2GLIA

Five-finger gli/dna complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*TP*CP*GP*TP*CP*TP*TP*GP*GP*GP*TP*GP*GP*TP*C
publication title Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 39
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 1993-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA05
1YSAC 1RMDA 2EL6A 2EN6A 2EQ0A 1G2DC 2MDGA 4IJDA 4R2PA 2D9HA 1ZR9A 2EPCA 2DRPA 2DMIA 1F2IG 2EOXA 1AAYA 2EMHA 4R2AA 1DGCA 1UN6B 4R2EA 2MKDA 2RSIA 4GZNC 1A1JA 2EOQA 2LVHA 2EMYA 1ZU1A 2EM9A 2EOFA 1X6EA 2EP3A 2EPAA 5KL2A 4F2JC 1JK2A 1BBOA 1A1IA 2EM5A 2DLQA 2EN4A 1UBDC 2EOMA 2YTIA 1B69A 2EMIA 2LO3A 2I13A 1P47A 1A1HA 2EPUA 4WSGA 2EOHA 1X5WA 4R2RA 2LCEA 2EN7A 2EN1A 2EPXA 2EMAA 2EMXA 2YTJA 2ADRA 5KL4A 2EPRA 2YSOA 2EN3A 4R2CA 2EM2A 1MEYC 2WBUA 2YRHA 2EL4A 2YTOA 2YTQA 4X9JA 3EPLA 2RPCA 2E72A 2WCC3 1A1LA 2GLIA 1TF3A 1KJKA 2YTDA 2EOYA 3M99B 4R2SA 1A1FA 2EMBA 2EN2A 2EJ4A 2EMLA 1JK1A 2YTPA 3MHHC 2DGCA 2CT1A 2EMKA 2LT7A 2BB8A 2ENCA 2EM8A 2GHFA 2YU8A 2YRKA 2J7JA 2YTGA 2WBSA 2JPAA 2EPPA 2EOSA 2EOOA 1G2FC 2EM0A 2WBTA 5KL6A 5KL3A 2EL5A 2YTNA 3EPJA 2YU5A 2CTDA 2EMGA 4FK5C 3UK3C 5KL5A 4R2QA 2EMWA 3EPHA 2EM3A 2PRTA 1A1GA 2M9AA 1Z1BA 2ELZA 2YTFA 2EM7A 3EPKA 2EOJA 2VRDA 2EN8A 1TN9A 2EOEA 2MKNA 1X6HA 1X6FA 2EOZA 1NCSA 1YUIA 2EM6A 2R1FA 2JP9A 2EOIA 1A1KA 2YSPA 2ELYA 2EPZA 4R2DA 2EMFA 1TF6A 2ENHA 5KL7A 2EMZA 1ZAAC 1X3CA 2EM4A 4F6NA 1YUJA 4M9VC 1WJPA 2NABA 2HGHA 2A25A 2ENAA 2EQ1A 2YRMA 2DLKA 2EE8A 4F6MA 2CSHA 4IS1C 1LLMC 2EMCA 2EORA 2EQ3A 3MHSC 2YTEA 3VHTB 1BB8A 2LV2A
chains in the Genus database with same CATH superfamily
2EQ0A 2EL6A 2LTSA 4BCAA 2MDGA 4MLVA 4R2PA 2D9HA 2FV4B 3JTZA 2L2MA 4Q28A 1F2IG 2EOXA 2JYAA 1MGTA 4B3SE 2MKDA 1WHQA 4F54A 1WRJA 3J80C 1T4OA 2EOFA 4WXDA 5FLXC 1A1IA 4DR1E 1IQSA 1UHZA 2EOMA 2L2KB 2I13A 1X49A 3IWBA 2MC6A 1X5WA 2R76A 3C6MA 1J5EE 3HPSA 2EMXA 4JI0E 4YHHE 5LMNE 3OTOE 4R2CA 2L2NA 2F4VE 2V89A 2WBUA 1DI2A 4X9JA 2KONA 2I9IA 2N8XA 2M7QA 2E72A 4JI5E 