2GLIA

Five-finger gli/dna complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*TP*TP*CP*GP*TP*CP*TP*TP*GP*GP*GP*TP*GP*GP*TP*C
total genus 39
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 1993-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2gliA05
1WJPA 1G2FC 2EPCA 4R2CA 4R2SA 2YRHA 2I13A 4R2DA 1P47A 2EMKA 2YTIA 2A25A 3UK3C 1ZU1A 2CT1A 2BB8A 2CTDA 2YTFA 2EMFA 3MHHC 2DMIA 2EPUA 4F6MA 2ELZA 5KL5A 1X5WA 2JPAA 1A1KA 2EMZA 2EM4A 1A1GA 1YSAC 5KL2A 2YTOA 1JK1A 1MEYC 1ZAAC 3VHTB 2YTEA 2YRKA 2EMAA 2EN6A 1BBOA 2EOOA 2WCC3 2YSPA 1A1IA 1BB8A 1LLMC 2HGHA 2RPCA 2EMCA 4R2PA 1X3CA 2EN3A 1JK2A 2ADRA 3MHSC 2DLQA 4GZNC 2J7JA 2GHFA 1A1HA 2LV2A 2EOEA 2EMYA 2EPAA 2LT7A 2EMLA 1ZR9A 2EE8A 1YUJA 1NCSA 2DRPA 2EN1A 2EOSA 2EMGA 2EMWA 1TF6A 1A1LA 5KL6A 2YRMA 1B69A 5KL3A 2EOXA 1TN9A 2YTNA 2EPXA 4M9VC 2R1FA 2YTDA 1X6EA 2MKNA 2EMXA 2M9AA 2ELYA 2D9HA 2LCEA 2YTJA 1TF3A 3EPLA 1A1JA 2MDGA 2YU5A 4FK5C 1RMDA 2EOMA 2WBSA 1F2IG 1A1FA 2DGCA 2EMHA 2EQ1A 4F2JC 1UN6B 4F6NA 2EM9A 1YUIA 2EOZA 1DGCA 4R2AA 2PRTA 2CSHA 2ENCA 2YTGA 2ENAA 1X6HA 2EMIA 1AAYA 2LO3A 2GLIA 2DLKA 2VRDA 4IS1C 3EPJA 4IJDA 2EM2A 2YTPA 4X9JA 2EM3A 2EP3A 2EN2A 2EOHA 2RSIA 1Z1BA 1KJKA 2EPZA 2EOQA 2YU8A 5KL7A 2LVHA 3EPKA 2EOYA 2EPRA 2YTQA 2EPPA 2EOFA 1G2DC 2EOIA 3M99B 2EJ4A 2NABA 2EQ0A 2EL6A 1X6FA 2E72A 2EN7A 4R2RA 2EORA 2EQ3A 2EM0A 4WSGA 4R2QA 1UBDC 2JP9A 2EL5A 2EOJA 2WBUA 2EM7A 2MKDA 2EL4A 2EN8A 2EM6A 2WBTA 3EPHA 2EM5A 2EMBA 2EM8A 4R2EA 5KL4A 2YSOA 2ENHA 2EN4A
chains in the Genus database with same CATH superfamily
2M7QA 2YZTA 2EPOA 4DKKA 5AE2A 3C6KA 2N8XA 4R2SA 3BIDA 2WZOA 2ODRD 4KWYA 1J5EE 2YTIA 2VQFE 1ZU1A 2V8QB 2CTDA 2DMIA 5KL5A 4X64E 5IWAE 1A1KA 4Q35B 5KL2A 2YTOA 4M0VA 4BHBA 1JK1A 4B3RE 3VHTB 4K0KE 3OMLA 2YRKA 2EMAA 1BBOA 2WCC3 1SR9A 2JY9A 4WXDA 2EMCA 2YT4A 4KZSA 2UXBE 4LF6E 1N33E 4R2PA 1N36E 1JK2A 3ECRA 2J7JA 2FV4B 2EMLA 1ZR9A 3ADLA 4DV0E 2I9IA 2RS7A 3J81C 2E5LE 2EN1A 4Q28A 1N34E 2EMGA 4KHPE 1TF6A 1PKPA 