2GLIA

Five-finger gli/dna complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
b'ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*TP*CP*GP*TP*CP*TP*TP*GP*GP*GP*TP*GP*GP*TP*C
publication title Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 39
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 1993-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA05
4IJDA 2EM9A 2EMGA 4FK5C 2EN3A 2EMBA 2EM3A 3MHHC 5KL4A 2EP3A 2EL4A 1TF6A 2EM6A 2EOXA 1TF3A 2DGCA 2EMIA 2YTJA 2EN1A 2YTPA 2BB8A 1TN9A 1Z1BA 2EM0A 4R2PA 4IS1C 2EN4A 1A1GA 2EM7A 5KL5A 1UN6B 2EMYA 2LO3A 2EQ0A 2R1FA 2GLIA 4R2DA 2ENAA 2WCC3 2EMLA 1A1FA 4F6MA 1DGCA 2EOEA 2EL6A 2YTDA 1X5WA 2YTQA 4R2EA 2EORA 2RSIA 2EN8A 2LT7A 2YTEA 1X6HA 4GZNC 1A1HA 2EPUA 2D9HA 1MEYC 2EPRA 2EMKA 2JP9A 1A1KA 2EN6A 2YSPA 2ENCA 2EPZA 1BB8A 2YTFA 2YRMA 4R2QA 2M9AA 4R2AA 2WBUA 2EPPA 1X6EA 4F6NA 1YUJA 4R2CA 1NCSA 2YTIA 2EN7A 2EOJA 3EPJA 2EM4A 3EPKA 2EQ1A 2YTNA 1YSAC 2LCEA 2EMAA 4R2SA 1WJPA 2EPCA 2EOYA 2EMHA 2YSOA 3VHTB 2YU5A 2I13A 2EOHA 1RMDA 2EMXA 2EPXA 2EMFA 1AAYA 3MHSC 2EMWA 2ELZA 2HGHA 2WBSA 2YRHA 2A25A 1X6FA 2EJ4A 5KL6A 1A1LA 1UBDC 1ZU1A 4X9JA 4F2JC 1B69A 2CT1A 1F2IG 1A1IA 2EM8A 2CTDA 3M99B 2RPCA 2EM2A 2ADRA 2EE8A 2DMIA 2ENHA 2EOOA 2EPAA 1A1JA 2EOQA 3UK3C 1YUIA 4R2RA 1BBOA 2YRKA 5KL3A 2WBTA 2EOIA 2YTOA 2NABA 2EOFA 2EOZA 2VRDA 3EPLA 2MKDA 2PRTA 3EPHA 1P47A 2E72A 2EN2A 1G2FC 2MKNA 2LVHA 5KL2A 2LV2A 2EMZA 2EOSA 2GHFA 1JK1A 1JK2A 2J7JA 2EMCA 1ZR9A 2EOMA 1KJKA 1X3CA 4WSGA 2EM5A 2EL5A 2YU8A 1LLMC 2DRPA 2DLKA 2YTGA 1G2DC 2JPAA 2EQ3A 4M9VC 2CSHA 2ELYA 1ZAAC 2DLQA 2MDGA 5KL7A
chains in the Genus database with same CATH superfamily
1I94E 2RSMA 2N3GA 4X65E 2DSYA 2LUPB 2EL4A 2NUFA 4B3RE 2M4IA 1XNQE 2EOXA 4JI1E 3VYXA 2YTJA 3BF2A 2LJHA 1Z1BA 2EM0A 4KHPE 4JYAE 1A1GA 4NZVA 3JTZA 3C4TA 2RQLA 2V87A 3ZOQB 4DMIA 1EH8A 2EL6A 4LFBE 4B3TE 1SR9A 2IHR1 2JOXA 3RMPA 4HEIA 1IBLE 4DV5E 2UU9E 3QG5C 2L92A 3AUZA 4MLVA 2EPUA 2D9HA 3T1YE 2BBGA 2DIXA 2EN6A 