4LF5E 2VQEE 4JI2E 5LL6R 1EH6A 4F9BB 2GLIA 3HPZA 3M99B 4DR2E 4AQYE 4HTGA 2LTRA 5LMUE 2EJ4A 2EMLA 2YTPA 2B7TA 4DV5E 2LT7A 2F8BA 4F9AB 2YU8A 3C4TA 4LF7E 2YTGA 2UXCE 1PJQA 2HC5A 2YTNA 5F3WA 3VK6A 4DV0E 2NA2A 1HNXE 4FK5C 1T38A 4HEIA 3UK3C 4JI1E 3ADIA 2LUPB 2ODRD 1A1GA 1X47A 5AASA 2YTFA 2EM7A 2M1SA 4DMIA 4DV1E 3H09A 2EZ6A 1N32E 4BBYA 1NCSA 1N3GA 2V83A 2M4IA 4ZYEA 4DV4E 2JWOA 2JP9A 2LMZA 1N33E 2EPZA 1YPNA 4F9CB 2EMFA 2UXBE 4X65E 5KL7A 1ZAAC 1BBGA 4BC7A 1YUJA 4O5GA 1HNZE 2EQ1A 5TSEA 1IMUA 2YRMA 1YYWA 1RQ0A 4P78A 2G7HA 4DV3E 4DR6E 2JOBA 1NEIA 3DJWA 2LV2A 5AE2A 2EN6A 2K4VA 4L8NA 1G2DC 3ADGA 4JI7E 2L3CA 1ZR9A 5ADZA 2B7VA 3BBGA 2DRPA 4ZYDA 4JV5E 2CPNA 2ZM6E 5DNYA 4JI4E 2UUAE 3ADLA 1UN6B 4R2EA 5IV8B 4GZNC 1A1JA 2EM9A 1ZU1A 2DMYA 2EP3A 4O24A 1N34E 2FGGA 4NZVA 1BBOA 3MSWA 4DV7E 2DLQA 3EQ1A 2YTIA 2MC5A 4BHBA 2L92A 5AE1A 2EPNA 4R2RA 4O4KA 4K0KE 3KZYA 2EN1A 4BHCA 1HNWE 3P1XA 2NUFA 1YFHA 4DUZE 2EM2A 4Q35B 3J81C 5AC5A 2JVAA 5IWAE 1XNRE 4DR7E 2RPCA 1GTKA 1GZ6A 1I94E 1TF3A 1KJKA 2YTDA 1A1FA 2EMBA 1JK1A 3MHHC 2CT1A 1STUA 3KWRA 2ENCA 3C4BA 4JYAE 2J7JA 2JR1A 3C6KA 2JPAA 1G2FC 2LBSB 2EM0A 2EL5A 1XMQE 2EMGA 5KL5A 2HJJA 4WSPA 4R2QA 1IBME 4TUIA 5AE3A 3EPHA 4X62E 2EM3A 2PRTA 3JU0A 4JI6E 1YYKA 4P7DA 2E5LE 2EOJA 2EN8A 2MKNA 2EOZA 2DSYA 4LF4E 5A2QC 1PDAA 3QG5C 1YUIA 4R8OA 3VYYA 1T4NA 2L33A 2JOXA 2EPMX 4BC9A 1PJTA 4R2DA 2EMZA 4N4RB 2VF1A 1X3CA 2EM4A 4F6NA 4M9VC 1UILA 1WJPA 1L4SA 2FTXB 1HR0E 4LFCE 2EORA 2EQ3A 4LF8E 2YTEA 2Q8UA 3VHTB 2RQLA 2EPKX 4B3TE 1BB8A 3BF2A 4IJDA 1N36E 2LE2A 1T4LB 2EPCA 4DV2E 3FIGA 1IBLE 2DMIA 2EMHA 4R2AA 1DGCA 3OMLA 3HTXA 3F6GA 1ZBQA 4YY3E 2UXDE 2LJUA 2RSIA 5BR8E 2EMYA 2VE7C 5KL2A 4F2JC 1PKPA 2JY9A 2EM5A 2EN4A 2L6MA 1B69A 2EMIA 1WXRA 1GQEA 4WXCA 3AV0A 2L3JA 2EN7A 2V85A 4LU9A 3RMPA 4LTYA 2EPXA 2YTJA 3F6HA 5KL4A 2EPRA 4RHBB 2EPLX 2EN3A 1X48A 2RTXA 2NUEA 3THNA 2YRHA 2HHHE 2YTOA 2YTQA 2NUGA 2B9DA 4JI8E 2WCC3 1A1LA 4LF6E 5A6BD 4LF9E 2RS7A 2EN2A 5LLQA 2H36X 2DGCA 2JXPA 2YWQA 1DQ3A 