2K7IA 4LF5E 5FLXC 4M9VC 2DIXA 2M9AA 2ELYA 4DR6E 2FTXB 2HJJA 2JYAA 4R03A 2WBSA 4DMIA 4BC9A 1UN6B 4JI3E 5AASA 2DB2A 2PRTA 2CSHA 2ENCA 2YTGA 2EMIA 2LO3A 2CPNA 4AQYE 1YYWA 3HPZA 3AUZA 4IS1C 3EPJA 2YTPA 1XNQE 1WHQA 5A6KA 1X49A 2EP3A 2EOHA 1Z1BA 4BS9A 2VE7C 2YU8A 5KL7A 3HPSA 4GKJE 3EPKA 4LF9E 4MLVA 4GEQB 2V85A 3F6GA 2EPRA 2YTQA 2EOFA 2EOIA 2RQLA 1QU6A 2HC5A 1YZ9A 2EWLA 5T6JA 1AH5A 1GQEA 4ZYDA 2UUBE 4OOGC 4X62E 5LLQA 2EN8A 2WBTA 2LUPB 3ADGA 5LL6R 3JTZA 3EQ1A 4N4RB 3BGHA 4NHRA 4M2ZA 2EN4A 3IWBA 1RQ0A 2K4VA 1G2FC 2YRHA 2V86A 3F6HA 2EMKA 5AE3A 2YTFA 3MHHC 2EZ6A 2V83A 1GZ6A 2V88A 1MEYC 1KYQA 1UHZA 5AE1A 1T39A 2L3CA 2EOOA 1A1IA 1BB8A 4BBYA 1LLMC 2DMYA 4LF8E 4BHCA 1O0WA 3ADIA 3P1XA 4O43A 2DLQA 2B7VA 4DR5E 2EOEA 5TSEA 1WXRA 1YUJA 2DRPA 2F4VE 1IQSA 2KOUA 2UXDE 4DUZE 5KL3A 1TN9A 2YTNA 2EPXA 2L2NA 3C4TA 4F9AB 2L33A 2R1FA 1A1JA 3RMPA 1RMDA 1A1FA 1F2IG 2DGCA 2EQ1A 2RTXA 2YWQA 2N3GA 3DJWA 1PJSA 4O4KA 4F2JC 4F6NA 3HXLA 1UILA 2EOZA 4YY3E 1YUIA 2YPNA 3IWDA 2BBGA 4DR2E 2ENAA 2LJHA 3TQMA 2DLKA 2EPMX 3J7AG 4JYAE 5A6AA 2NUEA 4DV5E 4IJDA 2EM2A 4DV4E 4DR3E 1MGTA 3VK6A 2UXCE 5AC5A 2EPZA 2ZM6E 1YFHA 4L5NC 1T4NA 5A6BA 3HQ1A 2F8BA 2EOYA 2L2KB 2LMZA 3T1YE 4NXME 2RS6A 4R8OA 4F9BB 4JI8E 2NABA 4ZYGA 1N3GA 2EQ0A 1NEIA 1IBME 4DR4E 4R2RA 4TUGA 2EORA 2GPIA 2EM0A 4WSGA 4R2QA 5A6JA 2EOJA 2L8TA 2WBUA 2MKDA 5LMUE 3THNA 2H36X 2EM6A 2RSMA 2EM5A 2KHXA 2MC5A 1I94E 2LTRA 2YSOA 3K6QA 2ENHA 4DV2E 4BCAA 4WX9A 2EPCA 4WXCA 4R2CA 2I13A 2B3TB 1HNZE 4DR7E 4R2DA 1P47A 2EMFA 4GKKE 2EPUA 4NXNE 4ZYEA 2ELZA 4NZVA 2KONA 4YHHE 1X5WA 2JPAA 2Q8UA 1PDAA 1YSAC 4O5GA 3ZOQB 1ZAAC 2YTEA 3AV0A 1EKZA 1FJGE 2UUCE 1QNTA 3J7Yp 1STUA 1X3CA 1SFEA 3MHSC 2IHR1 1YPNA 2GHFA 5ADZA 3VYYA 4DV6E 2LV2A 2EMYA 2EPAA 2LTSA 2EMWA 3BF2A 3HTXA 2B7TA 4DV1E 3QG5C 2YRMA 5A6BD 2MC6A 3THOB 1XNRE 2FGGA 2ODRC 2VQEE 1X6EA 1HR0E 2E1MA 4B3TE 2LCEA 2LUQA 3LLHA 2MDGA 1DQ3A 4FK5C 2EOMA 2UUAE 1IBLE 1L4SA 2EM9A 2LBSB 4F54A 1X6HA 1AAYA 3KWRA 2GLIA 1J26A 4ZYHA 