2YSPA 2YZTA 3J81C 2VQFE 2ZM6E 4R2QA 2M9AA 4O4KA 4N4RB 1UILA 2EPPA 1X6EA 5A6JA 1YUJA 2YTIA 4BMJA 1ZBTA 3HXLA 5ADZA 3EPJA 2E1MA 2LE2A 2EMAA 1WJPA 2F8BA 2YU5A 3THNA 2EOHA 2EMXA 2YWQA 2EPNA 1N32E 2HGHA 4WYQB 1WHQA 2YRHA 4LF5E 4F2JC 2EPLX 1PJQA 3VK6A 1B69A 3DJWA 2L33A 1UHZA 3KZYA 4BS9A 2RPCA 3J7AG 2EM2A 4DKKA 2EPAA 3C4BA 1PJSA 2VE7C 3AV0A 4JV5E 2CPNA 1QU6A 2WBTA 2YTOA 1T4LB 2EOFA 2VRDA 2MKDA 4TUIA 3EPHA 1P47A 4LF7E 3HPZA 1G2FC 2LVHA 5KL2A 2EMZA 4LF4E 4DR4E 4JI0E 2HJJA 1ZR9A 1YYKA 4O43A 2YPNA 2YU8A 1XMQE 2L2KB 1G2DC 3T1HE 4R8OA 2EQ3A 2VQEE 4M9VC 2L3JA 2DLQA 2MDGA 3J80C 1HNWE 2EN3A 3KWRA 2RS7A 5KL4A 4Q35B 4DUYE 4LFAE 1TF3A 2EMIA 1MGTA 4X64E 2YTPA 4WPYA 4WFTA 4DV7E 5AE2A 2LMZA 2EQ0A 3C6KA 2GLIA 2ENAA 1GTKA 1KYQA 3FIGA 5A6BA 5F3WA 1NEIA 2YTQA 2JR1A 4F9CB 5AE3A 2EN8A 5T6JA 2B3TB 2LT7A 3ADLA 1X6HA 1GZ6A 4K0KE 3P1XA 2EPOA 2JP9A 1A1KA 2ENCA 1WRJA 2E5LE 4GKJE 4DV1E 2NA2A 5FLXC 4F6NA 1XMOE 4GKKE 4DV3E 1XNRE 2JOBA 1YSAC 2LCEA 5IT9C 4R2SA 1AH5A 1PDAA 2EWLA 2V85A 3VHTB 1N36E 1RMDA 2EPXA 2EMFA 2HC5A 2FV4B 4JI6E 2ELYA 4BBYA 2EJ4A 1A1LA 2MC5A 4X9JA 4TUGA 1T4OA 2L8TA 4YY3E 4L8NA 1A1IA 2JXPA 3M99B 2UXDE 3MSWA 1WHNA 5AE1A 5A2QC 2ENHA 1A1JA 4RHBB 2EOQA 4I8OA 5KL3A 4M30A 1HR0E 1YYWA 2EOIA 1T39A 2K4VA 3BGHA 4NXNE 4ZYHA 3EPLA 2FTXB 2J7JA 2M1SA 2RTXA 4BC7A 4WSGA 1WXRA 4DV6E 1LLMC 2YT4A 5CFFE 4Q28A 2YTGA 2MC6A 4J8ZA 4KWYA 1EH6A 4AQYE 4X62E 5DNYA 5KL7A 2DB2A 4IJDA 2EM9A 1IMUA 2EMBA 2EM3A 2KONA 3BBGA 3H09A 4LTYA 1TF6A 2DGCA 4M0VA 4M2ZA 4LU9A 2BB8A 3J7Yp 1IQOA 2ODRC 4R2PA 2GPIA 2EM7A 4RH8A 5KL5A 1UN6B 2EMYA 4R03A 1L4SA 2R1FA 4R2DA 2WCC3 1FKAE 1A1FA 4F6MA 1DGCA 2B9DA 3DF6A 4B3SE 3HQ1A 4O24A 4R2EA 2EORA 3ECRA 1J26A 3F6HA 2YTEA 1EH7A 1YFHA 2FGGA 1IQSA 1FJGE 1MEYC 2EPRA 2EMKA 2L2MA 2JVAA 1J5EE 4WSPA 2UUCE 3K6QA 1RQ0A 4DV0E 1BB8A 2YTFA 2YRMA 4OOGC 4R2AA 2LTSA 5A6AA 1X47A 2K7IA 4R2CA 1NCSA 4LF9E 3BIDA 2UXBE 2EOJA 2HHHE 2L6MA 1T4NA 4DR2E 4LF6E 2EMHA 2I13A 3OTOE 3MHSC 5AC5A 2F4VE 2ELZA 4WXCA 2NUEA 4KZSA 