L92A 2I13A 2EN2A 2E72A 2ENCA 4DV3E 5A2QC 2PRTA
chains in the Genus database with same CATH topology
2EMWA 5KL6A 2DGCA 2EM9A 3EPJA 2GLIA 2EPPA 1DGCA 2LVHA 3M99B 2WBTA 1A1LA 4M9VC 2EPZA 2EMFA 2YTOA 2EQ3A 1KJKA 1UN6B 2DMIA 1A1GA 1MEYC 1UBDC 2EOHA 1G2FC 2EMIA 1B69A 2WBSA 2YU5A 3EPKA 1X5WA 2J7JA 4IJDA 2EM6A 1X6FA 1BB8A 2EORA 2EOJA 2EM2A 2YTIA 1AAYA 1YUJA 2YTQA 2ENAA 1TF6A 2M9AA 3MHHC 2EM8A 2YU8A 2EN4A 2EQ1A 2EOIA 2D9HA 3MHSC 2EPAA 1A1JA 4X9JA 2EOSA 2YSPA 2EMBA 1X6HA 2EL4A 2VRDA 2EOFA 3VHTB 2CTDA 1ZU1A 2EOYA 1BBOA 4R2CA 2EMCA 2CSHA 2MDGA 4GZNC 1NCSA 1TF3A 2YTEA 2EPUA 2YSOA 2R1FA 2EMKA 1P47A 4R2DA 2LV2A 5KL4A 2EOEA 2EMAA 2EJ4A 2EM4A 1A1KA 1JK1A 2EMGA 2EPXA 2ELZA 4R2EA 2ADRA 2MKNA 2YRHA 1X6EA 5KL5A 2JPAA 4F6NA 2YTGA 2EMZA 2A25A 2JP9A 2EL5A 2EOXA 2EN1A 2YRMA 1ZAAC 2EN6A 4R2SA 1X3CA 2EM0A 2EMLA 3UK3C 2DLQA 1YUIA 1Z1BA 2GHFA 4R2PA 2EOOA 1A1FA 2CT1A 2EM3A 2YRKA 2DRPA 1TN9A 5KL3A 2NABA 1F2IG 2EQ0A 2EOZA 5KL7A 4IS1C 2WBUA 2DLKA 2EN8A 2EMHA 2EMYA 4R2QA 2EPRA 2EM7A 1RMDA 2EMXA 4FK5C 4WSGA 4R2AA 4F6MA 2YTDA 1ZR9A 2EOMA 2LCEA 2EOQA 2MKDA 2EL6A 2ELYA 1WJPA 2RPCA 3EPHA 2EM5A 2EN7A 2WCC3 2EP3A 2HGHA 1JK2A 2EN3A 5KL2A 4R2RA 3EPLA 4F2JC 2LT7A 1G2DC 2YTJA 2YTNA 1YSAC 2BB8A 2ENHA 1A1IA 2YTFA 2EE8A 2I13A 2EN2A 2EPCA 2E72A 2ENCA 2RSIA 2LO3A 1A1HA 2PRTA 2YTPA 1LLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMW A;  5KL6 A;  2DGC A;  2EM9 A;  3EPJ A;  2GLI A;  2EPP A;  1DGC A;  2LVH A;  3M99 B;  2WBT A;  1A1L A;  4M9V C;  2EPZ A;  2EMF A;  2YTO A;  2EQ3 A;  1KJK A;  1UN6 B;  2DMI A;  1A1G A;  1MEY C;  1UBD C;  2EOH A;  1G2F C;  2EMI A;  1B69 A;  2WBS A;  2YU5 A;  3EPK A;  1X5W A;  2J7J A;  4IJD A;  2EM6 A;  1X6F A;  1BB8 A;  2EOR A;  2EOJ A;  2EM2 A;  2YTI A;  1AAY A;  1YUJ A;  2YTQ A;  2ENA A;  1TF6 A;  2M9A A;  3MHH C;  2EM8 A;  2YU8 A;  2EN4 A;  2EQ1 A;  2EOI A;  2D9H A;  3MHS C;  2EPA A;  1A1J A;  4X9J A;  2EOS A;  2YSP A;  2EMB A;  1X6H A;  2EL4 A;  2VRD A;  2EOF A;  3VHT B;  2CTD A;  1ZU1 A;  2EOY A;  1BBO A;  4R2C A;  2EMC A;  2CSH A;  2MDG A;  4GZN C;  1NCS A;  1TF3 A;  2YTE A;  2EPU A;  2YSO A;  2R1F A;  2EMK