4B3ME 5A69A 5A2QC 4RHBB 4HTGA 4X9JA 3MSWA 2EN2A 4WPYA 1PJTA 4DV7E 1T4LB 2EOQA 4L8NA 4X66E 4JI2E 4LF4E 4P78A 2N3HA 2JOXA 1X47A 2JXPA 3J80C 2EPPA 4WFTA 2NA2A 4MLQA 2DSYA 2VF1A 2L6MA 2M1SA 2E72A 2MDRA 4LFBE 5F3WA 4M30A 4JI5E 4WSPA 1WRJA 1UBDC 4JV5E 2JP9A 5AC4A 3EPHA 2EMBA 4LFCE 3BBGA 4DR1E 4LFAE 4J8ZA 2EM8A 2LJUA 4GZNC 2L2MA 1WJPA 5IT9C 4X65E 2JR1A 1EH8A 4F9CB 1IMUA 3JU0A 4B3SE 2A25A 3UK3C 2CT1A 4JI7E 2BB8A 3LMLA 1XMOE 4F6MA 3L00A 4JI6E 2EMZA 2EM4A 4O24A 1A1GA 2EPKX 1HNXE 2EN6A 4BMJA 3JAMC 5IV8B 2YSPA 1IQOA 3ADJA 4I8OA 2L92A 2RPCA 2HGHA 2NUGA 2NUFA 1YYKA 5LMNE 4P7DA 2EN3A 1XMQE 2ADRA 2EPLX 2EPNA 1PJQA 1A1HA 2LT7A 2EE8A 1NCSA 2L3JA 4JI0E 2UU9E 2EOSA 5IXMB 1A1LA 2JVAA 5KL6A 1B69A 1N32E 3VYXA 2EOXA 4OX9E 4LTYA 3IWCA 2JWOA 2YTDA 2MKNA 2EMXA 1RC7A 2D9HA 3H09A 2YTJA 5DNYA 3EPLA 1TF3A 2YU5A 2EMHA 4LU9A 1DGCA 4R2AA 4RH8A 4TUIA 3DF6A 5KL4A 2V89A 1BBGA 2B9DA 2JOBA 3C6MA 1YYOA 2VRDA 2M4IA 4LF7E 1GTKA 3OTOE 1FKAE 2LE2A 2EM3A 3KZYA 2RSIA 1EH6A 1KJKA 2LVHA 5BR8E 4JI1E 2HHHE 3C4BA 4DV3E 5CFFE 1WHNA 2R76A 1G2DC 3M99B 2EJ4A 1EH7A 1X48A 3T1HE 2EL6A 1X6FA 4JI4E 2EN7A 1DI2A 1HNWE 2EQ3A 2V87A 2LRSA 4WYQB 1T4OA 2G7HA 3FIGA 4BC7A 2EL5A 1T38A 2EM7A 2EL4A 1ZBTA 4DUYE 3KZZA 4R2EA 1ZBQA 4X8WA 1IBKE 4HEIA
chains in the Genus database with same CATH topology
1WJPA 1G2FC 2EPCA 4R2CA 4R2SA 2YRHA 2I13A 4R2DA 1P47A 2EMKA 2YTIA 2A25A 3UK3C 1ZU1A 2CT1A 2BB8A 2CTDA 2YTFA 2EMFA 3MHHC 2DMIA 2EPUA 4F6MA 2ELZA 5KL5A 1X5WA 2JPAA 1A1KA 2EMZA 2EM4A 1A1GA 1YSAC 5KL2A 2YTOA 1JK1A 1MEYC 1ZAAC 3VHTB 2YTEA 2YRKA 2EMAA 2EN6A 1BBOA 2EOOA 2WCC3 2YSPA 1A1IA 1BB8A 1LLMC 2HGHA 2RPCA 2EMCA 4R2PA 1X3CA 2EN3A 1JK2A 2ADRA 3MHSC 2DLQA 4GZNC 2J7JA 2GHFA 1A1HA 2LV2A 2EOEA 2EMYA 2EPAA 2LT7A 2EMLA 1ZR9A 2EE8A 1YUJA 1NCSA 2DRPA 2EN1A 2EOSA 2EMGA 2EMWA 1TF6A 1A1LA 5KL6A 2YRMA 1B69A 5KL3A 2EOXA 1TN9A 2YTNA 2EPXA 4M9VC 2R1FA 2YTDA 1X6EA 2MKNA 2EMXA 2M9AA 2ELYA 2D9HA 2LCEA 2YTJA 1TF3A 3EPLA 1A1JA 2MDGA 2YU5A 4FK5C 1RMDA 