2A25A 1X6FA 5KL6A 1UBDC 1ZU1A 2N3HA 5LMUE 4MLQA 1SFEA 2CT1A 4JI4E 1O0WA 2V8QB 2EM8A 2B7TA 2L2NA 2G7HA 2H36X 5LLQA 2LUQA 2ADRA 3IWBA 2DMIA 3F6GA 2EOOA 4ZYGA 3HTXA 3VYYA 3UK3C 1YUIA 4R2RA 5LL6R 1BBOA 1HNXE 1GQEA 4P78A 2NABA 5A69A 2DMYA 2EOZA 4JI5E 3ADJA 2PRTA 2E72A 5A6KA 2MKNA 2I9IA 4GEQB 2LV2A 4WXDA 1JK2A 2EMCA 2JYAA 1KJKA 2JY9A 2EPKX 2KOUA 2LTRA 4O5GA 4ZYDA 4HTGA 1STUA 2WZOA 3IWDA 5BR8E 2JPAA 2EPMX 2M7QA 2CSHA 2EZ6A 2EMGA 4FK5C 4ZYEA 4DR1E 4LF8E 4L5NC 2Q8UA 3MHHC 1X49A 2EP3A 5IWAE 2NUGA 2N8XA 2EM6A 3OMLA 2V83A 1IBKE 4BHBA 2EN1A 4DV2E 4B3ME 1EKZA 1PJTA 4JI7E 1TN9A 4JI2E 2V86A 4IS1C 2EN4A 4OX9E 4F54A 2LO3A 2JWOA 5A6BD 2EMLA 4WX9A 2EOEA 4X8WA 2YTDA 1X5WA 2RSIA 2LJUA 4GZNC 1A1HA 4DR3E 4JI8E 1IBME 3LLHA 5TSEA 4DR5E 2EPZA 3C6MA 3EQ1A 4DV4E 5AASA 1YZ9A 3KZZA 3ADGA 4BC9A 2R76A 2RS6A 4LFCE 2EN7A 3EPKA 2EM4A 2EQ1A 5IXMB 2YTNA 3ADIA 1PKPA 2KHXA 4DUZE 2EPCA 3THOB 2EOYA 2YSOA 3HPSA 2UUAE 1AAYA 2ODRD 1N33E 2EMWA 4YHHE 2MDRA 2WBSA 4BCAA 1HNZE 5LMNE 1F2IG 4DR7E 2VF1A 2CTDA 1N34E 2B7VA 4P7DA 2L3CA 2EE8A 2UXCE 1DI2A 3LMLA 2YRKA 1YPNA 1T38A 2UUBE 4BHCA 3L00A 3TQMA 1ZBQA 2V88A 1BBGA 2EN2A 2LRSA 2EOSA 2GHFA 4NHRA 1JK1A 4X66E 2EOMA 4F9BB 4F9AB 1DQ3A 4NXME 1X3CA 2EM5A 2EL5A 3JU0A 5AC4A 3JAMC 1YYOA 5IV8B 2DRPA 2DLKA 1QNTA 4DR6E 1X48A 3IWCA 2LBSB 2V89A 1RC7A 4JI3E 2WBUA 1N3GA 1ZAAC
chains in the Genus database with same CATH topology
4IJDA 2EM9A 2EMGA 4FK5C 2EN3A 2EMBA 2EM3A 3MHHC 5KL4A 2EP3A 2EL4A 1TF6A 2EM6A 2EOXA 1TF3A 2DGCA 2EMIA 2YTJA 2EN1A 2YTPA 2BB8A 1TN9A 1Z1BA 2EM0A 4R2PA 4IS1C 2EN4A 1A1GA 2EM7A 5KL5A 1UN6B 2EMYA 2LO3A 2EQ0A 2R1FA 2GLIA 4R2DA 2ENAA 2WCC3 2EMLA 1A1FA 4F6MA 1DGCA 2EOEA 2EL6A 2YTDA 1X5WA 2YTQA 4R2EA 2EORA 2RSIA 2EN8A 2LT7A 2YTEA 1X6HA 4GZNC 1A1HA 2EPUA 2D9HA 1MEYC 2EPRA 2EMKA 2JP9A 1A1KA 2EN6A 2YSPA 2ENCA 2EPZA 1BB8A 2YTFA 2YRMA 4R2QA 2M9AA 4R2AA 2WBUA 2EPPA 1X6EA 4F6NA 1YUJA 4R2CA 1NCSA 2YTIA 2EN7A 2EOJA 3EPJA 2EM4A 3EPKA 2EQ1A 2YTNA 1YSAC 2LCEA 2EMAA 4R2SA 1WJPA 2EPCA 