2GLIA

Five-finger gli/dna complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*TP*TP*CP*GP*TP*CP*TP*TP*GP*GP*GP*TP*GP*GP*TP*C
total genus 39
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 1993-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA05
4R2SA 2LT7A 1B69A 2EMXA 4GZNC 2EJ4A 2EN4A 2EPXA 4WSGA 4R2QA 3UK3C 2YTGA 2EMCA 4X9JA 1A1JA 2YTIA 1TF3A 2YU5A 1A1IA 2D9HA 1YUIA 1TF6A 2ELYA 2EOEA 2EE8A 2EMZA 4F6NA 1AAYA 1X5WA 2E72A 2EN2A 2WBTA 2EN3A 2EOZA 2A25A 2EOMA 2EL5A 3M99B 1NCSA 2VRDA 4R2AA 2EPUA 1YUJA 1JK1A 2EPCA 2DMIA 2GLIA 2M9AA 2JP9A 2CT1A 2YSOA 1BB8A 1JK2A 1A1FA 2EN6A 2EMYA 2RPCA 2YTEA 1TN9A 2MDGA 3EPJA 2CSHA 1MEYC 2MKNA 2YRHA 2NABA 2EOOA 3EPLA 2EM7A 2EPPA 2GHFA 2LCEA 1Z1BA 2EN8A 2ENHA 2EOIA 2YTOA 2EMAA 1X3CA 2LV2A 2EM0A 2HGHA 2ENCA 2EP3A 3MHHC 2MKDA 4F2JC 2YTQA 2EOFA 2EMIA 2YU8A 1BBOA 2EMFA 2LO3A 4IS1C 2EM8A 1ZR9A 2EN1A 2EMKA 2CTDA 2YTFA 1G2FC 2EMLA 1DGCA 5KL3A 2EOYA 1X6HA 2EN7A 4R2DA 3EPHA 2EOSA 2ENAA 5KL6A 1G2DC 4FK5C 2EOJA 2YRMA 2LVHA 4M9VC 1P47A 2YSPA 1A1LA 1A1KA 2BB8A 1WJPA 2EM9A 2EQ0A 2DLQA 2EQ1A 5KL5A 2EM5A 2EPRA 1ZU1A 2DGCA 2RSIA 3EPKA 4F6MA 1A1GA 1KJKA 1F2IG 4R2RA 2EMBA 1LLMC 2WBSA 2I13A 2YTJA 1ZAAC 5KL7A 2EM4A 2EL4A 2DRPA 1UBDC 1YSAC 4R2CA 2YTPA 2EPZA 2EMWA 2R1FA 2EOXA 3VHTB 2WCC3 1A1HA 2EM3A 2EOQA 2DLKA 2EMHA 2EM6A 4IJDA 5KL4A 2EM2A 2EL6A 1X6EA 2EQ3A 4R2PA 2EOHA 4R2EA 5KL2A 2WBUA 2JPAA 2YTDA 2YTNA 1RMDA 2ELZA 2ADRA 2YRKA 2EMGA 3MHSC 2PRTA 2EPAA 2EORA 2J7JA 1UN6B 1X6FA
chains in the Genus database with same CATH superfamily
2GPIA 2LT7A 1L4SA 1NEIA 1T39A 4GZNC 4WSGA 3VK6A 3F6GA 5AC5A 3J81C 2L2KB 3P1XA 3ZOQB 4RH8A 1A1IA 3T1HE 1TF6A 1MGTA 1UILA 1X5WA 4JI7E 1J5EE 4HEIA 2B3TB 4I8OA 2RTXA 4R2AA 3HTXA 2EPCA 4LF5E 2VQFE 2DMIA 2RS6A 3QG5C 4JI6E 4NXNE 2LE2A 1BB8A 4ZYGA 5A6BD 2DB2A 2Q8UA 2V8QB 5AC4A 1RC7A 2YRHA 2LJHA 1GTKA 4YY3E 2UUCE 2YPNA 2YT4A 4DV3E 4GEQB 5T6JA 2EM0A 4KHPE 2ENCA 1I94E 1IMUA 2EM8A 2E1MA 1QNTA 2YTFA 5A69A 1X6HA 2B9DA 