2EOMA 2WBSA 1F2IG 1A1FA 2DGCA 2EMHA 2EQ1A 4F2JC 1UN6B 4F6NA 2EM9A 1YUIA 2EOZA 1DGCA 4R2AA 2PRTA 2CSHA 2ENCA 2YTGA 2ENAA 1X6HA 2EMIA 1AAYA 2LO3A 2GLIA 2DLKA 2VRDA 4IS1C 3EPJA 4IJDA 2EM2A 2YTPA 4X9JA 2EM3A 2EP3A 2EN2A 2EOHA 2RSIA 1Z1BA 1KJKA 2EPZA 2EOQA 2YU8A 5KL7A 2LVHA 3EPKA 2EOYA 2EPRA 2YTQA 2EPPA 2EOFA 1G2DC 2EOIA 3M99B 2EJ4A 2NABA 2EQ0A 2EL6A 1X6FA 2E72A 2EN7A 4R2RA 2EORA 2EQ3A 2EM0A 4WSGA 4R2QA 1UBDC 2JP9A 2EL5A 2EOJA 2WBUA 2EM7A 2MKDA 2EL4A 2EN8A 2EM6A 2WBTA 3EPHA 2EM5A 2EMBA 2EM8A 4R2EA 5KL4A 2YSOA 2ENHA 2EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJP A;  1G2F C;  2EPC A;  4R2C A;  4R2S A;  2YRH A;  2I13 A;  4R2D A;  1P47 A;  2EMK A;  2YTI A;  2A25 A;  3UK3 C;  1ZU1 A;  2CT1 A;  2BB8 A;  2CTD A;  2YTF A;  2EMF A;  3MHH C;  2DMI A;  2EPU A;  4F6M A;  2ELZ A;  5KL5 A;  1X5W A;  2JPA A;  1A1K A;  2EMZ A;  2EM4 A;  1A1G A;  1YSA C;  5KL2 A;  2YTO A;  1JK1 A;  1MEY C;  1ZAA C;  3VHT B;  2YTE A;  2YRK A;  2EMA A;  2EN6 A;  1BBO A;  2EOO A;  2WCC 3;  2YSP A;  1A1I A;  1BB8 A;  1LLM C;  2HGH A;  2RPC A;  2EMC A;  4R2P A;  1X3C A;  2EN3 A;  1JK2 A;  2ADR A;  3MHS C;  2DLQ A;  4GZN C;  2J7J A;  2GHF A;  1A1H A;  2LV2 A;  2EOE A;  2EMY A;  2EPA A;  2LT7 A;  2EML A;  1ZR9 A;  2EE8 A;  1YUJ A;  1NCS A;  2DRP A;  2EN1 A;  2EOS A;  2EMG A;  2EMW A;  1TF6 A;  1A1L A;  5KL6 A;  2YRM A;  1B69 A;  5KL3 A;  2EOX A;  1TN9 A;  2YTN A;  2EPX A;  4M9V C;  2R1F A;  2YTD A;  1X6E A;  2MKN A;  2EMX A;  2M9A A;  2ELY A;  2D9H A;  2LCE A;  2YTJ A;  1TF3 A;  3EPL A;  1A1J A;  2MDG A;  2YU5 A;  4FK5 C;  1RMD A;  2EOM A;  2WBS A;  1F2I G;  1A1F A;  2DGC A;  2EMH A;  2EQ1 A;  4F2J C;  1UN6 B;  4F6N A;  2EM9 A;  1YUI A;  2EOZ A;  1DGC A;  4R2A A;  2PRT A;  2CSH A;  2ENC A;  2YTG A;  2ENA A;  1X6H A;  2EMI A;  1AAY A;  2LO3 A;  2GLI A;  2DLK A;  2VRD A;  4IS1 C;  3EPJ A;  4IJD A;  2EM2 A;  2YTP A;  4X9J A;  2EM3 A;  2EP3 A;  2EN2 A;  2EOH A;  2RSI A;  1Z1B A;  1KJK A;  