2YRKA 3K6QA 2WBSA 3T1HE 2EPPA 4X64E 2EOSA 4WYQB 5KL6A 3EPJA 2YU5A 2CTDA 2YZTA 4NXNE 2E1MA 1QNTA 1EKZA 3J7Yp 1Z1BA 4NHRA 2V88A 3EPKA 1YZ9A 3J7AG 2UUCE 2WZOA 2EOEA 4RH8A 1X6HA 4DUYE 2DIXA 1IQOA 1XNQE 2KHXA 2DB2A 2EOIA 1WHNA 2ELYA 2RSMA 2L8TA 2ENHA 1FJGE 4OOGC 3LLHA 2HGHA 4DR5E 2ENAA 5IXMB 2DLKA 4F6MA 2CSHA 4IS1C 5T6JA 2EMCA 1KYQA 2K7IA 4ZYHA 2V86A 3BIDA 1YSAC 1RMDA 1YYOA 2V87A 1SFEA 4J8ZA 5CFFE 2MDRA 1AAYA 3DF6A 2IHR1 5A6JA 4TUGA 3VYXA 1O0WA 2BBGA 4M0VA 2VQFE 2EOQA 4DR3E 2LVHA 4WFTA 5IT9C 2EPAA 1X6EA 1JK2A 4DR4E 1UBDC 2LO3A 1P47A 1A1HA 2EPUA 1IBKE 4WSGA 2EOHA 2LCEA 2RS6A 2GPIA 3ECRA 2EMAA 4KZSA 4BMJA 4DKKA 2ADRA 4KHPE 4BS9A 3IWDA 2YSOA 4GEQB 4L5NC 4WPYA 2KOUA 1MEYC 4NXME 1ZBTA 2EL4A 3KZZA 5A6AA 3EPLA 3JAMC 3IWCA 3LMLA 1T39A 2EOYA 4R2SA 3ZOQB 2EPOA 2YT4A 1FKAE 2LJHA 2EMKA 4KWYA 2B3TB 2BB8A 2EM8A 2GHFA 4JI3E 4GKJE 5A6BA 4WX9A 2YPNA 1AH5A 2EOOA 4X66E 1SR9A 2N3HA 2WBTA 5KL3A 1XMOE 2EWLA 2N3GA 4ZYGA 3ADJA 1QU6A 4M30A 5A69A 2LRSA 2EMWA 3TQMA 4B3ME 4DV6E 1RC7A 2M9AA 2ELZA 3HXLA 5A6KA 2ODRC 2VRDA 3THOB 1TN9A 1X6FA 2EM6A 2R1FA 5AC4A 4GKKE 4B3RE 1EH8A 1A1KA 2V8QB 2YSPA 3AUZA 4R03A 4X8WA 4M2ZA 1TF6A 3T1YE 4OX9E 4O43A 3BGHA 4LFBE 2NABA 2UU9E 4I8OA 1PJSA 2A25A 2EE8A 1J26A 3L00A 4LFAE 2LUQA 2UUBE 1LLMC 3MHSC 3HQ1A 1EH7A 4MLQA
chains in the Genus database with same CATH topology
1YSAC 1RMDA 2EL6A 2EN6A 2EQ0A 1G2DC 2MDGA 4IJDA 4R2PA 2D9HA 1ZR9A 2EPCA 2DRPA 2DMIA 1F2IG 2EOXA 1AAYA 2EMHA 4R2AA 1DGCA 1UN6B 4R2EA 2MKDA 2RSIA 4GZNC 1A1JA 2EOQA 2LVHA 2EMYA 1ZU1A 2EM9A 2EOFA 1X6EA 2EP3A 2EPAA 5KL2A 4F2JC 1JK2A 1BBOA 1A1IA 2EM5A 2DLQA 2EN4A 1UBDC 2EOMA 2YTIA 1B69A 2EMIA 2LO3A 2I13A 1P47A 1A1HA 2EPUA 4WSGA 2EOHA 1X5WA 4R2RA 2LCEA 2EN7A 2EN1A 2EPXA 2EMAA 2EMXA 2YTJA 2ADRA 5KL4A 2EPRA 2YSOA 2EN3A 4R2CA 2EM2A 1MEYC 2WBUA 2YRHA 2EL4A 2YTOA 2YTQA 4X9JA 3EPLA 2RPCA 2E72A 2WCC3 1A1LA 2GLIA 1TF3A 1KJKA 2YTDA 2EOYA 3M99B 4R2SA 1A1FA 2EMBA 2EN2A 2EJ4A 2EMLA 1JK1A 2YTPA 3MHHC 2DGCA 2CT1A 2EMKA 