2EOYA 2EMHA 2YSOA 3VHTB 2YU5A 2I13A 2EOHA 1RMDA 2EMXA 2EPXA 2EMFA 1AAYA 3MHSC 2EMWA 2ELZA 2HGHA 2WBSA 2YRHA 2A25A 1X6FA 2EJ4A 5KL6A 1A1LA 1UBDC 1ZU1A 4X9JA 4F2JC 1B69A 2CT1A 1F2IG 1A1IA 2EM8A 2CTDA 3M99B 2RPCA 2EM2A 2ADRA 2EE8A 2DMIA 2ENHA 2EOOA 2EPAA 1A1JA 2EOQA 3UK3C 1YUIA 4R2RA 1BBOA 2YRKA 5KL3A 2WBTA 2EOIA 2YTOA 2NABA 2EOFA 2EOZA 2VRDA 3EPLA 2MKDA 2PRTA 3EPHA 1P47A 2E72A 2EN2A 1G2FC 2MKNA 2LVHA 5KL2A 2LV2A 2EMZA 2EOSA 2GHFA 1JK1A 1JK2A 2J7JA 2EMCA 1ZR9A 2EOMA 1KJKA 1X3CA 4WSGA 2EM5A 2EL5A 2YU8A 1LLMC 2DRPA 2DLKA 2YTGA 1G2DC 2JPAA 2EQ3A 4M9VC 2CSHA 2ELYA 1ZAAC 2DLQA 2MDGA 5KL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  2EM9 A;  2EMG A;  4FK5 C;  2EN3 A;  2EMB A;  2EM3 A;  3MHH C;  5KL4 A;  2EP3 A;  2EL4 A;  1TF6 A;  2EM6 A;  2EOX A;  1TF3 A;  2DGC A;  2EMI A;  2YTJ A;  2EN1 A;  2YTP A;  2BB8 A;  1TN9 A;  1Z1B A;  2EM0 A;  4R2P A;  4IS1 C;  2EN4 A;  1A1G A;  2EM7 A;  5KL5 A;  1UN6 B;  2EMY A;  2LO3 A;  2EQ0 A;  2R1F A;  2GLI A;  4R2D A;  2ENA A;  2WCC 3;  2EML A;  1A1F A;  4F6M A;  1DGC A;  2EOE A;  2EL6 A;  2YTD A;  1X5W A;  2YTQ A;  4R2E A;  2EOR A;  2RSI A;  2EN8 A;  2LT7 A;  2YTE A;  1X6H A;  4GZN C;  1A1H A;  2EPU A;  2D9H A;  1MEY C;  2EPR A;  2EMK A;  2JP9 A;  1A1K A;  2EN6 A;  2YSP A;  2ENC A;  2EPZ A;  1BB8 A;  2YTF A;  2YRM A;  4R2Q A;  2M9A A;  4R2A A;  2WBU A;  2EPP A;  1X6E A;  4F6N A;  1YUJ A;  4R2C A;  1NCS A;  2YTI A;  2EN7 A;  2EOJ A;  3EPJ A;  2EM4 A;  3EPK A;  2EQ1 A;  2YTN A;  1YSA C;  2LCE A;  2EMA A;  4R2S A;  1WJP A;  2EPC A;  2EOY A;  2EMH A;  2YSO A;  3VHT B;  2YU5 A;  2I13 A;  2EOH A;  1RMD A;  2EMX A;  2EPX A;  2EMF A;  1AAY A;  3MHS C;  2EMW A;  2ELZ A;  2HGH A;  2WBS A;  2YRH A;  2A25 A;  1X6F A;  2EJ4 A;  5KL6 A;  1A1L A;  1UBD C;  1ZU1 A;  4X9J A;  4F2J C;  1B69 A;  2CT1 A;  1F2I G;  1A1I A;  2EM8 A;  2CTD A;  3M99 B;  2RPC A;  2EM2 A;  2ADR A;  2EE8 A;  2DMI A;  2ENH A;  2EOO A;  2EPA A;  1A1J A;  2EOQ A;  3UK3 C;  1YUI