2EPZ A;  2EOQ A;  2YU8 A;  5KL7 A;  2LVH A;  3EPK A;  2EOY A;  2EPR A;  2YTQ A;  2EPP A;  2EOF A;  1G2D C;  2EOI A;  3M99 B;  2EJ4 A;  2NAB A;  2EQ0 A;  2EL6 A;  1X6F A;  2E72 A;  2EN7 A;  4R2R A;  2EOR A;  2EQ3 A;  2EM0 A;  4WSG A;  4R2Q A;  1UBD C;  2JP9 A;  2EL5 A;  2EOJ A;  2WBU A;  2EM7 A;  2MKD A;  2EL4 A;  2EN8 A;  2EM6 A;  2WBT A;  3EPH A;  2EM5 A;  2EMB A;  2EM8 A;  4R2E A;  5KL4 A;  2YSO A;  2ENH A;  2EN4 A; 
#chains in the Genus database with same CATH topology
 2M7Q A;  2YZT A;  2EPO A;  4DKK A;  5AE2 A;  3C6K A;  2N8X A;  4R2S A;  3BID A;  2WZO A;  2ODR D;  4KWY A;  1J5E E;  2YTI A;  2VQF E;  1ZU1 A;  2V8Q B;  2CTD A;  2DMI A;  5KL5 A;  4X64 E;  5IWA E;  1A1K A;  4Q35 B;  5KL2 A;  2YTO A;  4M0V A;  4BHB A;  1JK1 A;  4B3R E;  3VHT B;  4K0K E;  3OML A;  2YRK A;  2EMA A;  1BBO A;  2WCC 3;  1SR9 A;  2JY9 A;  4WXD A;  2EMC A;  2YT4 A;  4KZS A;  2UXB E;  4LF6 E;  1N33 E;  4R2P A;  1N36 E;  1JK2 A;  3ECR A;  2J7J A;  2FV4 B;  2EML A;  1ZR9 A;  3ADL A;  4DV0 E;  2I9I A;  2RS7 A;  3J81 C;  2E5L E;  2EN1 A;  4Q28 A;  1N34 E;  2EMG A;  4KHP E;  1TF6 A;  1PKP A;  2K7I A;  4LF5 E;  5FLX C;  4M9V C;  2DIX A;  2M9A A;  2ELY A;  4DR6 E;  2FTX B;  2HJJ A;  2JYA A;  4R03 A;  2WBS A;  4DMI A;  4BC9 A;  1UN6 B;  4JI3 E;  5AAS A;  2DB2 A;  2PRT A;  2CSH A;  2ENC A;  2YTG A;  2EMI A;  2LO3 A;  2CPN A;  4AQY E;  1YYW A;  3HPZ A;  3AUZ A;  4IS1 C;  3EPJ A;  2YTP A;  1XNQ E;  1WHQ A;  5A6K A;  1X49 A;  2EP3 A;  2EOH A;  1Z1B A;  4BS9 A;  2VE7 C;  2YU8 A;  5KL7 A;  3HPS A;  4GKJ E;  3EPK A;  4LF9 E;  4MLV A;  4GEQ B;  2V85 A;  3F6G A;  2EPR A;  2YTQ A;  2EOF A;  2EOI A;  2RQL A;  1QU6 A;  2HC5 A;  1YZ9 A;  2EWL A;  5T6J A;  1AH5 A;  1GQE A;  4ZYD A;  2UUB E;  4OOG C;  4X62 E;  5LLQ A;  2EN8 A;  2WBT A;  2LUP B;  3ADG A;  5LL6 R;  3JTZ A;  3EQ1 A;  4N4R B;  3BGH A;  4NHR A;  4M2Z A;  2EN4 A;  3IWB A;  1RQ0 A;  2K4V A;  1G2F C;  2YRH A;  2V86 A;  3F6H A;  2EMK A;  5AE3 