2LT7A 2BB8A 2ENCA 2EM8A 2GHFA 2YU8A 2YRKA 2J7JA 2YTGA 2WBSA 2JPAA 2EPPA 2EOSA 2EOOA 1G2FC 2EM0A 2WBTA 5KL6A 5KL3A 2EL5A 2YTNA 3EPJA 2YU5A 2CTDA 2EMGA 4FK5C 3UK3C 5KL5A 4R2QA 2EMWA 3EPHA 2EM3A 2PRTA 1A1GA 2M9AA 1Z1BA 2ELZA 2YTFA 2EM7A 3EPKA 2EOJA 2VRDA 2EN8A 1TN9A 2EOEA 2MKNA 1X6HA 1X6FA 2EOZA 1NCSA 1YUIA 2EM6A 2R1FA 2JP9A 2EOIA 1A1KA 2YSPA 2ELYA 2EPZA 4R2DA 2EMFA 1TF6A 2ENHA 5KL7A 2EMZA 1ZAAC 1X3CA 2EM4A 4F6NA 1YUJA 4M9VC 1WJPA 2NABA 2HGHA 2A25A 2ENAA 2EQ1A 2YRMA 2DLKA 2EE8A 4F6MA 2CSHA 4IS1C 1LLMC 2EMCA 2EORA 2EQ3A 3MHSC 2YTEA 3VHTB 1BB8A 2LV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSA C;  1RMD A;  2EL6 A;  2EN6 A;  2EQ0 A;  1G2D C;  2MDG A;  4IJD A;  4R2P A;  2D9H A;  1ZR9 A;  2EPC A;  2DRP A;  2DMI A;  1F2I G;  2EOX A;  1AAY A;  2EMH A;  4R2A A;  1DGC A;  1UN6 B;  4R2E A;  2MKD A;  2RSI A;  4GZN C;  1A1J A;  2EOQ A;  2LVH A;  2EMY A;  1ZU1 A;  2EM9 A;  2EOF A;  1X6E A;  2EP3 A;  2EPA A;  5KL2 A;  4F2J C;  1JK2 A;  1BBO A;  1A1I A;  2EM5 A;  2DLQ A;  2EN4 A;  1UBD C;  2EOM A;  2YTI A;  1B69 A;  2EMI A;  2LO3 A;  2I13 A;  1P47 A;  1A1H A;  2EPU A;  4WSG A;  2EOH A;  1X5W A;  4R2R A;  2LCE A;  2EN7 A;  2EN1 A;  2EPX A;  2EMA A;  2EMX A;  2YTJ A;  2ADR A;  5KL4 A;  2EPR A;  2YSO A;  2EN3 A;  4R2C A;  2EM2 A;  1MEY C;  2WBU A;  2YRH A;  2EL4 A;  2YTO A;  2YTQ A;  4X9J A;  3EPL A;  2RPC A;  2E72 A;  2WCC 3;  1A1L A;  2GLI A;  1TF3 A;  1KJK A;  2YTD A;  2EOY A;  3M99 B;  4R2S A;  1A1F A;  2EMB A;  2EN2 A;  2EJ4 A;  2EML A;  1JK1 A;  2YTP A;  3MHH C;  2DGC A;  2CT1 A;  2EMK A;  2LT7 A;  2BB8 A;  2ENC A;  2EM8 A;  2GHF A;  2YU8 A;  2YRK A;  2J7J A;  2YTG A;  2WBS A;  2JPA A;  2EPP A;  2EOS A;  2EOO A;  1G2F C;  2EM0 A;  2WBT A;  5KL6 A;  5KL3 A;  2EL5 A;  2YTN A;  3EPJ A;  2YU5 A;  2CTD A;  2EMG A;  4FK5 C;  3UK3 C;  5KL5 A;  4R2Q A;  2EMW A;  3EPH A;  2EM3 A;  2PRT A;  1A1G A;  2M9A A;  1Z1B A;  2ELZ A;  2YTF A;  2EM7 A;  3EPK A;  2EOJ A;  2VRD A;  2EN8 