5AASA 2L92A 3JU0A 3K6QA 4KZSA 3EPHA 2ENAA 5KL6A 1IQOA 2EOJA 2YRMA 4X64E 2L2MA 3ECRA 2YSPA 4F9BB 3JAMC 2DLQA 2EQ1A 1A1GA 1UHZA 4ZYDA 4TUIA 2EMBA 4DV1E 1N3GA 2KONA 4NHRA 3F6HA 5KL7A 2HJJA 3C6MA 2EM4A 3J80C 4Q28A 4L8NA 2YTPA 2EPZA 4F9CB 1RQ0A 2EOXA 2R1FA 1A1HA 3ADLA 2DLKA 1IBLE 4JI0E 4O4KA 4R8OA 2CPNA 4OX9E 4BBYA 1FKAE 5A6BA 4R2EA 3LMLA 2KOUA 2L2NA 2YRKA 4JI2E 4M2ZA 1STUA 2PRTA 2EORA 2J7JA 1UN6B 3J7Yp 4R2SA 1ZBQA 2EMXA 2EN4A 4O24A 4R2QA 3UK3C 5FLXC 3BF2A 2G7HA 4DV0E 3THOB 2ELYA 1GZ6A 4WXCA 2EPMX 3IWCA 4F6NA 2RQLA 2EN2A 1WHNA 2WBTA 2EOZA 1YYKA 2UUBE 2EOMA 4HTGA 1BBGA 3KZZA 1N33E 2EPUA 2ODRD 2GLIA 2CT1A 2YSOA 1JK2A 1A1FA 2VE7C 2EPNA 2YTEA 1TN9A 4JI1E 2B7TA 2MDGA 2CSHA 3FIGA 1MEYC 1YYWA 5IV8B 2NABA 2GHFA 2N8XA 2EN8A 2ENHA 4WX9A 2EOIA 2YTOA 2MC6A 4WPYA 4JI3E 1X3CA 1QU6A 1IBME 4LFCE 2MKDA 1HNWE 2YTQA 2YU8A 3VYXA 1BBOA 4F9AB 5A6KA 2UXBE 5LMNE 3C4BA 4JYAE 1ZR9A 1YZ9A 1WHQA 2EMKA 1G2FC 5KL3A 1DQ3A 2EN7A 2V86A 5ADZA 3OTOE 2RS7A 4DV5E 1G2DC 2M7QA 1IBKE 1FJGE 1J26A 5AE2A 4WSPA 2FGGA 2UU9E 4DMIA 1PJTA 5KL5A 2NUGA 2RSIA 4F6MA 2LTSA 2JXPA 1F2IG 3AUZA 5LL6R 5LLQA 4JI5E 2WBSA 4B3RE 2I13A 2N3HA 3EQ1A 2EPOA 3DF6A 2DRPA 1UBDC 1YSAC 1HNXE 2EMWA 2ZM6E 4LU9A 2JOXA 2HHHE 2LRSA 4N4RB 1YYOA 2LJUA 2DIXA 4IJDA 3HQ1A 3BGHA 4LF8E 1T4OA 2EL6A 4F54A 4LF7E 3T1YE 2EOHA 5KL2A 2WBUA 2JPAA 2YTNA 2F8BA 2ADRA 2EMGA 4DR1E 2DSYA 3BIDA 2KHXA 1B69A 2EJ4A 2EPXA 1XNQE 2NUEA 2YTGA 2UXDE 2EMCA 5AE3A 4X9JA 1A1JA 5LMUE 2YTIA 3J7AG 2YU5A 2EE8A 2LUPB 2LBSB 1AAYA 4LF4E 2E72A 5DNYA 2EN3A 2WZOA 2UUAE 5AE1A 5A6JA 2H36X 2A25A 3L00A 4ZYEA 2EZ6A 1NCSA 2N3GA 5CFFE 1SFEA 1YUJA 2F4VE 4DR2E 1JK1A 4BS9A 1HR0E 1WXRA 3OMLA 2JP9A 3HPZA 2B7VA 4LF6E 2K7IA 4LF9E 2EMYA 2RPCA 2V83A 4O5GA 3ADIA 1HNZE 2VF1A 4OOGC 3DJWA 4BHBA 2LV2A 2HGHA 4M30A 2VQEE 3MHHC 2JVAA 5F3WA 5IXMB 1X48A 4IS1C 4MLVA 3LLHA 4P78A 4GKJE 3IWBA 1DGCA 2EOYA 4WXDA 4X65E 4R2DA 3TQMA 3HXLA 2V85A 2EOSA 4TUGA 4FK5C 4LFBE 2EPLX 2M4IA 3HPSA 2YZTA 2LVHA 4M9VC 2L6MA 