A;  1P47 A;  4R2D A;  2LV2 A;  5KL4 A;  2EOE A;  2EMA A;  2EJ4 A;  2EM4 A;  1A1K A;  1JK1 A;  2EMG A;  2EPX A;  2ELZ A;  4R2E A;  2ADR A;  2MKN A;  2YRH A;  1X6E A;  5KL5 A;  2JPA A;  4F6N A;  2YTG A;  2EMZ A;  2A25 A;  2JP9 A;  2EL5 A;  2EOX A;  2EN1 A;  2YRM A;  1ZAA C;  2EN6 A;  4R2S A;  1X3C A;  2EM0 A;  2EML A;  3UK3 C;  2DLQ A;  1YUI A;  1Z1B A;  2GHF A;  4R2P A;  2EOO A;  1A1F A;  2CT1 A;  2EM3 A;  2YRK A;  2DRP A;  1TN9 A;  5KL3 A;  2NAB A;  1F2I G;  2EQ0 A;  2EOZ A;  5KL7 A;  4IS1 C;  2WBU A;  2DLK A;  2EN8 A;  2EMH A;  2EMY A;  4R2Q A;  2EPR A;  2EM7 A;  1RMD A;  2EMX A;  4FK5 C;  4WSG A;  4R2A A;  4F6M A;  2YTD A;  1ZR9 A;  2EOM A;  2LCE A;  2EOQ A;  2MKD A;  2EL6 A;  2ELY A;  1WJP A;  2RPC A;  3EPH A;  2EM5 A;  2EN7 A;  2WCC 3;  2EP3 A;  2HGH A;  1JK2 A;  2EN3 A;  5KL2 A;  4R2R A;  3EPL A;  4F2J C;  2LT7 A;  1G2D C;  2YTJ A;  2YTN A;  1YSA C;  2BB8 A;  2ENH A;  1A1I A;  2YTF A;  2EE8 A;  2I13 A;  2EN2 A;  2EPC A;  2E72 A;  2ENC A;  2RSI A;  2LO3 A;  1A1H A;  2PRT A;  2YTP A;  1LLM C; 
#chains in the Genus database with same CATH topology
 3EQ1 A;  5KL6 A;  2B7V A;  1N36 E;  4MLQ A;  4JI0 E;  2EPP A;  2LVH A;  3M99 B;  5IV8 B;  3JAM C;  2MC6 A;  4R8O A;  1A1G A;  2EOH A;  4BHC A;  2LUP B;  3EPK A;  2WZO A;  1T4L B;  2EM6 A;  3P1X A;  1EH6 A;  2EOR A;  1FJG E;  2LRS A;  3KZZ A;  2M9A A;  5AE3 A;  4ZYD A;  2D9H A;  1N3G A;  2I9I A;  4X9J A;  2NUF A;  2VRD A;  4DV7 E;  2LTS A;  3VHT B;  4X64 E;  2M7Q A;  1BBO A;  3IWB A;  4GKK E;  2KHX A;  3DJW A;  2YTE A;  2V85 A;  2R1F A;  4O24 A;  2EMK A;  4WYQ B;  1T39 A;  1EKZ A;  5KL4 A;  2EMA A;  3QG5 C;  1GQE A;  3KZY A;  4F9C B;  2EM4 A;  2EPX A;  4LF7 E;  3ADL A;  1GTK A;  3VYX A;  2L2N A;  3JU0 A;  4KHP E;  2YRH A;  5KL5 A;  2JPA A;  1BBG A;  2EWL A;  2YTG A;  2A25 A;  2N8X A;  4GEQ B;  2EL5 A;  2EPO A;  2LJU A;  5A69 A;  4BC9 A;  4BS9 A;  5IT9 C;  2FV4 B;  1T38 A;  2GHF A;  4R2P A;  2JOX A;  2EOO A;  4B3R E;  4GKJ E;  1A1F A;  2MC5 A;  1T4O A;  4WXC A;  4O43 A;  3HTX A;  5A6K A;  2V83 A;  2YT4 A;  4WFT A;  3F6G A;  4RHB B;  4DV0 E;  1WHN A;  4DMI