A;  1TN9 A;  2EOE A;  2MKN A;  1X6H A;  1X6F A;  2EOZ A;  1NCS A;  1YUI A;  2EM6 A;  2R1F A;  2JP9 A;  2EOI A;  1A1K A;  2YSP A;  2ELY A;  2EPZ A;  4R2D A;  2EMF A;  1TF6 A;  2ENH A;  5KL7 A;  2EMZ A;  1ZAA C;  1X3C A;  2EM4 A;  4F6N A;  1YUJ A;  4M9V C;  1WJP A;  2NAB A;  2HGH A;  2A25 A;  2ENA A;  2EQ1 A;  2YRM A;  2DLK A;  2EE8 A;  4F6M A;  2CSH A;  4IS1 C;  1LLM C;  2EMC A;  2EOR A;  2EQ3 A;  3MHS C;  2YTE A;  3VHT B;  1BB8 A;  2LV2 A; 
#chains in the Genus database with same CATH topology
 2EQ0 A;  2EL6 A;  2LTS A;  4BCA A;  2MDG A;  4MLV A;  4R2P A;  2D9H A;  2FV4 B;  3JTZ A;  2L2M A;  4Q28 A;  1F2I G;  2EOX A;  2JYA A;  1MGT A;  4B3S E;  2MKD A;  1WHQ A;  4F54 A;  1WRJ A;  3J80 C;  1T4O A;  2EOF A;  4WXD A;  5FLX C;  1A1I A;  4DR1 E;  1IQS A;  1UHZ A;  2EOM A;  2L2K B;  2I13 A;  1X49 A;  3IWB A;  2MC6 A;  1X5W A;  2R76 A;  3C6M A;  1J5E E;  3HPS A;  2EMX A;  4JI0 E;  4YHH E;  5LMN E;  3OTO E;  4R2C A;  2L2N A;  2F4V E;  2V89 A;  2WBU A;  1DI2 A;  4X9J A;  2KON A;  2I9I A;  2N8X A;  2M7Q A;  2E72 A;  4JI5 E;  4LF5 E;  2VQE E;  4JI2 E;  5LL6 R;  1EH6 A;  4F9B B;  2GLI A;  3HPZ A;  3M99 B;  4DR2 E;  4AQY E;  4HTG A;  2LTR A;  5LMU E;  2EJ4 A;  2EML A;  2YTP A;  2B7T A;  4DV5 E;  2LT7 A;  2F8B A;  4F9A B;  2YU8 A;  3C4T A;  4LF7 E;  2YTG A;  2UXC E;  1PJQ A;  2HC5 A;  2YTN A;  5F3W A;  3VK6 A;  4DV0 E;  2NA2 A;  1HNX E;  4FK5 C;  1T38 A;  4HEI A;  3UK3 C;  4JI1 E;  3ADI A;  2LUP B;  2ODR D;  1A1G A;  1X47 A;  5AAS A;  2YTF A;  2EM7 A;  2M1S A;  4DMI A;  4DV1 E;  3H09 A;  2EZ6 A;  1N32 E;  4BBY A;  1NCS A;  1N3G A;  2V83 A;  2M4I A;  4ZYE A;  4DV4 E;  2JWO A;  2JP9 A;  2LMZ A;  1N33 E;  2EPZ A;  1YPN A;  4F9C B;  2EMF A;  2UXB E;  4X65 E;  5KL7 A;  1ZAA C;  1BBG A;  4BC7 A;  1YUJ A;  4O5G A;  1HNZ E;  2EQ1 A;  5TSE A;  1IMU A;  2YRM A;  1YYW A;  1RQ0 A;  4P78 A;  2G7H A;  4DV3 E;  4DR6 E;  2JOB A;  1NEI A;  3DJW A;  2LV2 A;  5AE2 A;  2EN6 A;  2K4V A;  4L8N