4B3ME 1A1KA 1WJPA 4B3SE 2MDRA 1N36E 2EPRA 2DGCA 2UXCE 3EPKA 4Q35B 4BCAA 4DR4E 4BHCA 1WRJA 4LTYA 2BBGA 4DV2E 1PJQA 1PKPA 2FV4B 2DMYA 1EH7A 1IQSA 1EH8A 4KWYA 5BR8E 3VYYA 4BMJA 4AQYE 2EM3A 2L8TA 2E5LE 2EMHA 2EM6A 4X62E 1X6EA 2EQ3A 4K0KE 4RHBB 1RMDA 2ELZA 3RMPA 4J8ZA 1T38A 1X47A 2IHR1 4MLQA 2L33A 1YFHA 4DUZE 4JI8E 5A6AA 5IT9C 1YUIA 1TF3A 2D9HA 2EOEA 2I9IA 2EMZA 1XMOE 4WFTA 4WYQB 3C4TA 1EKZA 2R76A 2EL5A 3M99B 1T4LB 2VRDA 1T4NA 2LTRA 3IWDA 1PJSA 1EH6A 2M9AA 3MSWA 5A2QC 2RSMA 2MC5A 2EN6A 1KYQA 2JYAA 3EPJA 2MKNA 2EOOA 3EPLA 2EM7A 2EPPA 1N34E 2LCEA 1Z1BA 4DR7E 2HC5A 1ZBTA 1N32E 1GQEA 2EMAA 3AV0A 2EP3A 1O0WA 4X8WA 4F2JC 2EOFA 2EMIA 2LUQA 2EMFA 3KZYA 2V88A 2LO3A 3KWRA 4ZYHA 4X66E 4M0VA 4O43A 4B3TE 4NXME 1YPNA 2EN1A 4DV4E 2CTDA 2V89A 2EMLA 4P7DA 4DV6E 4R03A 2L3CA 1PDAA 5IWAE 2L3JA 2JY9A 1P47A 4L5NC 2JOBA 1A1LA 2NA2A 5TSEA 4NZVA 2BB8A 4DV7E 2EQ0A 2EM9A 2ODRC 2V87A 3C6KA 3ADGA 2EM5A 1ZU1A 1KJKA 4R2RA 4JV5E 1LLMC 2JR1A 2K4VA 4DR6E 2EWLA 4LFAE 2YTJA 3JTZA 1ZAAC 4DR3E 4BC7A 2EL4A 2FTXB 4R2CA 4YHHE 4GKKE 1XNRE 3VHTB 3ADJA 4BC9A 2WCC3 2LMZA 3H09A 2EOQA 1XMQE 1X49A 5KL4A 2EM2A 2NUFA 2M1SA 4R2PA 4DR5E 4JI4E 1SR9A 4DKKA 2JWOA 2YWQA 2YTDA 1DI2A 2EPKX 3MHSC 1AH5A 2EPAA 3THNA 4DUYE 1X6FA 3BBGA
chains in the Genus database with same CATH topology
4R2SA 2LT7A 1B69A 2EMXA 4GZNC 2EJ4A 2EN4A 2EPXA 4WSGA 4R2QA 3UK3C 2YTGA 2EMCA 4X9JA 1A1JA 2YTIA 1TF3A 2YU5A 1A1IA 2D9HA 1YUIA 1TF6A 2ELYA 2EOEA 2EE8A 2EMZA 4F6NA 1AAYA 1X5WA 2E72A 2EN2A 2WBTA 2EN3A 2EOZA 2A25A 2EOMA 2EL5A 3M99B 1NCSA 2VRDA 4R2AA 2EPUA 1YUJA 1JK1A 2EPCA 2DMIA 2GLIA 2M9AA 2JP9A 2CT1A 2YSOA 1BB8A 1JK2A 1A1FA 2EN6A 2EMYA 2RPCA 2YTEA 1TN9A 2MDGA 3EPJA 2CSHA 1MEYC 2MKNA 2YRHA 2NABA 2EOOA 3EPLA 2EM7A 2EPPA 2GHFA 2LCEA 1Z1BA 2EN8A 2ENHA 2EOIA 2YTOA 2EMAA 1X3CA 2LV2A 2EM0A 2HGHA 2ENCA 2EP3A 3MHHC 2MKDA 4F2JC 2YTQA 2EOFA 2EMIA 2YU8A 1BBOA 2EMFA 2LO3A 4IS1C 2EM8A 1ZR9A 2EN1A 2EMKA 2CTDA 2YTFA 1G2FC 2EMLA 1DGCA 5KL3A 2EOYA 1X6HA 