A;  2YTF A;  3MHH C;  2EZ6 A;  2V83 A;  1GZ6 A;  2V88 A;  1MEY C;  1KYQ A;  1UHZ A;  5AE1 A;  1T39 A;  2L3C A;  2EOO A;  1A1I A;  1BB8 A;  4BBY A;  1LLM C;  2DMY A;  4LF8 E;  4BHC A;  1O0W A;  3ADI A;  3P1X A;  4O43 A;  2DLQ A;  2B7V A;  4DR5 E;  2EOE A;  5TSE A;  1WXR A;  1YUJ A;  2DRP A;  2F4V E;  1IQS A;  2KOU A;  2UXD E;  4DUZ E;  5KL3 A;  1TN9 A;  2YTN A;  2EPX A;  2L2N A;  3C4T A;  4F9A B;  2L33 A;  2R1F A;  1A1J A;  3RMP A;  1RMD A;  1A1F A;  1F2I G;  2DGC A;  2EQ1 A;  2RTX A;  2YWQ A;  2N3G A;  3DJW A;  1PJS A;  4O4K A;  4F2J C;  4F6N A;  3HXL A;  1UIL A;  2EOZ A;  4YY3 E;  1YUI A;  2YPN A;  3IWD A;  2BBG A;  4DR2 E;  2ENA A;  2LJH A;  3TQM A;  2DLK A;  2EPM X;  3J7A G;  4JYA E;  5A6A A;  2NUE A;  4DV5 E;  4IJD A;  2EM2 A;  4DV4 E;  4DR3 E;  1MGT A;  3VK6 A;  2UXC E;  5AC5 A;  2EPZ A;  2ZM6 E;  1YFH A;  4L5N C;  1T4N A;  5A6B A;  3HQ1 A;  2F8B A;  2EOY A;  2L2K B;  2LMZ A;  3T1Y E;  4NXM E;  2RS6 A;  4R8O A;  4F9B B;  4JI8 E;  2NAB A;  4ZYG A;  1N3G A;  2EQ0 A;  1NEI A;  1IBM E;  4DR4 E;  4R2R A;  4TUG A;  2EOR A;  2GPI A;  2EM0 A;  4WSG A;  4R2Q A;  5A6J A;  2EOJ A;  2L8T A;  2WBU A;  2MKD A;  5LMU E;  3THN A;  2H36 X;  2EM6 A;  2RSM A;  2EM5 A;  2KHX A;  2MC5 A;  1I94 E;  2LTR A;  2YSO A;  3K6Q A;  2ENH A;  4DV2 E;  4BCA A;  4WX9 A;  2EPC A;  4WXC A;  4R2C A;  2I13 A;  2B3T B;  1HNZ E;  4DR7 E;  4R2D A;  1P47 A;  2EMF A;  4GKK E;  2EPU A;  4NXN E;  4ZYE A;  2ELZ A;  4NZV A;  2KON A;  4YHH E;  1X5W A;  2JPA A;  2Q8U A;  1PDA A;  1YSA C;  4O5G A;  3ZOQ B;  1ZAA C;  2YTE A;  3AV0 A;  1EKZ A;  1FJG E;  2UUC E;  1QNT A;  3J7Y p;  1STU A;  1X3C A;  1SFE A;  3MHS C;  2IHR 1;  1YPN A;  2GHF A;  5ADZ A;  3VYY A;  4DV6 E;  2LV2 A;  2EMY A;  2EPA A;  2LTS A;  2EMW A;  3BF2 A;  3HTX A;  2B7T A;  4DV1 E;  3QG5 C;  2YRM A;  5A6B D;  2MC6 A;  3THO B;  1XNR E;  2FGG A;  2ODR C;  2VQE E;  1X6E A;  1HR0 E;  2E1M A;  4B3T E;  2LCE A;  2LUQ A;  3LLH A;  2MDG A;  