A;  1G2D C;  3ADG A;  4JI7 E;  2L3C A;  1ZR9 A;  5ADZ A;  2B7V A;  3BBG A;  2DRP A;  4ZYD A;  4JV5 E;  2CPN A;  2ZM6 E;  5DNY A;  4JI4 E;  2UUA E;  3ADL A;  1UN6 B;  4R2E A;  5IV8 B;  4GZN C;  1A1J A;  2EM9 A;  1ZU1 A;  2DMY A;  2EP3 A;  4O24 A;  1N34 E;  2FGG A;  4NZV A;  1BBO A;  3MSW A;  4DV7 E;  2DLQ A;  3EQ1 A;  2YTI A;  2MC5 A;  4BHB A;  2L92 A;  5AE1 A;  2EPN A;  4R2R A;  4O4K A;  4K0K E;  3KZY A;  2EN1 A;  4BHC A;  1HNW E;  3P1X A;  2NUF A;  1YFH A;  4DUZ E;  2EM2 A;  4Q35 B;  3J81 C;  5AC5 A;  2JVA A;  5IWA E;  1XNR E;  4DR7 E;  2RPC A;  1GTK A;  1GZ6 A;  1I94 E;  1TF3 A;  1KJK A;  2YTD A;  1A1F A;  2EMB A;  1JK1 A;  3MHH C;  2CT1 A;  1STU A;  3KWR A;  2ENC A;  3C4B A;  4JYA E;  2J7J A;  2JR1 A;  3C6K A;  2JPA A;  1G2F C;  2LBS B;  2EM0 A;  2EL5 A;  1XMQ E;  2EMG A;  5KL5 A;  2HJJ A;  4WSP A;  4R2Q A;  1IBM E;  4TUI A;  5AE3 A;  3EPH A;  4X62 E;  2EM3 A;  2PRT A;  3JU0 A;  4JI6 E;  1YYK A;  4P7D A;  2E5L E;  2EOJ A;  2EN8 A;  2MKN A;  2EOZ A;  2DSY A;  4LF4 E;  5A2Q C;  1PDA A;  3QG5 C;  1YUI A;  4R8O A;  3VYY A;  1T4N A;  2L33 A;  2JOX A;  2EPM X;  4BC9 A;  1PJT A;  4R2D A;  2EMZ A;  4N4R B;  2VF1 A;  1X3C A;  2EM4 A;  4F6N A;  4M9V C;  1UIL A;  1WJP A;  1L4S A;  2FTX B;  1HR0 E;  4LFC E;  2EOR A;  2EQ3 A;  4LF8 E;  2YTE A;  2Q8U A;  3VHT B;  2RQL A;  2EPK X;  4B3T E;  1BB8 A;  3BF2 A;  4IJD A;  1N36 E;  2LE2 A;  1T4L B;  2EPC A;  4DV2 E;  3FIG A;  1IBL E;  2DMI A;  2EMH A;  4R2A A;  1DGC A;  3OML A;  3HTX A;  3F6G A;  1ZBQ A;  4YY3 E;  2UXD E;  2LJU A;  2RSI A;  5BR8 E;  2EMY A;  2VE7 C;  5KL2 A;  4F2J C;  1PKP A;  2JY9 A;  2EM5 A;  2EN4 A;  2L6M A;  1B69 A;  2EMI A;  1WXR A;  1GQE A;  4WXC A;  3AV0 A;  2L3J A;  2EN7 A;  2V85 A;  4LU9 A;  3RMP A;  4LTY A;  2EPX A;  2YTJ A;  3F6H A;  5KL4 A;  2EPR A;  4RHB B;  2EPL X;  2EN3 A;  1X48 A;  2RTX A;  2NUE A;  3THN A;  2YRH A;  2HHH E;  2YTO A;  2YTQ A;  2NUG A;  2B9D A;  4JI8 E;  2WCC 3;  1A1L A;  4LF6 