A;  4OOG C;  2MDR A;  1IMU A;  3ADJ A;  2UUA E;  2EOQ A;  2RPC A;  2EN7 A;  2M4I A;  2UXC E;  1ZBT A;  4JI1 E;  4L8N A;  5IWA E;  2LT7 A;  1G2D C;  3KWR A;  2BB8 A;  2LTR A;  4F9B B;  2G7H A;  4X66 E;  2EPC A;  3HXL A;  1IBM E;  2EZ6 A;  2LO3 A;  2YTP A;  4LFA E;  4BBY A;  3LLH A;  2V8Q B;  2DGC A;  2L8T A;  2EM9 A;  4Q28 A;  2L2K B;  2NA2 A;  4N4R B;  3EPJ A;  1PDA A;  2EPL X;  1DQ3 A;  2YZT A;  4M30 A;  3J81 C;  4M9V C;  2EMF A;  2YTO A;  1HNX E;  4P7D A;  4Q35 B;  1MEY C;  4DR4 E;  2JYA A;  3IWC A;  3J7A G;  4IJD A;  4R03 A;  3HQ1 A;  4NHR A;  2YTI A;  1NEI A;  2EN4 A;  2EQ1 A;  1XMQ E;  1I94 E;  1A1J A;  3THN A;  2EOS A;  2EPK X;  3C4B A;  5CFF E;  5LMU E;  3H09 A;  4LF8 E;  2V89 A;  1IBK E;  1YFH A;  2LJH A;  3VK6 A;  3FIG A;  1HR0 E;  2YSO A;  3C4T A;  3F6H A;  4NZV A;  4R2D A;  4O4K A;  1JK1 A;  2JXP A;  2L3C A;  1N33 E;  4TUG A;  4LFB E;  4M2Z A;  5A6B A;  5ADZ A;  1YYW A;  5AAS A;  1X49 A;  3K6Q A;  2E1M A;  2EN6 A;  4WXD A;  4R2S A;  2NUE A;  1ZBQ A;  2EM0 A;  4JI3 E;  2EML A;  2V87 A;  3MSW A;  1IQO A;  4DV6 E;  5IXM B;  1UIL A;  2IHR 1;  2RTX A;  2CT1 A;  1J26 A;  1TN9 A;  2NAB A;  4DV2 E;  2EQ0 A;  2EOZ A;  1F2I G;  4JI2 E;  1PJS A;  4LTY A;  2VQF E;  4M0V A;  4R2Q A;  2EPR A;  4WSG A;  2EM7 A;  4R2A A;  1YYK A;  1PJQ A;  4X65 E;  4DV4 E;  5A6J A;  2FTX B;  2MKD A;  3EPH A;  3ZOQ B;  2HGH A;  1FKA E;  4R2R A;  3EPL A;  3T1H E;  5TSE A;  4HEI A;  2N3G A;  2YTN A;  5T6J A;  2Q8U A;  2YTF A;  2L2M A;  1A1H A;  3MHH C;  5F3W A;  1UN6 B;  1XNR E;  4TUI A;  1LLM C;  2NUG A;  5LMN E;  2L3J A;  2K4V A;  4DR2 E;  1GZ6 A;  5FLX C;  2GLI A;  5LL6 R;  3TQM A;  1A1L A;  1KJK A;  4X62 E;  1UBD C;  4DR6 E;  2WBS A;  2YU5 A;  1X5W A;  2J7J A;  2EOJ A;  1WXR A;  2K7I A;  2EPM X;  5A6B D;  1TF6 A;  2LE2 A;  2EM8 A;  2YU8 A;  4F54 A;  4NXN E;  3MHS C;  3AUZ A;  2EPA A;  5LLQ A;  1J5E E;  1N32 E;  2YSP A;  1X6H A;  2EOF A;  2JVA A;  2L6M A;  1IQS A;  1ZU1 A;  2EOY A;  4WSP A;  4DV5 E;  4DR1 E;  2H36 X;  2CSH A;  4RH8 A;  4OX9 E;  1IBL E;  1TF3 A;  1NCS A;  4JV5 E;  1RC7 A;  1P47 A;  2LV2 A;  2UXD E;  