2EN7A 4R2DA 3EPHA 2EOSA 2ENAA 5KL6A 1G2DC 4FK5C 2EOJA 2YRMA 2LVHA 4M9VC 1P47A 2YSPA 1A1LA 1A1KA 2BB8A 1WJPA 2EM9A 2EQ0A 2DLQA 2EQ1A 5KL5A 2EM5A 2EPRA 1ZU1A 2DGCA 2RSIA 3EPKA 4F6MA 1A1GA 1KJKA 1F2IG 4R2RA 2EMBA 1LLMC 2WBSA 2I13A 2YTJA 1ZAAC 5KL7A 2EM4A 2EL4A 2DRPA 1UBDC 1YSAC 4R2CA 2YTPA 2EPZA 2EMWA 2R1FA 2EOXA 3VHTB 2WCC3 1A1HA 2EM3A 2EOQA 2DLKA 2EMHA 2EM6A 4IJDA 5KL4A 2EM2A 2EL6A 1X6EA 2EQ3A 4R2PA 2EOHA 4R2EA 5KL2A 2WBUA 2JPAA 2YTDA 2YTNA 1RMDA 2ELZA 2ADRA 2YRKA 2EMGA 3MHSC 2PRTA 2EPAA 2EORA 2J7JA 1UN6B 1X6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2S A;  2LT7 A;  1B69 A;  2EMX A;  4GZN C;  2EJ4 A;  2EN4 A;  2EPX A;  4WSG A;  4R2Q A;  3UK3 C;  2YTG A;  2EMC A;  4X9J A;  1A1J A;  2YTI A;  1TF3 A;  2YU5 A;  1A1I A;  2D9H A;  1YUI A;  1TF6 A;  2ELY A;  2EOE A;  2EE8 A;  2EMZ A;  4F6N A;  1AAY A;  1X5W A;  2E72 A;  2EN2 A;  2WBT A;  2EN3 A;  2EOZ A;  2A25 A;  2EOM A;  2EL5 A;  3M99 B;  1NCS A;  2VRD A;  4R2A A;  2EPU A;  1YUJ A;  1JK1 A;  2EPC A;  2DMI A;  2GLI A;  2M9A A;  2JP9 A;  2CT1 A;  2YSO A;  1BB8 A;  1JK2 A;  1A1F A;  2EN6 A;  2EMY A;  2RPC A;  2YTE A;  1TN9 A;  2MDG A;  3EPJ A;  2CSH A;  1MEY C;  2MKN A;  2YRH A;  2NAB A;  2EOO A;  3EPL A;  2EM7 A;  2EPP A;  2GHF A;  2LCE A;  1Z1B A;  2EN8 A;  2ENH A;  2EOI A;  2YTO A;  2EMA A;  1X3C A;  2LV2 A;  2EM0 A;  2HGH A;  2ENC A;  2EP3 A;  3MHH C;  2MKD A;  4F2J C;  2YTQ A;  2EOF A;  2EMI A;  2YU8 A;  1BBO A;  2EMF A;  2LO3 A;  4IS1 C;  2EM8 A;  1ZR9 A;  2EN1 A;  2EMK A;  2CTD A;  2YTF A;  1G2F C;  2EML A;  1DGC A;  5KL3 A;  2EOY A;  1X6H A;  2EN7 A;  4R2D A;  3EPH A;  2EOS A;  2ENA A;  5KL6 A;  1G2D C;  4FK5 C;  2EOJ A;  2YRM A;  2LVH A;  4M9V C;  1P47 A;  2YSP A;  1A1L A;  1A1K A;  2BB8 A;  1WJP A;  2EM9 A;  2EQ0 A;  2DLQ A;  2EQ1 A;  5KL5 A;  2EM5 A;  2EPR A;  1ZU1 A;  2DGC A;  2RSI A;  3EPK A;  4F6M A;  1A1G A;  1KJK A;  1F2I G;  4R2R A;  2EMB A;  1LLM C;  2WBS A;  2I13 A;  2YTJ A;  1ZAA