E;  5A6B D;  4LF9 E;  2RS7 A;  2EN2 A;  5LLQ A;  2H36 X;  2DGC A;  2JXP A;  2YWQ A;  1DQ3 A;  2YRK A;  3K6Q A;  2WBS A;  3T1H E;  2EPP A;  4X64 E;  2EOS A;  4WYQ B;  5KL6 A;  3EPJ A;  2YU5 A;  2CTD A;  2YZT A;  4NXN E;  2E1M A;  1QNT A;  1EKZ A;  3J7Y p;  1Z1B A;  4NHR A;  2V88 A;  3EPK A;  1YZ9 A;  3J7A G;  2UUC E;  2WZO A;  2EOE A;  4RH8 A;  1X6H A;  4DUY E;  2DIX A;  1IQO A;  1XNQ E;  2KHX A;  2DB2 A;  2EOI A;  1WHN A;  2ELY A;  2RSM A;  2L8T A;  2ENH A;  1FJG E;  4OOG C;  3LLH A;  2HGH A;  4DR5 E;  2ENA A;  5IXM B;  2DLK A;  4F6M A;  2CSH A;  4IS1 C;  5T6J A;  2EMC A;  1KYQ A;  2K7I A;  4ZYH A;  2V86 A;  3BID A;  1YSA C;  1RMD A;  1YYO A;  2V87 A;  1SFE A;  4J8Z A;  5CFF E;  2MDR A;  1AAY A;  3DF6 A;  2IHR 1;  5A6J A;  4TUG A;  3VYX A;  1O0W A;  2BBG A;  4M0V A;  2VQF E;  2EOQ A;  4DR3 E;  2LVH A;  4WFT A;  5IT9 C;  2EPA A;  1X6E A;  1JK2 A;  4DR4 E;  1UBD C;  2LO3 A;  1P47 A;  1A1H A;  2EPU A;  1IBK E;  4WSG A;  2EOH A;  2LCE A;  2RS6 A;  2GPI A;  3ECR A;  2EMA A;  4KZS A;  4BMJ A;  4DKK A;  2ADR A;  4KHP E;  4BS9 A;  3IWD A;  2YSO A;  4GEQ B;  4L5N C;  4WPY A;  2KOU A;  1MEY C;  4NXM E;  1ZBT A;  2EL4 A;  3KZZ A;  5A6A A;  3EPL A;  3JAM C;  3IWC A;  3LML A;  1T39 A;  2EOY A;  4R2S A;  3ZOQ B;  2EPO A;  2YT4 A;  1FKA E;  2LJH A;  2EMK A;  4KWY A;  2B3T B;  2BB8 A;  2EM8 A;  2GHF A;  4JI3 E;  4GKJ E;  5A6B A;  4WX9 A;  2YPN A;  1AH5 A;  2EOO A;  4X66 E;  1SR9 A;  2N3H A;  2WBT A;  5KL3 A;  1XMO E;  2EWL A;  2N3G A;  4ZYG A;  3ADJ A;  1QU6 A;  4M30 A;  5A69 A;  2LRS A;  2EMW A;  3TQM A;  4B3M E;  4DV6 E;  1RC7 A;  2M9A A;  2ELZ A;  3HXL A;  5A6K A;  2ODR C;  2VRD A;  3THO B;  1TN9 A;  1X6F A;  2EM6 A;  2R1F A;  5AC4 A;  4GKK E;  4B3R E;  1EH8 A;  1A1K A;  2V8Q B;  2YSP A;  3AUZ A;  4R03 A;  4X8W A;  4M2Z A;  1TF6 A;  3T1Y E;  4OX9 E;  4O43 A;  3BGH A;  4LFB E;  2NAB A;  2UU9 E;  4I8O A;  1PJS A;  2A25 A;  2EE8 A;  1J26 A;  3L00 A;  4LFA E;  2LUQ A;  2UUB E;  1LLM C;  3MHS C;  3HQ1 A;  1EH7 A;  4MLQ A; 