A;  4R2R A;  1BBO A;  2YRK A;  5KL3 A;  2WBT A;  2EOI A;  2YTO A;  2NAB A;  2EOF A;  2EOZ A;  2VRD A;  3EPL A;  2MKD A;  2PRT A;  3EPH A;  1P47 A;  2E72 A;  2EN2 A;  1G2F C;  2MKN A;  2LVH A;  5KL2 A;  2LV2 A;  2EMZ A;  2EOS A;  2GHF A;  1JK1 A;  1JK2 A;  2J7J A;  2EMC A;  1ZR9 A;  2EOM A;  1KJK A;  1X3C A;  4WSG A;  2EM5 A;  2EL5 A;  2YU8 A;  1LLM C;  2DRP A;  2DLK A;  2YTG A;  1G2D C;  2JPA A;  2EQ3 A;  4M9V C;  2CSH A;  2ELY A;  1ZAA C;  2DLQ A;  2MDG A;  5KL7 A; 
#chains in the Genus database with same CATH topology
 1I94 E;  2RSM A;  2N3G A;  4X65 E;  2DSY A;  2LUP B;  2EL4 A;  2NUF A;  4B3R E;  2M4I A;  1XNQ E;  2EOX A;  4JI1 E;  3VYX A;  2YTJ A;  3BF2 A;  2LJH A;  1Z1B A;  2EM0 A;  4KHP E;  4JYA E;  1A1G A;  4NZV A;  3JTZ A;  3C4T A;  2RQL A;  2V87 A;  3ZOQ B;  4DMI A;  1EH8 A;  2EL6 A;  4LFB E;  4B3T E;  1SR9 A;  2IHR 1;  2JOX A;  3RMP A;  4HEI A;  1IBL E;  4DV5 E;  2UU9 E;  3QG5 C;  2L92 A;  3AUZ A;  4MLV A;  2EPU A;  2D9H A;  3T1Y E;  2BBG A;  2DIX A;  2EN6 A;  2YSP A;  2YZT A;  3J81 C;  2VQF E;  2ZM6 E;  4R2Q A;  2M9A A;  4O4K A;  4N4R B;  1UIL A;  2EPP A;  1X6E A;  5A6J A;  1YUJ A;  2YTI A;  4BMJ A;  1ZBT A;  3HXL A;  5ADZ A;  3EPJ A;  2E1M A;  2LE2 A;  2EMA A;  1WJP A;  2F8B A;  2YU5 A;  3THN A;  2EOH A;  2EMX A;  2YWQ A;  2EPN A;  1N32 E;  2HGH A;  4WYQ B;  1WHQ A;  2YRH A;  4LF5 E;  4F2J C;  2EPL X;  1PJQ A;  3VK6 A;  1B69 A;  3DJW A;  2L33 A;  1UHZ A;  3KZY A;  4BS9 A;  2RPC A;  3J7A G;  2EM2 A;  4DKK A;  2EPA A;  3C4B A;  1PJS A;  2VE7 C;  3AV0 A;  4JV5 E;  2CPN A;  1QU6 A;  2WBT A;  2YTO A;  1T4L B;  2EOF A;  2VRD A;  2MKD A;  4TUI A;  3EPH A;  1P47 A;  4LF7 E;  3HPZ A;  1G2F C;  2LVH A;  5KL2 A;  2EMZ A;  4LF4 E;  4DR4 E;  4JI0 E;  2HJJ A;  1ZR9 A;  1YYK A;  4O43 A;  2YPN A;  2YU8 A;  1XMQ E;  2L2K B;  1G2D C;  3T1H E;  4R8O A;  2EQ3 A;  2VQE E;  4M9V C;  2L3J A;  2DLQ A;  2MDG A;  3J80 C;  1HNW E;  2EN3 A;  3KWR A;  2RS7 A;  5KL4 A;  4Q35 B;  