C;  5KL7 A;  2EM4 A;  2EL4 A;  2DRP A;  1UBD C;  1YSA C;  4R2C A;  2YTP A;  2EPZ A;  2EMW A;  2R1F A;  2EOX A;  3VHT B;  2WCC 3;  1A1H A;  2EM3 A;  2EOQ A;  2DLK A;  2EMH A;  2EM6 A;  4IJD A;  5KL4 A;  2EM2 A;  2EL6 A;  1X6E A;  2EQ3 A;  4R2P A;  2EOH A;  4R2E A;  5KL2 A;  2WBU A;  2JPA A;  2YTD A;  2YTN A;  1RMD A;  2ELZ A;  2ADR A;  2YRK A;  2EMG A;  3MHS C;  2PRT A;  2EPA A;  2EOR A;  2J7J A;  1UN6 B;  1X6F A; 
#chains in the Genus database with same CATH topology
 2GPI A;  2LT7 A;  1L4S A;  1NEI A;  1T39 A;  4GZN C;  4WSG A;  3VK6 A;  3F6G A;  5AC5 A;  3J81 C;  2L2K B;  3P1X A;  3ZOQ B;  4RH8 A;  1A1I A;  3T1H E;  1TF6 A;  1MGT A;  1UIL A;  1X5W A;  4JI7 E;  1J5E E;  4HEI A;  2B3T B;  4I8O A;  2RTX A;  4R2A A;  3HTX A;  2EPC A;  4LF5 E;  2VQF E;  2DMI A;  2RS6 A;  3QG5 C;  4JI6 E;  4NXN E;  2LE2 A;  1BB8 A;  4ZYG A;  5A6B D;  2DB2 A;  2Q8U A;  2V8Q B;  5AC4 A;  1RC7 A;  2YRH A;  2LJH A;  1GTK A;  4YY3 E;  2UUC E;  2YPN A;  2YT4 A;  4DV3 E;  4GEQ B;  5T6J A;  2EM0 A;  4KHP E;  2ENC A;  1I94 E;  1IMU A;  2EM8 A;  2E1M A;  1QNT A;  2YTF A;  5A69 A;  1X6H A;  2B9D A;  5AAS A;  2L92 A;  3JU0 A;  3K6Q A;  4KZS A;  3EPH A;  2ENA A;  5KL6 A;  1IQO A;  2EOJ A;  2YRM A;  4X64 E;  2L2M A;  3ECR A;  2YSP A;  4F9B B;  3JAM C;  2DLQ A;  2EQ1 A;  1A1G A;  1UHZ A;  4ZYD A;  4TUI A;  2EMB A;  4DV1 E;  1N3G A;  2KON A;  4NHR A;  3F6H A;  5KL7 A;  2HJJ A;  3C6M A;  2EM4 A;  3J80 C;  4Q28 A;  4L8N A;  2YTP A;  2EPZ A;  4F9C B;  1RQ0 A;  2EOX A;  2R1F A;  1A1H A;  3ADL A;  2DLK A;  1IBL E;  4JI0 E;  4O4K A;  4R8O A;  2CPN A;  4OX9 E;  4BBY A;  1FKA E;  5A6B A;  4R2E A;  3LML A;  2KOU A;  2L2N A;  2YRK A;  4JI2 E;  4M2Z A;  1STU A;  2PRT A;  2EOR A;  2J7J A;  1UN6 B;  3J7Y p;  4R2S A;  1ZBQ A;  2EMX A;  2EN4 A;  4O24 A;  4R2Q A;  3UK3 C;  5FLX C;  3BF2 A;  2G7H A;  4DV0 E;  3THO B;  2ELY A;  1GZ6 A;  4WXC A;  2EPM X;  3IWC A;  4F6N A;  2RQL A;  2EN2 A;  1WHN A;  2WBT