#chains in the Genus database with same CATH homology
 1YSA C;  1RMD A;  2EL6 A;  2EN6 A;  2EQ0 A;  1G2D C;  2MDG A;  4IJD A;  4R2P A;  2D9H A;  1ZR9 A;  2EPC A;  2DRP A;  2DMI A;  1F2I G;  2EOX A;  1AAY A;  2EMH A;  4R2A A;  1DGC A;  1UN6 B;  4R2E A;  2MKD A;  2RSI A;  4GZN C;  1A1J A;  2EOQ A;  2LVH A;  2EMY A;  1ZU1 A;  2EM9 A;  2EOF A;  1X6E A;  2EP3 A;  2EPA A;  5KL2 A;  4F2J C;  1JK2 A;  1BBO A;  1A1I A;  2EM5 A;  2DLQ A;  2EN4 A;  1UBD C;  2EOM A;  2YTI A;  1B69 A;  2EMI A;  2LO3 A;  2I13 A;  1P47 A;  1A1H A;  2EPU A;  4WSG A;  2EOH A;  1X5W A;  4R2R A;  2LCE A;  2EN7 A;  2EN1 A;  2EPX A;  2EMA A;  2EMX A;  2YTJ A;  2ADR A;  5KL4 A;  2EPR A;  2YSO A;  2EN3 A;  4R2C A;  2EM2 A;  1MEY C;  2WBU A;  2YRH A;  2EL4 A;  2YTO A;  2YTQ A;  4X9J A;  3EPL A;  2RPC A;  2E72 A;  2WCC 3;  1A1L A;  2GLI A;  1TF3 A;  1KJK A;  2YTD A;  2EOY A;  3M99 B;  4R2S A;  1A1F A;  2EMB A;  2EN2 A;  2EJ4 A;  2EML A;  1JK1 A;  2YTP A;  3MHH C;  2DGC A;  2CT1 A;  2EMK A;  2LT7 A;  2BB8 A;  2ENC A;  2EM8 A;  2GHF A;  2YU8 A;  2YRK A;  2J7J A;  2YTG A;  2WBS A;  2JPA A;  2EPP A;  2EOS A;  2EOO A;  1G2F C;  2EM0 A;  2WBT A;  5KL6 A;  5KL3 A;  2EL5 A;  2YTN A;  3EPJ A;  2YU5 A;  2CTD A;  2EMG A;  4FK5 C;  3UK3 C;  5KL5 A;  4R2Q A;  2EMW A;  3EPH A;  2EM3 A;  2PRT A;  1A1G A;  2M9A A;  1Z1B A;  2ELZ A;  2YTF A;  2EM7 A;  3EPK A;  2EOJ A;  2VRD A;  2EN8 A;  1TN9 A;  2EOE A;  2MKN A;  1X6H A;  1X6F A;  2EOZ A;  1NCS A;  1YUI A;  2EM6 A;  2R1F A;  2JP9 A;  2EOI A;  1A1K A;  2YSP A;  2ELY A;  2EPZ A;  4R2D A;  2EMF A;  1TF6 A;  2ENH A;  5KL7 A;  2EMZ A;  1ZAA C;  1X3C A;  2EM4 A;  4F6N A;  1YUJ A;  4M9V C;  1WJP A;  2NAB A;  2HGH A;  2A25 A;  2ENA A;  2EQ1 A;  2YRM A;  2DLK A;  2EE8 A;  4F6M A;  2CSH A;  4IS1 C;  1LLM C;  2EMC A;  2EOR A;  2EQ3 A;  3MHS C;  2YTE A;  3VHT B;  1BB8 A;  2LV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...