4DUY E;  4LFA E;  1TF3 A;  2EMI A;  1MGT A;  4X64 E;  2YTP A;  4WPY A;  4WFT A;  4DV7 E;  5AE2 A;  2LMZ A;  2EQ0 A;  3C6K A;  2GLI A;  2ENA A;  1GTK A;  1KYQ A;  3FIG A;  5A6B A;  5F3W A;  1NEI A;  2YTQ A;  2JR1 A;  4F9C B;  5AE3 A;  2EN8 A;  5T6J A;  2B3T B;  2LT7 A;  3ADL A;  1X6H A;  1GZ6 A;  4K0K E;  3P1X A;  2EPO A;  2JP9 A;  1A1K A;  2ENC A;  1WRJ A;  2E5L E;  4GKJ E;  4DV1 E;  2NA2 A;  5FLX C;  4F6N A;  1XMO E;  4GKK E;  4DV3 E;  1XNR E;  2JOB A;  1YSA C;  2LCE A;  5IT9 C;  4R2S A;  1AH5 A;  1PDA A;  2EWL A;  2V85 A;  3VHT B;  1N36 E;  1RMD A;  2EPX A;  2EMF A;  2HC5 A;  2FV4 B;  4JI6 E;  2ELY A;  4BBY A;  2EJ4 A;  1A1L A;  2MC5 A;  4X9J A;  4TUG A;  1T4O A;  2L8T A;  4YY3 E;  4L8N A;  1A1I A;  2JXP A;  3M99 B;  2UXD E;  3MSW A;  1WHN A;  5AE1 A;  5A2Q C;  2ENH A;  1A1J A;  4RHB B;  2EOQ A;  4I8O A;  5KL3 A;  4M30 A;  1HR0 E;  1YYW A;  2EOI A;  1T39 A;  2K4V A;  3BGH A;  4NXN E;  4ZYH A;  3EPL A;  2FTX B;  2J7J A;  2M1S A;  2RTX A;  4BC7 A;  4WSG A;  1WXR A;  4DV6 E;  1LLM C;  2YT4 A;  5CFF E;  4Q28 A;  2YTG A;  2MC6 A;  4J8Z A;  4KWY A;  1EH6 A;  4AQY E;  4X62 E;  5DNY A;  5KL7 A;  2DB2 A;  4IJD A;  2EM9 A;  1IMU A;  2EMB A;  2EM3 A;  2KON A;  3BBG A;  3H09 A;  4LTY A;  1TF6 A;  2DGC A;  4M0V A;  4M2Z A;  4LU9 A;  2BB8 A;  3J7Y p;  1IQO A;  2ODR C;  4R2P A;  2GPI A;  2EM7 A;  4RH8 A;  5KL5 A;  1UN6 B;  2EMY A;  4R03 A;  1L4S A;  2R1F A;  4R2D A;  2WCC 3;  1FKA E;  1A1F A;  4F6M A;  1DGC A;  2B9D A;  3DF6 A;  4B3S E;  3HQ1 A;  4O24 A;  4R2E A;  2EOR A;  3ECR A;  1J26 A;  3F6H A;  2YTE A;  1EH7 A;  1YFH A;  2FGG A;  1IQS A;  1FJG E;  1MEY C;  2EPR A;  2EMK A;  2L2M A;  2JVA A;  1J5E E;  4WSP A;  2UUC E;  3K6Q A;  1RQ0 A;  4DV0 E;  1BB8 A;  2YTF A;  2YRM A;  4OOG C;  4R2A A;  2LTS A;  5A6A A;  1X47 A;  2K7I A;  4R2C A;  1NCS A;  4LF9 E;  3BID A;  2UXB E;  2EOJ A;  2HHH E;  2L6M A;  1T4N A;  4DR2 E;  4LF6 E;  2EMH A;  2I13 A;  3OTO E;  3MHS C;  5AC5 A;  2F4V E;  