1DQ3 A;  4FK5 C;  2EOM A;  2UUA E;  1IBL E;  1L4S A;  2EM9 A;  2LBS B;  4F54 A;  1X6H A;  1AAY A;  3KWR A;  2GLI A;  1J26 A;  4ZYH A;  4B3M E;  5A69 A;  5A2Q C;  4RHB B;  4HTG A;  4X9J A;  3MSW A;  2EN2 A;  4WPY A;  1PJT A;  4DV7 E;  1T4L B;  2EOQ A;  4L8N A;  4X66 E;  4JI2 E;  4LF4 E;  4P78 A;  2N3H A;  2JOX A;  1X47 A;  2JXP A;  3J80 C;  2EPP A;  4WFT A;  2NA2 A;  4MLQ A;  2DSY A;  2VF1 A;  2L6M A;  2M1S A;  2E72 A;  2MDR A;  4LFB E;  5F3W A;  4M30 A;  4JI5 E;  4WSP A;  1WRJ A;  1UBD C;  4JV5 E;  2JP9 A;  5AC4 A;  3EPH A;  2EMB A;  4LFC E;  3BBG A;  4DR1 E;  4LFA E;  4J8Z A;  2EM8 A;  2LJU A;  4GZN C;  2L2M A;  1WJP A;  5IT9 C;  4X65 E;  2JR1 A;  1EH8 A;  4F9C B;  1IMU A;  3JU0 A;  4B3S E;  2A25 A;  3UK3 C;  2CT1 A;  4JI7 E;  2BB8 A;  3LML A;  1XMO E;  4F6M A;  3L00 A;  4JI6 E;  2EMZ A;  2EM4 A;  4O24 A;  1A1G A;  2EPK X;  1HNX E;  2EN6 A;  4BMJ A;  3JAM C;  5IV8 B;  2YSP A;  1IQO A;  3ADJ A;  4I8O A;  2L92 A;  2RPC A;  2HGH A;  2NUG A;  2NUF A;  1YYK A;  5LMN E;  4P7D A;  2EN3 A;  1XMQ E;  2ADR A;  2EPL X;  2EPN A;  1PJQ A;  1A1H A;  2LT7 A;  2EE8 A;  1NCS A;  2L3J A;  4JI0 E;  2UU9 E;  2EOS A;  5IXM B;  1A1L A;  2JVA A;  5KL6 A;  1B69 A;  1N32 E;  3VYX A;  2EOX A;  4OX9 E;  4LTY A;  3IWC A;  2JWO A;  2YTD A;  2MKN A;  2EMX A;  1RC7 A;  2D9H A;  3H09 A;  2YTJ A;  5DNY A;  3EPL A;  1TF3 A;  2YU5 A;  2EMH A;  4LU9 A;  1DGC A;  4R2A A;  4RH8 A;  4TUI A;  3DF6 A;  5KL4 A;  2V89 A;  1BBG A;  2B9D A;  2JOB A;  3C6M A;  1YYO A;  2VRD A;  2M4I A;  4LF7 E;  1GTK A;  3OTO E;  1FKA E;  2LE2 A;  2EM3 A;  3KZY A;  2RSI A;  1EH6 A;  1KJK A;  2LVH A;  5BR8 E;  4JI1 E;  2HHH E;  3C4B A;  4DV3 E;  5CFF E;  1WHN A;  2R76 A;  1G2D C;  3M99 B;  2EJ4 A;  1EH7 A;  1X48 A;  3T1H E;  2EL6 A;  1X6F A;  4JI4 E;  2EN7 A;  1DI2 A;  1HNW E;  2EQ3 A;  2V87 A;  2LRS A;  4WYQ B;  1T4O A;  2G7H A;  3FIG A;  4BC7 A;  2EL5 A;  1T38 A;  2EM7 A;  2EL4 A;  1ZBT A;  4DUY E;  3KZZ A;  4R2E A;  1ZBQ A;  4X8W A;  1IBK E;  4HEI A; 