A;  2EOZ A;  1YYK A;  2UUB E;  2EOM A;  4HTG A;  1BBG A;  3KZZ A;  1N33 E;  2EPU A;  2ODR D;  2GLI A;  2CT1 A;  2YSO A;  1JK2 A;  1A1F A;  2VE7 C;  2EPN A;  2YTE A;  1TN9 A;  4JI1 E;  2B7T A;  2MDG A;  2CSH A;  3FIG A;  1MEY C;  1YYW A;  5IV8 B;  2NAB A;  2GHF A;  2N8X A;  2EN8 A;  2ENH A;  4WX9 A;  2EOI A;  2YTO A;  2MC6 A;  4WPY A;  4JI3 E;  1X3C A;  1QU6 A;  1IBM E;  4LFC E;  2MKD A;  1HNW E;  2YTQ A;  2YU8 A;  3VYX A;  1BBO A;  4F9A B;  5A6K A;  2UXB E;  5LMN E;  3C4B A;  4JYA E;  1ZR9 A;  1YZ9 A;  1WHQ A;  2EMK A;  1G2F C;  5KL3 A;  1DQ3 A;  2EN7 A;  2V86 A;  5ADZ A;  3OTO E;  2RS7 A;  4DV5 E;  1G2D C;  2M7Q A;  1IBK E;  1FJG E;  1J26 A;  5AE2 A;  4WSP A;  2FGG A;  2UU9 E;  4DMI A;  1PJT A;  5KL5 A;  2NUG A;  2RSI A;  4F6M A;  2LTS A;  2JXP A;  1F2I G;  3AUZ A;  5LL6 R;  5LLQ A;  4JI5 E;  2WBS A;  4B3R E;  2I13 A;  2N3H A;  3EQ1 A;  2EPO A;  3DF6 A;  2DRP A;  1UBD C;  1YSA C;  1HNX E;  2EMW A;  2ZM6 E;  4LU9 A;  2JOX A;  2HHH E;  2LRS A;  4N4R B;  1YYO A;  2LJU A;  2DIX A;  4IJD A;  3HQ1 A;  3BGH A;  4LF8 E;  1T4O A;  2EL6 A;  4F54 A;  4LF7 E;  3T1Y E;  2EOH A;  5KL2 A;  2WBU A;  2JPA A;  2YTN A;  2F8B A;  2ADR A;  2EMG A;  4DR1 E;  2DSY A;  3BID A;  2KHX A;  1B69 A;  2EJ4 A;  2EPX A;  1XNQ E;  2NUE A;  2YTG A;  2UXD E;  2EMC A;  5AE3 A;  4X9J A;  1A1J A;  5LMU E;  2YTI A;  3J7A G;  2YU5 A;  2EE8 A;  2LUP B;  2LBS B;  1AAY A;  4LF4 E;  2E72 A;  5DNY A;  2EN3 A;  2WZO A;  2UUA E;  5AE1 A;  5A6J A;  2H36 X;  2A25 A;  3L00 A;  4ZYE A;  2EZ6 A;  1NCS A;  2N3G A;  5CFF E;  1SFE A;  1YUJ A;  2F4V E;  4DR2 E;  1JK1 A;  4BS9 A;  1HR0 E;  1WXR A;  3OML A;  2JP9 A;  3HPZ A;  2B7V A;  4LF6 E;  2K7I A;  4LF9 E;  2EMY A;  2RPC A;  2V83 A;  4O5G A;  3ADI A;  1HNZ E;  2VF1 A;  4OOG C;  3DJW A;  4BHB A;  2LV2 A;  2HGH A;  4M30 A;  2VQE E;  3MHH C;  2JVA A;  5F3W A;  5IXM B;  1X48 A;  4IS1 C;  4MLV A;  3LLH A;  4P78 A;  4GKJ E;  3IWB A;  1DGC A;  2EOY A;  4WXD A;  