2ELZ A;  4WXC A;  2NUE A;  4KZS A;  2A25 A;  1X6F A;  5KL6 A;  1UBD C;  1ZU1 A;  2N3H A;  5LMU E;  4MLQ A;  1SFE A;  2CT1 A;  4JI4 E;  1O0W A;  2V8Q B;  2EM8 A;  2B7T A;  2L2N A;  2G7H A;  2H36 X;  5LLQ A;  2LUQ A;  2ADR A;  3IWB A;  2DMI A;  3F6G A;  2EOO A;  4ZYG A;  3HTX A;  3VYY A;  3UK3 C;  1YUI A;  4R2R A;  5LL6 R;  1BBO A;  1HNX E;  1GQE A;  4P78 A;  2NAB A;  5A69 A;  2DMY A;  2EOZ A;  4JI5 E;  3ADJ A;  2PRT A;  2E72 A;  5A6K A;  2MKN A;  2I9I A;  4GEQ B;  2LV2 A;  4WXD A;  1JK2 A;  2EMC A;  2JYA A;  1KJK A;  2JY9 A;  2EPK X;  2KOU A;  2LTR A;  4O5G A;  4ZYD A;  4HTG A;  1STU A;  2WZO A;  3IWD A;  5BR8 E;  2JPA A;  2EPM X;  2M7Q A;  2CSH A;  2EZ6 A;  2EMG A;  4FK5 C;  4ZYE A;  4DR1 E;  4LF8 E;  4L5N C;  2Q8U A;  3MHH C;  1X49 A;  2EP3 A;  5IWA E;  2NUG A;  2N8X A;  2EM6 A;  3OML A;  2V83 A;  1IBK E;  4BHB A;  2EN1 A;  4DV2 E;  4B3M E;  1EKZ A;  1PJT A;  4JI7 E;  1TN9 A;  4JI2 E;  2V86 A;  4IS1 C;  2EN4 A;  4OX9 E;  4F54 A;  2LO3 A;  2JWO A;  5A6B D;  2EML A;  4WX9 A;  2EOE A;  4X8W A;  2YTD A;  1X5W A;  2RSI A;  2LJU A;  4GZN C;  1A1H A;  4DR3 E;  4JI8 E;  1IBM E;  3LLH A;  5TSE A;  4DR5 E;  2EPZ A;  3C6M A;  3EQ1 A;  4DV4 E;  5AAS A;  1YZ9 A;  3KZZ A;  3ADG A;  4BC9 A;  2R76 A;  2RS6 A;  4LFC E;  2EN7 A;  3EPK A;  2EM4 A;  2EQ1 A;  5IXM B;  2YTN A;  3ADI A;  1PKP A;  2KHX A;  4DUZ E;  2EPC A;  3THO B;  2EOY A;  2YSO A;  3HPS A;  2UUA E;  1AAY A;  2ODR D;  1N33 E;  2EMW A;  4YHH E;  2MDR A;  2WBS A;  4BCA A;  1HNZ E;  5LMN E;  1F2I G;  4DR7 E;  2VF1 A;  2CTD A;  1N34 E;  2B7V A;  4P7D A;  2L3C A;  2EE8 A;  2UXC E;  1DI2 A;  3LML A;  2YRK A;  1YPN A;  1T38 A;  2UUB E;  4BHC A;  3L00 A;  3TQM A;  1ZBQ A;  2V88 A;  1BBG A;  2EN2 A;  2LRS A;  2EOS A;  2GHF A;  4NHR A;  1JK1 A;  4X66 E;  2EOM A;  4F9B B;  4F9A B;  1DQ3 A;  4NXM E;  1X3C A;  2EM5 A;  2EL5 A;  3JU0 A;  5AC4 A;  3JAM C;  1YYO A;  5IV8 B;  2DRP A;  2DLK A;  1QNT A;  4DR6 E;  1X48 A;  3IWC A;  2LBS B;  2V89 A;  1RC7 A;  4JI3 E;  2WBU A;  1N3G A;  1ZAA C; 