#chains in the Genus database with same CATH homology
 1WJP A;  1G2F C;  2EPC A;  4R2C A;  4R2S A;  2YRH A;  2I13 A;  4R2D A;  1P47 A;  2EMK A;  2YTI A;  2A25 A;  3UK3 C;  1ZU1 A;  2CT1 A;  2BB8 A;  2CTD A;  2YTF A;  2EMF A;  3MHH C;  2DMI A;  2EPU A;  4F6M A;  2ELZ A;  5KL5 A;  1X5W A;  2JPA A;  1A1K A;  2EMZ A;  2EM4 A;  1A1G A;  1YSA C;  5KL2 A;  2YTO A;  1JK1 A;  1MEY C;  1ZAA C;  3VHT B;  2YTE A;  2YRK A;  2EMA A;  2EN6 A;  1BBO A;  2EOO A;  2WCC 3;  2YSP A;  1A1I A;  1BB8 A;  1LLM C;  2HGH A;  2RPC A;  2EMC A;  4R2P A;  1X3C A;  2EN3 A;  1JK2 A;  2ADR A;  3MHS C;  2DLQ A;  4GZN C;  2J7J A;  2GHF A;  1A1H A;  2LV2 A;  2EOE A;  2EMY A;  2EPA A;  2LT7 A;  2EML A;  1ZR9 A;  2EE8 A;  1YUJ A;  1NCS A;  2DRP A;  2EN1 A;  2EOS A;  2EMG A;  2EMW A;  1TF6 A;  1A1L A;  5KL6 A;  2YRM A;  1B69 A;  5KL3 A;  2EOX A;  1TN9 A;  2YTN A;  2EPX A;  4M9V C;  2R1F A;  2YTD A;  1X6E A;  2MKN A;  2EMX A;  2M9A A;  2ELY A;  2D9H A;  2LCE A;  2YTJ A;  1TF3 A;  3EPL A;  1A1J A;  2MDG A;  2YU5 A;  4FK5 C;  1RMD A;  2EOM A;  2WBS A;  1F2I G;  1A1F A;  2DGC A;  2EMH A;  2EQ1 A;  4F2J C;  1UN6 B;  4F6N A;  2EM9 A;  1YUI A;  2EOZ A;  1DGC A;  4R2A A;  2PRT A;  2CSH A;  2ENC A;  2YTG A;  2ENA A;  1X6H A;  2EMI A;  1AAY A;  2LO3 A;  2GLI A;  2DLK A;  2VRD A;  4IS1 C;  3EPJ A;  4IJD A;  2EM2 A;  2YTP A;  4X9J A;  2EM3 A;  2EP3 A;  2EN2 A;  2EOH A;  2RSI A;  1Z1B A;  1KJK A;  2EPZ A;  2EOQ A;  2YU8 A;  5KL7 A;  2LVH A;  3EPK A;  2EOY A;  2EPR A;  2YTQ A;  2EPP A;  2EOF A;  1G2D C;  2EOI A;  3M99 B;  2EJ4 A;  2NAB A;  2EQ0 A;  2EL6 A;  1X6F A;  2E72 A;  2EN7 A;  4R2R A;  2EOR A;  2EQ3 A;  2EM0 A;  4WSG A;  4R2Q A;  1UBD C;  2JP9 A;  2EL5 A;  2EOJ A;  2WBU A;  2EM7 A;  2MKD A;  2EL4 A;  2EN8 A;  2EM6 A;  2WBT A;  3EPH A;  2EM5 A;  2EMB A;  2EM8 A;  4R2E A;  5KL4 A;  2YSO A;  2ENH A;  2EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...