4X65 E;  4R2D A;  3TQM A;  3HXL A;  2V85 A;  2EOS A;  4TUG A;  4FK5 C;  4LFB E;  2EPL X;  2M4I A;  3HPS A;  2YZT A;  2LVH A;  4M9V C;  2L6M A;  4B3M E;  1A1K A;  1WJP A;  4B3S E;  2MDR A;  1N36 E;  2EPR A;  2DGC A;  2UXC E;  3EPK A;  4Q35 B;  4BCA A;  4DR4 E;  4BHC A;  1WRJ A;  4LTY A;  2BBG A;  4DV2 E;  1PJQ A;  1PKP A;  2FV4 B;  2DMY A;  1EH7 A;  1IQS A;  1EH8 A;  4KWY A;  5BR8 E;  3VYY A;  4BMJ A;  4AQY E;  2EM3 A;  2L8T A;  2E5L E;  2EMH A;  2EM6 A;  4X62 E;  1X6E A;  2EQ3 A;  4K0K E;  4RHB B;  1RMD A;  2ELZ A;  3RMP A;  4J8Z A;  1T38 A;  1X47 A;  2IHR 1;  4MLQ A;  2L33 A;  1YFH A;  4DUZ E;  4JI8 E;  5A6A A;  5IT9 C;  1YUI A;  1TF3 A;  2D9H A;  2EOE A;  2I9I A;  2EMZ A;  1XMO E;  4WFT A;  4WYQ B;  3C4T A;  1EKZ A;  2R76 A;  2EL5 A;  3M99 B;  1T4L B;  2VRD A;  1T4N A;  2LTR A;  3IWD A;  1PJS A;  1EH6 A;  2M9A A;  3MSW A;  5A2Q C;  2RSM A;  2MC5 A;  2EN6 A;  1KYQ A;  2JYA A;  3EPJ A;  2MKN A;  2EOO A;  3EPL A;  2EM7 A;  2EPP A;  1N34 E;  2LCE A;  1Z1B A;  4DR7 E;  2HC5 A;  1ZBT A;  1N32 E;  1GQE A;  2EMA A;  3AV0 A;  2EP3 A;  1O0W A;  4X8W A;  4F2J C;  2EOF A;  2EMI A;  2LUQ A;  2EMF A;  3KZY A;  2V88 A;  2LO3 A;  3KWR A;  4ZYH A;  4X66 E;  4M0V A;  4O43 A;  4B3T E;  4NXM E;  1YPN A;  2EN1 A;  4DV4 E;  2CTD A;  2V89 A;  2EML A;  4P7D A;  4DV6 E;  4R03 A;  2L3C A;  1PDA A;  5IWA E;  2L3J A;  2JY9 A;  1P47 A;  4L5N C;  2JOB A;  1A1L A;  2NA2 A;  5TSE A;  4NZV A;  2BB8 A;  4DV7 E;  2EQ0 A;  2EM9 A;  2ODR C;  2V87 A;  3C6K A;  3ADG A;  2EM5 A;  1ZU1 A;  1KJK A;  4R2R A;  4JV5 E;  1LLM C;  2JR1 A;  2K4V A;  4DR6 E;  2EWL A;  4LFA E;  2YTJ A;  3JTZ A;  1ZAA C;  4DR3 E;  4BC7 A;  2EL4 A;  2FTX B;  4R2C A;  4YHH E;  4GKK E;  1XNR E;  3VHT B;  3ADJ A;  4BC9 A;  2WCC 3;  2LMZ A;  3H09 A;  2EOQ A;  1XMQ E;  1X49 A;  5KL4 A;  2EM2 A;  2NUF A;  2M1S A;  4R2P A;  4DR5 E;  4JI4 E;  1SR9 A;  4DKK A;  2JWO A;  2YWQ A;  2YTD A;  1DI2 A;  2EPK X;  3MHS C;  1AH5 A;  2EPA A;  3THN A;  4DUY E;  1X6F A;  3BBG A; 