#chains in the Genus database with same CATH homology
 4IJD A;  2EM9 A;  2EMG A;  4FK5 C;  2EN3 A;  2EMB A;  2EM3 A;  3MHH C;  5KL4 A;  2EP3 A;  2EL4 A;  1TF6 A;  2EM6 A;  2EOX A;  1TF3 A;  2DGC A;  2EMI A;  2YTJ A;  2EN1 A;  2YTP A;  2BB8 A;  1TN9 A;  1Z1B A;  2EM0 A;  4R2P A;  4IS1 C;  2EN4 A;  1A1G A;  2EM7 A;  5KL5 A;  1UN6 B;  2EMY A;  2LO3 A;  2EQ0 A;  2R1F A;  2GLI A;  4R2D A;  2ENA A;  2WCC 3;  2EML A;  1A1F A;  4F6M A;  1DGC A;  2EOE A;  2EL6 A;  2YTD A;  1X5W A;  2YTQ A;  4R2E A;  2EOR A;  2RSI A;  2EN8 A;  2LT7 A;  2YTE A;  1X6H A;  4GZN C;  1A1H A;  2EPU A;  2D9H A;  1MEY C;  2EPR A;  2EMK A;  2JP9 A;  1A1K A;  2EN6 A;  2YSP A;  2ENC A;  2EPZ A;  1BB8 A;  2YTF A;  2YRM A;  4R2Q A;  2M9A A;  4R2A A;  2WBU A;  2EPP A;  1X6E A;  4F6N A;  1YUJ A;  4R2C A;  1NCS A;  2YTI A;  2EN7 A;  2EOJ A;  3EPJ A;  2EM4 A;  3EPK A;  2EQ1 A;  2YTN A;  1YSA C;  2LCE A;  2EMA A;  4R2S A;  1WJP A;  2EPC A;  2EOY A;  2EMH A;  2YSO A;  3VHT B;  2YU5 A;  2I13 A;  2EOH A;  1RMD A;  2EMX A;  2EPX A;  2EMF A;  1AAY A;  3MHS C;  2EMW A;  2ELZ A;  2HGH A;  2WBS A;  2YRH A;  2A25 A;  1X6F A;  2EJ4 A;  5KL6 A;  1A1L A;  1UBD C;  1ZU1 A;  4X9J A;  4F2J C;  1B69 A;  2CT1 A;  1F2I G;  1A1I A;  2EM8 A;  2CTD A;  3M99 B;  2RPC A;  2EM2 A;  2ADR A;  2EE8 A;  2DMI A;  2ENH A;  2EOO A;  2EPA A;  1A1J A;  2EOQ A;  3UK3 C;  1YUI A;  4R2R A;  1BBO A;  2YRK A;  5KL3 A;  2WBT A;  2EOI A;  2YTO A;  2NAB A;  2EOF A;  2EOZ A;  2VRD A;  3EPL A;  2MKD A;  2PRT A;  3EPH A;  1P47 A;  2E72 A;  2EN2 A;  1G2F C;  2MKN A;  2LVH A;  5KL2 A;  2LV2 A;  2EMZ A;  2EOS A;  2GHF A;  1JK1 A;  1JK2 A;  2J7J A;  2EMC A;  1ZR9 A;  2EOM A;  1KJK A;  1X3C A;  4WSG A;  2EM5 A;  2EL5 A;  2YU8 A;  1LLM C;  2DRP A;  2DLK A;  2YTG A;  1G2D C;  2JPA A;  2EQ3 A;  4M9V C;  2CSH A;  2ELY A;  1ZAA C;  2DLQ A;  2MDG A;  5KL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...