4P78 A;  1XNQ E;  1A1K A;  4F9A B;  4BCA A;  2FGG A;  1SFE A;  4R2E A;  2ODR C;  2R76 A;  2MKN A;  4JI6 E;  1X6E A;  4F6N A;  1YYO A;  4AQY E;  4O5G A;  4DKK A;  1EH8 A;  4KWY A;  4DV1 E;  2EOX A;  2CPN A;  2E5L E;  1QU6 A;  3T1Y E;  3VYY A;  4JI5 E;  2DB2 A;  3RMP A;  2KOU A;  4YY3 E;  1Z1B A;  2F4V E;  2JWO A;  1L4S A;  4DUZ E;  2M1S A;  3BGH A;  3LML A;  3IWD A;  5KL7 A;  4IS1 C;  1WHQ A;  2RQL A;  1EH7 A;  2WBU A;  2EN8 A;  2JOB A;  3THO B;  2EMY A;  4KZS A;  1RMD A;  4FK5 C;  1X48 A;  4J8Z A;  1ZR9 A;  1PKP A;  2ELY A;  1WJP A;  4ZYH A;  2EM5 A;  2WCC 3;  2DIX A;  2EP3 A;  4ZYG A;  2EN3 A;  3ADG A;  2BBG A;  5KL2 A;  4F2J C;  1HNZ E;  4JI4 E;  4BHB A;  1X47 A;  4DR7 E;  5BR8 E;  1YSA C;  2KON A;  3ADI A;  2EE8 A;  2RSM A;  2RSI A;  2L33 A;  5DNY A;  3J7Y p;  5A6A A;  4JI7 E;  2ODR D;  2EMW A;  2F8B A;  2ZM6 E;  4JYA E;  3BF2 A;  1DGC A;  2DSY A;  2EPN A;  1MGT A;  1QNT A;  3HPZ A;  2WBT A;  4HTG A;  2EPZ A;  4BC7 A;  2EQ3 A;  2JR1 A;  2DMI A;  5AC4 A;  5AC5 A;  1G2F C;  2EMI A;  2HHH E;  4LF9 E;  1DI2 A;  1B69 A;  4B3M E;  4LU9 A;  1X6F A;  1BB8 A;  4X8W A;  4L5N C;  2EM2 A;  2B3T B;  3DF6 A;  4WX9 A;  1AAY A;  1YUJ A;  2YTQ A;  2ENA A;  4K0K E;  4ZYE A;  3HPS A;  2LMZ A;  2EOI A;  2LBS B;  3C6K A;  1N34 E;  3OTO E;  2EMB A;  2EL4 A;  3C6M A;  2CTD A;  2GPI A;  3JTZ A;  3BID A;  4R2C A;  2EMC A;  2MDG A;  4GZN C;  4DUY E;  2EPU A;  4B3T E;  1UHZ A;  1YZ9 A;  2B9D A;  2EOE A;  4I8O A;  2EJ4 A;  2EMG A;  4YHH E;  2YWQ A;  2V86 A;  2ELZ A;  4MLV A;  4LF6 E;  1SR9 A;  4BMJ A;  2ADR A;  5AE2 A;  4B3S E;  2B7T A;  2EMZ A;  2YPN A;  2JP9 A;  2EN1 A;  2YRM A;  1ZAA C;  1YPN A;  1AH5 A;  3BBG A;  3OML A;  4JI8 E;  2JY9 A;  1X3C A;  1WRJ A;  2RS6 A;  3UK3 C;  2N3H A;  2DLQ A;  1YUI A;  2DMY A;  2VQE E;  3AV0 A;  1KYQ A;  2UXB E;  1HNW E;  1XMO E;  2UUB E;  2HC5 A;  2EM3 A;  2YRK A;  1RQ0 A;  3L00 A;  4DR3 E;  2DRP A;  3J80 C;  5KL3 A;  1PJT A;  5AE1 A;  2UU9 E;  2RS7 A;  2DLK A;  1T4N A;  2EMH A;  2V88 A;  2EMX A;  4F6M A;  1O0W A;  4LFC E;  2VF1 A;  2YTD A;  2EOM A;  2LCE A;  2EL6 A;  1STU A;  3ECR A;  4LF5 E;  4WPY A;  2UUC E;  2HJJ A;  1JK2 A;  4LF4 E;  4DR5 E;  2LUQ A;  2VE7 C;  2YTJ A;  2ENH A;  1A1I A;  4NXM E;  2L92 A;  2I13 A;  2EN2 A;  2E72 A;  2ENC A;  4DV3 E;  5A2Q C;  2PRT A; 