#chains in the Genus database with same CATH homology
 4R2S A;  2LT7 A;  1B69 A;  2EMX A;  4GZN C;  2EJ4 A;  2EN4 A;  2EPX A;  4WSG A;  4R2Q A;  3UK3 C;  2YTG A;  2EMC A;  4X9J A;  1A1J A;  2YTI A;  1TF3 A;  2YU5 A;  1A1I A;  2D9H A;  1YUI A;  1TF6 A;  2ELY A;  2EOE A;  2EE8 A;  2EMZ A;  4F6N A;  1AAY A;  1X5W A;  2E72 A;  2EN2 A;  2WBT A;  2EN3 A;  2EOZ A;  2A25 A;  2EOM A;  2EL5 A;  3M99 B;  1NCS A;  2VRD A;  4R2A A;  2EPU A;  1YUJ A;  1JK1 A;  2EPC A;  2DMI A;  2GLI A;  2M9A A;  2JP9 A;  2CT1 A;  2YSO A;  1BB8 A;  1JK2 A;  1A1F A;  2EN6 A;  2EMY A;  2RPC A;  2YTE A;  1TN9 A;  2MDG A;  3EPJ A;  2CSH A;  1MEY C;  2MKN A;  2YRH A;  2NAB A;  2EOO A;  3EPL A;  2EM7 A;  2EPP A;  2GHF A;  2LCE A;  1Z1B A;  2EN8 A;  2ENH A;  2EOI A;  2YTO A;  2EMA A;  1X3C A;  2LV2 A;  2EM0 A;  2HGH A;  2ENC A;  2EP3 A;  3MHH C;  2MKD A;  4F2J C;  2YTQ A;  2EOF A;  2EMI A;  2YU8 A;  1BBO A;  2EMF A;  2LO3 A;  4IS1 C;  2EM8 A;  1ZR9 A;  2EN1 A;  2EMK A;  2CTD A;  2YTF A;  1G2F C;  2EML A;  1DGC A;  5KL3 A;  2EOY A;  1X6H A;  2EN7 A;  4R2D A;  3EPH A;  2EOS A;  2ENA A;  5KL6 A;  1G2D C;  4FK5 C;  2EOJ A;  2YRM A;  2LVH A;  4M9V C;  1P47 A;  2YSP A;  1A1L A;  1A1K A;  2BB8 A;  1WJP A;  2EM9 A;  2EQ0 A;  2DLQ A;  2EQ1 A;  5KL5 A;  2EM5 A;  2EPR A;  1ZU1 A;  2DGC A;  2RSI A;  3EPK A;  4F6M A;  1A1G A;  1KJK A;  1F2I G;  4R2R A;  2EMB A;  1LLM C;  2WBS A;  2I13 A;  2YTJ A;  1ZAA C;  5KL7 A;  2EM4 A;  2EL4 A;  2DRP A;  1UBD C;  1YSA C;  4R2C A;  2YTP A;  2EPZ A;  2EMW A;  2R1F A;  2EOX A;  3VHT B;  2WCC 3;  1A1H A;  2EM3 A;  2EOQ A;  2DLK A;  2EMH A;  2EM6 A;  4IJD A;  5KL4 A;  2EM2 A;  2EL6 A;  1X6E A;  2EQ3 A;  4R2P A;  2EOH A;  4R2E A;  5KL2 A;  2WBU A;  2JPA A;  2YTD A;  2YTN A;  1RMD A;  2ELZ A;  2ADR A;  2YRK A;  2EMG A;  3MHS C;  2PRT A;  2EPA A;  2EOR A;  2J7J A;  1UN6 B;  1X6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...