#chains in the Genus database with same CATH homology
 2EMW A;  5KL6 A;  2DGC A;  2EM9 A;  3EPJ A;  2GLI A;  2EPP A;  1DGC A;  2LVH A;  3M99 B;  2WBT A;  1A1L A;  4M9V C;  2EPZ A;  2EMF A;  2YTO A;  2EQ3 A;  1KJK A;  1UN6 B;  2DMI A;  1A1G A;  1MEY C;  1UBD C;  2EOH A;  1G2F C;  2EMI A;  1B69 A;  2WBS A;  2YU5 A;  3EPK A;  1X5W A;  2J7J A;  4IJD A;  2EM6 A;  1X6F A;  1BB8 A;  2EOR A;  2EOJ A;  2EM2 A;  2YTI A;  1AAY A;  1YUJ A;  2YTQ A;  2ENA A;  1TF6 A;  2M9A A;  3MHH C;  2EM8 A;  2YU8 A;  2EN4 A;  2EQ1 A;  2EOI A;  2D9H A;  3MHS C;  2EPA A;  1A1J A;  4X9J A;  2EOS A;  2YSP A;  2EMB A;  1X6H A;  2EL4 A;  2VRD A;  2EOF A;  3VHT B;  2CTD A;  1ZU1 A;  2EOY A;  1BBO A;  4R2C A;  2EMC A;  2CSH A;  2MDG A;  4GZN C;  1NCS A;  1TF3 A;  2YTE A;  2EPU A;  2YSO A;  2R1F A;  2EMK A;  1P47 A;  4R2D A;  2LV2 A;  5KL4 A;  2EOE A;  2EMA A;  2EJ4 A;  2EM4 A;  1A1K A;  1JK1 A;  2EMG A;  2EPX A;  2ELZ A;  4R2E A;  2ADR A;  2MKN A;  2YRH A;  1X6E A;  5KL5 A;  2JPA A;  4F6N A;  2YTG A;  2EMZ A;  2A25 A;  2JP9 A;  2EL5 A;  2EOX A;  2EN1 A;  2YRM A;  1ZAA C;  2EN6 A;  4R2S A;  1X3C A;  2EM0 A;  2EML A;  3UK3 C;  2DLQ A;  1YUI A;  1Z1B A;  2GHF A;  4R2P A;  2EOO A;  1A1F A;  2CT1 A;  2EM3 A;  2YRK A;  2DRP A;  1TN9 A;  5KL3 A;  2NAB A;  1F2I G;  2EQ0 A;  2EOZ A;  5KL7 A;  4IS1 C;  2WBU A;  2DLK A;  2EN8 A;  2EMH A;  2EMY A;  4R2Q A;  2EPR A;  2EM7 A;  1RMD A;  2EMX A;  4FK5 C;  4WSG A;  4R2A A;  4F6M A;  2YTD A;  1ZR9 A;  2EOM A;  2LCE A;  2EOQ A;  2MKD A;  2EL6 A;  2ELY A;  1WJP A;  2RPC A;  3EPH A;  2EM5 A;  2EN7 A;  2WCC 3;  2EP3 A;  2HGH A;  1JK2 A;  2EN3 A;  5KL2 A;  4R2R A;  3EPL A;  4F2J C;  2LT7 A;  1G2D C;  2YTJ A;  2YTN A;  1YSA C;  2BB8 A;  2ENH A;  1A1I A;  2YTF A;  2EE8 A;  2I13 A;  2EN2 A;  2EPC A;  2E72 A;  2ENC A;  2RSI A;  2LO3 A;  1A1H A;  2PRT A;  2YTP A;  1LLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...